4JI0C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji0C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji0C02
2EGTA 2HHHC 4LFAC 2CXCA 4DR5C 1XMOC 2BJOA 4JI6C 2E8EA 1XNQC 3JAMD 4B3MC 1HH2P 4MH4A 2KZFA 3R9XA 2JMPA 4NXNC 1J5EC 5IWAC 4DV6C 4LFCC 1ZB8A 4JI3C 1KKGA 4LF8C 3LUSA 1I94C 2VQFC 4X65C 1IBMC 1WF3A 1JOSA 2ZM6C 3EERA 1XMQC 1HNXC 4GKKC 4JI5C 1ML8A 4LF6C 2ASBA 1N32C 5A2QD 3AF5A 4DV2C 4KHPC 3AF6A 2D7VA 4DV1C 3GKUA 4JI1C 4B3TC 4DV4C 1EGAA 4YHHC 4LF4C 4K0KC 4DR4C 2E8FA 5BR8C 4BSZA 4AQYC 1HNWC 1N36C 5FLXD 4JI8C 3T1YC 4JI0C 1WH9A 4DV7C 4LF7C 4DR3C 1USPB 1VLAA 2UUAC 3J7AD 4DCTA 5LMUC 3CJEA 4DR7C 2UXBC 4DV5C 4X66C 4LF5C 4DR6C 1HR0C 2QL8A 3OTOC 2HJGA 4DR2C 3IEUA 4LFBC 1PA4A 4XX2A 4X62C 1K0RA 4NOZA 4DCUA 1IBLC 2E8CA 5LMNC 4NXMC 4DV3C 4DCSA 4B3RC 3T1HC 2UU9C 4DR1C 4DUZC 1UKKA 4YY3C 2OPLB 1N34C 4X64C 2F4VC 2ONFA 1N33C 1QWIA 4JI4C 1NYEA 1MKYA 2VQEC 4JI7C 1XNRC 2UUBC 1N2FA 4OX9C 4JI2C 3IEVA 3J80D 2OPLA 4JV5C 3R9WA 2UXCC 1USPA 1L2FA 2DYJA 2UXDC 1HNZC 2CY1A 2PT7G 1LQLA 4LF9C 2UUCC 2YCBA 4DUYC 1IBKC 4B3SC 4MTNA 2E7GA 3J81D 5IT9D 4DV0C 2PN2A 2XR1A 4DCVA 3I07A 2ATWA 4JYAC 1FJGC 4GKJC 1ZB9A 2E5LC
chains in the Genus database with same CATH superfamily
2EGTA 2HHHC 1XMOC 2BJOA 4JI6C 1HH2P 2D27A 5KEIA 3RV2A 4DV6C 2D1TA 1O92A 4PUGA 4L4QA 2ZM6C 1HNXC 3DLPX 4BC9A 3GR0A 2ASBA 4JI1C 4DV4C 4DR4C 3VNRA 3NYQA 4BSZA 3L8CA 5BR8C 4JI8C 2AYAA 2KZ0A 4ZLPA 1WH9A 4LF7C 1USPB 5A1GA 3J7AD 2ZZNA 2MMAB 2UXBC 4DV5C 1RY2A 2QL8A 2HJGA 4LFBC 3EQ6A 1PA4A 3FCEA 5GTDA 1K0RA 2WP0C 4FTFA 4NOZA 3SO4A 1ULTA 5AE3A 2UU9C 3O2EA 2BH1X 1N34C 1FLOA 3CQ1A 3DAYA 3R44A 1PG4A 3S82A 4JI7C 2UUBC 4PZPA 1N2FA 1M6XC 4JI2C 1L2FA 2DYJA 5BSUA 2D28C 4DUYC 1IBKC 4B3SC 1RG9A 1O93A 3IMLA 2PN2A 4DCVA 5A1IA 1YJ7A 1FJGC 3CW8X 4LE5A 3CQ3A 1ZB9A 4GXRA 1MXAA 5AE2A 2YX1A 1IB8A 1V60A 2D1RA 3JAMD 2P2MA 2Z51A 3R9XA 2JMPA 3VNSA 3PROC 5IWAC 5E7QA 4LFCC 4JI3C 1KKGA 2P2JA 2CU6A 4LF8C 1I94C 4X65C 3LAXA 1IBMC 2QVXX 1AMUA 4GKKC 3A9UA 4JI5C 4RM3A 5A2QD 4KHPC 2P02A 3NYRA 4RM2A 2WD9A 4DV1C 4B3TC 3PBKA 2M5HA 2E8FA 3ETCA 1HNWC 4R0MA 1N36C 4D56A 5BURA 5K85A 3T1YC 3A25A 3L95X 4DV7C 3UEBA 2M5OA 1QM4A 3LNVA 2Y4OA 3CJEA 2Y27A 2Y4NA 4LF5C 5BSVA 5BUSA 1HR0C 4KTTA 4DCUA 2MCQA 4PHTA 1IBLC 2E8CA 5BSRA 4WS9A 1P4EA 3IPLA 1UWDA 4DUZC 2JNVA 1UKKA 2YWBA 2F4VC 2ONFA 4OXIA 1NYEA 4L2ZA 1XNRC 1GPMA 2OO4A 1V26A 4ZJZA 5CZVA 4JV5C 4D4GA 3R9WA 2UXCC 1USPA 4G1IA 1LQLA 2UUCC 1XDXA 2E7GA 1MD9A 3A26A 4DV0C 3KXWA 2ATWA 3FM7A 3N2QA 4U5YD 4BC7A 5IFIA 4GS5A 2CXCA 2E8EA 1XNQC 2VZEA 2ZTBA 4MH4A 1WCJA 2KZFA 4NXNC 4R1LA 3UOWA 3FCCA 1ZB8A 5ADZA 1MXCA 2VSQA 2VQFC 2YWCA 3PESA 1MDFA 3H2TA 1JOSA 3E7WA 3EERA 3A4IA 1ML8A 4LF6C 1N32C 4BBYA 4TPSB 4DG9A 1O9TA 3AF6A 3GKUA 4OYCA 5AE1A 4WV3A 2D1SA 3ETOA 5FLXD 4RVNA 4JI0C 3RG2A 2UUAC 4EATA 4DCTA 5LMUC 4DR7C 5A19A 4DR6C 3OTOC 2D1QA 5T8TA 2MM9A 4FUQA 2NCLA 5LMNC 3C5EA 4NXMC 4DV3C 1YGTA 2KDNA 3T1HC 4DR1C 4BCAA 2P2FA 4R1MA 4YY3C 2OPLB 4GXQA 5LCIA 4RMNA 2DPLA 3TDEA 1O90A 1LCIA 2VQEC 4ODJA 1P7LA 4OX9C 1XRBA 3IEVA 3J80D 2OPLA 4HPVA 1MXBA 2UXDC 3LGXA 1HNZC 1T5DX 3G7SA 2YCBA 3CQ2A 4MTNA 3DHVA 5IT9D 2V7BA 4G36A 4RVOA 4IR7A 3I07A 1FUGA 3UZ0A 4D57A 2ZZMA 3TQIA 1P4EC 4LFAC 4I9FA 5KYVA 3B7WA 3VNQA 4DR5C 4K0BA 1TH5A 2P20A 1PG3A 4B3MC 1XS3A 2QVZX 3UX2A 1J5EC 1VEHA 2P2QA 1NY8A 5H9UA 2OBVA 1XRAA 3LUSA 4RLFA 4PROC 5BUQA 1WF3A 5BSMA 3TUFA 1XMQC 2PROA 5KYTA 3AF5A 5T8SA 4DV2C 2D7VA 5BSTA 4DG8A 1EGAA 4YHHC 4LF4C 3CW9A 4FUTA 4I9GA 4AQYC 1M6XA 3NPDA 3E7XA 4DR3C 1VLAA 1PU1A 1MDBA 2E0GA 4X66C 5CZXA 3GR1A 4KTVA 4NDNA 5DV9A 4DR2C 3IEUA 3NI2A 4L7IA 4XX2A 4X62C 1T5HX 2DHMA 4RLQA 3N54B 4B3RC 4DCSA 3TR3A 3AY0A 3K6RA 4X64C 4JM1A 1XRCA 1N33C 1QWIA 4IZ6A 1BA3A 4JI4C 1MKYA 2QW0X 3I08A 3A9VA 1V25A 3GPCA 5JRHA 1XHJA 2QVYX 4ISBA 2CY1A 4D4IA 2PG1E 2PT7G 4LF9C 4K0KC 3J81D 2XR1A 2P2BA 5BSWA 3LNOA 4PUIA 4JYAC 4PUHA 5K8FA 4GKJC 4G37A 3UX3A 2E5LC
chains in the Genus database with same CATH topology
2EGTA 2HHHC 1XMOC 2BJOA 4JI6C 1HH2P 2D27A 5KEIA 3RV2A 4DV6C 2D1TA 1O92A 4L4QA 2ZM6C 1HNXC 3DLPX 4BC9A 3GR0A 2ASBA 4JI1C 4DV4C 4DR4C 3VNRA 3NYQA 4BSZA 3L8CA 5BR8C 4JI8C 2AYAA 4ZLPA 1WH9A 4LF7C 1USPB 5A1GA 3J7AD 2UXBC 4DV5C 1RY2A 2QL8A 2HJGA 4LFBC 3EQ6A 1PA4A 3FCEA 5GTDA 1K0RA 2WP0C 4FTFA 4NOZA 3SO4A 1ULTA 5AE3A 2UU9C 2BH1X 1N34C 3DAYA 3R44A 1PG4A 3S82A 4JI7C 2UUBC 4PZPA 1N2FA 4JI2C 1L2FA 2DYJA 5BSUA 2D28C 4DUYC 1IBKC 4B3SC 1RG9A 1O93A 3IMLA 2PN2A 4DCVA 5A1IA 1YJ7A 1FJGC 3CW8X 4LE5A 1ZB9A 4GXRA 1MXAA 5AE2A 2D1RA 3JAMD 2P2MA 3R9XA 2JMPA 3VNSA 3PROC 5IWAC 5E7QA 4LFCC 4JI3C 1KKGA 2P2JA 4LF8C 1I94C 4X65C 3LAXA 1IBMC 2QVXX 1AMUA 4GKKC 3A9UA 4JI5C 4RM3A 5A2QD 4KHPC 2P02A 3NYRA 4RM2A 2WD9A 4DV1C 4B3TC 3PBKA 2E8FA 3ETCA 1HNWC 4R0MA 1N36C 4D56A 5BURA 5K85A 3T1YC 3L95X 4DV7C 1QM4A 3LNVA 2Y4OA 3CJEA 2Y27A 2Y4NA 4LF5C 5BSVA 5BUSA 1HR0C 4KTTA 4DCUA 4PHTA 1IBLC 2E8CA 5BSRA 4WS9A 3IPLA 4DUZC 1UKKA 2YWBA 2F4VC 2ONFA 4OXIA 1NYEA 4L2ZA 1XNRC 2OO4A 1GPMA 1V26A 4ZJZA 5CZVA 4JV5C 4D4GA 3R9WA 2UXCC 1USPA 4G1IA 1LQLA 2UUCC 2E7GA 1MD9A 4DV0C 3KXWA 2ATWA 3N2QA 4U5YD 4BC7A 5IFIA 4GS5A 2CXCA 2E8EA 1XNQC 2VZEA 4MH4A 2KZFA 4NXNC 4R1LA 3UOWA 3FCCA 1ZB8A 5ADZA 1MXCA 2VSQA 2VQFC 2YWCA 3PESA 1MDFA 3H2TA 1JOSA 3E7WA 3EERA 3A4IA 1ML8A 4LF6C 1N32C 4BBYA 4TPSB 4DG9A 1O9TA 3AF6A 3GKUA 4OYCA 5AE1A 4WV3A 2D1SA 3ETOA 5FLXD 4RVNA 4JI0C 3RG2A 2UUAC 4EATA 4DCTA 5LMUC 4DR7C 5A19A 4DR6C 3OTOC 2D1QA 5T8TA 4FUQA 5LMNC 3C5EA 4NXMC 4DV3C 3T1HC 4DR1C 4BCAA 2P2FA 4R1MA 4YY3C 2OPLB 4GXQA 4RMNA 2DPLA 3TDEA 1O90A 1LCIA 2VQEC 4ODJA 1P7LA 4OX9C 1XRBA 3IEVA 3J80D 2OPLA 4HPVA 1MXBA 2UXDC 3LGXA 1HNZC 1T5DX 3G7SA 2YCBA 4MTNA 5IT9D 3DHVA 2V7BA 4G36A 4RVOA 4IR7A 3I07A 1FUGA 3UZ0A 4D57A 3TQIA 4LFAC 4I9FA 5KYVA 3B7WA 3VNQA 4DR5C 4K0BA 2P20A 1PG3A 4B3MC 2QVZX 1J5EC 2P2QA 5H9UA 2OBVA 1XRAA 3LUSA 4RLFA 4PROC 5BUQA 1WF3A 5BSMA 3TUFA 1XMQC 2PROA 5KYTA 3AF5A 5T8SA 4DV2C 2D7VA 5BSTA 4DG8A 1EGAA 4YHHC 4LF4C 3CW9A 4FUTA 4I9GA 4AQYC 3NPDA 3E7XA 4DR3C 1VLAA 1MDBA 2E0GA 4X66C 5CZXA 3GR1A 4KTVA 4NDNA 5DV9A 4DR2C 3IEUA 3NI2A 4L7IA 4XX2A 4X62C 1T5HX 4RLQA 3N54B 4B3RC 4DCSA 4X64C 4JM1A 1XRCA 1N33C 1QWIA 4IZ6A 1BA3A 4JI4C 1MKYA 2QW0X 3I08A 3A9VA 1V25A 3GPCA 5JRHA 2QVYX 4ISBA 2CY1A 4D4IA 2PT7G 4LF9C 4K0KC 3J81D 2XR1A 2P2BA 5BSWA 4JYAC 5K8FA 4GKJC 4G37A 2E5LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGT A;  2HHH C;  4LFA C;  2CXC A;  4DR5 C;  1XMO C;  2BJO A;  4JI6 C;  2E8E A;  1XNQ C;  3JAM D;  4B3M C;  1HH2 P;  4MH4 A;  2KZF A;  3R9X A;  2JMP A;  4NXN C;  1J5E C;  5IWA C;  4DV6 C;  4LFC C;  1ZB8 A;  4JI3 C;  1KKG A;  4LF8 C;  3LUS A;  1I94 C;  2VQF C;  4X65 C;  1IBM C;  1WF3 A;  1JOS A;  2ZM6 C;  3EER A;  1XMQ C;  1HNX C;  4GKK C;  4JI5 C;  1ML8 A;  4LF6 C;  2ASB A;  1N32 C;  5A2Q D;  3AF5 A;  4DV2 C;  4KHP C;  3AF6 A;  2D7V A;  4DV1 C;  3GKU A;  4JI1 C;  4B3T C;  4DV4 C;  1EGA A;  4YHH C;  4LF4 C;  4K0K C;  4DR4 C;  2E8F A;  5BR8 C;  4BSZ A;  4AQY C;  1HNW C;  1N36 C;  5FLX D;  4JI8 C;  3T1Y C;  4JI0 C;  1WH9 A;  4DV7 C;  4LF7 C;  4DR3 C;  1USP B;  1VLA A;  2UUA C;  3J7A D;  4DCT A;  5LMU C;  3CJE A;  4DR7 C;  2UXB C;  4DV5 C;  4X66 C;  4LF5 C;  4DR6 C;  1HR0 C;  2QL8 A;  3OTO C;  2HJG A;  4DR2 C;  3IEU A;  4LFB C;  1PA4 A;  4XX2 A;  4X62 C;  1K0R A;  4NOZ A;  4DCU A;  1IBL C;  2E8C A;  5LMN C;  4NXM C;  4DV3 C;  4DCS A;  4B3R C;  3T1H C;  2UU9 C;  4DR1 C;  4DUZ C;  1UKK A;  4YY3 C;  2OPL B;  1N34 C;  4X64 C;  2F4V C;  2ONF A;  1N33 C;  1QWI A;  4JI4 C;  1NYE A;  1MKY A;  2VQE C;  4JI7 C;  1XNR C;  2UUB C;  1N2F A;  4OX9 C;  4JI2 C;  3IEV A;  3J80 D;  2OPL A;  4JV5 C;  3R9W A;  2UXC C;  1USP A;  1L2F A;  2DYJ A;  2UXD C;  1HNZ C;  2CY1 A;  2PT7 G;  1LQL A;  4LF9 C;  2UUC C;  2YCB A;  4DUY C;  1IBK C;  4B3S C;  4MTN A;  2E7G A;  3J81 D;  5IT9 D;  4DV0 C;  2PN2 A;  2XR1 A;  4DCV A;  3I07 A;  2ATW A;  4JYA C;  1FJG C;  4GKJ C;  1ZB9 A;  2E5L C; 
#chains in the Genus database with same CATH topology
 2EGT A;  2HHH C;  1XMO C;  2BJO A;  4JI6 C;  1HH2 P;  2D27 A;  5KEI A;  3RV2 A;  4DV6 C;  2D1T A;  1O92 A;  4PUG A;  4L4Q A;  2ZM6 C;  1HNX C;  3DLP X;  4BC9 A;  3GR0 A;  2ASB A;  4JI1 C;  4DV4 C;  4DR4 C;  3VNR A;  3NYQ A;  4BSZ A;  3L8C A;  5BR8 C;  4JI8 C;  2AYA A;  2KZ0 A;  4ZLP A;  1WH9 A;  4LF7 C;  1USP B;  5A1G A;  3J7A D;  2ZZN A;  2MMA B;  2UXB C;  4DV5 C;  1RY2 A;  2QL8 A;  2HJG A;  4LFB C;  3EQ6 A;  1PA4 A;  3FCE A;  5GTD A;  1K0R A;  2WP0 C;  4FTF A;  4NOZ A;  3SO4 A;  1ULT A;  5AE3 A;  2UU9 C;  3O2E A;  2BH1 X;  1N34 C;  1FLO A;  3CQ1 A;  3DAY A;  3R44 A;  1PG4 A;  3S82 A;  4JI7 C;  2UUB C;  4PZP A;  1N2F A;  1M6X C;  4JI2 C;  1L2F A;  2DYJ A;  5BSU A;  2D28 C;  4DUY C;  1IBK C;  4B3S C;  1RG9 A;  1O93 A;  3IML A;  2PN2 A;  4DCV A;  5A1I A;  1YJ7 A;  1FJG C;  3CW8 X;  4LE5 A;  3CQ3 A;  1ZB9 A;  4GXR A;  1MXA A;  5AE2 A;  2YX1 A;  1IB8 A;  1V60 A;  2D1R A;  3JAM D;  2P2M A;  2Z51 A;  3R9X A;  2JMP A;  3VNS A;  3PRO C;  5IWA C;  5E7Q A;  4LFC C;  4JI3 C;  1KKG A;  2P2J A;  2CU6 A;  4LF8 C;  1I94 C;  4X65 C;  3LAX A;  1IBM C;  2QVX X;  1AMU A;  4GKK C;  3A9U A;  4JI5 C;  4RM3 A;  5A2Q D;  4KHP C;  2P02 A;  3NYR A;  4RM2 A;  2WD9 A;  4DV1 C;  4B3T C;  3PBK A;  2M5H A;  2E8F A;  3ETC A;  1HNW C;  4R0M A;  1N36 C;  4D56 A;  5BUR A;  5K85 A;  3T1Y C;  3A25 A;  3L95 X;  4DV7 C;  3UEB A;  2M5O A;  1QM4 A;  3LNV A;  2Y4O A;  3CJE A;  2Y27 A;  2Y4N A;  4LF5 C;  5BSV A;  5BUS A;  1HR0 C;  4KTT A;  4DCU A;  2MCQ A;  4PHT A;  1IBL C;  2E8C A;  5BSR A;  4WS9 A;  1P4E A;  3IPL A;  1UWD A;  4DUZ C;  2JNV A;  1UKK A;  2YWB A;  2F4V C;  2ONF A;  4OXI A;  1NYE A;  4L2Z A;  1XNR C;  1GPM A;  2OO4 A;  1V26 A;  4ZJZ A;  5CZV A;  4JV5 C;  4D4G A;  3R9W A;  2UXC C;  1USP A;  4G1I A;  1LQL A;  2UUC C;  1XDX A;  2E7G A;  1MD9 A;  3A26 A;  4DV0 C;  3KXW A;  2ATW A;  3FM7 A;  3N2Q A;  4U5Y D;  4BC7 A;  5IFI A;  4GS5 A;  2CXC A;  2E8E A;  1XNQ C;  2VZE A;  2ZTB A;  4MH4 A;  1WCJ A;  2KZF A;  4NXN C;  4R1L A;  3UOW A;  3FCC A;  1ZB8 A;  5ADZ A;  1MXC A;  2VSQ A;  2VQF C;  2YWC A;  3PES A;  1MDF A;  3H2T A;  1JOS A;  3E7W A;  3EER A;  3A4I A;  1ML8 A;  4LF6 C;  1N32 C;  4BBY A;  4TPS B;  4DG9 A;  1O9T A;  3AF6 A;  3GKU A;  4OYC A;  5AE1 A;  4WV3 A;  2D1S A;  3ETO A;  5FLX D;  4RVN A;  4JI0 C;  3RG2 A;  2UUA C;  4EAT A;  4DCT A;  5LMU C;  4DR7 C;  5A19 A;  4DR6 C;  3OTO C;  2D1Q A;  5T8T A;  2MM9 A;  4FUQ A;  2NCL A;  5LMN C;  3C5E A;  4NXM C;  4DV3 C;  1YGT A;  2KDN A;  3T1H C;  4DR1 C;  4BCA A;  2P2F A;  4R1M A;  4YY3 C;  2OPL B;  4GXQ A;  5LCI A;  4RMN A;  2DPL A;  3TDE A;  1O90 A;  1LCI A;  2VQE C;  4ODJ A;  1P7L A;  4OX9 C;  1XRB A;  3IEV A;  3J80 D;  2OPL A;  4HPV A;  1MXB A;  2UXD C;  3LGX A;  1HNZ C;  1T5D X;  3G7S A;  2YCB A;  3CQ2 A;  4MTN A;  3DHV A;  5IT9 D;  2V7B A;  4G36 A;  4RVO A;  4IR7 A;  3I07 A;  1FUG A;  3UZ0 A;  4D57 A;  2ZZM A;  3TQI A;  1P4E C;  4LFA C;  4I9F A;  5KYV A;  3B7W A;  3VNQ A;  4DR5 C;  4K0B A;  1TH5 A;  2P20 A;  1PG3 A;  4B3M C;  1XS3 A;  2QVZ X;  3UX2 A;  1J5E C;  1VEH A;  2P2Q A;  1NY8 A;  5H9U A;  2OBV A;  1XRA A;  3LUS A;  4RLF A;  4PRO C;  5BUQ A;  1WF3 A;  5BSM A;  3TUF A;  1XMQ C;  2PRO A;  5KYT A;  3AF5 A;  5T8S A;  4DV2 C;  2D7V A;  5BST A;  4DG8 A;  1EGA A;  4YHH C;  4LF4 C;  3CW9 A;  4FUT A;  4I9G A;  4AQY C;  1M6X A;  3NPD A;  3E7X A;  4DR3 C;  1VLA A;  1PU1 A;  1MDB A;  2E0G A;  4X66 C;  5CZX A;  3GR1 A;  4KTV A;  4NDN A;  5DV9 A;  4DR2 C;  3IEU A;  3NI2 A;  4L7I A;  4XX2 A;  4X62 C;  1T5H X;  2DHM A;  4RLQ A;  3N54 B;  4B3R C;  4DCS A;  3TR3 A;  3AY0 A;  3K6R A;  4X64 C;  4JM1 A;  1XRC A;  1N33 C;  1QWI A;  4IZ6 A;  1BA3 A;  4JI4 C;  1MKY A;  2QW0 X;  3I08 A;  3A9V A;  1V25 A;  3GPC A;  5JRH A;  1XHJ A;  2QVY X;  4ISB A;  2CY1 A;  4D4I A;  2PG1 E;  2PT7 G;  4LF9 C;  4K0K C;  3J81 D;  2XR1 A;  2P2B A;  5BSW A;  3LNO A;  4PUI A;  4JYA C;  4PUH A;  5K8F A;  4GKJ C;  4G37 A;  3UX3 A;  2E5L C; 
#chains in the Genus database with same CATH homology
 2EGT A;  2HHH C;  1XMO C;  2BJO A;  4JI6 C;  1HH2 P;  2D27 A;  5KEI A;  3RV2 A;  4DV6 C;  2D1T A;  1O92 A;  4L4Q A;  2ZM6 C;  1HNX C;  3DLP X;  4BC9 A;  3GR0 A;  2ASB A;  4JI1 C;  4DV4 C;  4DR4 C;  3VNR A;  3NYQ A;  4BSZ A;  3L8C A;  5BR8 C;  4JI8 C;  2AYA A;  4ZLP A;  1WH9 A;  4LF7 C;  1USP B;  5A1G A;  3J7A D;  2UXB C;  4DV5 C;  1RY2 A;  2QL8 A;  2HJG A;  4LFB C;  3EQ6 A;  1PA4 A;  3FCE A;  5GTD A;  1K0R A;  2WP0 C;  4FTF A;  4NOZ A;  3SO4 A;  1ULT A;  5AE3 A;  2UU9 C;  2BH1 X;  1N34 C;  3DAY A;  3R44 A;  1PG4 A;  3S82 A;  4JI7 C;  2UUB C;  4PZP A;  1N2F A;  4JI2 C;  1L2F A;  2DYJ A;  5BSU A;  2D28 C;  4DUY C;  1IBK C;  4B3S C;  1RG9 A;  1O93 A;  3IML A;  2PN2 A;  4DCV A;  5A1I A;  1YJ7 A;  1FJG C;  3CW8 X;  4LE5 A;  1ZB9 A;  4GXR A;  1MXA A;  5AE2 A;  2D1R A;  3JAM D;  2P2M A;  3R9X A;  2JMP A;  3VNS A;  3PRO C;  5IWA C;  5E7Q A;  4LFC C;  4JI3 C;  1KKG A;  2P2J A;  4LF8 C;  1I94 C;  4X65 C;  3LAX A;  1IBM C;  2QVX X;  1AMU A;  4GKK C;  3A9U A;  4JI5 C;  4RM3 A;  5A2Q D;  4KHP C;  2P02 A;  3NYR A;  4RM2 A;  2WD9 A;  4DV1 C;  4B3T C;  3PBK A;  2E8F A;  3ETC A;  1HNW C;  4R0M A;  1N36 C;  4D56 A;  5BUR A;  5K85 A;  3T1Y C;  3L95 X;  4DV7 C;  1QM4 A;  3LNV A;  2Y4O A;  3CJE A;  2Y27 A;  2Y4N A;  4LF5 C;  5BSV A;  5BUS A;  1HR0 C;  4KTT A;  4DCU A;  4PHT A;  1IBL C;  2E8C A;  5BSR A;  4WS9 A;  3IPL A;  4DUZ C;  1UKK A;  2YWB A;  2F4V C;  2ONF A;  4OXI A;  1NYE A;  4L2Z A;  1XNR C;  2OO4 A;  1GPM A;  1V26 A;  4ZJZ A;  5CZV A;  4JV5 C;  4D4G A;  3R9W A;  2UXC C;  1USP A;  4G1I A;  1LQL A;  2UUC C;  2E7G A;  1MD9 A;  4DV0 C;  3KXW A;  2ATW A;  3N2Q A;  4U5Y D;  4BC7 A;  5IFI A;  4GS5 A;  2CXC A;  2E8E A;  1XNQ C;  2VZE A;  4MH4 A;  2KZF A;  4NXN C;  4R1L A;  3UOW A;  3FCC A;  1ZB8 A;  5ADZ A;  1MXC A;  2VSQ A;  2VQF C;  2YWC A;  3PES A;  1MDF A;  3H2T A;  1JOS A;  3E7W A;  3EER A;  3A4I A;  1ML8 A;  4LF6 C;  1N32 C;  4BBY A;  4TPS B;  4DG9 A;  1O9T A;  3AF6 A;  3GKU A;  4OYC A;  5AE1 A;  4WV3 A;  2D1S A;  3ETO A;  5FLX D;  4RVN A;  4JI0 C;  3RG2 A;  2UUA C;  4EAT A;  4DCT A;  5LMU C;  4DR7 C;  5A19 A;  4DR6 C;  3OTO C;  2D1Q A;  5T8T A;  4FUQ A;  5LMN C;  3C5E A;  4NXM C;  4DV3 C;  3T1H C;  4DR1 C;  4BCA A;  2P2F A;  4R1M A;  4YY3 C;  2OPL B;  4GXQ A;  4RMN A;  2DPL A;  3TDE A;  1O90 A;  1LCI A;  2VQE C;  4ODJ A;  1P7L A;  4OX9 C;  1XRB A;  3IEV A;  3J80 D;  2OPL A;  4HPV A;  1MXB A;  2UXD C;  3LGX A;  1HNZ C;  1T5D X;  3G7S A;  2YCB A;  4MTN A;  5IT9 D;  3DHV A;  2V7B A;  4G36 A;  4RVO A;  4IR7 A;  3I07 A;  1FUG A;  3UZ0 A;  4D57 A;  3TQI A;  4LFA C;  4I9F A;  5KYV A;  3B7W A;  3VNQ A;  4DR5 C;  4K0B A;  2P20 A;  1PG3 A;  4B3M C;  2QVZ X;  1J5E C;  2P2Q A;  5H9U A;  2OBV A;  1XRA A;  3LUS A;  4RLF A;  4PRO C;  5BUQ A;  1WF3 A;  5BSM A;  3TUF A;  1XMQ C;  2PRO A;  5KYT A;  3AF5 A;  5T8S A;  4DV2 C;  2D7V A;  5BST A;  4DG8 A;  1EGA A;  4YHH C;  4LF4 C;  3CW9 A;  4FUT A;  4I9G A;  4AQY C;  3NPD A;  3E7X A;  4DR3 C;  1VLA A;  1MDB A;  2E0G A;  4X66 C;  5CZX A;  3GR1 A;  4KTV A;  4NDN A;  5DV9 A;  4DR2 C;  3IEU A;  3NI2 A;  4L7I A;  4XX2 A;  4X62 C;  1T5H X;  4RLQ A;  3N54 B;  4B3R C;  4DCS A;  4X64 C;  4JM1 A;  1XRC A;  1N33 C;  1QWI A;  4IZ6 A;  1BA3 A;  4JI4 C;  1MKY A;  2QW0 X;  3I08 A;  3A9V A;  1V25 A;  3GPC A;  5JRH A;  2QVY X;  4ISB A;  2CY1 A;  4D4I A;  2PT7 G;  4LF9 C;  4K0K C;  3J81 D;  2XR1 A;  2P2B A;  5BSW A;  4JYA C;  5K8F A;  4GKJ C;  4G37 A;  2E5L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...