3JAMD

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
223
Chain Sequence
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVLEPSVKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 45
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
D PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3jamD01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3jamD02
2CY1A 5IT9D 1N36C 2F4VC 2VQEC 4MH4A 4JI2C 1XMOC 5BR8C 4DV3C 2E7GA 3T1HC 4B3TC 4NXNC 4NOZA 4LF7C 4JI6C 2PN2A 1USPA 2ASBA 5FLXD 5IWAC 4BSZA 4X66C 4DV6C 3J7AD 1XMQC 4JI0C 4DR1C 4DV0C 4LF9C 1MKYA 1JOSA 1N32C 2UXBC 4MTNA 4DR7C 3EERA 4DV7C 2JMPA 5LMNC 4JI8C 1N34C 3CJEA 2YCBA 2VQFC 2ATWA 4YHHC 4KHPC 1HNXC 4DR5C 2XR1A 4LF8C 4DV2C 1HR0C 4LF4C 4JI5C 3AF6A 5LMUC 1LQLA 2EGTA 1UKKA 4OX9C 3I07A 4JI1C 3T1YC 4DCVA 2ONFA 4DR6C 3R9WA 2E8FA 1WF3A 1L2FA 1QWIA 4DCSA 2ZM6C 4AQYC 1ZB8A 2QL8A 2OPLA 4DUZC 4DR4C 1J5EC 2UU9C 4GKKC 4DV4C 3OTOC 3AF5A 1IBKC 1IBLC 4LFAC 1HNWC 4X64C 1XNQC 1KKGA 1N2FA 4JI7C 1HNZC 2UUAC 1ML8A 4DR2C 4B3MC 4X65C 2E5LC 1EGAA 1I94C 1USPB 4DV5C 4B3RC 4X62C 3R9XA 2UXDC 2E8EA 2DYJA 1XNRC 4DCUA 1K0RA 3IEVA 2HJGA 4DR3C 4GKJC 1FJGC 1HH2P 4JI3C 4K0KC 2E8CA 2UUCC 4DCTA 3J81D 3IEUA 2BJOA 2UUBC 4LF6C 3LUSA 4LFBC 4NXMC 4JI4C 2HHHC 4YY3C 5A2QD 4JV5C 1VLAA 1NYEA 4XX2A 1N33C 1PA4A 4LFCC 2UXCC 2D7VA 1ZB9A 2KZFA 2OPLB 1WH9A 3GKUA 3J80D 4B3SC 4DUYC 2CXCA 4JYAC 4DV1C 1IBMC 2PT7G 3JAMD 4LF5C
chains in the Genus database with same CATH superfamily
4D4GA 3I08A 5A19A 5IT9D 4JI2C 1XMOC 3UOWA 4NXNC 2E7GA 4NOZA 4JI6C 2ASBA 5IWAC 3A9VA 4X66C 3L95X 1XS3A 5GTDA 1XRBA 1RY2A 2JMPA 2PROA 2QVYX 3PBKA 4YHHC 2AYAA 3DAYA 4JI5C 2Z51A 2EGTA 3PESA 3I07A 4JM1A 3FCCA 4DCVA 2YX1A 5CZXA 2ZM6C 1QWIA 4AQYC 2WP0C 4ZLPA 4DUZC 4DR4C 4GKKC 5BSWA 3OTOC 3AF5A 4LFAC 1HNWC 1KKGA 2UUAC 1V26A 5T8TA 4B3RC 2UXDC 2D28C 4WS9A 4RM3A 5AE3A 2ZTBA 3K6RA 3TDEA 3VNRA 5BSVA 2Y4OA 2UUCC 3DLPX 5IFIA 1V25A 2VSQA 2QVZX 4NXMC 2P2BA 4JI4C 1MD9A 1GPMA 4XX2A 1T5HX 4LFCC 2NCLA 4FUTA 5BSTA 2P2FA 3A26A 2OPLB 4B3SC 3NYQA 4RLFA 3UEBA 3JAMD 1VEHA 1XHJA 2CY1A 2D1RA 1P4EC 3TUFA 5A1GA 3AY0A 1MDFA 3GR0A 3FCEA 2BH1X 3T1HC 4B3TC 4IZ6A 3LAXA 4K0BA 1USPA 4OXIA 4BSZA 4DV6C 4BBYA 4DR1C 2P2JA 1MKYA 4GXRA 1JOSA 4DG9A 1PG3A 4MTNA 4HPVA 3LNVA 4DV7C 5LMNC 2KDNA 5BUQA 1XRCA 3CJEA 3O2EA 4KHPC 4DR5C 1HR0C 4LF4C 1UKKA 4JI1C 5DV9A 5LCIA 2ZZNA 2E0GA 2ONFA 4DR6C 4TPSB 3R9WA 1L2FA 2YWCA 5BSRA 1ZB8A 1MXBA 4FTFA 2P2MA 2D1TA 1J5EC 3L8CA 2UU9C 4D4IA 3LNOA 4G36A 5A1IA 1FUGA 1IBKC 1IBLC 1N2FA 4NDNA 4G1IA 1HNZC 1ML8A 4DR2C 4B3MC 2Y27A 4PUGA 1I94C 3GR1A 2QW0X 2QVXX 4GXQA 3R44A 2YWBA 4L7IA 3H2TA 3E7XA 2HJGA 4I9GA 2KZ0A 5T8SA 4K0KC 3IEUA 1M6XC 4LF6C 3IPLA 2M5HA 3LUSA 4ZJZA 3B7WA 4PZPA 1YGTA 2UXCC 2WD9A 3VNSA 1ZB9A 1MDBA 2DPLA 3J80D 4JYAC 2CXCA 4PHTA 3CW9A 1RG9A 5BURA 3N2QA 1IBMC 3TQIA 5KYTA 4LF5C 2V7BA 1PG4A 4KTVA 1N36C 2F4VC 2VQEC 3CQ1A 1T5DX 1ULTA 5BR8C 3FM7A 4D57A 2PN2A 5FLXD 3A25A 1XMQC 4R1MA 4DV0C 4RVOA 4LF9C 5K85A 1N32C 1P4EA 2UXBC 4D56A 4DR7C 3RV2A 1WCJA 4JI8C 1N34C 1HNXC 5ADZA 2XR1A 4DV2C 3CQ2A 3AF6A 1O93A 2CU6A 2D27A 2OBVA 4OX9C 3T1YC 4RLQA 5K8FA 1NY8A 3UZ0A 4R0MA 2E8FA 3UX3A 4DCSA 2OO4A 3E7WA 2QL8A 3G7SA 2PG1E 1MXAA 5AE1A 4RMNA 1AMUA 1XNQC 1O92A 4JI7C 3A4IA 3PROC 4X65C 2E5LC 1EGAA 2P20A 1USPB 5BSUA 4X62C 3CW8X 4FUQA 4ISBA 2JNVA 5AE2A 3SO4A 4R1LA 5KYVA 4DCUA 1K0RA 3NPDA 5H9UA 3IEVA 4DR3C 4GKJC 1FJGC 1QM4A 1HH2P 2E8CA 3NI2A 3ETOA 3VNQA 2BJOA 2UUBC 1YJ7A 3IMLA 3C5EA 4YY3C 1N33C 2P2QA 2MCQA 2D7VA 2KZFA 3DHVA 1WH9A 3N54B 4RVNA 4DG8A 1M6XA 3KXWA 5CZVA 1UWDA 1PU1A 5E7QA 2D1SA 4MH4A 1FLOA 4DV3C 4G37A 4OYCA 4LF7C 1O90A 4BCAA 3UX2A 3J7AD 4JI0C 2DHMA 2MMAB 2P02A 2D1QA 4EATA 4I9FA 3EERA 1LCIA 2YCBA 4BC7A 2VQFC 4WV3A 2ZZMA 2ATWA 1O9TA 4LF8C 4LE5A 5BSMA 5LMUC 1LQLA 1P7LA 2Y4NA 5JRHA 3EQ6A 4BC9A 5KEIA 1WF3A 2OPLA 4GS5A 4U5YD 4RM2A 3CQ3A 4DV4C 4X64C 3TR3A 3RG2A 3S82A 4DV5C 2M5OA 3R9XA 1MXCA 2E8EA 2DYJA 4PROC 1V60A 3LGXA 1XNRC 4KTTA 4PUIA 3A9UA 2MM9A 4JI3C 4L4QA 4DCTA 3NYRA 3J81D 3GPCA 4LFBC 4PUHA 2HHHC 1BA3A 5A2QD 4JV5C 1VLAA 5BUSA 1NYEA 1PA4A 2VZEA 1TH5A 3ETCA 1XRAA 4IR7A 1IB8A 1XDXA 3GKUA 4DUYC 4DV1C 4ODJA 2PT7G 4L2ZA
chains in the Genus database with same CATH topology
4D4GA 3I08A 5A19A 5IT9D 4JI2C 1XMOC 3UOWA 4NXNC 2E7GA 4NOZA 4JI6C 2ASBA 5IWAC 3A9VA 4X66C 3L95X 5GTDA 1XRBA 1RY2A 2JMPA 2PROA 2QVYX 3PBKA 4YHHC 2AYAA 3DAYA 4JI5C 2EGTA 3PESA 3I07A 4JM1A 3FCCA 4DCVA 2ZM6C 4AQYC 1QWIA 5CZXA 2WP0C 4ZLPA 4DUZC 4DR4C 4GKKC 5BSWA 3OTOC 3AF5A 4LFAC 1HNWC 1KKGA 2UUAC 1V26A 5T8TA 4B3RC 2UXDC 2D28C 4WS9A 4RM3A 5AE3A 3TDEA 3VNRA 5BSVA 2Y4OA 2UUCC 3DLPX 5IFIA 1V25A 2VSQA 2QVZX 4NXMC 2P2BA 4JI4C 1MD9A 1GPMA 4XX2A 1T5HX 4LFCC 4FUTA 5BSTA 2P2FA 2OPLB 4B3SC 3NYQA 4RLFA 3JAMD 2CY1A 2D1RA 3TUFA 5A1GA 1MDFA 3GR0A 3FCEA 2BH1X 3T1HC 4B3TC 4IZ6A 3LAXA 4K0BA 1USPA 4OXIA 4BSZA 4DV6C 4BBYA 4DR1C 2P2JA 1MKYA 4GXRA 1JOSA 4DG9A 1PG3A 4MTNA 4HPVA 3LNVA 4DV7C 5LMNC 5BUQA 1XRCA 3CJEA 4KHPC 4DR5C 1HR0C 4LF4C 1UKKA 4JI1C 5DV9A 2E0GA 2ONFA 4DR6C 4TPSB 3R9WA 1L2FA 2YWCA 5BSRA 1ZB8A 1MXBA 4FTFA 2P2MA 2D1TA 1J5EC 3L8CA 2UU9C 4D4IA 4G36A 5A1IA 1FUGA 1IBKC 1IBLC 1N2FA 4NDNA 4G1IA 1HNZC 1ML8A 4DR2C 4B3MC 2Y27A 1I94C 3GR1A 2QW0X 2QVXX 4GXQA 3R44A 2YWBA 4L7IA 3H2TA 3E7XA 2HJGA 4I9GA 5T8SA 4K0KC 3IEUA 4LF6C 3IPLA 3LUSA 4ZJZA 3B7WA 4PZPA 2UXCC 2WD9A 1ZB9A 3VNSA 1MDBA 2DPLA 3J80D 4JYAC 2CXCA 4PHTA 3CW9A 1RG9A 5BURA 3N2QA 1IBMC 3TQIA 5KYTA 4LF5C 2V7BA 1PG4A 4KTVA 1N36C 2F4VC 2VQEC 1T5DX 1ULTA 5BR8C 4D57A 2PN2A 5FLXD 1XMQC 4R1MA 4DV0C 4RVOA 4LF9C 5K85A 1N32C 2UXBC 4D56A 4DR7C 3RV2A 4JI8C 1N34C 1HNXC 5ADZA 2XR1A 4DV2C 3AF6A 1O93A 2D27A 2OBVA 4OX9C 3T1YC 4RLQA 5K8FA 3UZ0A 4R0MA 2E8FA 4DCSA 2OO4A 3E7WA 2QL8A 3G7SA 1MXAA 5AE1A 4RMNA 1AMUA 1XNQC 1O92A 4JI7C 3A4IA 3PROC 4X65C 2E5LC 1EGAA 2P20A 1USPB 5BSUA 4X62C 3CW8X 4FUQA 4ISBA 5AE2A 3SO4A 4R1LA 5KYVA 4DCUA 1K0RA 3NPDA 5H9UA 3IEVA 4DR3C 4GKJC 1FJGC 1QM4A 1HH2P 2E8CA 3NI2A 3ETOA 3VNQA 2BJOA 2UUBC 1YJ7A 3IMLA 3C5EA 4YY3C 1N33C 2P2QA 2D7VA 2KZFA 3DHVA 1WH9A 3N54B 4RVNA 4DG8A 3KXWA 5CZVA 5E7QA 2D1SA 4MH4A 4DV3C 4G37A 4OYCA 4LF7C 1O90A 4BCAA 3J7AD 4JI0C 2P02A 2D1QA 4EATA 4I9FA 3EERA 1LCIA 2YCBA 4BC7A 2VQFC 4WV3A 2ATWA 1O9TA 4LF8C 4LE5A 5BSMA 5LMUC 1LQLA 1P7LA 2Y4NA 5JRHA 3EQ6A 4BC9A 5KEIA 1WF3A 2OPLA 4GS5A 4U5YD 4RM2A 4DV4C 4X64C 3RG2A 3S82A 4DV5C 3R9XA 1MXCA 2E8EA 2DYJA 4PROC 3LGXA 1XNRC 4KTTA 3A9UA 4JI3C 4L4QA 4DCTA 3NYRA 3J81D 3GPCA 4LFBC 2HHHC 1BA3A 5A2QD 4JV5C 1VLAA 5BUSA 1NYEA 1PA4A 2VZEA 3ETCA 1XRAA 4IR7A 3GKUA 4DUYC 4DV1C 4ODJA 2PT7G 4L2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY1 A;  5IT9 D;  1N36 C;  2F4V C;  2VQE C;  4MH4 A;  4JI2 C;  1XMO C;  5BR8 C;  4DV3 C;  2E7G A;  3T1H C;  4B3T C;  4NXN C;  4NOZ A;  4LF7 C;  4JI6 C;  2PN2 A;  1USP A;  2ASB A;  5FLX D;  5IWA C;  4BSZ A;  4X66 C;  4DV6 C;  3J7A D;  1XMQ C;  4JI0 C;  4DR1 C;  4DV0 C;  4LF9 C;  1MKY A;  1JOS A;  1N32 C;  2UXB C;  4MTN A;  4DR7 C;  3EER A;  4DV7 C;  2JMP A;  5LMN C;  4JI8 C;  1N34 C;  3CJE A;  2YCB A;  2VQF C;  2ATW A;  4YHH C;  4KHP C;  1HNX C;  4DR5 C;  2XR1 A;  4LF8 C;  4DV2 C;  1HR0 C;  4LF4 C;  4JI5 C;  3AF6 A;  5LMU C;  1LQL A;  2EGT A;  1UKK A;  4OX9 C;  3I07 A;  4JI1 C;  3T1Y C;  4DCV A;  2ONF A;  4DR6 C;  3R9W A;  2E8F A;  1WF3 A;  1L2F A;  1QWI A;  4DCS A;  2ZM6 C;  4AQY C;  1ZB8 A;  2QL8 A;  2OPL A;  4DUZ C;  4DR4 C;  1J5E C;  2UU9 C;  4GKK C;  4DV4 C;  3OTO C;  3AF5 A;  1IBK C;  1IBL C;  4LFA C;  1HNW C;  4X64 C;  1XNQ C;  1KKG A;  1N2F A;  4JI7 C;  1HNZ C;  2UUA C;  1ML8 A;  4DR2 C;  4B3M C;  4X65 C;  2E5L C;  1EGA A;  1I94 C;  1USP B;  4DV5 C;  4B3R C;  4X62 C;  3R9X A;  2UXD C;  2E8E A;  2DYJ A;  1XNR C;  4DCU A;  1K0R A;  3IEV A;  2HJG A;  4DR3 C;  4GKJ C;  1FJG C;  1HH2 P;  4JI3 C;  4K0K C;  2E8C A;  2UUC C;  4DCT A;  3J81 D;  3IEU A;  2BJO A;  2UUB C;  4LF6 C;  3LUS A;  4LFB C;  4NXM C;  4JI4 C;  2HHH C;  4YY3 C;  5A2Q D;  4JV5 C;  1VLA A;  1NYE A;  4XX2 A;  1N33 C;  1PA4 A;  4LFC C;  2UXC C;  2D7V A;  1ZB9 A;  2KZF A;  2OPL B;  1WH9 A;  3GKU A;  3J80 D;  4B3S C;  4DUY C;  2CXC A;  4JYA C;  4DV1 C;  1IBM C;  2PT7 G;  3JAM D;  4LF5 C; 
#chains in the Genus database with same CATH topology
 4D4G A;  3I08 A;  5A19 A;  5IT9 D;  4JI2 C;  1XMO C;  3UOW A;  4NXN C;  2E7G A;  4NOZ A;  4JI6 C;  2ASB A;  5IWA C;  3A9V A;  4X66 C;  3L95 X;  1XS3 A;  5GTD A;  1XRB A;  1RY2 A;  2JMP A;  2PRO A;  2QVY X;  3PBK A;  4YHH C;  2AYA A;  3DAY A;  4JI5 C;  2Z51 A;  2EGT A;  3PES A;  3I07 A;  4JM1 A;  3FCC A;  4DCV A;  2YX1 A;  5CZX A;  2ZM6 C;  1QWI A;  4AQY C;  2WP0 C;  4ZLP A;  4DUZ C;  4DR4 C;  4GKK C;  5BSW A;  3OTO C;  3AF5 A;  4LFA C;  1HNW C;  1KKG A;  2UUA C;  1V26 A;  5T8T A;  4B3R C;  2UXD C;  2D28 C;  4WS9 A;  4RM3 A;  5AE3 A;  2ZTB A;  3K6R A;  3TDE A;  3VNR A;  5BSV A;  2Y4O A;  2UUC C;  3DLP X;  5IFI A;  1V25 A;  2VSQ A;  2QVZ X;  4NXM C;  2P2B A;  4JI4 C;  1MD9 A;  1GPM A;  4XX2 A;  1T5H X;  4LFC C;  2NCL A;  4FUT A;  5BST A;  2P2F A;  3A26 A;  2OPL B;  4B3S C;  3NYQ A;  4RLF A;  3UEB A;  3JAM D;  1VEH A;  1XHJ A;  2CY1 A;  2D1R A;  1P4E C;  3TUF A;  5A1G A;  3AY0 A;  1MDF A;  3GR0 A;  3FCE A;  2BH1 X;  3T1H C;  4B3T C;  4IZ6 A;  3LAX A;  4K0B A;  1USP A;  4OXI A;  4BSZ A;  4DV6 C;  4BBY A;  4DR1 C;  2P2J A;  1MKY A;  4GXR A;  1JOS A;  4DG9 A;  1PG3 A;  4MTN A;  4HPV A;  3LNV A;  4DV7 C;  5LMN C;  2KDN A;  5BUQ A;  1XRC A;  3CJE A;  3O2E A;  4KHP C;  4DR5 C;  1HR0 C;  4LF4 C;  1UKK A;  4JI1 C;  5DV9 A;  5LCI A;  2ZZN A;  2E0G A;  2ONF A;  4DR6 C;  4TPS B;  3R9W A;  1L2F A;  2YWC A;  5BSR A;  1ZB8 A;  1MXB A;  4FTF A;  2P2M A;  2D1T A;  1J5E C;  3L8C A;  2UU9 C;  4D4I A;  3LNO A;  4G36 A;  5A1I A;  1FUG A;  1IBK C;  1IBL C;  1N2F A;  4NDN A;  4G1I A;  1HNZ C;  1ML8 A;  4DR2 C;  4B3M C;  2Y27 A;  4PUG A;  1I94 C;  3GR1 A;  2QW0 X;  2QVX X;  4GXQ A;  3R44 A;  2YWB A;  4L7I A;  3H2T A;  3E7X A;  2HJG A;  4I9G A;  2KZ0 A;  5T8S A;  4K0K C;  3IEU A;  1M6X C;  4LF6 C;  3IPL A;  2M5H A;  3LUS A;  4ZJZ A;  3B7W A;  4PZP A;  1YGT A;  2UXC C;  2WD9 A;  3VNS A;  1ZB9 A;  1MDB A;  2DPL A;  3J80 D;  4JYA C;  2CXC A;  4PHT A;  3CW9 A;  1RG9 A;  5BUR A;  3N2Q A;  1IBM C;  3TQI A;  5KYT A;  4LF5 C;  2V7B A;  1PG4 A;  4KTV A;  1N36 C;  2F4V C;  2VQE C;  3CQ1 A;  1T5D X;  1ULT A;  5BR8 C;  3FM7 A;  4D57 A;  2PN2 A;  5FLX D;  3A25 A;  1XMQ C;  4R1M A;  4DV0 C;  4RVO A;  4LF9 C;  5K85 A;  1N32 C;  1P4E A;  2UXB C;  4D56 A;  4DR7 C;  3RV2 A;  1WCJ A;  4JI8 C;  1N34 C;  1HNX C;  5ADZ A;  2XR1 A;  4DV2 C;  3CQ2 A;  3AF6 A;  1O93 A;  2CU6 A;  2D27 A;  2OBV A;  4OX9 C;  3T1Y C;  4RLQ A;  5K8F A;  1NY8 A;  3UZ0 A;  4R0M A;  2E8F A;  3UX3 A;  4DCS A;  2OO4 A;  3E7W A;  2QL8 A;  3G7S A;  2PG1 E;  1MXA A;  5AE1 A;  4RMN A;  1AMU A;  1XNQ C;  1O92 A;  4JI7 C;  3A4I A;  3PRO C;  4X65 C;  2E5L C;  1EGA A;  2P20 A;  1USP B;  5BSU A;  4X62 C;  3CW8 X;  4FUQ A;  4ISB A;  2JNV A;  5AE2 A;  3SO4 A;  4R1L A;  5KYV A;  4DCU A;  1K0R A;  3NPD A;  5H9U A;  3IEV A;  4DR3 C;  4GKJ C;  1FJG C;  1QM4 A;  1HH2 P;  2E8C A;  3NI2 A;  3ETO A;  3VNQ A;  2BJO A;  2UUB C;  1YJ7 A;  3IML A;  3C5E A;  4YY3 C;  1N33 C;  2P2Q A;  2MCQ A;  2D7V A;  2KZF A;  3DHV A;  1WH9 A;  3N54 B;  4RVN A;  4DG8 A;  1M6X A;  3KXW A;  5CZV A;  1UWD A;  1PU1 A;  5E7Q A;  2D1S A;  4MH4 A;  1FLO A;  4DV3 C;  4G37 A;  4OYC A;  4LF7 C;  1O90 A;  4BCA A;  3UX2 A;  3J7A D;  4JI0 C;  2DHM A;  2MMA B;  2P02 A;  2D1Q A;  4EAT A;  4I9F A;  3EER A;  1LCI A;  2YCB A;  4BC7 A;  2VQF C;  4WV3 A;  2ZZM A;  2ATW A;  1O9T A;  4LF8 C;  4LE5 A;  5BSM A;  5LMU C;  1LQL A;  1P7L A;  2Y4N A;  5JRH A;  3EQ6 A;  4BC9 A;  5KEI A;  1WF3 A;  2OPL A;  4GS5 A;  4U5Y D;  4RM2 A;  3CQ3 A;  4DV4 C;  4X64 C;  3TR3 A;  3RG2 A;  3S82 A;  4DV5 C;  2M5O A;  3R9X A;  1MXC A;  2E8E A;  2DYJ A;  4PRO C;  1V60 A;  3LGX A;  1XNR C;  4KTT A;  4PUI A;  3A9U A;  2MM9 A;  4JI3 C;  4L4Q A;  4DCT A;  3NYR A;  3J81 D;  3GPC A;  4LFB C;  4PUH A;  2HHH C;  1BA3 A;  5A2Q D;  4JV5 C;  1VLA A;  5BUS A;  1NYE A;  1PA4 A;  2VZE A;  1TH5 A;  3ETC A;  1XRA A;  4IR7 A;  1IB8 A;  1XDX A;  3GKU A;  4DUY C;  4DV1 C;  4ODJ A;  2PT7 G;  4L2Z A; 
#chains in the Genus database with same CATH homology
 4D4G A;  3I08 A;  5A19 A;  5IT9 D;  4JI2 C;  1XMO C;  3UOW A;  4NXN C;  2E7G A;  4NOZ A;  4JI6 C;  2ASB A;  5IWA C;  3A9V A;  4X66 C;  3L95 X;  5GTD A;  1XRB A;  1RY2 A;  2JMP A;  2PRO A;  2QVY X;  3PBK A;  4YHH C;  2AYA A;  3DAY A;  4JI5 C;  2EGT A;  3PES A;  3I07 A;  4JM1 A;  3FCC A;  4DCV A;  2ZM6 C;  4AQY C;  1QWI A;  5CZX A;  2WP0 C;  4ZLP A;  4DUZ C;  4DR4 C;  4GKK C;  5BSW A;  3OTO C;  3AF5 A;  4LFA C;  1HNW C;  1KKG A;  2UUA C;  1V26 A;  5T8T A;  4B3R C;  2UXD C;  2D28 C;  4WS9 A;  4RM3 A;  5AE3 A;  3TDE A;  3VNR A;  5BSV A;  2Y4O A;  2UUC C;  3DLP X;  5IFI A;  1V25 A;  2VSQ A;  2QVZ X;  4NXM C;  2P2B A;  4JI4 C;  1MD9 A;  1GPM A;  4XX2 A;  1T5H X;  4LFC C;  4FUT A;  5BST A;  2P2F A;  2OPL B;  4B3S C;  3NYQ A;  4RLF A;  3JAM D;  2CY1 A;  2D1R A;  3TUF A;  5A1G A;  1MDF A;  3GR0 A;  3FCE A;  2BH1 X;  3T1H C;  4B3T C;  4IZ6 A;  3LAX A;  4K0B A;  1USP A;  4OXI A;  4BSZ A;  4DV6 C;  4BBY A;  4DR1 C;  2P2J A;  1MKY A;  4GXR A;  1JOS A;  4DG9 A;  1PG3 A;  4MTN A;  4HPV A;  3LNV A;  4DV7 C;  5LMN C;  5BUQ A;  1XRC A;  3CJE A;  4KHP C;  4DR5 C;  1HR0 C;  4LF4 C;  1UKK A;  4JI1 C;  5DV9 A;  2E0G A;  2ONF A;  4DR6 C;  4TPS B;  3R9W A;  1L2F A;  2YWC A;  5BSR A;  1ZB8 A;  1MXB A;  4FTF A;  2P2M A;  2D1T A;  1J5E C;  3L8C A;  2UU9 C;  4D4I A;  4G36 A;  5A1I A;  1FUG A;  1IBK C;  1IBL C;  1N2F A;  4NDN A;  4G1I A;  1HNZ C;  1ML8 A;  4DR2 C;  4B3M C;  2Y27 A;  1I94 C;  3GR1 A;  2QW0 X;  2QVX X;  4GXQ A;  3R44 A;  2YWB A;  4L7I A;  3H2T A;  3E7X A;  2HJG A;  4I9G A;  5T8S A;  4K0K C;  3IEU A;  4LF6 C;  3IPL A;  3LUS A;  4ZJZ A;  3B7W A;  4PZP A;  2UXC C;  2WD9 A;  1ZB9 A;  3VNS A;  1MDB A;  2DPL A;  3J80 D;  4JYA C;  2CXC A;  4PHT A;  3CW9 A;  1RG9 A;  5BUR A;  3N2Q A;  1IBM C;  3TQI A;  5KYT A;  4LF5 C;  2V7B A;  1PG4 A;  4KTV A;  1N36 C;  2F4V C;  2VQE C;  1T5D X;  1ULT A;  5BR8 C;  4D57 A;  2PN2 A;  5FLX D;  1XMQ C;  4R1M A;  4DV0 C;  4RVO A;  4LF9 C;  5K85 A;  1N32 C;  2UXB C;  4D56 A;  4DR7 C;  3RV2 A;  4JI8 C;  1N34 C;  1HNX C;  5ADZ A;  2XR1 A;  4DV2 C;  3AF6 A;  1O93 A;  2D27 A;  2OBV A;  4OX9 C;  3T1Y C;  4RLQ A;  5K8F A;  3UZ0 A;  4R0M A;  2E8F A;  4DCS A;  2OO4 A;  3E7W A;  2QL8 A;  3G7S A;  1MXA A;  5AE1 A;  4RMN A;  1AMU A;  1XNQ C;  1O92 A;  4JI7 C;  3A4I A;  3PRO C;  4X65 C;  2E5L C;  1EGA A;  2P20 A;  1USP B;  5BSU A;  4X62 C;  3CW8 X;  4FUQ A;  4ISB A;  5AE2 A;  3SO4 A;  4R1L A;  5KYV A;  4DCU A;  1K0R A;  3NPD A;  5H9U A;  3IEV A;  4DR3 C;  4GKJ C;  1FJG C;  1QM4 A;  1HH2 P;  2E8C A;  3NI2 A;  3ETO A;  3VNQ A;  2BJO A;  2UUB C;  1YJ7 A;  3IML A;  3C5E A;  4YY3 C;  1N33 C;  2P2Q A;  2D7V A;  2KZF A;  3DHV A;  1WH9 A;  3N54 B;  4RVN A;  4DG8 A;  3KXW A;  5CZV A;  5E7Q A;  2D1S A;  4MH4 A;  4DV3 C;  4G37 A;  4OYC A;  4LF7 C;  1O90 A;  4BCA A;  3J7A D;  4JI0 C;  2P02 A;  2D1Q A;  4EAT A;  4I9F A;  3EER A;  1LCI A;  2YCB A;  4BC7 A;  2VQF C;  4WV3 A;  2ATW A;  1O9T A;  4LF8 C;  4LE5 A;  5BSM A;  5LMU C;  1LQL A;  1P7L A;  2Y4N A;  5JRH A;  3EQ6 A;  4BC9 A;  5KEI A;  1WF3 A;  2OPL A;  4GS5 A;  4U5Y D;  4RM2 A;  4DV4 C;  4X64 C;  3RG2 A;  3S82 A;  4DV5 C;  3R9X A;  1MXC A;  2E8E A;  2DYJ A;  4PRO C;  3LGX A;  1XNR C;  4KTT A;  3A9U A;  4JI3 C;  4L4Q A;  4DCT A;  3NYR A;  3J81 D;  3GPC A;  4LFB C;  2HHH C;  1BA3 A;  5A2Q D;  4JV5 C;  1VLA A;  5BUS A;  1NYE A;  1PA4 A;  2VZE A;  3ETC A;  1XRA A;  4IR7 A;  3GKU A;  4DUY C;  4DV1 C;  4ODJ A;  2PT7 G;  4L2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...