4JI0C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji0C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji0C02
4LF6C 3R9WA 4YHHC 4JI3C 2VQEC 4DV7C 1J5EC 2E8CA 4JI1C 4K0KC 1N36C 4BSZA 2UU9C 4LF7C 2XR1A 4DCSA 3IEUA 2VQFC 4GKKC 4LFAC 4JI4C 1HR0C 1XNRC 4DR6C 4B3SC 2CY1A 2F4VC 1PA4A 2YCBA 4LF4C 4DR1C 4LFCC 1N32C 1HNZC 5IT9D 4NOZA 2OPLB 3R9XA 1ML8A 3J80D 4YY3C 1K0RA 4DR7C 4B3TC 4DUYC 1I94C 1WF3A 4MTNA 3CJEA 4DV1C 1HNXC 4JI7C 2UXDC 2ATWA 4DR2C 3OTOC 5LMUC 4AQYC 4X66C 2HJGA 1XNQC 4LFBC 2E8EA 4JV5C 1LQLA 1L2FA 4DV5C 2E8FA 2ASBA 1USPA 1N33C 2JMPA 4GKJC 2ZM6C 3J7AD 4DCUA 2PT7G 4MH4A 2DYJA 4DR5C 1XMQC 1JOSA 1XMOC 2QL8A 1EGAA 3T1HC 4DCVA 3JAMD 3T1YC 4DR3C 2CXCA 4DV6C 4XX2A 2E7GA 5IWAC 5LMNC 2UUCC 1KKGA 4OX9C 4DR4C 2OPLA 2UXBC 1N34C 1QWIA 2PN2A 1NYEA 4NXMC 4NXNC 5A2QD 4DUZC 5BR8C 4DV4C 4JI8C 3AF5A 1IBKC 2KZFA 4X65C 4JYAC 4DV0C 2D7VA 4JI6C 5FLXD 1IBLC 2BJOA 3GKUA 1WH9A 1UKKA 1IBMC 1VLAA 4JI2C 2UUBC 2E5LC 4KHPC 3LUSA 4DV3C 2ONFA 4X62C 1FJGC 3AF6A 4DCTA 4LF9C 4JI5C 2HHHC 4JI0C 3IEVA 4B3RC 1HH2P 4LF8C 4LF5C 1N2FA 1MKYA 2EGTA 3EERA 2UUAC 1ZB8A 1HNWC 1ZB9A 4B3MC 3J81D 4X64C 1USPB 2UXCC 4DV2C 3I07A
chains in the Genus database with same CATH superfamily
2P02A 4JI3C 1J5EC 2E8CA 1MDBA 2D1QA 3VNSA 5KEIA 4R0MA 2UU9C 4K0BA 4OYCA 2XR1A 3N2QA 2VQFC 4GKKC 1HR0C 2CY1A 2P2BA 5BSMA 4LF4C 4DR1C 4LFCC 5IT9D 3GPCA 5KYVA 3J80D 1K0RA 2D1TA 5T8SA 2P20A 3CJEA 3C5EA 4LFBC 2E8EA 2D28C 3CQ3A 5T8TA 3E7XA 5A1GA 2ASBA 1PU1A 1USPA 2ZM6C 3J7AD 4DCUA 4G1IA 5BSRA 2DYJA 1FLOA 4HPVA 3ETOA 2BH1X 1V26A 1EGAA 3T1HC 2ZZMA 4BBYA 3TR3A 4DV6C 2NCLA 3PROC 1O90A 1RG9A 1ULTA 5GTDA 2UXBC 1N34C 2PN2A 2YWCA 2ZZNA 4DUZC 3DLPX 2DHMA 3L8CA 2KZFA 5AE2A 5DV9A 4JI6C 1WH9A 2WP0C 3IPLA 2UUBC 1P4EA 3LUSA 2ONFA 4X62C 1NY8A 3AF6A 2D1SA 4JI5C 2HHHC 4FUTA 3L95X 1MKYA 1N2FA 3EERA 3EQ6A 1ZB8A 4FTFA 5BSTA 3H2TA 1USPB 2UXCC 3CW8X 3R9WA 5ADZA 5CZXA 2VQEC 4JI1C 4K0KC 5BSUA 4BSZA 2PROA 3A9UA 4DCSA 4RM3A 3IEUA 5E7QA 1XNRC 4B3SC 4WV3A 4NOZA 1XS3A 5H9UA 4DUYC 1WF3A 4MTNA 2AYAA 4RMNA 3O2EA 1HNXC 2JNVA 3LAXA 4JI7C 2UXDC 4NDNA 5BSVA 2Y27A 4DR2C 4WS9A 3OTOC 5LMUC 1XHJA 2P2QA 1XNQC 1LQLA 4ZJZA 1L2FA 1N33C 4GKJC 4RVNA 4R1MA 2PT7G 3FCEA 3VNQA 4KTVA 4DR5C 1JOSA 1XMOC 1IB8A 1MD9A 4DCVA 2V7BA 3T1YC 1QM4A 1O93A 4GS5A 5KYTA 2CXCA 5LCIA 5LMNC 1KKGA 2OPLA 1QWIA 1NYEA 4PUIA 4NXNC 5A2QD 4DV4C 3E7WA 3A25A 4D4GA 3GKUA 3NYRA 4OXIA 4JI2C 3DAYA 4IR7A 2E5LC 4KHPC 2MCQA 4PUGA 4DCTA 1YGTA 3CQ2A 1PG4A 3FM7A 1MXAA 5BUSA 3DHVA 2M5OA 4LF8C 4B3RC 3PESA 3B7WA 4BCAA 4DG9A 4PROC 5BSWA 2D27A 2ZTBA 5BUQA 3I07A 4LF6C 4RLQA 4YHHC 4DV7C 4BC7A 1N36C 1MDFA 1YJ7A 3IMLA 4LF7C 3ETCA 4LFAC 4DR6C 2F4VC 1PA4A 2VZEA 3AY0A 2YCBA 4I9GA 4IZ6A 2D1RA 4JM1A 3UEBA 2PG1E 2OPLB 4TPSB 3NPDA 1GPMA 4DR7C 1I94C 3GR1A 4RVOA 3I08A 4GXQA 3NI2A 4DV1C 5JRHA 3RV2A 3UZ0A 1RY2A 2ATWA 2QW0X 3S82A 4JV5C 3R44A 1LCIA 3FCCA 4R1LA 1XRCA 3N54B 4PZPA 2Z51A 4FUQA 1XMQC 2QL8A 4D56A 1XDXA 5CZVA 3KXWA 3JAMD 4DR3C 5IWAC 1T5HX 2UUCC 4OX9C 4ISBA 5BR8C 4JI8C 4JYAC 3PBKA 2D7VA 2CU6A 3GR0A 3LNVA 5FLXD 1IBLC 3RG2A 2VSQA 1VLAA 3A26A 3G7SA 4DV3C 1FJGC 2M5HA 3A4IA 4LF9C 2Y4OA 4DG8A 3LNOA 4LF5C 2EGTA 1ZB9A 1XRAA 4I9FA 3J81D 1AMUA 2KDNA 2MM9A 2YWBA 5AE1A 2P2JA 1VEHA 2P2MA 2DPLA 1V60A 1WCJA 4JI4C 1O92A 1T5DX 2YX1A 4D4IA 2QVYX 4G37A 1N32C 1HNZC 4U5YD 3UX3A 1ML8A 3R9XA 4YY3C 2OBVA 4L2ZA 3NYQA 1P4EC 4B3TC 3CW9A 4G36A 1M6XC 3SO4A 2QVXX 5A19A 3K6RA 1PG3A 1BA3A 1V25A 4RM2A 4AQYC 1MXBA 4X66C 2HJGA 1UWDA 4DV5C 2E8FA 4LE5A 2QVZX 2JMPA 5A1IA 1TH5A 5IFIA 4MH4A 4PUHA 1FUGA 5K8FA 2P2FA 2Y4NA 2E0GA 1P7LA 3LGXA 1M6XA 5BURA 3UOWA 3CQ1A 2E7GA 4XX2A 4BC9A 3TDEA 2KZ0A 3A9VA 4DR4C 4EATA 2OO4A 4NXMC 3AF5A 1XRBA 1IBKC 4X65C 4DV0C 5K85A 4L4QA 2WD9A 4GXRA 2BJOA 4ZLPA 2MMAB 1UKKA 1IBMC 3TUFA 1O9TA 3IEVA 4KTTA 4JI0C 3VNRA 4ODJA 1HH2P 4L7IA 4PHTA 5AE3A 1MXCA 2UUAC 1HNWC 3UX2A 4B3MC 4X64C 4D57A 3TQIA 4RLFA 4DV2C
chains in the Genus database with same CATH topology
2P02A 4JI3C 1J5EC 2E8CA 1MDBA 2D1QA 3VNSA 5KEIA 4R0MA 2UU9C 4K0BA 4OYCA 2XR1A 3N2QA 2VQFC 4GKKC 1HR0C 2CY1A 2P2BA 5BSMA 4LF4C 4DR1C 4LFCC 5IT9D 3GPCA 5KYVA 3J80D 1K0RA 2D1TA 5T8SA 2P20A 3CJEA 3C5EA 4LFBC 2E8EA 2D28C 5T8TA 3E7XA 5A1GA 2ASBA 1USPA 2ZM6C 3J7AD 4DCUA 4G1IA 5BSRA 2DYJA 4HPVA 3ETOA 2BH1X 1V26A 1EGAA 3T1HC 4BBYA 4DV6C 3PROC 1O90A 1RG9A 1ULTA 5GTDA 2UXBC 1N34C 2PN2A 2YWCA 4DUZC 3DLPX 3L8CA 2KZFA 5AE2A 5DV9A 4JI6C 1WH9A 2WP0C 3IPLA 2UUBC 3LUSA 2ONFA 4X62C 3AF6A 2D1SA 4JI5C 2HHHC 4FUTA 3L95X 1N2FA 1MKYA 3EERA 3EQ6A 1ZB8A 4FTFA 5BSTA 3H2TA 1USPB 2UXCC 3CW8X 3R9WA 5ADZA 5CZXA 2VQEC 4JI1C 4K0KC 5BSUA 4BSZA 2PROA 3A9UA 4DCSA 4RM3A 3IEUA 5E7QA 1XNRC 4B3SC 4WV3A 4NOZA 5H9UA 4DUYC 1WF3A 4MTNA 2AYAA 4RMNA 1HNXC 3LAXA 4JI7C 2UXDC 4NDNA 5BSVA 2Y27A 4DR2C 4WS9A 3OTOC 5LMUC 2P2QA 1XNQC 1LQLA 4ZJZA 1L2FA 1N33C 4GKJC 4RVNA 4R1MA 2PT7G 3FCEA 3VNQA 4KTVA 4DR5C 1JOSA 1XMOC 1MD9A 4DCVA 2V7BA 3T1YC 1QM4A 1O93A 4GS5A 2CXCA 5KYTA 5LMNC 1KKGA 2OPLA 1QWIA 1NYEA 4NXNC 5A2QD 4DV4C 3E7WA 4D4GA 3GKUA 3NYRA 4OXIA 4JI2C 3DAYA 4IR7A 2E5LC 4KHPC 4DCTA 1PG4A 1MXAA 3DHVA 5BUSA 4B3RC 4LF8C 3PESA 3B7WA 4BCAA 4DG9A 4PROC 5BSWA 2D27A 5BUQA 3I07A 4LF6C 4RLQA 4YHHC 4DV7C 4BC7A 1N36C 1MDFA 1YJ7A 3IMLA 4LF7C 3ETCA 4LFAC 4DR6C 2F4VC 1PA4A 2VZEA 2YCBA 4I9GA 4IZ6A 2D1RA 4JM1A 2OPLB 4TPSB 3NPDA 1GPMA 4DR7C 1I94C 3GR1A 4RVOA 3I08A 4GXQA 3NI2A 4DV1C 5JRHA 3RV2A 3UZ0A 1RY2A 2ATWA 2QW0X 3S82A 4JV5C 3R44A 1LCIA 3FCCA 4R1LA 1XRCA 3N54B 4PZPA 4FUQA 1XMQC 2QL8A 4D56A 5CZVA 3KXWA 3JAMD 4DR3C 5IWAC 1T5HX 2UUCC 4OX9C 4ISBA 5BR8C 4JI8C 4JYAC 3PBKA 2D7VA 3GR0A 3LNVA 5FLXD 1IBLC 3RG2A 2VSQA 1VLAA 3G7SA 4DV3C 1FJGC 3A4IA 4LF9C 2Y4OA 4DG8A 4LF5C 2EGTA 1ZB9A 1XRAA 4I9FA 3J81D 1AMUA 2YWBA 5AE1A 2P2JA 2P2MA 2DPLA 4JI4C 1O92A 1T5DX 4D4IA 2QVYX 4G37A 1N32C 1HNZC 4U5YD 3R9XA 1ML8A 4YY3C 2OBVA 4L2ZA 3NYQA 4B3TC 3CW9A 4G36A 3SO4A 2QVXX 5A19A 1PG3A 1BA3A 1V25A 4RM2A 4AQYC 1MXBA 4X66C 2HJGA 4DV5C 2E8FA 4LE5A 2QVZX 2JMPA 5A1IA 5IFIA 4MH4A 1FUGA 5K8FA 2P2FA 2Y4NA 2E0GA 1P7LA 3LGXA 5BURA 3UOWA 4XX2A 2E7GA 4BC9A 3TDEA 3A9VA 4DR4C 4EATA 2OO4A 4NXMC 3AF5A 1XRBA 1IBKC 4X65C 4DV0C 5K85A 4L4QA 2WD9A 4GXRA 2BJOA 4ZLPA 1UKKA 1IBMC 3TUFA 1O9TA 3IEVA 4KTTA 4JI0C 3VNRA 4ODJA 1HH2P 4L7IA 4PHTA 5AE3A 1MXCA 2UUAC 1HNWC 4B3MC 4X64C 4D57A 3TQIA 4RLFA 4DV2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 C;  3R9W A;  4YHH C;  4JI3 C;  2VQE C;  4DV7 C;  1J5E C;  2E8C A;  4JI1 C;  4K0K C;  1N36 C;  4BSZ A;  2UU9 C;  4LF7 C;  2XR1 A;  4DCS A;  3IEU A;  2VQF C;  4GKK C;  4LFA C;  4JI4 C;  1HR0 C;  1XNR C;  4DR6 C;  4B3S C;  2CY1 A;  2F4V C;  1PA4 A;  2YCB A;  4LF4 C;  4DR1 C;  4LFC C;  1N32 C;  1HNZ C;  5IT9 D;  4NOZ A;  2OPL B;  3R9X A;  1ML8 A;  3J80 D;  4YY3 C;  1K0R A;  4DR7 C;  4B3T C;  4DUY C;  1I94 C;  1WF3 A;  4MTN A;  3CJE A;  4DV1 C;  1HNX C;  4JI7 C;  2UXD C;  2ATW A;  4DR2 C;  3OTO C;  5LMU C;  4AQY C;  4X66 C;  2HJG A;  1XNQ C;  4LFB C;  2E8E A;  4JV5 C;  1LQL A;  1L2F A;  4DV5 C;  2E8F A;  2ASB A;  1USP A;  1N33 C;  2JMP A;  4GKJ C;  2ZM6 C;  3J7A D;  4DCU A;  2PT7 G;  4MH4 A;  2DYJ A;  4DR5 C;  1XMQ C;  1JOS A;  1XMO C;  2QL8 A;  1EGA A;  3T1H C;  4DCV A;  3JAM D;  3T1Y C;  4DR3 C;  2CXC A;  4DV6 C;  4XX2 A;  2E7G A;  5IWA C;  5LMN C;  2UUC C;  1KKG A;  4OX9 C;  4DR4 C;  2OPL A;  2UXB C;  1N34 C;  1QWI A;  2PN2 A;  1NYE A;  4NXM C;  4NXN C;  5A2Q D;  4DUZ C;  5BR8 C;  4DV4 C;  4JI8 C;  3AF5 A;  1IBK C;  2KZF A;  4X65 C;  4JYA C;  4DV0 C;  2D7V A;  4JI6 C;  5FLX D;  1IBL C;  2BJO A;  3GKU A;  1WH9 A;  1UKK A;  1IBM C;  1VLA A;  4JI2 C;  2UUB C;  2E5L C;  4KHP C;  3LUS A;  4DV3 C;  2ONF A;  4X62 C;  1FJG C;  3AF6 A;  4DCT A;  4LF9 C;  4JI5 C;  2HHH C;  4JI0 C;  3IEV A;  4B3R C;  1HH2 P;  4LF8 C;  4LF5 C;  1N2F A;  1MKY A;  2EGT A;  3EER A;  2UUA C;  1ZB8 A;  1HNW C;  1ZB9 A;  4B3M C;  3J81 D;  4X64 C;  1USP B;  2UXC C;  4DV2 C;  3I07 A; 
#chains in the Genus database with same CATH topology
 2P02 A;  4JI3 C;  1J5E C;  2E8C A;  1MDB A;  2D1Q A;  3VNS A;  5KEI A;  4R0M A;  2UU9 C;  4K0B A;  4OYC A;  2XR1 A;  3N2Q A;  2VQF C;  4GKK C;  1HR0 C;  2CY1 A;  2P2B A;  5BSM A;  4LF4 C;  4DR1 C;  4LFC C;  5IT9 D;  3GPC A;  5KYV A;  3J80 D;  1K0R A;  2D1T A;  5T8S A;  2P20 A;  3CJE A;  3C5E A;  4LFB C;  2E8E A;  2D28 C;  3CQ3 A;  5T8T A;  3E7X A;  5A1G A;  2ASB A;  1PU1 A;  1USP A;  2ZM6 C;  3J7A D;  4DCU A;  4G1I A;  5BSR A;  2DYJ A;  1FLO A;  4HPV A;  3ETO A;  2BH1 X;  1V26 A;  1EGA A;  3T1H C;  2ZZM A;  4BBY A;  3TR3 A;  4DV6 C;  2NCL A;  3PRO C;  1O90 A;  1RG9 A;  1ULT A;  5GTD A;  2UXB C;  1N34 C;  2PN2 A;  2YWC A;  2ZZN A;  4DUZ C;  3DLP X;  2DHM A;  3L8C A;  2KZF A;  5AE2 A;  5DV9 A;  4JI6 C;  1WH9 A;  2WP0 C;  3IPL A;  2UUB C;  1P4E A;  3LUS A;  2ONF A;  4X62 C;  1NY8 A;  3AF6 A;  2D1S A;  4JI5 C;  2HHH C;  4FUT A;  3L95 X;  1MKY A;  1N2F A;  3EER A;  3EQ6 A;  1ZB8 A;  4FTF A;  5BST A;  3H2T A;  1USP B;  2UXC C;  3CW8 X;  3R9W A;  5ADZ A;  5CZX A;  2VQE C;  4JI1 C;  4K0K C;  5BSU A;  4BSZ A;  2PRO A;  3A9U A;  4DCS A;  4RM3 A;  3IEU A;  5E7Q A;  1XNR C;  4B3S C;  4WV3 A;  4NOZ A;  1XS3 A;  5H9U A;  4DUY C;  1WF3 A;  4MTN A;  2AYA A;  4RMN A;  3O2E A;  1HNX C;  2JNV A;  3LAX A;  4JI7 C;  2UXD C;  4NDN A;  5BSV A;  2Y27 A;  4DR2 C;  4WS9 A;  3OTO C;  5LMU C;  1XHJ A;  2P2Q A;  1XNQ C;  1LQL A;  4ZJZ A;  1L2F A;  1N33 C;  4GKJ C;  4RVN A;  4R1M A;  2PT7 G;  3FCE A;  3VNQ A;  4KTV A;  4DR5 C;  1JOS A;  1XMO C;  1IB8 A;  1MD9 A;  4DCV A;  2V7B A;  3T1Y C;  1QM4 A;  1O93 A;  4GS5 A;  5KYT A;  2CXC A;  5LCI A;  5LMN C;  1KKG A;  2OPL A;  1QWI A;  1NYE A;  4PUI A;  4NXN C;  5A2Q D;  4DV4 C;  3E7W A;  3A25 A;  4D4G A;  3GKU A;  3NYR A;  4OXI A;  4JI2 C;  3DAY A;  4IR7 A;  2E5L C;  4KHP C;  2MCQ A;  4PUG A;  4DCT A;  1YGT A;  3CQ2 A;  1PG4 A;  3FM7 A;  1MXA A;  5BUS A;  3DHV A;  2M5O A;  4LF8 C;  4B3R C;  3PES A;  3B7W A;  4BCA A;  4DG9 A;  4PRO C;  5BSW A;  2D27 A;  2ZTB A;  5BUQ A;  3I07 A;  4LF6 C;  4RLQ A;  4YHH C;  4DV7 C;  4BC7 A;  1N36 C;  1MDF A;  1YJ7 A;  3IML A;  4LF7 C;  3ETC A;  4LFA C;  4DR6 C;  2F4V C;  1PA4 A;  2VZE A;  3AY0 A;  2YCB A;  4I9G A;  4IZ6 A;  2D1R A;  4JM1 A;  3UEB A;  2PG1 E;  2OPL B;  4TPS B;  3NPD A;  1GPM A;  4DR7 C;  1I94 C;  3GR1 A;  4RVO A;  3I08 A;  4GXQ A;  3NI2 A;  4DV1 C;  5JRH A;  3RV2 A;  3UZ0 A;  1RY2 A;  2ATW A;  2QW0 X;  3S82 A;  4JV5 C;  3R44 A;  1LCI A;  3FCC A;  4R1L A;  1XRC A;  3N54 B;  4PZP A;  2Z51 A;  4FUQ A;  1XMQ C;  2QL8 A;  4D56 A;  1XDX A;  5CZV A;  3KXW A;  3JAM D;  4DR3 C;  5IWA C;  1T5H X;  2UUC C;  4OX9 C;  4ISB A;  5BR8 C;  4JI8 C;  4JYA C;  3PBK A;  2D7V A;  2CU6 A;  3GR0 A;  3LNV A;  5FLX D;  1IBL C;  3RG2 A;  2VSQ A;  1VLA A;  3A26 A;  3G7S A;  4DV3 C;  1FJG C;  2M5H A;  3A4I A;  4LF9 C;  2Y4O A;  4DG8 A;  3LNO A;  4LF5 C;  2EGT A;  1ZB9 A;  1XRA A;  4I9F A;  3J81 D;  1AMU A;  2KDN A;  2MM9 A;  2YWB A;  5AE1 A;  2P2J A;  1VEH A;  2P2M A;  2DPL A;  1V60 A;  1WCJ A;  4JI4 C;  1O92 A;  1T5D X;  2YX1 A;  4D4I A;  2QVY X;  4G37 A;  1N32 C;  1HNZ C;  4U5Y D;  3UX3 A;  1ML8 A;  3R9X A;  4YY3 C;  2OBV A;  4L2Z A;  3NYQ A;  1P4E C;  4B3T C;  3CW9 A;  4G36 A;  1M6X C;  3SO4 A;  2QVX X;  5A19 A;  3K6R A;  1PG3 A;  1BA3 A;  1V25 A;  4RM2 A;  4AQY C;  1MXB A;  4X66 C;  2HJG A;  1UWD A;  4DV5 C;  2E8F A;  4LE5 A;  2QVZ X;  2JMP A;  5A1I A;  1TH5 A;  5IFI A;  4MH4 A;  4PUH A;  1FUG A;  5K8F A;  2P2F A;  2Y4N A;  2E0G A;  1P7L A;  3LGX A;  1M6X A;  5BUR A;  3UOW A;  3CQ1 A;  2E7G A;  4XX2 A;  4BC9 A;  3TDE A;  2KZ0 A;  3A9V A;  4DR4 C;  4EAT A;  2OO4 A;  4NXM C;  3AF5 A;  1XRB A;  1IBK C;  4X65 C;  4DV0 C;  5K85 A;  4L4Q A;  2WD9 A;  4GXR A;  2BJO A;  4ZLP A;  2MMA B;  1UKK A;  1IBM C;  3TUF A;  1O9T A;  3IEV A;  4KTT A;  4JI0 C;  3VNR A;  4ODJ A;  1HH2 P;  4L7I A;  4PHT A;  5AE3 A;  1MXC A;  2UUA C;  1HNW C;  3UX2 A;  4B3M C;  4X64 C;  4D57 A;  3TQI A;  4RLF A;  4DV2 C; 
#chains in the Genus database with same CATH homology
 2P02 A;  4JI3 C;  1J5E C;  2E8C A;  1MDB A;  2D1Q A;  3VNS A;  5KEI A;  4R0M A;  2UU9 C;  4K0B A;  4OYC A;  2XR1 A;  3N2Q A;  2VQF C;  4GKK C;  1HR0 C;  2CY1 A;  2P2B A;  5BSM A;  4LF4 C;  4DR1 C;  4LFC C;  5IT9 D;  3GPC A;  5KYV A;  3J80 D;  1K0R A;  2D1T A;  5T8S A;  2P20 A;  3CJE A;  3C5E A;  4LFB C;  2E8E A;  2D28 C;  5T8T A;  3E7X A;  5A1G A;  2ASB A;  1USP A;  2ZM6 C;  3J7A D;  4DCU A;  4G1I A;  5BSR A;  2DYJ A;  4HPV A;  3ETO A;  2BH1 X;  1V26 A;  1EGA A;  3T1H C;  4BBY A;  4DV6 C;  3PRO C;  1O90 A;  1RG9 A;  1ULT A;  5GTD A;  2UXB C;  1N34 C;  2PN2 A;  2YWC A;  4DUZ C;  3DLP X;  3L8C A;  2KZF A;  5AE2 A;  5DV9 A;  4JI6 C;  1WH9 A;  2WP0 C;  3IPL A;  2UUB C;  3LUS A;  2ONF A;  4X62 C;  3AF6 A;  2D1S A;  4JI5 C;  2HHH C;  4FUT A;  3L95 X;  1N2F A;  1MKY A;  3EER A;  3EQ6 A;  1ZB8 A;  4FTF A;  5BST A;  3H2T A;  1USP B;  2UXC C;  3CW8 X;  3R9W A;  5ADZ A;  5CZX A;  2VQE C;  4JI1 C;  4K0K C;  5BSU A;  4BSZ A;  2PRO A;  3A9U A;  4DCS A;  4RM3 A;  3IEU A;  5E7Q A;  1XNR C;  4B3S C;  4WV3 A;  4NOZ A;  5H9U A;  4DUY C;  1WF3 A;  4MTN A;  2AYA A;  4RMN A;  1HNX C;  3LAX A;  4JI7 C;  2UXD C;  4NDN A;  5BSV A;  2Y27 A;  4DR2 C;  4WS9 A;  3OTO C;  5LMU C;  2P2Q A;  1XNQ C;  1LQL A;  4ZJZ A;  1L2F A;  1N33 C;  4GKJ C;  4RVN A;  4R1M A;  2PT7 G;  3FCE A;  3VNQ A;  4KTV A;  4DR5 C;  1JOS A;  1XMO C;  1MD9 A;  4DCV A;  2V7B A;  3T1Y C;  1QM4 A;  1O93 A;  4GS5 A;  2CXC A;  5KYT A;  5LMN C;  1KKG A;  2OPL A;  1QWI A;  1NYE A;  4NXN C;  5A2Q D;  4DV4 C;  3E7W A;  4D4G A;  3GKU A;  3NYR A;  4OXI A;  4JI2 C;  3DAY A;  4IR7 A;  2E5L C;  4KHP C;  4DCT A;  1PG4 A;  1MXA A;  3DHV A;  5BUS A;  4B3R C;  4LF8 C;  3PES A;  3B7W A;  4BCA A;  4DG9 A;  4PRO C;  5BSW A;  2D27 A;  5BUQ A;  3I07 A;  4LF6 C;  4RLQ A;  4YHH C;  4DV7 C;  4BC7 A;  1N36 C;  1MDF A;  1YJ7 A;  3IML A;  4LF7 C;  3ETC A;  4LFA C;  4DR6 C;  2F4V C;  1PA4 A;  2VZE A;  2YCB A;  4I9G A;  4IZ6 A;  2D1R A;  4JM1 A;  2OPL B;  4TPS B;  3NPD A;  1GPM A;  4DR7 C;  1I94 C;  3GR1 A;  4RVO A;  3I08 A;  4GXQ A;  3NI2 A;  4DV1 C;  5JRH A;  3RV2 A;  3UZ0 A;  1RY2 A;  2ATW A;  2QW0 X;  3S82 A;  4JV5 C;  3R44 A;  1LCI A;  3FCC A;  4R1L A;  1XRC A;  3N54 B;  4PZP A;  4FUQ A;  1XMQ C;  2QL8 A;  4D56 A;  5CZV A;  3KXW A;  3JAM D;  4DR3 C;  5IWA C;  1T5H X;  2UUC C;  4OX9 C;  4ISB A;  5BR8 C;  4JI8 C;  4JYA C;  3PBK A;  2D7V A;  3GR0 A;  3LNV A;  5FLX D;  1IBL C;  3RG2 A;  2VSQ A;  1VLA A;  3G7S A;  4DV3 C;  1FJG C;  3A4I A;  4LF9 C;  2Y4O A;  4DG8 A;  4LF5 C;  2EGT A;  1ZB9 A;  1XRA A;  4I9F A;  3J81 D;  1AMU A;  2YWB A;  5AE1 A;  2P2J A;  2P2M A;  2DPL A;  4JI4 C;  1O92 A;  1T5D X;  4D4I A;  2QVY X;  4G37 A;  1N32 C;  1HNZ C;  4U5Y D;  3R9X A;  1ML8 A;  4YY3 C;  2OBV A;  4L2Z A;  3NYQ A;  4B3T C;  3CW9 A;  4G36 A;  3SO4 A;  2QVX X;  5A19 A;  1PG3 A;  1BA3 A;  1V25 A;  4RM2 A;  4AQY C;  1MXB A;  4X66 C;  2HJG A;  4DV5 C;  2E8F A;  4LE5 A;  2QVZ X;  2JMP A;  5A1I A;  5IFI A;  4MH4 A;  1FUG A;  5K8F A;  2P2F A;  2Y4N A;  2E0G A;  1P7L A;  3LGX A;  5BUR A;  3UOW A;  4XX2 A;  2E7G A;  4BC9 A;  3TDE A;  3A9V A;  4DR4 C;  4EAT A;  2OO4 A;  4NXM C;  3AF5 A;  1XRB A;  1IBK C;  4X65 C;  4DV0 C;  5K85 A;  4L4Q A;  2WD9 A;  4GXR A;  2BJO A;  4ZLP A;  1UKK A;  1IBM C;  3TUF A;  1O9T A;  3IEV A;  4KTT A;  4JI0 C;  3VNR A;  4ODJ A;  1HH2 P;  4L7I A;  4PHT A;  5AE3 A;  1MXC A;  2UUA C;  1HNW C;  4B3M C;  4X64 C;  4D57 A;  3TQI A;  4RLF A;  4DV2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...