4DV7C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv7C02
1HNZC 4OX9C 4X64C 4JI0C 2E7GA 2PN2A 4JI2C 4DCTA 2OPLA 4NXNC 1HNWC 4NXMC 2QL8A 4DV3C 4YHHC 1N36C 2HHHC 4DV1C 2D7VA 4DV5C 1IBKC 2UXBC 1UKKA 4JI6C 1XMOC 1N2FA 2EGTA 2YCBA 2UUCC 3LUSA 4DR5C 2HJGA 1ZB9A 3AF5A 1XNQC 2E8FA 4DV0C 2UUBC 3R9WA 4DCSA 4B3RC 2UU9C 5LMUC 4KHPC 1KKGA 1PA4A 3JAMD 4DR6C 4B3MC 2CY1A 3R9XA 1XMQC 4DR7C 3AF6A 4GKKC 1K0RA 4YY3C 2UXDC 4XX2A 4JI7C 4DV7C 4DR2C 2UUAC 4DR4C 2JMPA 3J80D 2E8EA 1J5EC 3J81D 4JYAC 1JOSA 2BJOA 4X62C 1N32C 2ATWA 1VLAA 5A2QD 2UXCC 2E8CA 2PT7G 1HH2P 1WF3A 4LF7C 1NYEA 2ASBA 4DR3C 4JI8C 1FJGC 3IEUA 4X65C 4LFBC 4DCUA 2VQFC 1MKYA 3T1YC 4MTNA 1N33C 2E5LC 1ML8A 4JI5C 1USPB 1ZB8A 4DR1C 2OPLB 4LF9C 4K0KC 3CJEA 1USPA 2KZFA 4B3TC 4BSZA 1XNRC 3GKUA 5LMNC 4LF4C 2ONFA 4LFCC 4LF8C 1IBMC 3EERA 1LQLA 2DYJA 1HNXC 4LFAC 4NOZA 4MH4A 3I07A 4JI3C 1QWIA 4DV4C 2F4VC 4X66C 4B3SC 1L2FA 2XR1A 4LF6C 4DUZC 1I94C 2CXCA 1WH9A 1N34C 2VQEC 5IT9D 4JI4C 3IEVA 3T1HC 3OTOC 4JI1C 2ZM6C 1IBLC 4JV5C 1HR0C 4GKJC 4DCVA 5BR8C 4DUYC 1EGAA 3J7AD 4DV2C 4AQYC 5FLXD 4DV6C 5IWAC 4LF5C
chains in the Genus database with same CATH superfamily
5T8TA 4IR7A 1HNZC 1T5DX 2E7GA 5AE3A 4NXNC 1HNWC 1M6XC 1LCIA 3AY0A 4DV5C 2UXBC 4DG9A 3K6RA 3E7XA 2UUCC 3LNOA 3DAYA 4ODJA 4D4GA 2HJGA 1FLOA 2D1RA 3VNSA 2UUBC 4DCSA 5LMUC 3CW8X 2QW0X 3UZ0A 3NI2A 4KHPC 3PESA 4B3MC 5KYTA 3GR0A 3A26A 2CY1A 3R9XA 1XMQC 5DV9A 4YY3C 4WS9A 3UX2A 3SO4A 5BUSA 4BC9A 2ZTBA 3J80D 2D1TA 1V25A 1JOSA 4KTTA 1WF3A 1NYEA 5K8FA 3H2TA 4JI8C 4RVOA 4PUIA 1N33C 3UX3A 3A9UA 1ML8A 2P2QA 2OPLB 4LF9C 4I9FA 1USPA 2KZFA 2P2JA 4BSZA 1XDXA 1XNRC 5LMNC 4LF4C 3PBKA 2D27A 2P2BA 4LF8C 2CU6A 2MMAB 1HNXC 4L7IA 2M5OA 5A1IA 2D28C 4I9GA 2CXCA 3KXWA 4JI4C 4K0BA 5IT9D 3OTOC 4JI1C 5BSMA 1V60A 4GKJC 5BR8C 5BUQA 1TH5A 4R1LA 4KTVA 5FLXD 5GTDA 4AQYC 5IFIA 3CW9A 1P4EC 4PHTA 1XRAA 3RG2A 4JI0C 2PN2A 4GXRA 2OPLA 3LGXA 4GS5A 4HPVA 4RMNA 1BA3A 2QL8A 4DV3C 2HHHC 4DV1C 2D7VA 2Y4NA 2P2MA 3DLPX 2ZZMA 2WD9A 3RV2A 1MDFA 1N2FA 2YCBA 1RG9A 4RM2A 1ULTA 4IZ6A 4U5YD 2Z51A 4DV0C 3R9WA 4B3RC 2UU9C 4G1IA 2V7BA 3B7WA 3LAXA 5CZXA 1PG3A 1MXAA 4DR2C 4DR4C 4JYAC 5T8SA 2UXCC 4PZPA 1NY8A 4ZLPA 1HH2P 1GPMA 4PUGA 4L4QA 5ADZA 4D57A 3FM7A 5K85A 2WP0C 3IEUA 5AE1A 4DCUA 2VQFC 1MXCA 1PG4A 2DHMA 3O2EA 2MCQA 1ZB8A 3CQ1A 3CJEA 2YX1A 4OYCA 4LFCC 3VNQA 4EATA 3IPLA 2JNVA 1O9TA 4NOZA 3NYQA 3I07A 4L2ZA 3L95X 2F4VC 5A19A 1WH9A 1IBLC 4DCVA 2BH1X 1PU1A 3ETOA 4DV6C 1O93A 4LF5C 3TDEA 5LCIA 5BSVA 3UOWA 3A4IA 4NXMC 4YHHC 4LE5A 3PROC 4PROC 1IBKC 2DPLA 2KDNA 1WCJA 3TR3A 4G37A 1XMOC 2EGTA 2OO4A 3NYRA 2P2FA 1ZB9A 3AF5A 2E8FA 1YJ7A 4RVNA 3JAMD 4DR6C 5H9UA 3I08A 4DR7C 4RM3A 3AF6A 4FUQA 5A1GA 3ETCA 4DG8A 2E0GA 4FUTA 4XX2A 4D4IA 1MDBA 1O90A 3N2QA 2VSQA 3GPCA 4RLQA 2JMPA 2E8EA 3FCCA 4PUHA 2Y4OA 4TPSB 1VLAA 4ISBA 2ATWA 3C5EA 2PT7G 3L8CA 1RY2A 4DR3C 3R44A 4ZJZA 1QM4A 5BSTA 2M5HA 3LNVA 1T5HX 4B3TC 3DHVA 3GKUA 4R0MA 2ONFA 1IBMC 3EERA 2D1QA 3A9VA 4NDNA 5KEIA 5E7QA 4D56A 3G7SA 4DV4C 4X66C 4DUZC 1FUGA 1XHJA 1N34C 3IEVA 3T1HC 3E7WA 4JV5C 1P7LA 1HR0C 3NPDA 4DUYC 3VNRA 4DV2C 3A25A 3TUFA 2P02A 5BSRA 2UUAC 5IWAC 4OX9C 1YGTA 4X64C 4JI2C 4DCTA 2D1SA 4BCAA 2PG1E 1N36C 4R1MA 4BC7A 3S82A 1UKKA 4JI6C 3N54B 3GR1A 3LUSA 4DR5C 1XNQC 1P4EA 5CZVA 3TQIA 5JRHA 1XRBA 1KKGA 1PA4A 2PROA 2NCLA 5AE2A 3UEBA 4GKKC 1XRCA 1K0RA 5BSWA 2UXDC 1UWDA 4JI7C 4DV7C 1AMUA 1J5EC 3J81D 2BJOA 2MM9A 4X62C 1N32C 5A2QD 2YWBA 2E8CA 4BBYA 2AYAA 5BURA 3EQ6A 4GXQA 2ASBA 1MXBA 1FJGC 4X65C 1IB8A 4LFBC 1V26A 2Y27A 1MKYA 3T1YC 4MTNA 2P20A 2E5LC 4JI5C 4WV3A 1USPB 4DR1C 4JM1A 2ZZNA 3CQ3A 4K0KC 4FTFA 5BSUA 2YWCA 1VEHA 3CQ2A 1XS3A 1LQLA 2DYJA 2QVYX 4RLFA 4LFAC 2KZ0A 4MH4A 4JI3C 2VZEA 1QWIA 2QVXX 4B3SC 1L2FA 2XR1A 4LF6C 1M6XA 4OXIA 1I94C 2VQEC 2ZM6C 3FCEA 1MD9A 4G36A 2OBVA 1EGAA 3J7AD 5KYVA 1O92A 3IMLA 2QVZX 4LF7C
chains in the Genus database with same CATH topology
5T8TA 4IR7A 1HNZC 1T5DX 2E7GA 5AE3A 4NXNC 1HNWC 1LCIA 4DV5C 2UXBC 4DG9A 3E7XA 2UUCC 3DAYA 4ODJA 4D4GA 2HJGA 2D1RA 3VNSA 2UUBC 4DCSA 5LMUC 3CW8X 2QW0X 3UZ0A 3NI2A 4KHPC 3PESA 4B3MC 5KYTA 3GR0A 2CY1A 3R9XA 1XMQC 5DV9A 4YY3C 4WS9A 3SO4A 5BUSA 4BC9A 3J80D 2D1TA 1V25A 1JOSA 4KTTA 1WF3A 1NYEA 5K8FA 3H2TA 4JI8C 4RVOA 1N33C 3A9UA 1ML8A 2P2QA 2OPLB 4LF9C 4I9FA 1USPA 2KZFA 2P2JA 4BSZA 1XNRC 5LMNC 4LF4C 3PBKA 2D27A 2P2BA 4LF8C 1HNXC 4L7IA 5A1IA 2D28C 4I9GA 2CXCA 3KXWA 4JI4C 4K0BA 5IT9D 3OTOC 4JI1C 5BSMA 4GKJC 5BR8C 5BUQA 4R1LA 4KTVA 5FLXD 5GTDA 4AQYC 5IFIA 3CW9A 4PHTA 1XRAA 3RG2A 4JI0C 2PN2A 4GXRA 2OPLA 3LGXA 4GS5A 4HPVA 4RMNA 1BA3A 2QL8A 4DV3C 2HHHC 4DV1C 2D7VA 2Y4NA 2P2MA 3DLPX 2WD9A 3RV2A 1MDFA 1N2FA 2YCBA 1RG9A 4RM2A 1ULTA 4IZ6A 4U5YD 4DV0C 3R9WA 4B3RC 2UU9C 4G1IA 2V7BA 3B7WA 3LAXA 5CZXA 1PG3A 1MXAA 4DR2C 4DR4C 4JYAC 5T8SA 2UXCC 4PZPA 4ZLPA 1HH2P 1GPMA 4L4QA 5ADZA 4D57A 5K85A 2WP0C 3IEUA 5AE1A 4DCUA 2VQFC 1MXCA 1PG4A 1ZB8A 3CJEA 4OYCA 4LFCC 3VNQA 4EATA 3IPLA 1O9TA 4NOZA 3NYQA 3I07A 4L2ZA 3L95X 2F4VC 5A19A 1WH9A 1IBLC 4DCVA 2BH1X 3ETOA 4DV6C 1O93A 4LF5C 3TDEA 5BSVA 3UOWA 3A4IA 4NXMC 4YHHC 4LE5A 3PROC 4PROC 1IBKC 2DPLA 4G37A 1XMOC 2EGTA 2OO4A 3NYRA 2P2FA 1ZB9A 3AF5A 2E8FA 1YJ7A 4RVNA 3JAMD 4DR6C 5H9UA 3I08A 4DR7C 4RM3A 3AF6A 4FUQA 5A1GA 3ETCA 4DG8A 2E0GA 4FUTA 4XX2A 4D4IA 1MDBA 1O90A 3N2QA 2VSQA 3GPCA 4RLQA 2JMPA 2E8EA 3FCCA 2Y4OA 4TPSB 1VLAA 4ISBA 2ATWA 3C5EA 2PT7G 3L8CA 1RY2A 4DR3C 3R44A 4ZJZA 1QM4A 5BSTA 3LNVA 1T5HX 4B3TC 3DHVA 3GKUA 4R0MA 2ONFA 1IBMC 3EERA 2D1QA 3A9VA 4NDNA 5KEIA 5E7QA 4D56A 3G7SA 4DV4C 4X66C 4DUZC 1FUGA 1N34C 3IEVA 3T1HC 3E7WA 4JV5C 1P7LA 1HR0C 3NPDA 4DUYC 3VNRA 4DV2C 3TUFA 2P02A 5BSRA 2UUAC 5IWAC 4OX9C 4X64C 4JI2C 4DCTA 2D1SA 4BCAA 1N36C 4R1MA 4BC7A 3S82A 1UKKA 4JI6C 3N54B 3GR1A 3LUSA 4DR5C 1XNQC 5CZVA 3TQIA 5JRHA 1XRBA 1KKGA 1PA4A 2PROA 5AE2A 4GKKC 1XRCA 1K0RA 5BSWA 2UXDC 4JI7C 4DV7C 1AMUA 1J5EC 3J81D 2BJOA 4X62C 1N32C 5A2QD 2YWBA 2E8CA 4BBYA 2AYAA 5BURA 3EQ6A 4GXQA 2ASBA 1MXBA 1FJGC 4X65C 4LFBC 1V26A 2Y27A 1MKYA 3T1YC 4MTNA 2P20A 2E5LC 4JI5C 4WV3A 1USPB 4DR1C 4JM1A 4K0KC 4FTFA 5BSUA 2YWCA 1LQLA 2DYJA 2QVYX 4RLFA 4LFAC 4MH4A 4JI3C 2VZEA 1QWIA 2QVXX 4B3SC 1L2FA 2XR1A 4LF6C 4OXIA 1I94C 2VQEC 2ZM6C 3FCEA 1MD9A 4G36A 2OBVA 1EGAA 3J7AD 5KYVA 1O92A 3IMLA 2QVZX 4LF7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ C;  4OX9 C;  4X64 C;  4JI0 C;  2E7G A;  2PN2 A;  4JI2 C;  4DCT A;  2OPL A;  4NXN C;  1HNW C;  4NXM C;  2QL8 A;  4DV3 C;  4YHH C;  1N36 C;  2HHH C;  4DV1 C;  2D7V A;  4DV5 C;  1IBK C;  2UXB C;  1UKK A;  4JI6 C;  1XMO C;  1N2F A;  2EGT A;  2YCB A;  2UUC C;  3LUS A;  4DR5 C;  2HJG A;  1ZB9 A;  3AF5 A;  1XNQ C;  2E8F A;  4DV0 C;  2UUB C;  3R9W A;  4DCS A;  4B3R C;  2UU9 C;  5LMU C;  4KHP C;  1KKG A;  1PA4 A;  3JAM D;  4DR6 C;  4B3M C;  2CY1 A;  3R9X A;  1XMQ C;  4DR7 C;  3AF6 A;  4GKK C;  1K0R A;  4YY3 C;  2UXD C;  4XX2 A;  4JI7 C;  4DV7 C;  4DR2 C;  2UUA C;  4DR4 C;  2JMP A;  3J80 D;  2E8E A;  1J5E C;  3J81 D;  4JYA C;  1JOS A;  2BJO A;  4X62 C;  1N32 C;  2ATW A;  1VLA A;  5A2Q D;  2UXC C;  2E8C A;  2PT7 G;  1HH2 P;  1WF3 A;  4LF7 C;  1NYE A;  2ASB A;  4DR3 C;  4JI8 C;  1FJG C;  3IEU A;  4X65 C;  4LFB C;  4DCU A;  2VQF C;  1MKY A;  3T1Y C;  4MTN A;  1N33 C;  2E5L C;  1ML8 A;  4JI5 C;  1USP B;  1ZB8 A;  4DR1 C;  2OPL B;  4LF9 C;  4K0K C;  3CJE A;  1USP A;  2KZF A;  4B3T C;  4BSZ A;  1XNR C;  3GKU A;  5LMN C;  4LF4 C;  2ONF A;  4LFC C;  4LF8 C;  1IBM C;  3EER A;  1LQL A;  2DYJ A;  1HNX C;  4LFA C;  4NOZ A;  4MH4 A;  3I07 A;  4JI3 C;  1QWI A;  4DV4 C;  2F4V C;  4X66 C;  4B3S C;  1L2F A;  2XR1 A;  4LF6 C;  4DUZ C;  1I94 C;  2CXC A;  1WH9 A;  1N34 C;  2VQE C;  5IT9 D;  4JI4 C;  3IEV A;  3T1H C;  3OTO C;  4JI1 C;  2ZM6 C;  1IBL C;  4JV5 C;  1HR0 C;  4GKJ C;  4DCV A;  5BR8 C;  4DUY C;  1EGA A;  3J7A D;  4DV2 C;  4AQY C;  5FLX D;  4DV6 C;  5IWA C;  4LF5 C; 
#chains in the Genus database with same CATH topology
 5T8T A;  4IR7 A;  1HNZ C;  1T5D X;  2E7G A;  5AE3 A;  4NXN C;  1HNW C;  1M6X C;  1LCI A;  3AY0 A;  4DV5 C;  2UXB C;  4DG9 A;  3K6R A;  3E7X A;  2UUC C;  3LNO A;  3DAY A;  4ODJ A;  4D4G A;  2HJG A;  1FLO A;  2D1R A;  3VNS A;  2UUB C;  4DCS A;  5LMU C;  3CW8 X;  2QW0 X;  3UZ0 A;  3NI2 A;  4KHP C;  3PES A;  4B3M C;  5KYT A;  3GR0 A;  3A26 A;  2CY1 A;  3R9X A;  1XMQ C;  5DV9 A;  4YY3 C;  4WS9 A;  3UX2 A;  3SO4 A;  5BUS A;  4BC9 A;  2ZTB A;  3J80 D;  2D1T A;  1V25 A;  1JOS A;  4KTT A;  1WF3 A;  1NYE A;  5K8F A;  3H2T A;  4JI8 C;  4RVO A;  4PUI A;  1N33 C;  3UX3 A;  3A9U A;  1ML8 A;  2P2Q A;  2OPL B;  4LF9 C;  4I9F A;  1USP A;  2KZF A;  2P2J A;  4BSZ A;  1XDX A;  1XNR C;  5LMN C;  4LF4 C;  3PBK A;  2D27 A;  2P2B A;  4LF8 C;  2CU6 A;  2MMA B;  1HNX C;  4L7I A;  2M5O A;  5A1I A;  2D28 C;  4I9G A;  2CXC A;  3KXW A;  4JI4 C;  4K0B A;  5IT9 D;  3OTO C;  4JI1 C;  5BSM A;  1V60 A;  4GKJ C;  5BR8 C;  5BUQ A;  1TH5 A;  4R1L A;  4KTV A;  5FLX D;  5GTD A;  4AQY C;  5IFI A;  3CW9 A;  1P4E C;  4PHT A;  1XRA A;  3RG2 A;  4JI0 C;  2PN2 A;  4GXR A;  2OPL A;  3LGX A;  4GS5 A;  4HPV A;  4RMN A;  1BA3 A;  2QL8 A;  4DV3 C;  2HHH C;  4DV1 C;  2D7V A;  2Y4N A;  2P2M A;  3DLP X;  2ZZM A;  2WD9 A;  3RV2 A;  1MDF A;  1N2F A;  2YCB A;  1RG9 A;  4RM2 A;  1ULT A;  4IZ6 A;  4U5Y D;  2Z51 A;  4DV0 C;  3R9W A;  4B3R C;  2UU9 C;  4G1I A;  2V7B A;  3B7W A;  3LAX A;  5CZX A;  1PG3 A;  1MXA A;  4DR2 C;  4DR4 C;  4JYA C;  5T8S A;  2UXC C;  4PZP A;  1NY8 A;  4ZLP A;  1HH2 P;  1GPM A;  4PUG A;  4L4Q A;  5ADZ A;  4D57 A;  3FM7 A;  5K85 A;  2WP0 C;  3IEU A;  5AE1 A;  4DCU A;  2VQF C;  1MXC A;  1PG4 A;  2DHM A;  3O2E A;  2MCQ A;  1ZB8 A;  3CQ1 A;  3CJE A;  2YX1 A;  4OYC A;  4LFC C;  3VNQ A;  4EAT A;  3IPL A;  2JNV A;  1O9T A;  4NOZ A;  3NYQ A;  3I07 A;  4L2Z A;  3L95 X;  2F4V C;  5A19 A;  1WH9 A;  1IBL C;  4DCV A;  2BH1 X;  1PU1 A;  3ETO A;  4DV6 C;  1O93 A;  4LF5 C;  3TDE A;  5LCI A;  5BSV A;  3UOW A;  3A4I A;  4NXM C;  4YHH C;  4LE5 A;  3PRO C;  4PRO C;  1IBK C;  2DPL A;  2KDN A;  1WCJ A;  3TR3 A;  4G37 A;  1XMO C;  2EGT A;  2OO4 A;  3NYR A;  2P2F A;  1ZB9 A;  3AF5 A;  2E8F A;  1YJ7 A;  4RVN A;  3JAM D;  4DR6 C;  5H9U A;  3I08 A;  4DR7 C;  4RM3 A;  3AF6 A;  4FUQ A;  5A1G A;  3ETC A;  4DG8 A;  2E0G A;  4FUT A;  4XX2 A;  4D4I A;  1MDB A;  1O90 A;  3N2Q A;  2VSQ A;  3GPC A;  4RLQ A;  2JMP A;  2E8E A;  3FCC A;  4PUH A;  2Y4O A;  4TPS B;  1VLA A;  4ISB A;  2ATW A;  3C5E A;  2PT7 G;  3L8C A;  1RY2 A;  4DR3 C;  3R44 A;  4ZJZ A;  1QM4 A;  5BST A;  2M5H A;  3LNV A;  1T5H X;  4B3T C;  3DHV A;  3GKU A;  4R0M A;  2ONF A;  1IBM C;  3EER A;  2D1Q A;  3A9V A;  4NDN A;  5KEI A;  5E7Q A;  4D56 A;  3G7S A;  4DV4 C;  4X66 C;  4DUZ C;  1FUG A;  1XHJ A;  1N34 C;  3IEV A;  3T1H C;  3E7W A;  4JV5 C;  1P7L A;  1HR0 C;  3NPD A;  4DUY C;  3VNR A;  4DV2 C;  3A25 A;  3TUF A;  2P02 A;  5BSR A;  2UUA C;  5IWA C;  4OX9 C;  1YGT A;  4X64 C;  4JI2 C;  4DCT A;  2D1S A;  4BCA A;  2PG1 E;  1N36 C;  4R1M A;  4BC7 A;  3S82 A;  1UKK A;  4JI6 C;  3N54 B;  3GR1 A;  3LUS A;  4DR5 C;  1XNQ C;  1P4E A;  5CZV A;  3TQI A;  5JRH A;  1XRB A;  1KKG A;  1PA4 A;  2PRO A;  2NCL A;  5AE2 A;  3UEB A;  4GKK C;  1XRC A;  1K0R A;  5BSW A;  2UXD C;  1UWD A;  4JI7 C;  4DV7 C;  1AMU A;  1J5E C;  3J81 D;  2BJO A;  2MM9 A;  4X62 C;  1N32 C;  5A2Q D;  2YWB A;  2E8C A;  4BBY A;  2AYA A;  5BUR A;  3EQ6 A;  4GXQ A;  2ASB A;  1MXB A;  1FJG C;  4X65 C;  1IB8 A;  4LFB C;  1V26 A;  2Y27 A;  1MKY A;  3T1Y C;  4MTN A;  2P20 A;  2E5L C;  4JI5 C;  4WV3 A;  1USP B;  4DR1 C;  4JM1 A;  2ZZN A;  3CQ3 A;  4K0K C;  4FTF A;  5BSU A;  2YWC A;  1VEH A;  3CQ2 A;  1XS3 A;  1LQL A;  2DYJ A;  2QVY X;  4RLF A;  4LFA C;  2KZ0 A;  4MH4 A;  4JI3 C;  2VZE A;  1QWI A;  2QVX X;  4B3S C;  1L2F A;  2XR1 A;  4LF6 C;  1M6X A;  4OXI A;  1I94 C;  2VQE C;  2ZM6 C;  3FCE A;  1MD9 A;  4G36 A;  2OBV A;  1EGA A;  3J7A D;  5KYV A;  1O92 A;  3IML A;  2QVZ X;  4LF7 C; 
#chains in the Genus database with same CATH homology
 5T8T A;  4IR7 A;  1HNZ C;  1T5D X;  2E7G A;  5AE3 A;  4NXN C;  1HNW C;  1LCI A;  4DV5 C;  2UXB C;  4DG9 A;  3E7X A;  2UUC C;  3DAY A;  4ODJ A;  4D4G A;  2HJG A;  2D1R A;  3VNS A;  2UUB C;  4DCS A;  5LMU C;  3CW8 X;  2QW0 X;  3UZ0 A;  3NI2 A;  4KHP C;  3PES A;  4B3M C;  5KYT A;  3GR0 A;  2CY1 A;  3R9X A;  1XMQ C;  5DV9 A;  4YY3 C;  4WS9 A;  3SO4 A;  5BUS A;  4BC9 A;  3J80 D;  2D1T A;  1V25 A;  1JOS A;  4KTT A;  1WF3 A;  1NYE A;  5K8F A;  3H2T A;  4JI8 C;  4RVO A;  1N33 C;  3A9U A;  1ML8 A;  2P2Q A;  2OPL B;  4LF9 C;  4I9F A;  1USP A;  2KZF A;  2P2J A;  4BSZ A;  1XNR C;  5LMN C;  4LF4 C;  3PBK A;  2D27 A;  2P2B A;  4LF8 C;  1HNX C;  4L7I A;  5A1I A;  2D28 C;  4I9G A;  2CXC A;  3KXW A;  4JI4 C;  4K0B A;  5IT9 D;  3OTO C;  4JI1 C;  5BSM A;  4GKJ C;  5BR8 C;  5BUQ A;  4R1L A;  4KTV A;  5FLX D;  5GTD A;  4AQY C;  5IFI A;  3CW9 A;  4PHT A;  1XRA A;  3RG2 A;  4JI0 C;  2PN2 A;  4GXR A;  2OPL A;  3LGX A;  4GS5 A;  4HPV A;  4RMN A;  1BA3 A;  2QL8 A;  4DV3 C;  2HHH C;  4DV1 C;  2D7V A;  2Y4N A;  2P2M A;  3DLP X;  2WD9 A;  3RV2 A;  1MDF A;  1N2F A;  2YCB A;  1RG9 A;  4RM2 A;  1ULT A;  4IZ6 A;  4U5Y D;  4DV0 C;  3R9W A;  4B3R C;  2UU9 C;  4G1I A;  2V7B A;  3B7W A;  3LAX A;  5CZX A;  1PG3 A;  1MXA A;  4DR2 C;  4DR4 C;  4JYA C;  5T8S A;  2UXC C;  4PZP A;  4ZLP A;  1HH2 P;  1GPM A;  4L4Q A;  5ADZ A;  4D57 A;  5K85 A;  2WP0 C;  3IEU A;  5AE1 A;  4DCU A;  2VQF C;  1MXC A;  1PG4 A;  1ZB8 A;  3CJE A;  4OYC A;  4LFC C;  3VNQ A;  4EAT A;  3IPL A;  1O9T A;  4NOZ A;  3NYQ A;  3I07 A;  4L2Z A;  3L95 X;  2F4V C;  5A19 A;  1WH9 A;  1IBL C;  4DCV A;  2BH1 X;  3ETO A;  4DV6 C;  1O93 A;  4LF5 C;  3TDE A;  5BSV A;  3UOW A;  3A4I A;  4NXM C;  4YHH C;  4LE5 A;  3PRO C;  4PRO C;  1IBK C;  2DPL A;  4G37 A;  1XMO C;  2EGT A;  2OO4 A;  3NYR A;  2P2F A;  1ZB9 A;  3AF5 A;  2E8F A;  1YJ7 A;  4RVN A;  3JAM D;  4DR6 C;  5H9U A;  3I08 A;  4DR7 C;  4RM3 A;  3AF6 A;  4FUQ A;  5A1G A;  3ETC A;  4DG8 A;  2E0G A;  4FUT A;  4XX2 A;  4D4I A;  1MDB A;  1O90 A;  3N2Q A;  2VSQ A;  3GPC A;  4RLQ A;  2JMP A;  2E8E A;  3FCC A;  2Y4O A;  4TPS B;  1VLA A;  4ISB A;  2ATW A;  3C5E A;  2PT7 G;  3L8C A;  1RY2 A;  4DR3 C;  3R44 A;  4ZJZ A;  1QM4 A;  5BST A;  3LNV A;  1T5H X;  4B3T C;  3DHV A;  3GKU A;  4R0M A;  2ONF A;  1IBM C;  3EER A;  2D1Q A;  3A9V A;  4NDN A;  5KEI A;  5E7Q A;  4D56 A;  3G7S A;  4DV4 C;  4X66 C;  4DUZ C;  1FUG A;  1N34 C;  3IEV A;  3T1H C;  3E7W A;  4JV5 C;  1P7L A;  1HR0 C;  3NPD A;  4DUY C;  3VNR A;  4DV2 C;  3TUF A;  2P02 A;  5BSR A;  2UUA C;  5IWA C;  4OX9 C;  4X64 C;  4JI2 C;  4DCT A;  2D1S A;  4BCA A;  1N36 C;  4R1M A;  4BC7 A;  3S82 A;  1UKK A;  4JI6 C;  3N54 B;  3GR1 A;  3LUS A;  4DR5 C;  1XNQ C;  5CZV A;  3TQI A;  5JRH A;  1XRB A;  1KKG A;  1PA4 A;  2PRO A;  5AE2 A;  4GKK C;  1XRC A;  1K0R A;  5BSW A;  2UXD C;  4JI7 C;  4DV7 C;  1AMU A;  1J5E C;  3J81 D;  2BJO A;  4X62 C;  1N32 C;  5A2Q D;  2YWB A;  2E8C A;  4BBY A;  2AYA A;  5BUR A;  3EQ6 A;  4GXQ A;  2ASB A;  1MXB A;  1FJG C;  4X65 C;  4LFB C;  1V26 A;  2Y27 A;  1MKY A;  3T1Y C;  4MTN A;  2P20 A;  2E5L C;  4JI5 C;  4WV3 A;  1USP B;  4DR1 C;  4JM1 A;  4K0K C;  4FTF A;  5BSU A;  2YWC A;  1LQL A;  2DYJ A;  2QVY X;  4RLF A;  4LFA C;  4MH4 A;  4JI3 C;  2VZE A;  1QWI A;  2QVX X;  4B3S C;  1L2F A;  2XR1 A;  4LF6 C;  4OXI A;  1I94 C;  2VQE C;  2ZM6 C;  3FCE A;  1MD9 A;  4G36 A;  2OBV A;  1EGA A;  3J7A D;  5KYV A;  1O92 A;  3IML A;  2QVZ X;  4LF7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...