3JAMD

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 45
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3jamD01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3jamD02
2HJGA 1J5EC 2F4VC 4XX2A 3AF6A 2CY1A 4DV1C 1USPA 3J81D 2E8EA 2D7VA 4JI0C 4OX9C 5IWAC 3I07A 4DUZC 2ATWA 4YY3C 4DV7C 4MH4A 1HH2P 3CJEA 4X65C 1NYEA 2ASBA 2DYJA 2JMPA 4MTNA 4BSZA 4B3TC 4LF9C 4X64C 1WF3A 2BJOA 1L2FA 1K0RA 3J80D 2HHHC 1N2FA 1UKKA 2E8CA 4B3RC 1LQLA 4X66C 2XR1A 3T1YC 4JYAC 4JI6C 4DUYC 4B3MC 4DR2C 1HNWC 4DCSA 5LMUC 2OPLB 3GKUA 4JI1C 4JI8C 1N34C 1IBLC 2UUBC 1IBKC 1QWIA 2UXBC 5A2QD 4DV5C 1PA4A 2PT7G 1IBMC 1WH9A 4JV5C 5IT9D 4JI2C 4LF8C 4NXNC 4LF4C 4NOZA 3IEUA 2EGTA 4GKJC 1ZB9A 4JI7C 4DR7C 2PN2A 1N36C 2UUCC 4JI5C 1N32C 2ONFA 2QL8A 3JAMD 4DR5C 1HR0C 2UU9C 1N33C 3EERA 2E7GA 1EGAA 4DCUA 4JI4C 4DV6C 1USPB 2VQEC 2KZFA 3R9XA 1HNXC 2VQFC 1JOSA 4DCTA 2E8FA 2YCBA 2E5LC 4DR6C 3OTOC 1ML8A 4DCVA 1MKYA 1FJGC 2UXCC 3AF5A 4LF6C 2CXCA 4LF5C 4X62C 4LF7C 1XNQC 4NXMC 4DV3C 2UUAC 4LFAC 4GKKC 1HNZC 2UXDC 4LFBC 2OPLA 4AQYC 4JI3C 1XNRC 3T1HC 4KHPC 1XMOC 1I94C 4LFCC 3J7AD 4B3SC 1VLAA 1ZB8A 4DV0C 1KKGA 4DV4C 1XMQC 5FLXD 4YHHC 5BR8C 5LMNC 4DR1C 3IEVA 4DR4C 3LUSA 2ZM6C 4K0KC 3R9WA 4DV2C 4DR3C
chains in the Genus database with same CATH superfamily
2PROA 1QM4A 4R1LA 1GPMA 1PU1A 3ETCA 3I07A 4R1MA 4DV7C 1XHJA 4PROC 3E7XA 1HH2P 3CW9A 2ASBA 3B7WA 2JMPA 4MTNA 5AE1A 1L2FA 2P2QA 4L4QA 1UKKA 2E8CA 3ETOA 4ZJZA 5ADZA 4KTVA 3TDEA 5A1GA 4DUYC 1HNWC 2QVYX 5LMUC 4JI8C 3SO4A 4JM1A 1IBKC 2UXBC 2WD9A 1WH9A 3CQ1A 4LF4C 2M5OA 4GKJC 5T8TA 2WP0C 5E7QA 2DHMA 1N36C 3A26A 1N32C 1O93A 2QL8A 3C5EA 3EERA 4ODJA 2D1TA 1MDBA 3FCCA 3AY0A 4TPSB 4IR7A 4DCTA 3DAYA 3KXWA 4BCAA 4FTFA 5BSTA 2YWBA 4LF5C 4LF7C 1XNQC 2YWCA 4DG9A 3LGXA 3A9UA 3NYQA 4JI3C 2OO4A 2P2JA 2CU6A 1XMOC 1P4EC 4WV3A 2P2FA 2YX1A 5CZVA 2D1RA 4G36A 3TQIA 5LMNC 3NYRA 5BR8C 4DR1C 1XS3A 3LUSA 4ZLPA 2ZM6C 3R9WA 1XRAA 2F4VC 1FLOA 2Y4NA 2CY1A 2VSQA 2OBVA 1XDXA 3L8CA 3UX2A 2E8EA 4JI0C 4PZPA 4IZ6A 4YY3C 2MMAB 4MH4A 3TUFA 4BSZA 2KZ0A 4LF9C 2BJOA 4OYCA 1NY8A 1WCJA 4X66C 3PBKA 2XR1A 4RM2A 3T1YC 5KYTA 3FCEA 1O9TA 1VEHA 1O92A 3R44A 3GR1A 5A19A 4KTTA 2OPLB 1N34C 4L2ZA 4PHTA 5A2QD 4DV5C 1PA4A 2PT7G 5BSWA 4LF8C 5BSMA 4NOZA 1MDFA 4JI7C 5BURA 2JNVA 3DHVA 5BUSA 4G1IA 2D1SA 2ONFA 1T5DX 1RG9A 4BC7A 3FM7A 2E7GA 3UEBA 1USPB 3VNRA 3O2EA 2V7BA 1ULTA 3NI2A 4RVNA 2YCBA 3GR0A 4D4IA 1IB8A 5BSUA 4NXMC 2UUAC 4GKKC 3L95X 4LFBC 4I9GA 4AQYC 2D27A 1V26A 1I94C 2ZZMA 4I9FA 2DPLA 1KKGA 4DV4C 3IMLA 2QW0X 1XMQC 3IEVA 4DR4C 4LE5A 3PESA 4K0KC 4DR3C 4OXIA 4XX2A 3AF6A 4L7IA 1BA3A 3A9VA 2P2BA 3J81D 3N54B 5CZXA 3UOWA 3CQ3A 2DYJA 2NCLA 3UZ0A 3J80D 3A4IA 3UX3A 4R0MA 4JYAC 4B3MC 2D1QA 4PUHA 3VNQA 4DCSA 5JRHA 1MD9A 2E0GA 5AE2A 4RM3A 4RVOA 1P7LA 2UUBC 1QWIA 2QVXX 4HPVA 4EATA 1IBMC 1MXAA 5T8SA 3NPDA 2AYAA 3VNSA 3IEUA 3E7WA 2EGTA 1YGTA 4JI5C 4U5YD 3LNOA 4BBYA 3LNVA 5BUQA 1EGAA 4DCUA 4JI4C 4DV6C 2D28C 2VQEC 3R9XA 1M6XA 1HNXC 4FUQA 2ZTBA 2VQFC 4WS9A 1JOSA 2E8FA 1T5HX 4DR6C 3CW8X 1MKYA 2UXCC 1UWDA 3AF5A 4LF6C 4X62C 4ISBA 2OPLA 1PG4A 2BH1X 1RY2A 3EQ6A 1XNRC 3T1HC 4LFCC 4RLFA 3PROC 2MCQA 3RG2A 5DV9A 4RMNA 5FLXD 4YHHC 5KEIA 2HJGA 1J5EC 2Y4OA 4DV1C 1USPA 1XRBA 2PG1E 1MXBA 2D7VA 4OX9C 5IWAC 3I08A 3N2QA 4DUZC 2ATWA 3G7SA 4NDNA 2P02A 4D56A 3CJEA 4X65C 1NYEA 4B3TC 4X64C 5GTDA 1WF3A 2KDNA 1K0RA 1O90A 2HHHC 1N2FA 4B3RC 1LQLA 4DG8A 4GXQA 3LAXA 3CQ2A 1YJ7A 4BC9A 4JI6C 4PUGA 5IFIA 4DR2C 4JI1C 3GKUA 4PUIA 1AMUA 1IBLC 2VZEA 1V25A 3K6RA 4JV5C 3RV2A 4K0BA 5K85A 5IT9D 4JI2C 5BSVA 4NXNC 3H2TA 1TH5A 1V60A 2Z51A 1ZB9A 4DR7C 2PN2A 2UUCC 2Y27A 3JAMD 1HR0C 3TR3A 4DR5C 2UU9C 1N33C 2P2MA 1PG3A 5KYVA 2MM9A 2QVZX 3DLPX 1LCIA 2KZFA 1MXCA 1P4EA 2E5LC 2M5HA 4D4GA 1ML8A 3OTOC 4DCVA 1FJGC 2CXCA 3S82A 5K8FA 4DV3C 1FUGA 4LFAC 1HNZC 2UXDC 4GS5A 5H9UA 5BSRA 4D57A 3IPLA 4KHPC 5LCIA 2P20A 3J7AD 4RLQA 1M6XC 4B3SC 4GXRA 1VLAA 1ZB8A 4DV0C 2ZZNA 3A25A 4FUTA 5A1IA 3GPCA 4G37A 5AE3A 1XRCA 4DV2C
chains in the Genus database with same CATH topology
2PROA 1QM4A 4R1LA 1GPMA 3ETCA 3I07A 4R1MA 4DV7C 4PROC 3E7XA 1HH2P 3CW9A 2ASBA 3B7WA 2JMPA 4MTNA 5AE1A 1L2FA 2P2QA 4L4QA 1UKKA 2E8CA 3ETOA 4ZJZA 5ADZA 4KTVA 3TDEA 5A1GA 4DUYC 1HNWC 2QVYX 5LMUC 4JI8C 3SO4A 4JM1A 1IBKC 2UXBC 2WD9A 1WH9A 4LF4C 4GKJC 5T8TA 2WP0C 5E7QA 1N36C 1N32C 1O93A 2QL8A 3C5EA 3EERA 4ODJA 2D1TA 1MDBA 3FCCA 4TPSB 4IR7A 4DCTA 3DAYA 3KXWA 4BCAA 4FTFA 5BSTA 2YWBA 4LF5C 4LF7C 1XNQC 2YWCA 4DG9A 3LGXA 3A9UA 3NYQA 4JI3C 2OO4A 2P2JA 1XMOC 4WV3A 2P2FA 5CZVA 2D1RA 4G36A 3TQIA 5LMNC 3NYRA 5BR8C 4DR1C 3LUSA 4ZLPA 2ZM6C 3R9WA 1XRAA 2F4VC 2Y4NA 2CY1A 2VSQA 2OBVA 3L8CA 2E8EA 4JI0C 4PZPA 4IZ6A 4YY3C 4MH4A 3TUFA 4BSZA 4LF9C 2BJOA 4OYCA 4X66C 3PBKA 2XR1A 4RM2A 3T1YC 5KYTA 3FCEA 1O9TA 1O92A 3R44A 3GR1A 5A19A 4KTTA 2OPLB 1N34C 4L2ZA 4PHTA 5A2QD 4DV5C 1PA4A 2PT7G 5BSWA 4LF8C 4NOZA 5BSMA 1MDFA 4JI7C 5BURA 3DHVA 5BUSA 4G1IA 2D1SA 2ONFA 1T5DX 1RG9A 4BC7A 2E7GA 1USPB 3VNRA 2V7BA 1ULTA 3NI2A 4RVNA 2YCBA 3GR0A 4D4IA 5BSUA 4NXMC 2UUAC 4GKKC 3L95X 4LFBC 4I9GA 4AQYC 2D27A 1V26A 1I94C 4I9FA 2DPLA 1KKGA 4DV4C 3IMLA 2QW0X 1XMQC 3IEVA 4DR4C 4LE5A 3PESA 4K0KC 4DR3C 4OXIA 4XX2A 3AF6A 4L7IA 1BA3A 3A9VA 2P2BA 3J81D 3N54B 5CZXA 3UOWA 2DYJA 3UZ0A 3J80D 3A4IA 4R0MA 4JYAC 4B3MC 2D1QA 4DCSA 3VNQA 5JRHA 1MD9A 2E0GA 5AE2A 4RM3A 4RVOA 1P7LA 2UUBC 1QWIA 2QVXX 4HPVA 4EATA 1IBMC 1MXAA 5T8SA 3NPDA 2AYAA 3VNSA 3IEUA 3E7WA 2EGTA 4JI5C 4U5YD 4BBYA 3LNVA 5BUQA 1EGAA 4DCUA 4JI4C 4DV6C 2D28C 2VQEC 3R9XA 1HNXC 4FUQA 2VQFC 4WS9A 1JOSA 2E8FA 1T5HX 4DR6C 3CW8X 1MKYA 2UXCC 3AF5A 4LF6C 4X62C 4ISBA 2OPLA 1PG4A 2BH1X 1RY2A 3EQ6A 1XNRC 3T1HC 4LFCC 4RLFA 3PROC 3RG2A 5DV9A 4RMNA 5FLXD 4YHHC 5KEIA 2HJGA 1J5EC 2Y4OA 4DV1C 1USPA 1XRBA 1MXBA 2D7VA 4OX9C 5IWAC 3I08A 3N2QA 4DUZC 2ATWA 3G7SA 4NDNA 2P02A 4D56A 3CJEA 4X65C 1NYEA 4B3TC 4X64C 5GTDA 1WF3A 1K0RA 1O90A 2HHHC 1N2FA 4B3RC 1LQLA 4DG8A 4GXQA 3LAXA 1YJ7A 4BC9A 4JI6C 5IFIA 4DR2C 4JI1C 3GKUA 1AMUA 1IBLC 2VZEA 1V25A 4JV5C 3RV2A 4K0BA 5K85A 5IT9D 4JI2C 5BSVA 4NXNC 3H2TA 1ZB9A 4DR7C 2PN2A 2UUCC 2Y27A 3JAMD 1HR0C 4DR5C 2UU9C 1N33C 2P2MA 1PG3A 5KYVA 2QVZX 3DLPX 1LCIA 2KZFA 1MXCA 2E5LC 4D4GA 1ML8A 3OTOC 4DCVA 1FJGC 2CXCA 3S82A 5K8FA 4DV3C 1FUGA 4LFAC 1HNZC 2UXDC 4GS5A 5H9UA 5BSRA 4D57A 3IPLA 4KHPC 2P20A 3J7AD 4RLQA 4B3SC 4GXRA 1VLAA 1ZB8A 4DV0C 4FUTA 5A1IA 3GPCA 4G37A 5AE3A 1XRCA 4DV2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJG A;  1J5E C;  2F4V C;  4XX2 A;  3AF6 A;  2CY1 A;  4DV1 C;  1USP A;  3J81 D;  2E8E A;  2D7V A;  4JI0 C;  4OX9 C;  5IWA C;  3I07 A;  4DUZ C;  2ATW A;  4YY3 C;  4DV7 C;  4MH4 A;  1HH2 P;  3CJE A;  4X65 C;  1NYE A;  2ASB A;  2DYJ A;  2JMP A;  4MTN A;  4BSZ A;  4B3T C;  4LF9 C;  4X64 C;  1WF3 A;  2BJO A;  1L2F A;  1K0R A;  3J80 D;  2HHH C;  1N2F A;  1UKK A;  2E8C A;  4B3R C;  1LQL A;  4X66 C;  2XR1 A;  3T1Y C;  4JYA C;  4JI6 C;  4DUY C;  4B3M C;  4DR2 C;  1HNW C;  4DCS A;  5LMU C;  2OPL B;  3GKU A;  4JI1 C;  4JI8 C;  1N34 C;  1IBL C;  2UUB C;  1IBK C;  1QWI A;  2UXB C;  5A2Q D;  4DV5 C;  1PA4 A;  2PT7 G;  1IBM C;  1WH9 A;  4JV5 C;  5IT9 D;  4JI2 C;  4LF8 C;  4NXN C;  4LF4 C;  4NOZ A;  3IEU A;  2EGT A;  4GKJ C;  1ZB9 A;  4JI7 C;  4DR7 C;  2PN2 A;  1N36 C;  2UUC C;  4JI5 C;  1N32 C;  2ONF A;  2QL8 A;  3JAM D;  4DR5 C;  1HR0 C;  2UU9 C;  1N33 C;  3EER A;  2E7G A;  1EGA A;  4DCU A;  4JI4 C;  4DV6 C;  1USP B;  2VQE C;  2KZF A;  3R9X A;  1HNX C;  2VQF C;  1JOS A;  4DCT A;  2E8F A;  2YCB A;  2E5L C;  4DR6 C;  3OTO C;  1ML8 A;  4DCV A;  1MKY A;  1FJG C;  2UXC C;  3AF5 A;  4LF6 C;  2CXC A;  4LF5 C;  4X62 C;  4LF7 C;  1XNQ C;  4NXM C;  4DV3 C;  2UUA C;  4LFA C;  4GKK C;  1HNZ C;  2UXD C;  4LFB C;  2OPL A;  4AQY C;  4JI3 C;  1XNR C;  3T1H C;  4KHP C;  1XMO C;  1I94 C;  4LFC C;  3J7A D;  4B3S C;  1VLA A;  1ZB8 A;  4DV0 C;  1KKG A;  4DV4 C;  1XMQ C;  5FLX D;  4YHH C;  5BR8 C;  5LMN C;  4DR1 C;  3IEV A;  4DR4 C;  3LUS A;  2ZM6 C;  4K0K C;  3R9W A;  4DV2 C;  4DR3 C; 
#chains in the Genus database with same CATH topology
 2PRO A;  1QM4 A;  4R1L A;  1GPM A;  1PU1 A;  3ETC A;  3I07 A;  4R1M A;  4DV7 C;  1XHJ A;  4PRO C;  3E7X A;  1HH2 P;  3CW9 A;  2ASB A;  3B7W A;  2JMP A;  4MTN A;  5AE1 A;  1L2F A;  2P2Q A;  4L4Q A;  1UKK A;  2E8C A;  3ETO A;  4ZJZ A;  5ADZ A;  4KTV A;  3TDE A;  5A1G A;  4DUY C;  1HNW C;  2QVY X;  5LMU C;  4JI8 C;  3SO4 A;  4JM1 A;  1IBK C;  2UXB C;  2WD9 A;  1WH9 A;  3CQ1 A;  4LF4 C;  2M5O A;  4GKJ C;  5T8T A;  2WP0 C;  5E7Q A;  2DHM A;  1N36 C;  3A26 A;  1N32 C;  1O93 A;  2QL8 A;  3C5E A;  3EER A;  4ODJ A;  2D1T A;  1MDB A;  3FCC A;  3AY0 A;  4TPS B;  4IR7 A;  4DCT A;  3DAY A;  3KXW A;  4BCA A;  4FTF A;  5BST A;  2YWB A;  4LF5 C;  4LF7 C;  1XNQ C;  2YWC A;  4DG9 A;  3LGX A;  3A9U A;  3NYQ A;  4JI3 C;  2OO4 A;  2P2J A;  2CU6 A;  1XMO C;  1P4E C;  4WV3 A;  2P2F A;  2YX1 A;  5CZV A;  2D1R A;  4G36 A;  3TQI A;  5LMN C;  3NYR A;  5BR8 C;  4DR1 C;  1XS3 A;  3LUS A;  4ZLP A;  2ZM6 C;  3R9W A;  1XRA A;  2F4V C;  1FLO A;  2Y4N A;  2CY1 A;  2VSQ A;  2OBV A;  1XDX A;  3L8C A;  3UX2 A;  2E8E A;  4JI0 C;  4PZP A;  4IZ6 A;  4YY3 C;  2MMA B;  4MH4 A;  3TUF A;  4BSZ A;  2KZ0 A;  4LF9 C;  2BJO A;  4OYC A;  1NY8 A;  1WCJ A;  4X66 C;  3PBK A;  2XR1 A;  4RM2 A;  3T1Y C;  5KYT A;  3FCE A;  1O9T A;  1VEH A;  1O92 A;  3R44 A;  3GR1 A;  5A19 A;  4KTT A;  2OPL B;  1N34 C;  4L2Z A;  4PHT A;  5A2Q D;  4DV5 C;  1PA4 A;  2PT7 G;  5BSW A;  4LF8 C;  5BSM A;  4NOZ A;  1MDF A;  4JI7 C;  5BUR A;  2JNV A;  3DHV A;  5BUS A;  4G1I A;  2D1S A;  2ONF A;  1T5D X;  1RG9 A;  4BC7 A;  3FM7 A;  2E7G A;  3UEB A;  1USP B;  3VNR A;  3O2E A;  2V7B A;  1ULT A;  3NI2 A;  4RVN A;  2YCB A;  3GR0 A;  4D4I A;  1IB8 A;  5BSU A;  4NXM C;  2UUA C;  4GKK C;  3L95 X;  4LFB C;  4I9G A;  4AQY C;  2D27 A;  1V26 A;  1I94 C;  2ZZM A;  4I9F A;  2DPL A;  1KKG A;  4DV4 C;  3IML A;  2QW0 X;  1XMQ C;  3IEV A;  4DR4 C;  4LE5 A;  3PES A;  4K0K C;  4DR3 C;  4OXI A;  4XX2 A;  3AF6 A;  4L7I A;  1BA3 A;  3A9V A;  2P2B A;  3J81 D;  3N54 B;  5CZX A;  3UOW A;  3CQ3 A;  2DYJ A;  2NCL A;  3UZ0 A;  3J80 D;  3A4I A;  3UX3 A;  4R0M A;  4JYA C;  4B3M C;  2D1Q A;  4PUH A;  3VNQ A;  4DCS A;  5JRH A;  1MD9 A;  2E0G A;  5AE2 A;  4RM3 A;  4RVO A;  1P7L A;  2UUB C;  1QWI A;  2QVX X;  4HPV A;  4EAT A;  1IBM C;  1MXA A;  5T8S A;  3NPD A;  2AYA A;  3VNS A;  3IEU A;  3E7W A;  2EGT A;  1YGT A;  4JI5 C;  4U5Y D;  3LNO A;  4BBY A;  3LNV A;  5BUQ A;  1EGA A;  4DCU A;  4JI4 C;  4DV6 C;  2D28 C;  2VQE C;  3R9X A;  1M6X A;  1HNX C;  4FUQ A;  2ZTB A;  2VQF C;  4WS9 A;  1JOS A;  2E8F A;  1T5H X;  4DR6 C;  3CW8 X;  1MKY A;  2UXC C;  1UWD A;  3AF5 A;  4LF6 C;  4X62 C;  4ISB A;  2OPL A;  1PG4 A;  2BH1 X;  1RY2 A;  3EQ6 A;  1XNR C;  3T1H C;  4LFC C;  4RLF A;  3PRO C;  2MCQ A;  3RG2 A;  5DV9 A;  4RMN A;  5FLX D;  4YHH C;  5KEI A;  2HJG A;  1J5E C;  2Y4O A;  4DV1 C;  1USP A;  1XRB A;  2PG1 E;  1MXB A;  2D7V A;  4OX9 C;  5IWA C;  3I08 A;  3N2Q A;  4DUZ C;  2ATW A;  3G7S A;  4NDN A;  2P02 A;  4D56 A;  3CJE A;  4X65 C;  1NYE A;  4B3T C;  4X64 C;  5GTD A;  1WF3 A;  2KDN A;  1K0R A;  1O90 A;  2HHH C;  1N2F A;  4B3R C;  1LQL A;  4DG8 A;  4GXQ A;  3LAX A;  3CQ2 A;  1YJ7 A;  4BC9 A;  4JI6 C;  4PUG A;  5IFI A;  4DR2 C;  4JI1 C;  3GKU A;  4PUI A;  1AMU A;  1IBL C;  2VZE A;  1V25 A;  3K6R A;  4JV5 C;  3RV2 A;  4K0B A;  5K85 A;  5IT9 D;  4JI2 C;  5BSV A;  4NXN C;  3H2T A;  1TH5 A;  1V60 A;  2Z51 A;  1ZB9 A;  4DR7 C;  2PN2 A;  2UUC C;  2Y27 A;  3JAM D;  1HR0 C;  3TR3 A;  4DR5 C;  2UU9 C;  1N33 C;  2P2M A;  1PG3 A;  5KYV A;  2MM9 A;  2QVZ X;  3DLP X;  1LCI A;  2KZF A;  1MXC A;  1P4E A;  2E5L C;  2M5H A;  4D4G A;  1ML8 A;  3OTO C;  4DCV A;  1FJG C;  2CXC A;  3S82 A;  5K8F A;  4DV3 C;  1FUG A;  4LFA C;  1HNZ C;  2UXD C;  4GS5 A;  5H9U A;  5BSR A;  4D57 A;  3IPL A;  4KHP C;  5LCI A;  2P20 A;  3J7A D;  4RLQ A;  1M6X C;  4B3S C;  4GXR A;  1VLA A;  1ZB8 A;  4DV0 C;  2ZZN A;  3A25 A;  4FUT A;  5A1I A;  3GPC A;  4G37 A;  5AE3 A;  1XRC A;  4DV2 C; 
#chains in the Genus database with same CATH homology
 2PRO A;  1QM4 A;  4R1L A;  1GPM A;  3ETC A;  3I07 A;  4R1M A;  4DV7 C;  4PRO C;  3E7X A;  1HH2 P;  3CW9 A;  2ASB A;  3B7W A;  2JMP A;  4MTN A;  5AE1 A;  1L2F A;  2P2Q A;  4L4Q A;  1UKK A;  2E8C A;  3ETO A;  4ZJZ A;  5ADZ A;  4KTV A;  3TDE A;  5A1G A;  4DUY C;  1HNW C;  2QVY X;  5LMU C;  4JI8 C;  3SO4 A;  4JM1 A;  1IBK C;  2UXB C;  2WD9 A;  1WH9 A;  4LF4 C;  4GKJ C;  5T8T A;  2WP0 C;  5E7Q A;  1N36 C;  1N32 C;  1O93 A;  2QL8 A;  3C5E A;  3EER A;  4ODJ A;  2D1T A;  1MDB A;  3FCC A;  4TPS B;  4IR7 A;  4DCT A;  3DAY A;  3KXW A;  4BCA A;  4FTF A;  5BST A;  2YWB A;  4LF5 C;  4LF7 C;  1XNQ C;  2YWC A;  4DG9 A;  3LGX A;  3A9U A;  3NYQ A;  4JI3 C;  2OO4 A;  2P2J A;  1XMO C;  4WV3 A;  2P2F A;  5CZV A;  2D1R A;  4G36 A;  3TQI A;  5LMN C;  3NYR A;  5BR8 C;  4DR1 C;  3LUS A;  4ZLP A;  2ZM6 C;  3R9W A;  1XRA A;  2F4V C;  2Y4N A;  2CY1 A;  2VSQ A;  2OBV A;  3L8C A;  2E8E A;  4JI0 C;  4PZP A;  4IZ6 A;  4YY3 C;  4MH4 A;  3TUF A;  4BSZ A;  4LF9 C;  2BJO A;  4OYC A;  4X66 C;  3PBK A;  2XR1 A;  4RM2 A;  3T1Y C;  5KYT A;  3FCE A;  1O9T A;  1O92 A;  3R44 A;  3GR1 A;  5A19 A;  4KTT A;  2OPL B;  1N34 C;  4L2Z A;  4PHT A;  5A2Q D;  4DV5 C;  1PA4 A;  2PT7 G;  5BSW A;  4LF8 C;  4NOZ A;  5BSM A;  1MDF A;  4JI7 C;  5BUR A;  3DHV A;  5BUS A;  4G1I A;  2D1S A;  2ONF A;  1T5D X;  1RG9 A;  4BC7 A;  2E7G A;  1USP B;  3VNR A;  2V7B A;  1ULT A;  3NI2 A;  4RVN A;  2YCB A;  3GR0 A;  4D4I A;  5BSU A;  4NXM C;  2UUA C;  4GKK C;  3L95 X;  4LFB C;  4I9G A;  4AQY C;  2D27 A;  1V26 A;  1I94 C;  4I9F A;  2DPL A;  1KKG A;  4DV4 C;  3IML A;  2QW0 X;  1XMQ C;  3IEV A;  4DR4 C;  4LE5 A;  3PES A;  4K0K C;  4DR3 C;  4OXI A;  4XX2 A;  3AF6 A;  4L7I A;  1BA3 A;  3A9V A;  2P2B A;  3J81 D;  3N54 B;  5CZX A;  3UOW A;  2DYJ A;  3UZ0 A;  3J80 D;  3A4I A;  4R0M A;  4JYA C;  4B3M C;  2D1Q A;  4DCS A;  3VNQ A;  5JRH A;  1MD9 A;  2E0G A;  5AE2 A;  4RM3 A;  4RVO A;  1P7L A;  2UUB C;  1QWI A;  2QVX X;  4HPV A;  4EAT A;  1IBM C;  1MXA A;  5T8S A;  3NPD A;  2AYA A;  3VNS A;  3IEU A;  3E7W A;  2EGT A;  4JI5 C;  4U5Y D;  4BBY A;  3LNV A;  5BUQ A;  1EGA A;  4DCU A;  4JI4 C;  4DV6 C;  2D28 C;  2VQE C;  3R9X A;  1HNX C;  4FUQ A;  2VQF C;  4WS9 A;  1JOS A;  2E8F A;  1T5H X;  4DR6 C;  3CW8 X;  1MKY A;  2UXC C;  3AF5 A;  4LF6 C;  4X62 C;  4ISB A;  2OPL A;  1PG4 A;  2BH1 X;  1RY2 A;  3EQ6 A;  1XNR C;  3T1H C;  4LFC C;  4RLF A;  3PRO C;  3RG2 A;  5DV9 A;  4RMN A;  5FLX D;  4YHH C;  5KEI A;  2HJG A;  1J5E C;  2Y4O A;  4DV1 C;  1USP A;  1XRB A;  1MXB A;  2D7V A;  4OX9 C;  5IWA C;  3I08 A;  3N2Q A;  4DUZ C;  2ATW A;  3G7S A;  4NDN A;  2P02 A;  4D56 A;  3CJE A;  4X65 C;  1NYE A;  4B3T C;  4X64 C;  5GTD A;  1WF3 A;  1K0R A;  1O90 A;  2HHH C;  1N2F A;  4B3R C;  1LQL A;  4DG8 A;  4GXQ A;  3LAX A;  1YJ7 A;  4BC9 A;  4JI6 C;  5IFI A;  4DR2 C;  4JI1 C;  3GKU A;  1AMU A;  1IBL C;  2VZE A;  1V25 A;  4JV5 C;  3RV2 A;  4K0B A;  5K85 A;  5IT9 D;  4JI2 C;  5BSV A;  4NXN C;  3H2T A;  1ZB9 A;  4DR7 C;  2PN2 A;  2UUC C;  2Y27 A;  3JAM D;  1HR0 C;  4DR5 C;  2UU9 C;  1N33 C;  2P2M A;  1PG3 A;  5KYV A;  2QVZ X;  3DLP X;  1LCI A;  2KZF A;  1MXC A;  2E5L C;  4D4G A;  1ML8 A;  3OTO C;  4DCV A;  1FJG C;  2CXC A;  3S82 A;  5K8F A;  4DV3 C;  1FUG A;  4LFA C;  1HNZ C;  2UXD C;  4GS5 A;  5H9U A;  5BSR A;  4D57 A;  3IPL A;  4KHP C;  2P20 A;  3J7A D;  4RLQ A;  4B3S C;  4GXR A;  1VLA A;  1ZB8 A;  4DV0 C;  4FUT A;  5A1I A;  3GPC A;  4G37 A;  5AE3 A;  1XRC A;  4DV2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...