4DV7C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv7C02
3OTOC 4DR2C 4DR4C 2ZM6C 1UKKA 3AF5A 4LFCC 2E8CA 4LF4C 1PA4A 2VQFC 2OPLB 5LMUC 4NOZA 2HHHC 4JI2C 4LF8C 2QL8A 4JYAC 5A2QD 4X66C 1XMOC 2ASBA 4DCVA 1FJGC 1HNWC 2E8EA 2JMPA 4DV4C 2UUAC 1XMQC 1IBKC 2E7GA 3IEVA 4DR5C 1IBMC 4X65C 4DV0C 4AQYC 1K0RA 4JI6C 3T1YC 4JV5C 4MTNA 1XNRC 4GKJC 4JI7C 2UXDC 2EGTA 1N34C 4BSZA 3EERA 2OPLA 1WH9A 2ATWA 1WF3A 2CY1A 1L2FA 2VQEC 1I94C 4DV1C 1USPB 4JI4C 1MKYA 4DR6C 2XR1A 4LF7C 2UU9C 3IEUA 2UXBC 1ZB8A 4DV2C 4DCSA 1J5EC 4DR1C 4DCUA 4KHPC 2UXCC 1HNXC 4JI5C 4YY3C 4DV6C 3LUSA 4B3MC 1LQLA 4OX9C 1VLAA 2KZFA 4DV5C 2UUBC 2E5LC 4X64C 1NYEA 5FLXD 4XX2A 4MH4A 2ONFA 4DCTA 3JAMD 5LMNC 1HR0C 4B3SC 1XNQC 4GKKC 4LFBC 5IWAC 4JI3C 1USPA 4LFAC 5IT9D 4B3TC 3R9WA 1ML8A 5BR8C 1EGAA 4JI1C 1ZB9A 4DUYC 4B3RC 3T1HC 3AF6A 1JOSA 4LF5C 2HJGA 1IBLC 4JI0C 2UUCC 2YCBA 4NXNC 2DYJA 2PN2A 1QWIA 2E8FA 1HNZC 3CJEA 3J7AD 4YHHC 4DV3C 4DR3C 4DR7C 4K0KC 1N36C 1HH2P 2PT7G 2D7VA 3R9XA 3J80D 4LF9C 2F4VC 2CXCA 3I07A 3J81D 1N2FA 1N33C 4X62C 4DV7C 4DUZC 2BJOA 4LF6C 4NXMC 4JI8C 1N32C 3GKUA 1KKGA
chains in the Genus database with same CATH superfamily
3SO4A 3OTOC 4LFCC 2E8CA 4LF4C 1XRCA 4FUQA 2VQFC 2KZ0A 2OPLB 5LMUC 4RM3A 4NOZA 1V25A 2D1QA 2P2QA 2YWCA 3CW9A 1XMOC 2ASBA 5E7QA 4DCVA 3A26A 3DHVA 2JMPA 1FLOA 1IBKC 2E7GA 3E7XA 3IEVA 4DR5C 4X65C 5BSWA 4JV5C 4MTNA 3TR3A 4RLQA 4BSZA 3EERA 4D4GA 1WF3A 2D1TA 3PBKA 1AMUA 3VNSA 3KXWA 4JI4C 3UEBA 2PROA 4LF7C 3UX3A 5LCIA 3A25A 1ZB8A 1O90A 4YY3C 4D57A 4ZJZA 3O2EA 4B3MC 1LQLA 5T8SA 3CQ1A 3A4IA 4NDNA 3L8CA 4D4IA 5FLXD 2ONFA 4B3SC 5LMNC 3PESA 5ADZA 5BR8C 2M5HA 4FTFA 4L2ZA 5BUQA 2M5OA 4G1IA 1PU1A 4D56A 3CQ2A 1JOSA 4LF5C 4BBYA 1IBLC 3IPLA 2DPLA 3GR0A 2E8FA 2P20A 3CW8X 3CJEA 3ETOA 1IB8A 5KYTA 5K8FA 4DR7C 4LE5A 2D7VA 3ETCA 3UOWA 4WS9A 1FUGA 4R1LA 1N2FA 3UZ0A 4RVOA 3DAYA 4JI8C 2P2MA 3GPCA 4PROC 3FCEA 4DR4C 2MMAB 2ZM6C 1UKKA 4PZPA 4R1MA 3RG2A 3NYQA 4BC7A 3A9VA 3DLPX 2HHHC 4JI2C 4LF8C 4JYAC 5A2QD 1P4EA 4GXRA 1FJGC 2DHMA 1TH5A 1XMQC 5A1GA 1YGTA 4DV0C 1K0RA 3T1YC 1XNRC 2UXDC 2EGTA 1N34C 3NYRA 2V7BA 2YX1A 2OPLA 1M6XA 1MDBA 1WH9A 2ATWA 2CY1A 1L2FA 1I94C 2D28C 3FCCA 1USPB 4PUGA 2UXBC 5AE2A 2VSQA 4DV2C 4DCSA 2Y27A 2UXCC 1HNXC 3B7WA 2D27A 1P4EC 4OX9C 2KZFA 4DV5C 4FUTA 3S82A 2E5LC 1NYEA 3K6RA 4DCTA 3JAMD 3G7SA 4JI3C 5IT9D 3R9WA 1ML8A 4K0BA 3R44A 3PROC 3NPDA 1EGAA 4R0MA 4JM1A 2KDNA 2Y4OA 5CZXA 3T1HC 1V60A 2ZZNA 4GS5A 1QWIA 2ZZMA 4I9FA 3VNQA 1PG3A 4DV3C 1RG9A 2Y4NA 2PT7G 3R9XA 3J80D 1GPMA 2CXCA 2D1SA 3NI2A 5H9UA 4DUZC 3L95X 1UWDA 4L7IA 4L4QA 2QW0X 2WD9A 1N32C 1XRAA 1KKGA 4IR7A 5AE3A 4DR2C 5BSTA 3AF5A 4HPVA 2VZEA 3CQ3A 1PA4A 1V26A 1BA3A 3GR1A 2P02A 5KYVA 2OO4A 1HNWC 3FM7A 4DV4C 4U5YD 4AQYC 4GXQA 4JI6C 4GKJC 2JNVA 4RVNA 1M6XC 2QVXX 2VQEC 2CU6A 3LAXA 1MXCA 1MD9A 4DR6C 2UU9C 1MXBA 3TDEA 5GTDA 1J5EC 5KEIA 4OXIA 4DCUA 4I9GA 4IZ6A 5A19A 4JI5C 2UUBC 4X64C 3LNOA 4GKKC 4LFBC 5IWAC 1USPA 1XDXA 4LFAC 3A9UA 2QVYX 4RM2A 4JI1C 4PUIA 4B3RC 2P2BA 3AF6A 4JI0C 2UUCC 5AE1A 3C5EA 5K85A 1QM4A 4NXNC 5A1IA 1XS3A 2MM9A 3J7AD 3TUFA 4DR3C 2P2JA 1N36C 1HH2P 5DV9A 4LF9C 5T8TA 2F4VC 4PUHA 3J81D 4ZLPA 2ZTBA 4DV7C 4X62C 4LF6C 4BCAA 3GKUA 4BC9A 1NY8A 2Z51A 4DG8A 5CZVA 2AYAA 1O92A 3VNRA 2OBVA 2QL8A 4X66C 3IMLA 2QVZX 1MDFA 1T5HX 1P7LA 2E8EA 2UUAC 1MXAA 4EATA 1IBMC 3E7WA 3N54B 1RY2A 5IFIA 4JI7C 5BSUA 3EQ6A 1PG4A 4G36A 4ISBA 4OYCA 2YWBA 2D1RA 4DV1C 3TQIA 1XHJA 1O93A 1MKYA 4TPSB 4WV3A 2XR1A 3IEUA 2PG1E 4DR1C 4KHPC 5BSVA 4KTVA 4DV6C 3LUSA 4RLFA 1VLAA 3LGXA 3UX2A 4XX2A 4MH4A 1HR0C 1XNQC 1O9TA 1YJ7A 3I08A 5BUSA 2NCLA 5BSRA 4B3TC 3LNVA 4DG9A 1LCIA 1ZB9A 2BH1X 5BURA 2WP0C 5BSMA 4RMNA 4DUYC 4KTTA 2HJGA 1T5DX 3H2TA 2YCBA 2E0GA 2DYJA 2PN2A 1HNZC 2P2FA 4YHHC 3N2QA 4K0KC 4ODJA 4G37A 5JRHA 3I07A 3AY0A 1N33C 1XRBA 1WCJA 2BJOA 2MCQA 1ULTA 4NXMC 3RV2A 1VEHA 4PHTA
chains in the Genus database with same CATH topology
3SO4A 3OTOC 4LFCC 2E8CA 4LF4C 1XRCA 4FUQA 2VQFC 2OPLB 5LMUC 4RM3A 4NOZA 1V25A 2D1QA 2P2QA 2YWCA 3CW9A 1XMOC 2ASBA 5E7QA 4DCVA 3DHVA 2JMPA 1IBKC 2E7GA 3E7XA 3IEVA 4DR5C 4X65C 5BSWA 4JV5C 4MTNA 4RLQA 4BSZA 3EERA 4D4GA 1WF3A 2D1TA 3PBKA 1AMUA 3VNSA 3KXWA 4JI4C 2PROA 4LF7C 1ZB8A 1O90A 4YY3C 4D57A 4ZJZA 4B3MC 1LQLA 5T8SA 3A4IA 4NDNA 3L8CA 4D4IA 5FLXD 2ONFA 4B3SC 5LMNC 3PESA 5ADZA 5BR8C 4FTFA 4L2ZA 5BUQA 4G1IA 4D56A 1JOSA 4LF5C 4BBYA 1IBLC 3IPLA 2DPLA 3GR0A 2E8FA 2P20A 3CW8X 3CJEA 3ETOA 5KYTA 5K8FA 4DR7C 4LE5A 2D7VA 3ETCA 3UOWA 4WS9A 1FUGA 4R1LA 1N2FA 3UZ0A 4RVOA 3DAYA 4JI8C 2P2MA 3GPCA 4PROC 3FCEA 4DR4C 2ZM6C 1UKKA 4PZPA 4R1MA 3RG2A 3NYQA 4BC7A 3A9VA 3DLPX 2HHHC 4JI2C 4LF8C 4JYAC 5A2QD 4GXRA 1FJGC 1XMQC 5A1GA 4DV0C 1K0RA 3T1YC 1XNRC 2UXDC 2EGTA 1N34C 3NYRA 2V7BA 2OPLA 1MDBA 1WH9A 2ATWA 2CY1A 1L2FA 1I94C 2D28C 3FCCA 1USPB 2UXBC 5AE2A 2VSQA 4DV2C 4DCSA 2Y27A 2UXCC 1HNXC 3B7WA 2D27A 4OX9C 2KZFA 4DV5C 4FUTA 3S82A 2E5LC 1NYEA 4DCTA 3JAMD 3G7SA 4JI3C 5IT9D 3R9WA 1ML8A 4K0BA 3R44A 3PROC 3NPDA 1EGAA 4R0MA 4JM1A 2Y4OA 5CZXA 3T1HC 4GS5A 1QWIA 4I9FA 3VNQA 1PG3A 4DV3C 1RG9A 2Y4NA 2PT7G 3R9XA 3J80D 1GPMA 2CXCA 2D1SA 3NI2A 5H9UA 4DUZC 3L95X 4L7IA 4L4QA 2QW0X 2WD9A 1N32C 1XRAA 1KKGA 4IR7A 5AE3A 4DR2C 5BSTA 3AF5A 4HPVA 2VZEA 1PA4A 1V26A 1BA3A 3GR1A 2P02A 5KYVA 2OO4A 1HNWC 4DV4C 4U5YD 4AQYC 4GXQA 4JI6C 4GKJC 4RVNA 2QVXX 2VQEC 3LAXA 1MXCA 1MD9A 4DR6C 2UU9C 1MXBA 3TDEA 5GTDA 1J5EC 5KEIA 4OXIA 4DCUA 4I9GA 4IZ6A 5A19A 4JI5C 2UUBC 4X64C 4GKKC 4LFBC 5IWAC 1USPA 4LFAC 3A9UA 2QVYX 4RM2A 4JI1C 4B3RC 2P2BA 3AF6A 2UUCC 4JI0C 5AE1A 3C5EA 5K85A 1QM4A 4NXNC 5A1IA 3J7AD 3TUFA 4DR3C 2P2JA 1N36C 1HH2P 5DV9A 4LF9C 5T8TA 2F4VC 3J81D 4ZLPA 4X62C 4DV7C 4LF6C 4BCAA 3GKUA 4BC9A 4DG8A 5CZVA 2AYAA 1O92A 3VNRA 2OBVA 2QL8A 4X66C 3IMLA 2QVZX 1MDFA 1T5HX 1P7LA 2E8EA 2UUAC 1MXAA 4EATA 1IBMC 3E7WA 3N54B 1RY2A 5IFIA 4JI7C 5BSUA 3EQ6A 1PG4A 4G36A 4ISBA 4OYCA 2YWBA 2D1RA 4DV1C 3TQIA 1O93A 1MKYA 4TPSB 4WV3A 2XR1A 3IEUA 4DR1C 4KHPC 5BSVA 4KTVA 4DV6C 3LUSA 4RLFA 1VLAA 3LGXA 4XX2A 4MH4A 1HR0C 1XNQC 1O9TA 1YJ7A 3I08A 5BUSA 5BSRA 4B3TC 3LNVA 4DG9A 1LCIA 1ZB9A 2BH1X 5BURA 2WP0C 5BSMA 4RMNA 4DUYC 4KTTA 2HJGA 1T5DX 3H2TA 2YCBA 2E0GA 2DYJA 2PN2A 1HNZC 2P2FA 4YHHC 3N2QA 4K0KC 4ODJA 4G37A 5JRHA 3I07A 1N33C 1XRBA 2BJOA 1ULTA 4NXMC 3RV2A 4PHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO C;  4DR2 C;  4DR4 C;  2ZM6 C;  1UKK A;  3AF5 A;  4LFC C;  2E8C A;  4LF4 C;  1PA4 A;  2VQF C;  2OPL B;  5LMU C;  4NOZ A;  2HHH C;  4JI2 C;  4LF8 C;  2QL8 A;  4JYA C;  5A2Q D;  4X66 C;  1XMO C;  2ASB A;  4DCV A;  1FJG C;  1HNW C;  2E8E A;  2JMP A;  4DV4 C;  2UUA C;  1XMQ C;  1IBK C;  2E7G A;  3IEV A;  4DR5 C;  1IBM C;  4X65 C;  4DV0 C;  4AQY C;  1K0R A;  4JI6 C;  3T1Y C;  4JV5 C;  4MTN A;  1XNR C;  4GKJ C;  4JI7 C;  2UXD C;  2EGT A;  1N34 C;  4BSZ A;  3EER A;  2OPL A;  1WH9 A;  2ATW A;  1WF3 A;  2CY1 A;  1L2F A;  2VQE C;  1I94 C;  4DV1 C;  1USP B;  4JI4 C;  1MKY A;  4DR6 C;  2XR1 A;  4LF7 C;  2UU9 C;  3IEU A;  2UXB C;  1ZB8 A;  4DV2 C;  4DCS A;  1J5E C;  4DR1 C;  4DCU A;  4KHP C;  2UXC C;  1HNX C;  4JI5 C;  4YY3 C;  4DV6 C;  3LUS A;  4B3M C;  1LQL A;  4OX9 C;  1VLA A;  2KZF A;  4DV5 C;  2UUB C;  2E5L C;  4X64 C;  1NYE A;  5FLX D;  4XX2 A;  4MH4 A;  2ONF A;  4DCT A;  3JAM D;  5LMN C;  1HR0 C;  4B3S C;  1XNQ C;  4GKK C;  4LFB C;  5IWA C;  4JI3 C;  1USP A;  4LFA C;  5IT9 D;  4B3T C;  3R9W A;  1ML8 A;  5BR8 C;  1EGA A;  4JI1 C;  1ZB9 A;  4DUY C;  4B3R C;  3T1H C;  3AF6 A;  1JOS A;  4LF5 C;  2HJG A;  1IBL C;  4JI0 C;  2UUC C;  2YCB A;  4NXN C;  2DYJ A;  2PN2 A;  1QWI A;  2E8F A;  1HNZ C;  3CJE A;  3J7A D;  4YHH C;  4DV3 C;  4DR3 C;  4DR7 C;  4K0K C;  1N36 C;  1HH2 P;  2PT7 G;  2D7V A;  3R9X A;  3J80 D;  4LF9 C;  2F4V C;  2CXC A;  3I07 A;  3J81 D;  1N2F A;  1N33 C;  4X62 C;  4DV7 C;  4DUZ C;  2BJO A;  4LF6 C;  4NXM C;  4JI8 C;  1N32 C;  3GKU A;  1KKG A; 
#chains in the Genus database with same CATH topology
 3SO4 A;  3OTO C;  4LFC C;  2E8C A;  4LF4 C;  1XRC A;  4FUQ A;  2VQF C;  2KZ0 A;  2OPL B;  5LMU C;  4RM3 A;  4NOZ A;  1V25 A;  2D1Q A;  2P2Q A;  2YWC A;  3CW9 A;  1XMO C;  2ASB A;  5E7Q A;  4DCV A;  3A26 A;  3DHV A;  2JMP A;  1FLO A;  1IBK C;  2E7G A;  3E7X A;  3IEV A;  4DR5 C;  4X65 C;  5BSW A;  4JV5 C;  4MTN A;  3TR3 A;  4RLQ A;  4BSZ A;  3EER A;  4D4G A;  1WF3 A;  2D1T A;  3PBK A;  1AMU A;  3VNS A;  3KXW A;  4JI4 C;  3UEB A;  2PRO A;  4LF7 C;  3UX3 A;  5LCI A;  3A25 A;  1ZB8 A;  1O90 A;  4YY3 C;  4D57 A;  4ZJZ A;  3O2E A;  4B3M C;  1LQL A;  5T8S A;  3CQ1 A;  3A4I A;  4NDN A;  3L8C A;  4D4I A;  5FLX D;  2ONF A;  4B3S C;  5LMN C;  3PES A;  5ADZ A;  5BR8 C;  2M5H A;  4FTF A;  4L2Z A;  5BUQ A;  2M5O A;  4G1I A;  1PU1 A;  4D56 A;  3CQ2 A;  1JOS A;  4LF5 C;  4BBY A;  1IBL C;  3IPL A;  2DPL A;  3GR0 A;  2E8F A;  2P20 A;  3CW8 X;  3CJE A;  3ETO A;  1IB8 A;  5KYT A;  5K8F A;  4DR7 C;  4LE5 A;  2D7V A;  3ETC A;  3UOW A;  4WS9 A;  1FUG A;  4R1L A;  1N2F A;  3UZ0 A;  4RVO A;  3DAY A;  4JI8 C;  2P2M A;  3GPC A;  4PRO C;  3FCE A;  4DR4 C;  2MMA B;  2ZM6 C;  1UKK A;  4PZP A;  4R1M A;  3RG2 A;  3NYQ A;  4BC7 A;  3A9V A;  3DLP X;  2HHH C;  4JI2 C;  4LF8 C;  4JYA C;  5A2Q D;  1P4E A;  4GXR A;  1FJG C;  2DHM A;  1TH5 A;  1XMQ C;  5A1G A;  1YGT A;  4DV0 C;  1K0R A;  3T1Y C;  1XNR C;  2UXD C;  2EGT A;  1N34 C;  3NYR A;  2V7B A;  2YX1 A;  2OPL A;  1M6X A;  1MDB A;  1WH9 A;  2ATW A;  2CY1 A;  1L2F A;  1I94 C;  2D28 C;  3FCC A;  1USP B;  4PUG A;  2UXB C;  5AE2 A;  2VSQ A;  4DV2 C;  4DCS A;  2Y27 A;  2UXC C;  1HNX C;  3B7W A;  2D27 A;  1P4E C;  4OX9 C;  2KZF A;  4DV5 C;  4FUT A;  3S82 A;  2E5L C;  1NYE A;  3K6R A;  4DCT A;  3JAM D;  3G7S A;  4JI3 C;  5IT9 D;  3R9W A;  1ML8 A;  4K0B A;  3R44 A;  3PRO C;  3NPD A;  1EGA A;  4R0M A;  4JM1 A;  2KDN A;  2Y4O A;  5CZX A;  3T1H C;  1V60 A;  2ZZN A;  4GS5 A;  1QWI A;  2ZZM A;  4I9F A;  3VNQ A;  1PG3 A;  4DV3 C;  1RG9 A;  2Y4N A;  2PT7 G;  3R9X A;  3J80 D;  1GPM A;  2CXC A;  2D1S A;  3NI2 A;  5H9U A;  4DUZ C;  3L95 X;  1UWD A;  4L7I A;  4L4Q A;  2QW0 X;  2WD9 A;  1N32 C;  1XRA A;  1KKG A;  4IR7 A;  5AE3 A;  4DR2 C;  5BST A;  3AF5 A;  4HPV A;  2VZE A;  3CQ3 A;  1PA4 A;  1V26 A;  1BA3 A;  3GR1 A;  2P02 A;  5KYV A;  2OO4 A;  1HNW C;  3FM7 A;  4DV4 C;  4U5Y D;  4AQY C;  4GXQ A;  4JI6 C;  4GKJ C;  2JNV A;  4RVN A;  1M6X C;  2QVX X;  2VQE C;  2CU6 A;  3LAX A;  1MXC A;  1MD9 A;  4DR6 C;  2UU9 C;  1MXB A;  3TDE A;  5GTD A;  1J5E C;  5KEI A;  4OXI A;  4DCU A;  4I9G A;  4IZ6 A;  5A19 A;  4JI5 C;  2UUB C;  4X64 C;  3LNO A;  4GKK C;  4LFB C;  5IWA C;  1USP A;  1XDX A;  4LFA C;  3A9U A;  2QVY X;  4RM2 A;  4JI1 C;  4PUI A;  4B3R C;  2P2B A;  3AF6 A;  4JI0 C;  2UUC C;  5AE1 A;  3C5E A;  5K85 A;  1QM4 A;  4NXN C;  5A1I A;  1XS3 A;  2MM9 A;  3J7A D;  3TUF A;  4DR3 C;  2P2J A;  1N36 C;  1HH2 P;  5DV9 A;  4LF9 C;  5T8T A;  2F4V C;  4PUH A;  3J81 D;  4ZLP A;  2ZTB A;  4DV7 C;  4X62 C;  4LF6 C;  4BCA A;  3GKU A;  4BC9 A;  1NY8 A;  2Z51 A;  4DG8 A;  5CZV A;  2AYA A;  1O92 A;  3VNR A;  2OBV A;  2QL8 A;  4X66 C;  3IML A;  2QVZ X;  1MDF A;  1T5H X;  1P7L A;  2E8E A;  2UUA C;  1MXA A;  4EAT A;  1IBM C;  3E7W A;  3N54 B;  1RY2 A;  5IFI A;  4JI7 C;  5BSU A;  3EQ6 A;  1PG4 A;  4G36 A;  4ISB A;  4OYC A;  2YWB A;  2D1R A;  4DV1 C;  3TQI A;  1XHJ A;  1O93 A;  1MKY A;  4TPS B;  4WV3 A;  2XR1 A;  3IEU A;  2PG1 E;  4DR1 C;  4KHP C;  5BSV A;  4KTV A;  4DV6 C;  3LUS A;  4RLF A;  1VLA A;  3LGX A;  3UX2 A;  4XX2 A;  4MH4 A;  1HR0 C;  1XNQ C;  1O9T A;  1YJ7 A;  3I08 A;  5BUS A;  2NCL A;  5BSR A;  4B3T C;  3LNV A;  4DG9 A;  1LCI A;  1ZB9 A;  2BH1 X;  5BUR A;  2WP0 C;  5BSM A;  4RMN A;  4DUY C;  4KTT A;  2HJG A;  1T5D X;  3H2T A;  2YCB A;  2E0G A;  2DYJ A;  2PN2 A;  1HNZ C;  2P2F A;  4YHH C;  3N2Q A;  4K0K C;  4ODJ A;  4G37 A;  5JRH A;  3I07 A;  3AY0 A;  1N33 C;  1XRB A;  1WCJ A;  2BJO A;  2MCQ A;  1ULT A;  4NXM C;  3RV2 A;  1VEH A;  4PHT A; 
#chains in the Genus database with same CATH homology
 3SO4 A;  3OTO C;  4LFC C;  2E8C A;  4LF4 C;  1XRC A;  4FUQ A;  2VQF C;  2OPL B;  5LMU C;  4RM3 A;  4NOZ A;  1V25 A;  2D1Q A;  2P2Q A;  2YWC A;  3CW9 A;  1XMO C;  2ASB A;  5E7Q A;  4DCV A;  3DHV A;  2JMP A;  1IBK C;  2E7G A;  3E7X A;  3IEV A;  4DR5 C;  4X65 C;  5BSW A;  4JV5 C;  4MTN A;  4RLQ A;  4BSZ A;  3EER A;  4D4G A;  1WF3 A;  2D1T A;  3PBK A;  1AMU A;  3VNS A;  3KXW A;  4JI4 C;  2PRO A;  4LF7 C;  1ZB8 A;  1O90 A;  4YY3 C;  4D57 A;  4ZJZ A;  4B3M C;  1LQL A;  5T8S A;  3A4I A;  4NDN A;  3L8C A;  4D4I A;  5FLX D;  2ONF A;  4B3S C;  5LMN C;  3PES A;  5ADZ A;  5BR8 C;  4FTF A;  4L2Z A;  5BUQ A;  4G1I A;  4D56 A;  1JOS A;  4LF5 C;  4BBY A;  1IBL C;  3IPL A;  2DPL A;  3GR0 A;  2E8F A;  2P20 A;  3CW8 X;  3CJE A;  3ETO A;  5KYT A;  5K8F A;  4DR7 C;  4LE5 A;  2D7V A;  3ETC A;  3UOW A;  4WS9 A;  1FUG A;  4R1L A;  1N2F A;  3UZ0 A;  4RVO A;  3DAY A;  4JI8 C;  2P2M A;  3GPC A;  4PRO C;  3FCE A;  4DR4 C;  2ZM6 C;  1UKK A;  4PZP A;  4R1M A;  3RG2 A;  3NYQ A;  4BC7 A;  3A9V A;  3DLP X;  2HHH C;  4JI2 C;  4LF8 C;  4JYA C;  5A2Q D;  4GXR A;  1FJG C;  1XMQ C;  5A1G A;  4DV0 C;  1K0R A;  3T1Y C;  1XNR C;  2UXD C;  2EGT A;  1N34 C;  3NYR A;  2V7B A;  2OPL A;  1MDB A;  1WH9 A;  2ATW A;  2CY1 A;  1L2F A;  1I94 C;  2D28 C;  3FCC A;  1USP B;  2UXB C;  5AE2 A;  2VSQ A;  4DV2 C;  4DCS A;  2Y27 A;  2UXC C;  1HNX C;  3B7W A;  2D27 A;  4OX9 C;  2KZF A;  4DV5 C;  4FUT A;  3S82 A;  2E5L C;  1NYE A;  4DCT A;  3JAM D;  3G7S A;  4JI3 C;  5IT9 D;  3R9W A;  1ML8 A;  4K0B A;  3R44 A;  3PRO C;  3NPD A;  1EGA A;  4R0M A;  4JM1 A;  2Y4O A;  5CZX A;  3T1H C;  4GS5 A;  1QWI A;  4I9F A;  3VNQ A;  1PG3 A;  4DV3 C;  1RG9 A;  2Y4N A;  2PT7 G;  3R9X A;  3J80 D;  1GPM A;  2CXC A;  2D1S A;  3NI2 A;  5H9U A;  4DUZ C;  3L95 X;  4L7I A;  4L4Q A;  2QW0 X;  2WD9 A;  1N32 C;  1XRA A;  1KKG A;  4IR7 A;  5AE3 A;  4DR2 C;  5BST A;  3AF5 A;  4HPV A;  2VZE A;  1PA4 A;  1V26 A;  1BA3 A;  3GR1 A;  2P02 A;  5KYV A;  2OO4 A;  1HNW C;  4DV4 C;  4U5Y D;  4AQY C;  4GXQ A;  4JI6 C;  4GKJ C;  4RVN A;  2QVX X;  2VQE C;  3LAX A;  1MXC A;  1MD9 A;  4DR6 C;  2UU9 C;  1MXB A;  3TDE A;  5GTD A;  1J5E C;  5KEI A;  4OXI A;  4DCU A;  4I9G A;  4IZ6 A;  5A19 A;  4JI5 C;  2UUB C;  4X64 C;  4GKK C;  4LFB C;  5IWA C;  1USP A;  4LFA C;  3A9U A;  2QVY X;  4RM2 A;  4JI1 C;  4B3R C;  2P2B A;  3AF6 A;  2UUC C;  4JI0 C;  5AE1 A;  3C5E A;  5K85 A;  1QM4 A;  4NXN C;  5A1I A;  3J7A D;  3TUF A;  4DR3 C;  2P2J A;  1N36 C;  1HH2 P;  5DV9 A;  4LF9 C;  5T8T A;  2F4V C;  3J81 D;  4ZLP A;  4X62 C;  4DV7 C;  4LF6 C;  4BCA A;  3GKU A;  4BC9 A;  4DG8 A;  5CZV A;  2AYA A;  1O92 A;  3VNR A;  2OBV A;  2QL8 A;  4X66 C;  3IML A;  2QVZ X;  1MDF A;  1T5H X;  1P7L A;  2E8E A;  2UUA C;  1MXA A;  4EAT A;  1IBM C;  3E7W A;  3N54 B;  1RY2 A;  5IFI A;  4JI7 C;  5BSU A;  3EQ6 A;  1PG4 A;  4G36 A;  4ISB A;  4OYC A;  2YWB A;  2D1R A;  4DV1 C;  3TQI A;  1O93 A;  1MKY A;  4TPS B;  4WV3 A;  2XR1 A;  3IEU A;  4DR1 C;  4KHP C;  5BSV A;  4KTV A;  4DV6 C;  3LUS A;  4RLF A;  1VLA A;  3LGX A;  4XX2 A;  4MH4 A;  1HR0 C;  1XNQ C;  1O9T A;  1YJ7 A;  3I08 A;  5BUS A;  5BSR A;  4B3T C;  3LNV A;  4DG9 A;  1LCI A;  1ZB9 A;  2BH1 X;  5BUR A;  2WP0 C;  5BSM A;  4RMN A;  4DUY C;  4KTT A;  2HJG A;  1T5D X;  3H2T A;  2YCB A;  2E0G A;  2DYJ A;  2PN2 A;  1HNZ C;  2P2F A;  4YHH C;  3N2Q A;  4K0K C;  4ODJ A;  4G37 A;  5JRH A;  3I07 A;  1N33 C;  1XRB A;  2BJO A;  1ULT A;  4NXM C;  3RV2 A;  4PHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...