4JV5C

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4jv5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4jv5C02
1USPA 1LQLA 4LF9C 3R9WA 2HHHC 2E8CA 1KKGA 4DV6C 1IBLC 4K0KC 2E8FA 2ONFA 1JOSA 4DUZC 4X66C 1HNXC 1ML8A 2UU9C 5BR8C 2UUCC 3R9XA 1L2FA 4BSZA 4DR6C 1XNQC 1N2FA 1XMOC 2ASBA 4GKKC 4XX2A 2HJGA 4JI5C 4DR7C 2KZFA 4DCTA 4B3SC 2ATWA 1N33C 4DR5C 2BJOA 4LFBC 1FJGC 3CJEA 1HR0C 1N36C 2UXCC 4DR4C 3J80D 4JI1C 4YHHC 1WH9A 2UUBC 4JV5C 3J7AD 4B3TC 4JI2C 3AF6A 1XNRC 4OX9C 2JMPA 4JI8C 1EGAA 2CY1A 3GKUA 4MH4A 2OPLA 1QWIA 2UXDC 4B3MC 1USPB 5A2QD 4AQYC 1HNWC 5IWAC 4LF7C 4LFAC 1WF3A 4DV3C 4JI7C 3JAMD 4LF8C 4DV5C 2QL8A 1I94C 2XR1A 1N32C 3IEUA 2D7VA 1IBMC 1NYEA 4B3RC 4NXMC 4DR3C 4LF6C 4KHPC 1HNZC 1MKYA 4DUYC 2PN2A 5LMNC 4DCVA 5LMUC 2E5LC 2CXCA 4DV7C 4JI4C 4LFCC 4X64C 2VQFC 2UUAC 4GKJC 5IT9D 4X65C 4JYAC 2E7GA 4YY3C 4JI0C 4DV1C 3OTOC 1IBKC 1PA4A 1VLAA 1ZB9A 2DYJA 3IEVA 3T1YC 2E8EA 2PT7G 2EGTA 1HH2P 4LF5C 3LUSA 5FLXD 4DV0C 4DR2C 3EERA 4DV4C 4JI6C 4LF4C 2F4VC 4JI3C 3T1HC 1N34C 2VQEC 1J5EC 1K0RA 1UKKA 4X62C 4DV2C 3J81D 4NOZA 4DR1C 2YCBA 4DCUA 3I07A 2ZM6C 2OPLB 1ZB8A 2UXBC 4MTNA 3AF5A 4DCSA 4NXNC 1XMQC
chains in the Genus database with same CATH superfamily
4L7IA 4BBYA 1LQLA 4FUQA 2YWBA 2HHHC 1T5DX 1KKGA 4DV6C 4GXRA 4RLQA 3FM7A 5AE2A 3NYRA 4X66C 1ML8A 5BR8C 1PG3A 3A9UA 3LGXA 2P2BA 1O9TA 4BSZA 2HJGA 4BC7A 4RMNA 4KTTA 4DG9A 1WCJA 4WV3A 3CJEA 3KXWA 1N36C 3SO4A 4EATA 2Y27A 4PROC 3EQ6A 4JI8C 1MDBA 5A19A 1XHJA 1USPB 5KYVA 1HNWC 5AE1A 5IWAC 3O2EA 3N2QA 2YX1A 3JAMD 2P2FA 2QL8A 4L2ZA 4OYCA 2XR1A 3A4IA 2D7VA 1IBMC 4PUHA 4KHPC 4PUIA 5AE3A 4IZ6A 1HNZC 3GR1A 1V60A 4DCVA 5LMUC 2E5LC 1P7LA 4R0MA 2P02A 2QW0X 4X64C 1FUGA 2QVZX 1GPMA 4X65C 2ZZNA 3L95X 1UWDA 2E7GA 3TUFA 4JI0C 4DV1C 3VNQA 1VLAA 5CZXA 5JRHA 4ZLPA 2QVXX 2MCQA 2E8EA 3PESA 4RVNA 4RM2A 1NY8A 1V26A 4DR2C 5KYTA 2D28C 3T1HC 1N34C 4R1MA 4WS9A 1UKKA 4X62C 4DV2C 3I08A 2YCBA 3S82A 4ODJA 4TPSB 1ZB8A 1O93A 4MTNA 1IBKC 4B3MC 4JI6C 1USPA 4I9GA 3VNSA 2QVYX 3R9WA 3LAXA 3DAYA 5BSUA 1HNXC 2BH1X 3PBKA 4DR6C 3B7WA 1XNQC 1XMOC 2D27A 4XX2A 2M5OA 4JI5C 3RG2A 4DCTA 5ADZA 4DR5C 5K8FA 3NI2A 2BJOA 4K0BA 2P2MA 3UEBA 4LFBC 4JI1C 3E7WA 5BSVA 4HPVA 2UUBC 4B3TC 1XNRC 4OX9C 4D56A 2JNVA 2WP0C 5A2QD 4AQYC 2CU6A 1WF3A 1PU1A 4DV3C 1PG4A 4BC9A 1RY2A 2D1SA 3TDEA 1N32C 3IEUA 3LNOA 1NYEA 1MKYA 2P2JA 5T8SA 5A1GA 4OXIA 3TQIA 2KZ0A 4I9FA 3CQ3A 1PA4A 4D57A 3T1YC 1O90A 1XRAA 1TH5A 3IPLA 2EGTA 3LUSA 1MDFA 5FLXD 4DV0C 1M6XC 2D1RA 3EERA 4G1IA 2Y4NA 4DV4C 3CW9A 2F4VC 4BCAA 3LNVA 3UOWA 2OO4A 1MXBA 4DR1C 4DCUA 2NCLA 3I07A 4D4IA 3R44A 5H9UA 1XMQC 4DR7C 3CQ1A 5GTDA 3A26A 4LF9C 2WD9A 3DLPX 2V7BA 4DUZC 2UU9C 1AMUA 1O92A 4RM3A 2MM9A 3UZ0A 4U5YD 3R9XA 1N2FA 1QM4A 2ASBA 3L8CA 4GKKC 1YGTA 3N54B 1XRCA 1RG9A 2KZFA 4B3SC 1LCIA 1N33C 4G36A 1FJGC 3PROC 2UXCC 3ETCA 4DR4C 3J80D 3UX3A 4JV5C 4FTFA 2DHMA 2JMPA 3RV2A 1EGAA 2CY1A 4MH4A 2OPLA 1XS3A 2UXDC 1MD9A 5BSTA 2KDNA 3A25A 4JI7C 4DV5C 1I94C 2P20A 5IFIA 2Z51A 4NXMC 4DR3C 4LF6C 3AY0A 3G7SA 4DUYC 2PN2A 5LMNC 1IB8A 4DV7C 5BSWA 2M5HA 4RLFA 4NDNA 4DG8A 2MMAB 2UUAC 4JYAC 3VNRA 3NPDA 4YY3C 5E7QA 3NYQA 1FLOA 4PZPA 2D1TA 1P4EC 1HH2P 4LF5C 5DV9A 3DHVA 3FCCA 5BSMA 4LF4C 1P4EA 1V25A 1J5EC 2VQEC 1K0RA 1BA3A 4GS5A 2E0GA 4PUGA 3J81D 2ZTBA 1YJ7A 2OBVA 2OPLB 3GR0A 1XDXA 2UXBC 5KEIA 4DCSA 4NXNC 3CQ2A 3FCEA 2E8CA 1IBLC 4K0KC 2E8FA 2ONFA 1JOSA 2UUCC 4R1LA 1L2FA 2PROA 4L4QA 1T5HX 2P2QA 4D4GA 2ATWA 3ETOA 3TR3A 2D1QA 1HR0C 4KTVA 4FUTA 4YHHC 1WH9A 3J7AD 2YWCA 4JI2C 1VEHA 3AF6A 4RVOA 1XRBA 3GKUA 1QWIA 3H2TA 3UX2A 4LF7C 4LFAC 1ULTA 5CZVA 5BSRA 4LF8C 4B3RC 3IMLA 1MXAA 4ISBA 2ZZMA 2PG1E 3GPCA 1MXCA 4LE5A 4ZJZA 5LCIA 2VSQA 2CXCA 4JI4C 4LFCC 5BURA 2VQFC 4GKJC 5K85A 4GXQA 3C5EA 5IT9D 3OTOC 2DYJA 1ZB9A 3IEVA 4PHTA 3K6RA 3A9VA 4IR7A 2PT7G 2Y4OA 3CW8X 4JM1A 1M6XA 5BUSA 4JI3C 4G37A 2AYAA 2VZEA 5A1IA 5T8TA 4NOZA 3E7XA 2ZM6C 5BUQA 2DPLA 3AF5A
chains in the Genus database with same CATH topology
4L7IA 4BBYA 1LQLA 4FUQA 2YWBA 2HHHC 1T5DX 1KKGA 4DV6C 4GXRA 4RLQA 5AE2A 3NYRA 4X66C 1ML8A 5BR8C 1PG3A 3A9UA 3LGXA 2P2BA 1O9TA 4BSZA 2HJGA 4BC7A 4RMNA 4KTTA 4DG9A 4WV3A 3CJEA 3KXWA 1N36C 3SO4A 4EATA 2Y27A 4PROC 3EQ6A 4JI8C 1MDBA 5A19A 1USPB 5KYVA 1HNWC 5AE1A 5IWAC 3N2QA 3JAMD 2P2FA 2QL8A 4L2ZA 4OYCA 2XR1A 3A4IA 2D7VA 1IBMC 4KHPC 5AE3A 4IZ6A 1HNZC 3GR1A 4DCVA 5LMUC 2E5LC 1P7LA 4R0MA 2P02A 2QW0X 4X64C 1FUGA 2QVZX 1GPMA 4X65C 3L95X 2E7GA 3TUFA 4JI0C 4DV1C 3VNQA 1VLAA 5CZXA 5JRHA 4ZLPA 2QVXX 2E8EA 3PESA 4RVNA 4RM2A 1V26A 4DR2C 5KYTA 2D28C 3T1HC 1N34C 4R1MA 4WS9A 1UKKA 4X62C 4DV2C 3I08A 2YCBA 3S82A 4ODJA 4TPSB 1ZB8A 1O93A 1IBKC 4JI6C 4B3MC 4MTNA 1USPA 4I9GA 3VNSA 2QVYX 3R9WA 3LAXA 3DAYA 5BSUA 1HNXC 2BH1X 3PBKA 4DR6C 3B7WA 1XNQC 1XMOC 2D27A 4XX2A 4JI5C 3RG2A 4DCTA 5ADZA 4DR5C 5K8FA 3NI2A 2BJOA 4K0BA 2P2MA 4LFBC 4JI1C 3E7WA 5BSVA 4HPVA 2UUBC 4B3TC 1XNRC 4OX9C 4D56A 2WP0C 5A2QD 4AQYC 1WF3A 4DV3C 1PG4A 4BC9A 1RY2A 2D1SA 3TDEA 1N32C 3IEUA 1NYEA 1MKYA 2P2JA 5T8SA 5A1GA 4OXIA 3TQIA 4I9FA 1PA4A 4D57A 3T1YC 1O90A 1XRAA 3IPLA 2EGTA 3LUSA 1MDFA 5FLXD 4DV0C 2D1RA 3EERA 4G1IA 2Y4NA 4DV4C 3CW9A 2F4VC 4BCAA 3LNVA 3UOWA 2OO4A 1MXBA 4DR1C 4DCUA 3I07A 4D4IA 3R44A 5H9UA 1XMQC 4DR7C 5GTDA 4LF9C 2WD9A 3DLPX 2V7BA 4DUZC 2UU9C 1AMUA 1O92A 4RM3A 3UZ0A 4U5YD 3R9XA 1N2FA 1QM4A 2ASBA 3L8CA 4GKKC 3N54B 1XRCA 1RG9A 4B3SC 2KZFA 1LCIA 1N33C 4G36A 1FJGC 3PROC 2UXCC 3ETCA 4DR4C 3J80D 4JV5C 4FTFA 2JMPA 3RV2A 1EGAA 2CY1A 4MH4A 2OPLA 2UXDC 1MD9A 5BSTA 4JI7C 4DV5C 1I94C 2P20A 5IFIA 4NXMC 4DR3C 4LF6C 3G7SA 4DUYC 2PN2A 5LMNC 4DV7C 5BSWA 4RLFA 4DG8A 4NDNA 2UUAC 4JYAC 3VNRA 3NPDA 4YY3C 5E7QA 3NYQA 4PZPA 2D1TA 1HH2P 4LF5C 5DV9A 3DHVA 3FCCA 5BSMA 4LF4C 1V25A 1J5EC 2VQEC 1K0RA 1BA3A 4GS5A 2E0GA 3J81D 1YJ7A 2OBVA 2OPLB 3GR0A 2UXBC 5KEIA 4DCSA 4NXNC 3FCEA 2E8CA 1IBLC 4K0KC 2E8FA 2ONFA 1JOSA 2UUCC 4R1LA 1L2FA 2PROA 4L4QA 1T5HX 2P2QA 4D4GA 2ATWA 3ETOA 2D1QA 1HR0C 4KTVA 4FUTA 4YHHC 1WH9A 3J7AD 2YWCA 4JI2C 3AF6A 4RVOA 1XRBA 3GKUA 1QWIA 3H2TA 4LF7C 4LFAC 1ULTA 5CZVA 5BSRA 4LF8C 4B3RC 3IMLA 1MXAA 4ISBA 3GPCA 1MXCA 4LE5A 4ZJZA 2VSQA 2CXCA 4JI4C 4LFCC 5BURA 2VQFC 4GKJC 5K85A 4GXQA 3C5EA 5IT9D 3OTOC 2DYJA 1ZB9A 3IEVA 4PHTA 3A9VA 4IR7A 2PT7G 2Y4OA 3CW8X 4JM1A 5BUSA 4JI3C 4G37A 2AYAA 2VZEA 5A1IA 5T8TA 4NOZA 3E7XA 2ZM6C 5BUQA 2DPLA 3AF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  1LQL A;  4LF9 C;  3R9W A;  2HHH C;  2E8C A;  1KKG A;  4DV6 C;  1IBL C;  4K0K C;  2E8F A;  2ONF A;  1JOS A;  4DUZ C;  4X66 C;  1HNX C;  1ML8 A;  2UU9 C;  5BR8 C;  2UUC C;  3R9X A;  1L2F A;  4BSZ A;  4DR6 C;  1XNQ C;  1N2F A;  1XMO C;  2ASB A;  4GKK C;  4XX2 A;  2HJG A;  4JI5 C;  4DR7 C;  2KZF A;  4DCT A;  4B3S C;  2ATW A;  1N33 C;  4DR5 C;  2BJO A;  4LFB C;  1FJG C;  3CJE A;  1HR0 C;  1N36 C;  2UXC C;  4DR4 C;  3J80 D;  4JI1 C;  4YHH C;  1WH9 A;  2UUB C;  4JV5 C;  3J7A D;  4B3T C;  4JI2 C;  3AF6 A;  1XNR C;  4OX9 C;  2JMP A;  4JI8 C;  1EGA A;  2CY1 A;  3GKU A;  4MH4 A;  2OPL A;  1QWI A;  2UXD C;  4B3M C;  1USP B;  5A2Q D;  4AQY C;  1HNW C;  5IWA C;  4LF7 C;  4LFA C;  1WF3 A;  4DV3 C;  4JI7 C;  3JAM D;  4LF8 C;  4DV5 C;  2QL8 A;  1I94 C;  2XR1 A;  1N32 C;  3IEU A;  2D7V A;  1IBM C;  1NYE A;  4B3R C;  4NXM C;  4DR3 C;  4LF6 C;  4KHP C;  1HNZ C;  1MKY A;  4DUY C;  2PN2 A;  5LMN C;  4DCV A;  5LMU C;  2E5L C;  2CXC A;  4DV7 C;  4JI4 C;  4LFC C;  4X64 C;  2VQF C;  2UUA C;  4GKJ C;  5IT9 D;  4X65 C;  4JYA C;  2E7G A;  4YY3 C;  4JI0 C;  4DV1 C;  3OTO C;  1IBK C;  1PA4 A;  1VLA A;  1ZB9 A;  2DYJ A;  3IEV A;  3T1Y C;  2E8E A;  2PT7 G;  2EGT A;  1HH2 P;  4LF5 C;  3LUS A;  5FLX D;  4DV0 C;  4DR2 C;  3EER A;  4DV4 C;  4JI6 C;  4LF4 C;  2F4V C;  4JI3 C;  3T1H C;  1N34 C;  2VQE C;  1J5E C;  1K0R A;  1UKK A;  4X62 C;  4DV2 C;  3J81 D;  4NOZ A;  4DR1 C;  2YCB A;  4DCU A;  3I07 A;  2ZM6 C;  2OPL B;  1ZB8 A;  2UXB C;  4MTN A;  3AF5 A;  4DCS A;  4NXN C;  1XMQ C; 
#chains in the Genus database with same CATH topology
 4L7I A;  4BBY A;  1LQL A;  4FUQ A;  2YWB A;  2HHH C;  1T5D X;  1KKG A;  4DV6 C;  4GXR A;  4RLQ A;  3FM7 A;  5AE2 A;  3NYR A;  4X66 C;  1ML8 A;  5BR8 C;  1PG3 A;  3A9U A;  3LGX A;  2P2B A;  1O9T A;  4BSZ A;  2HJG A;  4BC7 A;  4RMN A;  4KTT A;  4DG9 A;  1WCJ A;  4WV3 A;  3CJE A;  3KXW A;  1N36 C;  3SO4 A;  4EAT A;  2Y27 A;  4PRO C;  3EQ6 A;  4JI8 C;  1MDB A;  5A19 A;  1XHJ A;  1USP B;  5KYV A;  1HNW C;  5AE1 A;  5IWA C;  3O2E A;  3N2Q A;  2YX1 A;  3JAM D;  2P2F A;  2QL8 A;  4L2Z A;  4OYC A;  2XR1 A;  3A4I A;  2D7V A;  1IBM C;  4PUH A;  4KHP C;  4PUI A;  5AE3 A;  4IZ6 A;  1HNZ C;  3GR1 A;  1V60 A;  4DCV A;  5LMU C;  2E5L C;  1P7L A;  4R0M A;  2P02 A;  2QW0 X;  4X64 C;  1FUG A;  2QVZ X;  1GPM A;  4X65 C;  2ZZN A;  3L95 X;  1UWD A;  2E7G A;  3TUF A;  4JI0 C;  4DV1 C;  3VNQ A;  1VLA A;  5CZX A;  5JRH A;  4ZLP A;  2QVX X;  2MCQ A;  2E8E A;  3PES A;  4RVN A;  4RM2 A;  1NY8 A;  1V26 A;  4DR2 C;  5KYT A;  2D28 C;  3T1H C;  1N34 C;  4R1M A;  4WS9 A;  1UKK A;  4X62 C;  4DV2 C;  3I08 A;  2YCB A;  3S82 A;  4ODJ A;  4TPS B;  1ZB8 A;  1O93 A;  4MTN A;  1IBK C;  4B3M C;  4JI6 C;  1USP A;  4I9G A;  3VNS A;  2QVY X;  3R9W A;  3LAX A;  3DAY A;  5BSU A;  1HNX C;  2BH1 X;  3PBK A;  4DR6 C;  3B7W A;  1XNQ C;  1XMO C;  2D27 A;  4XX2 A;  2M5O A;  4JI5 C;  3RG2 A;  4DCT A;  5ADZ A;  4DR5 C;  5K8F A;  3NI2 A;  2BJO A;  4K0B A;  2P2M A;  3UEB A;  4LFB C;  4JI1 C;  3E7W A;  5BSV A;  4HPV A;  2UUB C;  4B3T C;  1XNR C;  4OX9 C;  4D56 A;  2JNV A;  2WP0 C;  5A2Q D;  4AQY C;  2CU6 A;  1WF3 A;  1PU1 A;  4DV3 C;  1PG4 A;  4BC9 A;  1RY2 A;  2D1S A;  3TDE A;  1N32 C;  3IEU A;  3LNO A;  1NYE A;  1MKY A;  2P2J A;  5T8S A;  5A1G A;  4OXI A;  3TQI A;  2KZ0 A;  4I9F A;  3CQ3 A;  1PA4 A;  4D57 A;  3T1Y C;  1O90 A;  1XRA A;  1TH5 A;  3IPL A;  2EGT A;  3LUS A;  1MDF A;  5FLX D;  4DV0 C;  1M6X C;  2D1R A;  3EER A;  4G1I A;  2Y4N A;  4DV4 C;  3CW9 A;  2F4V C;  4BCA A;  3LNV A;  3UOW A;  2OO4 A;  1MXB A;  4DR1 C;  4DCU A;  2NCL A;  3I07 A;  4D4I A;  3R44 A;  5H9U A;  1XMQ C;  4DR7 C;  3CQ1 A;  5GTD A;  3A26 A;  4LF9 C;  2WD9 A;  3DLP X;  2V7B A;  4DUZ C;  2UU9 C;  1AMU A;  1O92 A;  4RM3 A;  2MM9 A;  3UZ0 A;  4U5Y D;  3R9X A;  1N2F A;  1QM4 A;  2ASB A;  3L8C A;  4GKK C;  1YGT A;  3N54 B;  1XRC A;  1RG9 A;  2KZF A;  4B3S C;  1LCI A;  1N33 C;  4G36 A;  1FJG C;  3PRO C;  2UXC C;  3ETC A;  4DR4 C;  3J80 D;  3UX3 A;  4JV5 C;  4FTF A;  2DHM A;  2JMP A;  3RV2 A;  1EGA A;  2CY1 A;  4MH4 A;  2OPL A;  1XS3 A;  2UXD C;  1MD9 A;  5BST A;  2KDN A;  3A25 A;  4JI7 C;  4DV5 C;  1I94 C;  2P20 A;  5IFI A;  2Z51 A;  4NXM C;  4DR3 C;  4LF6 C;  3AY0 A;  3G7S A;  4DUY C;  2PN2 A;  5LMN C;  1IB8 A;  4DV7 C;  5BSW A;  2M5H A;  4RLF A;  4NDN A;  4DG8 A;  2MMA B;  2UUA C;  4JYA C;  3VNR A;  3NPD A;  4YY3 C;  5E7Q A;  3NYQ A;  1FLO A;  4PZP A;  2D1T A;  1P4E C;  1HH2 P;  4LF5 C;  5DV9 A;  3DHV A;  3FCC A;  5BSM A;  4LF4 C;  1P4E A;  1V25 A;  1J5E C;  2VQE C;  1K0R A;  1BA3 A;  4GS5 A;  2E0G A;  4PUG A;  3J81 D;  2ZTB A;  1YJ7 A;  2OBV A;  2OPL B;  3GR0 A;  1XDX A;  2UXB C;  5KEI A;  4DCS A;  4NXN C;  3CQ2 A;  3FCE A;  2E8C A;  1IBL C;  4K0K C;  2E8F A;  2ONF A;  1JOS A;  2UUC C;  4R1L A;  1L2F A;  2PRO A;  4L4Q A;  1T5H X;  2P2Q A;  4D4G A;  2ATW A;  3ETO A;  3TR3 A;  2D1Q A;  1HR0 C;  4KTV A;  4FUT A;  4YHH C;  1WH9 A;  3J7A D;  2YWC A;  4JI2 C;  1VEH A;  3AF6 A;  4RVO A;  1XRB A;  3GKU A;  1QWI A;  3H2T A;  3UX2 A;  4LF7 C;  4LFA C;  1ULT A;  5CZV A;  5BSR A;  4LF8 C;  4B3R C;  3IML A;  1MXA A;  4ISB A;  2ZZM A;  2PG1 E;  3GPC A;  1MXC A;  4LE5 A;  4ZJZ A;  5LCI A;  2VSQ A;  2CXC A;  4JI4 C;  4LFC C;  5BUR A;  2VQF C;  4GKJ C;  5K85 A;  4GXQ A;  3C5E A;  5IT9 D;  3OTO C;  2DYJ A;  1ZB9 A;  3IEV A;  4PHT A;  3K6R A;  3A9V A;  4IR7 A;  2PT7 G;  2Y4O A;  3CW8 X;  4JM1 A;  1M6X A;  5BUS A;  4JI3 C;  4G37 A;  2AYA A;  2VZE A;  5A1I A;  5T8T A;  4NOZ A;  3E7X A;  2ZM6 C;  5BUQ A;  2DPL A;  3AF5 A; 
#chains in the Genus database with same CATH homology
 4L7I A;  4BBY A;  1LQL A;  4FUQ A;  2YWB A;  2HHH C;  1T5D X;  1KKG A;  4DV6 C;  4GXR A;  4RLQ A;  5AE2 A;  3NYR A;  4X66 C;  1ML8 A;  5BR8 C;  1PG3 A;  3A9U A;  3LGX A;  2P2B A;  1O9T A;  4BSZ A;  2HJG A;  4BC7 A;  4RMN A;  4KTT A;  4DG9 A;  4WV3 A;  3CJE A;  3KXW A;  1N36 C;  3SO4 A;  4EAT A;  2Y27 A;  4PRO C;  3EQ6 A;  4JI8 C;  1MDB A;  5A19 A;  1USP B;  5KYV A;  1HNW C;  5AE1 A;  5IWA C;  3N2Q A;  3JAM D;  2P2F A;  2QL8 A;  4L2Z A;  4OYC A;  2XR1 A;  3A4I A;  2D7V A;  1IBM C;  4KHP C;  5AE3 A;  4IZ6 A;  1HNZ C;  3GR1 A;  4DCV A;  5LMU C;  2E5L C;  1P7L A;  4R0M A;  2P02 A;  2QW0 X;  4X64 C;  1FUG A;  2QVZ X;  1GPM A;  4X65 C;  3L95 X;  2E7G A;  3TUF A;  4JI0 C;  4DV1 C;  3VNQ A;  1VLA A;  5CZX A;  5JRH A;  4ZLP A;  2QVX X;  2E8E A;  3PES A;  4RVN A;  4RM2 A;  1V26 A;  4DR2 C;  5KYT A;  2D28 C;  3T1H C;  1N34 C;  4R1M A;  4WS9 A;  1UKK A;  4X62 C;  4DV2 C;  3I08 A;  2YCB A;  3S82 A;  4ODJ A;  4TPS B;  1ZB8 A;  1O93 A;  1IBK C;  4JI6 C;  4B3M C;  4MTN A;  1USP A;  4I9G A;  3VNS A;  2QVY X;  3R9W A;  3LAX A;  3DAY A;  5BSU A;  1HNX C;  2BH1 X;  3PBK A;  4DR6 C;  3B7W A;  1XNQ C;  1XMO C;  2D27 A;  4XX2 A;  4JI5 C;  3RG2 A;  4DCT A;  5ADZ A;  4DR5 C;  5K8F A;  3NI2 A;  2BJO A;  4K0B A;  2P2M A;  4LFB C;  4JI1 C;  3E7W A;  5BSV A;  4HPV A;  2UUB C;  4B3T C;  1XNR C;  4OX9 C;  4D56 A;  2WP0 C;  5A2Q D;  4AQY C;  1WF3 A;  4DV3 C;  1PG4 A;  4BC9 A;  1RY2 A;  2D1S A;  3TDE A;  1N32 C;  3IEU A;  1NYE A;  1MKY A;  2P2J A;  5T8S A;  5A1G A;  4OXI A;  3TQI A;  4I9F A;  1PA4 A;  4D57 A;  3T1Y C;  1O90 A;  1XRA A;  3IPL A;  2EGT A;  3LUS A;  1MDF A;  5FLX D;  4DV0 C;  2D1R A;  3EER A;  4G1I A;  2Y4N A;  4DV4 C;  3CW9 A;  2F4V C;  4BCA A;  3LNV A;  3UOW A;  2OO4 A;  1MXB A;  4DR1 C;  4DCU A;  3I07 A;  4D4I A;  3R44 A;  5H9U A;  1XMQ C;  4DR7 C;  5GTD A;  4LF9 C;  2WD9 A;  3DLP X;  2V7B A;  4DUZ C;  2UU9 C;  1AMU A;  1O92 A;  4RM3 A;  3UZ0 A;  4U5Y D;  3R9X A;  1N2F A;  1QM4 A;  2ASB A;  3L8C A;  4GKK C;  3N54 B;  1XRC A;  1RG9 A;  4B3S C;  2KZF A;  1LCI A;  1N33 C;  4G36 A;  1FJG C;  3PRO C;  2UXC C;  3ETC A;  4DR4 C;  3J80 D;  4JV5 C;  4FTF A;  2JMP A;  3RV2 A;  1EGA A;  2CY1 A;  4MH4 A;  2OPL A;  2UXD C;  1MD9 A;  5BST A;  4JI7 C;  4DV5 C;  1I94 C;  2P20 A;  5IFI A;  4NXM C;  4DR3 C;  4LF6 C;  3G7S A;  4DUY C;  2PN2 A;  5LMN C;  4DV7 C;  5BSW A;  4RLF A;  4DG8 A;  4NDN A;  2UUA C;  4JYA C;  3VNR A;  3NPD A;  4YY3 C;  5E7Q A;  3NYQ A;  4PZP A;  2D1T A;  1HH2 P;  4LF5 C;  5DV9 A;  3DHV A;  3FCC A;  5BSM A;  4LF4 C;  1V25 A;  1J5E C;  2VQE C;  1K0R A;  1BA3 A;  4GS5 A;  2E0G A;  3J81 D;  1YJ7 A;  2OBV A;  2OPL B;  3GR0 A;  2UXB C;  5KEI A;  4DCS A;  4NXN C;  3FCE A;  2E8C A;  1IBL C;  4K0K C;  2E8F A;  2ONF A;  1JOS A;  2UUC C;  4R1L A;  1L2F A;  2PRO A;  4L4Q A;  1T5H X;  2P2Q A;  4D4G A;  2ATW A;  3ETO A;  2D1Q A;  1HR0 C;  4KTV A;  4FUT A;  4YHH C;  1WH9 A;  3J7A D;  2YWC A;  4JI2 C;  3AF6 A;  4RVO A;  1XRB A;  3GKU A;  1QWI A;  3H2T A;  4LF7 C;  4LFA C;  1ULT A;  5CZV A;  5BSR A;  4LF8 C;  4B3R C;  3IML A;  1MXA A;  4ISB A;  3GPC A;  1MXC A;  4LE5 A;  4ZJZ A;  2VSQ A;  2CXC A;  4JI4 C;  4LFC C;  5BUR A;  2VQF C;  4GKJ C;  5K85 A;  4GXQ A;  3C5E A;  5IT9 D;  3OTO C;  2DYJ A;  1ZB9 A;  3IEV A;  4PHT A;  3A9V A;  4IR7 A;  2PT7 G;  2Y4O A;  3CW8 X;  4JM1 A;  5BUS A;  4JI3 C;  4G37 A;  2AYA A;  2VZE A;  5A1I A;  5T8T A;  4NOZ A;  3E7X A;  2ZM6 C;  5BUQ A;  2DPL A;  3AF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...