3JAMD

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3jamD01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3jamD02
1USPA 2JMPA 1N36C 4GKKC 2YCBA 1QWIA 1HH2P 1XMQC 2VQEC 4LFCC 2F4VC 4LF6C 2VQFC 4DV1C 3IEVA 4YY3C 4BSZA 4DR5C 3T1HC 4LF4C 4LFAC 2OPLA 4DR3C 4DR1C 2E7GA 2PT7G 4JYAC 4DUYC 1IBMC 1XNQC 4MH4A 4GKJC 4DCTA 1HNXC 2UXBC 3EERA 3J7AD 4LF8C 1JOSA 4JI5C 1HNWC 2UXCC 2UUAC 2PN2A 1WH9A 2E8EA 4DR2C 2EGTA 1ZB9A 4JI6C 4LF5C 4B3RC 3J81D 2ATWA 4NXMC 4DV2C 4B3TC 2OPLB 1I94C 2BJOA 4OX9C 1XMOC 3T1YC 4X65C 4DV4C 1HR0C 4LF9C 1KKGA 4JI8C 4LFBC 1N2FA 2E8FA 4LF7C 1J5EC 1ZB8A 2HJGA 2E5LC 4K0KC 1PA4A 5LMNC 4DR7C 2UXDC 4DV7C 4X64C 3CJEA 4DCUA 4JI0C 2ZM6C 5IWAC 5IT9D 2UUBC 4DUZC 4KHPC 3LUSA 5LMUC 1WF3A 4B3SC 2UUCC 4JI2C 1UKKA 3GKUA 4AQYC 1N33C 1ML8A 4DR6C 2E8CA 3I07A 4XX2A 2CXCA 1EGAA 1MKYA 2KZFA 2ASBA 1N32C 2XR1A 4DR4C 4DV5C 1XNRC 4NOZA 4DV6C 4X66C 3R9WA 2D7VA 4B3MC 3IEUA 4JI1C 2QL8A 4X62C 1K0RA 4JI4C 4NXNC 3JAMD 4JI7C 4DCVA 5BR8C 5A2QD 3AF6A 2UU9C 4DCSA 2CY1A 2HHHC 4DV0C 3OTOC 5FLXD 1NYEA 4JV5C 1IBLC 1FJGC 2DYJA 1HNZC 1IBKC 3R9XA 1LQLA 3AF5A 1USPB 1VLAA 1N34C 4DV3C 4JI3C 3J80D 1L2FA 2ONFA 4YHHC 4MTNA
chains in the Genus database with same CATH superfamily
3EQ6A 4GKKC 2YCBA 1XMQC 4FUTA 4LF6C 2D1TA 4YY3C 4K0BA 3GR1A 4TPSB 3KXWA 1AMUA 2OPLA 5DV9A 4R1MA 4DR1C 3AY0A 2Y27A 5BSWA 3LNVA 1XHJA 2MM9A 2YWBA 3DAYA 4ZJZA 2UUAC 1O93A 3N54B 4EATA 4B3RC 3NYQA 4IZ6A 4L4QA 4B3TC 1XMOC 3LNOA 3T1YC 1HR0C 1MXCA 4R1LA 2KDNA 2D1QA 4GXRA 1J5EC 1TH5A 2QW0X 2M5HA 2P20A 1YJ7A 3FM7A 1V25A 4IR7A 4D57A 4ZLPA 1M6XA 4OXIA 2ZM6C 4D4IA 1MD9A 1XS3A 4L2ZA 1WF3A 2Y4NA 3I08A 4D4GA 3GKUA 1N33C 1ML8A 4GS5A 4I9GA 3CQ2A 1EGAA 2KZFA 2VZEA 1N32C 2XR1A 2ZZNA 3E7XA 3IPLA 1M6XC 4NOZA 1O90A 5ADZA 3IEUA 5AE1A 4JI1C 2P02A 4X62C 4BBYA 5KEIA 3A4IA 4DCVA 5BR8C 3AF6A 4DG9A 4DCSA 3CQ1A 1MDFA 5A19A 3UX2A 1V60A 4PHTA 1MXBA 5JRHA 1FUGA 4PUIA 2JMPA 5KYTA 2F4VC 3FCEA 2VQFC 2D1RA 1NY8A 3FCCA 4RLQA 2WP0C 4RLFA 4DR5C 4LFAC 2ZTBA 1QM4A 3O2EA 4DR3C 4RM2A 2PT7G 1IBMC 1XNQC 3VNRA 2UXBC 4WV3A 2E8EA 4LF5C 2V7BA 2YWCA 1I94C 2BJOA 5CZVA 4OX9C 1MXAA 5A1GA 5IFIA 2P2MA 3UEBA 2D28C 3DLPX 4NDNA 2MCQA 2E8FA 2Z51A 4LF7C 2OBVA 1ZB8A 4OYCA 5LMNC 2UXDC 5BSUA 3L95X 3K6RA 4G37A 4D56A 1P7LA 1PU1A 5IWAC 1O92A 4R0MA 2UUCC 4RM3A 1PG3A 5T8SA 4BC7A 1MKYA 4X66C 2D7VA 2OO4A 4FTFA 3LAXA 2MMAB 2QL8A 1V26A 1MDBA 4JI4C 4L7IA 3GR0A 4BCAA 3RG2A 5E7QA 3TUFA 2CY1A 5FLXD 1NYEA 3CW9A 4DV3C 4JI3C 2ONFA 4YHHC 1N36C 2QVYX 4LFCC 1HH2P 2DHMA 4DV1C 3IEVA 3VNQA 4BSZA 1O9TA 4FUQA 1ULTA 1FLOA 3L8CA 4LF4C 4HPVA 2PROA 2Y4OA 2P2FA 2E7GA 4JYAC 1P4EC 3B7WA 4GKJC 3CW8X 4DCTA 3J7AD 4JM1A 4U5YD 1LCIA 4JI5C 2UXCC 4DR2C 4ISBA 3VNSA 1XRAA 2EGTA 4JI6C 2QVZX 3TQIA 3H2TA 3J81D 4ODJA 3GPCA 4NXMC 2M5OA 2OPLB 2AYAA 2DPLA 4X65C 1KKGA 4LFBC 1N2FA 2NCLA 2P2JA 5AE2A 3PBKA 2E5LC 4K0KC 1BA3A 4WS9A 1PA4A 4DR7C 3DHVA 4RVOA 4DV7C 4X64C 3TDEA 5GTDA 1PG4A 4DCUA 4JI0C 4KHPC 5BUSA 5BSMA 3G7SA 4JI2C 2P2QA 4AQYC 3PROC 1XDXA 4PUHA 4DR6C 3A9UA 2QVXX 4RMNA 4XX2A 2CXCA 2ASBA 3NYRA 1T5DX 4I9FA 4DR4C 4DV5C 4DV6C 3R9WA 4B3MC 4PUGA 2KZ0A 2JNVA 4NXNC 3JAMD 4JI7C 4BC9A 3NPDA 5A2QD 2HHHC 3OTOC 2DYJA 1IBKC 5BURA 3R9XA 3AF5A 3RV2A 1VLAA 3J80D 3UZ0A 1L2FA 4KTTA 4MTNA 1USPA 1QWIA 2E0GA 2PG1E 2VQEC 5A1IA 2CU6A 3IMLA 3T1HC 2ZZMA 1GPMA 3TR3A 3CQ3A 5K8FA 4DUYC 4LE5A 4MH4A 1HNXC 1XRBA 2YX1A 1T5HX 1RY2A 3EERA 4LF8C 1JOSA 1HNWC 1P4EA 3PESA 1WH9A 2PN2A 3UOWA 1ZB9A 5LCIA 5AE3A 2WD9A 4KTVA 3A26A 2P2BA 2D27A 5BSVA 4DV2C 3ETCA 3SO4A 3LGXA 1VEHA 4DV4C 4LF9C 4PZPA 4JI8C 2D1SA 1YGTA 4G36A 1IB8A 3A9VA 2HJGA 3NI2A 4PROC 5T8TA 3UX3A 5BSRA 3E7WA 2BH1X 3CJEA 5IT9D 5BSTA 4RVNA 2UUBC 4DUZC 3LUSA 5LMUC 4B3SC 1UWDA 1UKKA 3ETOA 5K85A 2E8CA 3I07A 4GXQA 1RG9A 5BUQA 1XNRC 5H9UA 4G1IA 1XRCA 3R44A 5KYVA 1K0RA 4DG8A 2UU9C 3S82A 4DV0C 3A25A 2VSQA 4JV5C 1IBLC 1FJGC 3N2QA 1HNZC 1LQLA 1USPB 1WCJA 3C5EA 1N34C 5CZXA 2ATWA
chains in the Genus database with same CATH topology
3EQ6A 4GKKC 2YCBA 1XMQC 4FUTA 4LF6C 2D1TA 4YY3C 4K0BA 3GR1A 4TPSB 3KXWA 1AMUA 2OPLA 5DV9A 4R1MA 4DR1C 2Y27A 5BSWA 3LNVA 2YWBA 3DAYA 4ZJZA 2UUAC 1O93A 3N54B 4EATA 4B3RC 3NYQA 4IZ6A 4L4QA 4B3TC 1XMOC 3T1YC 1HR0C 1MXCA 4R1LA 2D1QA 4GXRA 1J5EC 2QW0X 2P20A 1YJ7A 1V25A 4IR7A 4D57A 4ZLPA 4OXIA 2ZM6C 4D4IA 1MD9A 4L2ZA 1WF3A 2Y4NA 3I08A 4D4GA 3GKUA 1N33C 1ML8A 4GS5A 4I9GA 1EGAA 2KZFA 2VZEA 1N32C 2XR1A 3E7XA 3IPLA 4NOZA 1O90A 5ADZA 3IEUA 5AE1A 4JI1C 2P02A 4X62C 4BBYA 5KEIA 3A4IA 4DCVA 5BR8C 3AF6A 4DG9A 4DCSA 1MDFA 5A19A 4PHTA 1MXBA 5JRHA 1FUGA 2JMPA 5KYTA 2F4VC 3FCEA 2VQFC 2D1RA 3FCCA 4RLQA 2WP0C 4RLFA 4DR5C 4LFAC 1QM4A 4DR3C 4RM2A 2PT7G 1IBMC 1XNQC 3VNRA 2UXBC 4WV3A 2E8EA 4LF5C 2V7BA 2YWCA 1I94C 2BJOA 5CZVA 4OX9C 1MXAA 5A1GA 5IFIA 2P2MA 2D28C 3DLPX 4NDNA 2E8FA 4LF7C 2OBVA 1ZB8A 4OYCA 5LMNC 2UXDC 5BSUA 3L95X 4G37A 4D56A 1P7LA 5IWAC 1O92A 4R0MA 2UUCC 4RM3A 1PG3A 5T8SA 4BC7A 1MKYA 4X66C 2D7VA 2OO4A 4FTFA 3LAXA 2QL8A 1V26A 1MDBA 4JI4C 4L7IA 3GR0A 4BCAA 3RG2A 5E7QA 3TUFA 2CY1A 5FLXD 1NYEA 3CW9A 4DV3C 4JI3C 2ONFA 4YHHC 1N36C 2QVYX 4LFCC 1HH2P 4DV1C 3IEVA 3VNQA 4BSZA 1O9TA 4FUQA 1ULTA 3L8CA 4LF4C 4HPVA 2PROA 2Y4OA 2P2FA 2E7GA 4JYAC 3B7WA 4GKJC 3CW8X 4DCTA 3J7AD 4JM1A 4U5YD 1LCIA 4JI5C 2UXCC 4DR2C 4ISBA 3VNSA 1XRAA 2EGTA 4JI6C 2QVZX 3TQIA 3H2TA 3J81D 4ODJA 3GPCA 4NXMC 2OPLB 2AYAA 2DPLA 4X65C 1KKGA 4LFBC 1N2FA 2P2JA 5AE2A 3PBKA 2E5LC 4K0KC 1BA3A 4WS9A 1PA4A 4DR7C 3DHVA 4RVOA 4DV7C 4X64C 3TDEA 5GTDA 1PG4A 4DCUA 4JI0C 4KHPC 5BUSA 5BSMA 3G7SA 4JI2C 2P2QA 4AQYC 3PROC 4DR6C 3A9UA 2QVXX 4RMNA 4XX2A 2CXCA 2ASBA 3NYRA 1T5DX 4I9FA 4DR4C 4DV5C 4DV6C 3R9WA 4B3MC 4NXNC 3JAMD 4JI7C 4BC9A 3NPDA 5A2QD 2HHHC 3OTOC 2DYJA 1IBKC 5BURA 3R9XA 3AF5A 3RV2A 1VLAA 3J80D 3UZ0A 1L2FA 4KTTA 4MTNA 1USPA 1QWIA 2E0GA 2VQEC 5A1IA 3IMLA 3T1HC 1GPMA 5K8FA 4DUYC 4LE5A 4MH4A 1HNXC 1XRBA 3EERA 1T5HX 1RY2A 4LF8C 1JOSA 1HNWC 3PESA 1WH9A 2PN2A 3UOWA 1ZB9A 5AE3A 2WD9A 4KTVA 2P2BA 2D27A 5BSVA 4DV2C 3ETCA 3SO4A 3LGXA 4DV4C 4LF9C 4PZPA 4JI8C 2D1SA 4G36A 3A9VA 2HJGA 3NI2A 4PROC 5T8TA 5BSRA 3E7WA 2BH1X 3CJEA 5IT9D 5BSTA 4RVNA 2UUBC 4DUZC 3LUSA 5LMUC 4B3SC 1UKKA 3ETOA 5K85A 2E8CA 3I07A 4GXQA 1RG9A 5BUQA 1XNRC 5H9UA 4G1IA 1XRCA 3R44A 5KYVA 1K0RA 4DG8A 2UU9C 3S82A 4DV0C 2VSQA 4JV5C 1IBLC 1FJGC 3N2QA 1HNZC 1LQLA 1USPB 3C5EA 1N34C 5CZXA 2ATWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  2JMP A;  1N36 C;  4GKK C;  2YCB A;  1QWI A;  1HH2 P;  1XMQ C;  2VQE C;  4LFC C;  2F4V C;  4LF6 C;  2VQF C;  4DV1 C;  3IEV A;  4YY3 C;  4BSZ A;  4DR5 C;  3T1H C;  4LF4 C;  4LFA C;  2OPL A;  4DR3 C;  4DR1 C;  2E7G A;  2PT7 G;  4JYA C;  4DUY C;  1IBM C;  1XNQ C;  4MH4 A;  4GKJ C;  4DCT A;  1HNX C;  2UXB C;  3EER A;  3J7A D;  4LF8 C;  1JOS A;  4JI5 C;  1HNW C;  2UXC C;  2UUA C;  2PN2 A;  1WH9 A;  2E8E A;  4DR2 C;  2EGT A;  1ZB9 A;  4JI6 C;  4LF5 C;  4B3R C;  3J81 D;  2ATW A;  4NXM C;  4DV2 C;  4B3T C;  2OPL B;  1I94 C;  2BJO A;  4OX9 C;  1XMO C;  3T1Y C;  4X65 C;  4DV4 C;  1HR0 C;  4LF9 C;  1KKG A;  4JI8 C;  4LFB C;  1N2F A;  2E8F A;  4LF7 C;  1J5E C;  1ZB8 A;  2HJG A;  2E5L C;  4K0K C;  1PA4 A;  5LMN C;  4DR7 C;  2UXD C;  4DV7 C;  4X64 C;  3CJE A;  4DCU A;  4JI0 C;  2ZM6 C;  5IWA C;  5IT9 D;  2UUB C;  4DUZ C;  4KHP C;  3LUS A;  5LMU C;  1WF3 A;  4B3S C;  2UUC C;  4JI2 C;  1UKK A;  3GKU A;  4AQY C;  1N33 C;  1ML8 A;  4DR6 C;  2E8C A;  3I07 A;  4XX2 A;  2CXC A;  1EGA A;  1MKY A;  2KZF A;  2ASB A;  1N32 C;  2XR1 A;  4DR4 C;  4DV5 C;  1XNR C;  4NOZ A;  4DV6 C;  4X66 C;  3R9W A;  2D7V A;  4B3M C;  3IEU A;  4JI1 C;  2QL8 A;  4X62 C;  1K0R A;  4JI4 C;  4NXN C;  3JAM D;  4JI7 C;  4DCV A;  5BR8 C;  5A2Q D;  3AF6 A;  2UU9 C;  4DCS A;  2CY1 A;  2HHH C;  4DV0 C;  3OTO C;  5FLX D;  1NYE A;  4JV5 C;  1IBL C;  1FJG C;  2DYJ A;  1HNZ C;  1IBK C;  3R9X A;  1LQL A;  3AF5 A;  1USP B;  1VLA A;  1N34 C;  4DV3 C;  4JI3 C;  3J80 D;  1L2F A;  2ONF A;  4YHH C;  4MTN A; 
#chains in the Genus database with same CATH topology
 3EQ6 A;  4GKK C;  2YCB A;  1XMQ C;  4FUT A;  4LF6 C;  2D1T A;  4YY3 C;  4K0B A;  3GR1 A;  4TPS B;  3KXW A;  1AMU A;  2OPL A;  5DV9 A;  4R1M A;  4DR1 C;  3AY0 A;  2Y27 A;  5BSW A;  3LNV A;  1XHJ A;  2MM9 A;  2YWB A;  3DAY A;  4ZJZ A;  2UUA C;  1O93 A;  3N54 B;  4EAT A;  4B3R C;  3NYQ A;  4IZ6 A;  4L4Q A;  4B3T C;  1XMO C;  3LNO A;  3T1Y C;  1HR0 C;  1MXC A;  4R1L A;  2KDN A;  2D1Q A;  4GXR A;  1J5E C;  1TH5 A;  2QW0 X;  2M5H A;  2P20 A;  1YJ7 A;  3FM7 A;  1V25 A;  4IR7 A;  4D57 A;  4ZLP A;  1M6X A;  4OXI A;  2ZM6 C;  4D4I A;  1MD9 A;  1XS3 A;  4L2Z A;  1WF3 A;  2Y4N A;  3I08 A;  4D4G A;  3GKU A;  1N33 C;  1ML8 A;  4GS5 A;  4I9G A;  3CQ2 A;  1EGA A;  2KZF A;  2VZE A;  1N32 C;  2XR1 A;  2ZZN A;  3E7X A;  3IPL A;  1M6X C;  4NOZ A;  1O90 A;  5ADZ A;  3IEU A;  5AE1 A;  4JI1 C;  2P02 A;  4X62 C;  4BBY A;  5KEI A;  3A4I A;  4DCV A;  5BR8 C;  3AF6 A;  4DG9 A;  4DCS A;  3CQ1 A;  1MDF A;  5A19 A;  3UX2 A;  1V60 A;  4PHT A;  1MXB A;  5JRH A;  1FUG A;  4PUI A;  2JMP A;  5KYT A;  2F4V C;  3FCE A;  2VQF C;  2D1R A;  1NY8 A;  3FCC A;  4RLQ A;  2WP0 C;  4RLF A;  4DR5 C;  4LFA C;  2ZTB A;  1QM4 A;  3O2E A;  4DR3 C;  4RM2 A;  2PT7 G;  1IBM C;  1XNQ C;  3VNR A;  2UXB C;  4WV3 A;  2E8E A;  4LF5 C;  2V7B A;  2YWC A;  1I94 C;  2BJO A;  5CZV A;  4OX9 C;  1MXA A;  5A1G A;  5IFI A;  2P2M A;  3UEB A;  2D28 C;  3DLP X;  4NDN A;  2MCQ A;  2E8F A;  2Z51 A;  4LF7 C;  2OBV A;  1ZB8 A;  4OYC A;  5LMN C;  2UXD C;  5BSU A;  3L95 X;  3K6R A;  4G37 A;  4D56 A;  1P7L A;  1PU1 A;  5IWA C;  1O92 A;  4R0M A;  2UUC C;  4RM3 A;  1PG3 A;  5T8S A;  4BC7 A;  1MKY A;  4X66 C;  2D7V A;  2OO4 A;  4FTF A;  3LAX A;  2MMA B;  2QL8 A;  1V26 A;  1MDB A;  4JI4 C;  4L7I A;  3GR0 A;  4BCA A;  3RG2 A;  5E7Q A;  3TUF A;  2CY1 A;  5FLX D;  1NYE A;  3CW9 A;  4DV3 C;  4JI3 C;  2ONF A;  4YHH C;  1N36 C;  2QVY X;  4LFC C;  1HH2 P;  2DHM A;  4DV1 C;  3IEV A;  3VNQ A;  4BSZ A;  1O9T A;  4FUQ A;  1ULT A;  1FLO A;  3L8C A;  4LF4 C;  4HPV A;  2PRO A;  2Y4O A;  2P2F A;  2E7G A;  4JYA C;  1P4E C;  3B7W A;  4GKJ C;  3CW8 X;  4DCT A;  3J7A D;  4JM1 A;  4U5Y D;  1LCI A;  4JI5 C;  2UXC C;  4DR2 C;  4ISB A;  3VNS A;  1XRA A;  2EGT A;  4JI6 C;  2QVZ X;  3TQI A;  3H2T A;  3J81 D;  4ODJ A;  3GPC A;  4NXM C;  2M5O A;  2OPL B;  2AYA A;  2DPL A;  4X65 C;  1KKG A;  4LFB C;  1N2F A;  2NCL A;  2P2J A;  5AE2 A;  3PBK A;  2E5L C;  4K0K C;  1BA3 A;  4WS9 A;  1PA4 A;  4DR7 C;  3DHV A;  4RVO A;  4DV7 C;  4X64 C;  3TDE A;  5GTD A;  1PG4 A;  4DCU A;  4JI0 C;  4KHP C;  5BUS A;  5BSM A;  3G7S A;  4JI2 C;  2P2Q A;  4AQY C;  3PRO C;  1XDX A;  4PUH A;  4DR6 C;  3A9U A;  2QVX X;  4RMN A;  4XX2 A;  2CXC A;  2ASB A;  3NYR A;  1T5D X;  4I9F A;  4DR4 C;  4DV5 C;  4DV6 C;  3R9W A;  4B3M C;  4PUG A;  2KZ0 A;  2JNV A;  4NXN C;  3JAM D;  4JI7 C;  4BC9 A;  3NPD A;  5A2Q D;  2HHH C;  3OTO C;  2DYJ A;  1IBK C;  5BUR A;  3R9X A;  3AF5 A;  3RV2 A;  1VLA A;  3J80 D;  3UZ0 A;  1L2F A;  4KTT A;  4MTN A;  1USP A;  1QWI A;  2E0G A;  2PG1 E;  2VQE C;  5A1I A;  2CU6 A;  3IML A;  3T1H C;  2ZZM A;  1GPM A;  3TR3 A;  3CQ3 A;  5K8F A;  4DUY C;  4LE5 A;  4MH4 A;  1HNX C;  1XRB A;  2YX1 A;  1T5H X;  1RY2 A;  3EER A;  4LF8 C;  1JOS A;  1HNW C;  1P4E A;  3PES A;  1WH9 A;  2PN2 A;  3UOW A;  1ZB9 A;  5LCI A;  5AE3 A;  2WD9 A;  4KTV A;  3A26 A;  2P2B A;  2D27 A;  5BSV A;  4DV2 C;  3ETC A;  3SO4 A;  3LGX A;  1VEH A;  4DV4 C;  4LF9 C;  4PZP A;  4JI8 C;  2D1S A;  1YGT A;  4G36 A;  1IB8 A;  3A9V A;  2HJG A;  3NI2 A;  4PRO C;  5T8T A;  3UX3 A;  5BSR A;  3E7W A;  2BH1 X;  3CJE A;  5IT9 D;  5BST A;  4RVN A;  2UUB C;  4DUZ C;  3LUS A;  5LMU C;  4B3S C;  1UWD A;  1UKK A;  3ETO A;  5K85 A;  2E8C A;  3I07 A;  4GXQ A;  1RG9 A;  5BUQ A;  1XNR C;  5H9U A;  4G1I A;  1XRC A;  3R44 A;  5KYV A;  1K0R A;  4DG8 A;  2UU9 C;  3S82 A;  4DV0 C;  3A25 A;  2VSQ A;  4JV5 C;  1IBL C;  1FJG C;  3N2Q A;  1HNZ C;  1LQL A;  1USP B;  1WCJ A;  3C5E A;  1N34 C;  5CZX A;  2ATW A; 
#chains in the Genus database with same CATH homology
 3EQ6 A;  4GKK C;  2YCB A;  1XMQ C;  4FUT A;  4LF6 C;  2D1T A;  4YY3 C;  4K0B A;  3GR1 A;  4TPS B;  3KXW A;  1AMU A;  2OPL A;  5DV9 A;  4R1M A;  4DR1 C;  2Y27 A;  5BSW A;  3LNV A;  2YWB A;  3DAY A;  4ZJZ A;  2UUA C;  1O93 A;  3N54 B;  4EAT A;  4B3R C;  3NYQ A;  4IZ6 A;  4L4Q A;  4B3T C;  1XMO C;  3T1Y C;  1HR0 C;  1MXC A;  4R1L A;  2D1Q A;  4GXR A;  1J5E C;  2QW0 X;  2P20 A;  1YJ7 A;  1V25 A;  4IR7 A;  4D57 A;  4ZLP A;  4OXI A;  2ZM6 C;  4D4I A;  1MD9 A;  4L2Z A;  1WF3 A;  2Y4N A;  3I08 A;  4D4G A;  3GKU A;  1N33 C;  1ML8 A;  4GS5 A;  4I9G A;  1EGA A;  2KZF A;  2VZE A;  1N32 C;  2XR1 A;  3E7X A;  3IPL A;  4NOZ A;  1O90 A;  5ADZ A;  3IEU A;  5AE1 A;  4JI1 C;  2P02 A;  4X62 C;  4BBY A;  5KEI A;  3A4I A;  4DCV A;  5BR8 C;  3AF6 A;  4DG9 A;  4DCS A;  1MDF A;  5A19 A;  4PHT A;  1MXB A;  5JRH A;  1FUG A;  2JMP A;  5KYT A;  2F4V C;  3FCE A;  2VQF C;  2D1R A;  3FCC A;  4RLQ A;  2WP0 C;  4RLF A;  4DR5 C;  4LFA C;  1QM4 A;  4DR3 C;  4RM2 A;  2PT7 G;  1IBM C;  1XNQ C;  3VNR A;  2UXB C;  4WV3 A;  2E8E A;  4LF5 C;  2V7B A;  2YWC A;  1I94 C;  2BJO A;  5CZV A;  4OX9 C;  1MXA A;  5A1G A;  5IFI A;  2P2M A;  2D28 C;  3DLP X;  4NDN A;  2E8F A;  4LF7 C;  2OBV A;  1ZB8 A;  4OYC A;  5LMN C;  2UXD C;  5BSU A;  3L95 X;  4G37 A;  4D56 A;  1P7L A;  5IWA C;  1O92 A;  4R0M A;  2UUC C;  4RM3 A;  1PG3 A;  5T8S A;  4BC7 A;  1MKY A;  4X66 C;  2D7V A;  2OO4 A;  4FTF A;  3LAX A;  2QL8 A;  1V26 A;  1MDB A;  4JI4 C;  4L7I A;  3GR0 A;  4BCA A;  3RG2 A;  5E7Q A;  3TUF A;  2CY1 A;  5FLX D;  1NYE A;  3CW9 A;  4DV3 C;  4JI3 C;  2ONF A;  4YHH C;  1N36 C;  2QVY X;  4LFC C;  1HH2 P;  4DV1 C;  3IEV A;  3VNQ A;  4BSZ A;  1O9T A;  4FUQ A;  1ULT A;  3L8C A;  4LF4 C;  4HPV A;  2PRO A;  2Y4O A;  2P2F A;  2E7G A;  4JYA C;  3B7W A;  4GKJ C;  3CW8 X;  4DCT A;  3J7A D;  4JM1 A;  4U5Y D;  1LCI A;  4JI5 C;  2UXC C;  4DR2 C;  4ISB A;  3VNS A;  1XRA A;  2EGT A;  4JI6 C;  2QVZ X;  3TQI A;  3H2T A;  3J81 D;  4ODJ A;  3GPC A;  4NXM C;  2OPL B;  2AYA A;  2DPL A;  4X65 C;  1KKG A;  4LFB C;  1N2F A;  2P2J A;  5AE2 A;  3PBK A;  2E5L C;  4K0K C;  1BA3 A;  4WS9 A;  1PA4 A;  4DR7 C;  3DHV A;  4RVO A;  4DV7 C;  4X64 C;  3TDE A;  5GTD A;  1PG4 A;  4DCU A;  4JI0 C;  4KHP C;  5BUS A;  5BSM A;  3G7S A;  4JI2 C;  2P2Q A;  4AQY C;  3PRO C;  4DR6 C;  3A9U A;  2QVX X;  4RMN A;  4XX2 A;  2CXC A;  2ASB A;  3NYR A;  1T5D X;  4I9F A;  4DR4 C;  4DV5 C;  4DV6 C;  3R9W A;  4B3M C;  4NXN C;  3JAM D;  4JI7 C;  4BC9 A;  3NPD A;  5A2Q D;  2HHH C;  3OTO C;  2DYJ A;  1IBK C;  5BUR A;  3R9X A;  3AF5 A;  3RV2 A;  1VLA A;  3J80 D;  3UZ0 A;  1L2F A;  4KTT A;  4MTN A;  1USP A;  1QWI A;  2E0G A;  2VQE C;  5A1I A;  3IML A;  3T1H C;  1GPM A;  5K8F A;  4DUY C;  4LE5 A;  4MH4 A;  1HNX C;  1XRB A;  3EER A;  1T5H X;  1RY2 A;  4LF8 C;  1JOS A;  1HNW C;  3PES A;  1WH9 A;  2PN2 A;  3UOW A;  1ZB9 A;  5AE3 A;  2WD9 A;  4KTV A;  2P2B A;  2D27 A;  5BSV A;  4DV2 C;  3ETC A;  3SO4 A;  3LGX A;  4DV4 C;  4LF9 C;  4PZP A;  4JI8 C;  2D1S A;  4G36 A;  3A9V A;  2HJG A;  3NI2 A;  4PRO C;  5T8T A;  5BSR A;  3E7W A;  2BH1 X;  3CJE A;  5IT9 D;  5BST A;  4RVN A;  2UUB C;  4DUZ C;  3LUS A;  5LMU C;  4B3S C;  1UKK A;  3ETO A;  5K85 A;  2E8C A;  3I07 A;  4GXQ A;  1RG9 A;  5BUQ A;  1XNR C;  5H9U A;  4G1I A;  1XRC A;  3R44 A;  5KYV A;  1K0R A;  4DG8 A;  2UU9 C;  3S82 A;  4DV0 C;  2VSQ A;  4JV5 C;  1IBL C;  1FJG C;  3N2Q A;  1HNZ C;  1LQL A;  1USP B;  3C5E A;  1N34 C;  5CZX A;  2ATW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...