4JV5C

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4jv5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4jv5C02
3AF6A 2KZFA 4LF4C 1EGAA 4DV5C 4AQYC 2YCBA 4B3TC 3J80D 2E5LC 4X65C 5IT9D 3R9XA 4DR7C 2UXDC 1PA4A 2HHHC 1HNZC 2XR1A 1IBLC 4DV0C 2ZM6C 4GKKC 2DYJA 2OPLA 2UUBC 3JAMD 4DCSA 1N34C 2QL8A 1FJGC 2UXCC 5LMNC 1N33C 4JI5C 1UKKA 4DV7C 3CJEA 4JYAC 4X64C 1L2FA 1N36C 4LF6C 2CXCA 4DUZC 1ZB8A 4LFBC 2CY1A 4JI0C 1HNXC 2E8EA 2EGTA 4XX2A 1USPA 4K0KC 2PN2A 4JI3C 1KKGA 1HH2P 4JI8C 4DR4C 1ZB9A 1XNRC 1JOSA 4X62C 4B3MC 3EERA 2E7GA 3GKUA 4YY3C 4LF7C 3LUSA 4YHHC 4DCUA 3IEVA 1XMOC 3T1HC 2OPLB 1MKYA 4MTNA 4DR3C 4NXNC 4LFCC 4DV6C 4LF9C 4DCVA 4NXMC 4OX9C 2BJOA 4JI2C 2HJGA 4JI4C 5A2QD 4MH4A 4LF5C 2UUCC 1WH9A 5LMUC 4JI7C 1WF3A 1LQLA 4DV3C 4LFAC 3IEUA 4NOZA 2E8FA 4DR6C 1N2FA 2D7VA 3OTOC 4DV4C 2VQEC 4DCTA 1NYEA 4KHPC 4X66C 4BSZA 4DR2C 3J81D 4GKJC 2UXBC 1VLAA 1IBMC 3J7AD 4LF8C 4JV5C 5IWAC 2JMPA 5FLXD 1I94C 4JI6C 2VQFC 4DV2C 3R9WA 3T1YC 1ML8A 2F4VC 1QWIA 3AF5A 4DR5C 1XNQC 4JI1C 2ASBA 2E8CA 1K0RA 4B3RC 2UUAC 1USPB 3I07A 2PT7G 1IBKC 2UU9C 4DR1C 1HNWC 1HR0C 4DV1C 2ONFA 1N32C 1J5EC 4DUYC 2ATWA 4B3SC 1XMQC 5BR8C
chains in the Genus database with same CATH superfamily
3G7SA 4LF4C 1PU1A 4AQYC 1M6XA 4B3TC 3C5EA 5CZVA 1UWDA 3R9XA 2DPLA 4DV0C 4GKKC 2OPLA 3LNVA 3DHVA 5A1IA 1V25A 3LNOA 2P2JA 2QL8A 1FJGC 1T5DX 4FTFA 3K6RA 2UXCC 1N33C 4LF6C 5AE2A 3A25A 4RM3A 4BC9A 2EGTA 4XX2A 1HH2P 4JI8C 1ZB9A 1XNRC 1LCIA 4BCAA 1JOSA 4R1LA 5E7QA 2P2MA 5K8FA 1V60A 4OXIA 3DLPX 4IZ6A 3LUSA 5A1GA 4DG9A 3VNRA 4DR3C 2QW0X 3NPDA 4LF9C 4NXMC 1IB8A 4IR7A 3IMLA 3E7XA 3E7WA 5T8SA 2HJGA 3FM7A 2VSQA 4ISBA 5IFIA 2P20A 3O2EA 1P4EA 4PUGA 3FCEA 1NYEA 4KHPC 1XHJA 4X66C 4BSZA 5KEIA 2UXBC 1VLAA 4ZJZA 1QM4A 4LF8C 2D1RA 3LGXA 1MXAA 2F4VC 3A9UA 2PG1E 1VEHA 2E8CA 1K0RA 5BSTA 1HNWC 4DV1C 4DUYC 1XMQC 3S82A 3AF6A 2V7BA 4HPVA 2AYAA 4R1MA 4DV5C 3PBKA 3J80D 2E5LC 1XRCA 1NY8A 4I9GA 3LAXA 2ZM6C 4BC7A 2DYJA 4DCSA 1N34C 5AE1A 4WV3A 5LMNC 4DV7C 4D56A 3A9VA 1L2FA 2D27A 1TH5A 1N36C 1ZB8A 4LFBC 2CY1A 4JI0C 3I08A 3KXWA 4K0KC 2PN2A 1KKGA 3CW9A 4DR4C 2ZZNA 3N2QA 4BBYA 4K0BA 3EQ6A 3UZ0A 3CQ2A 4L2ZA 1XMOC 5H9UA 1T5HX 3T1HC 4D4IA 1MKYA 4MTNA 4DG8A 4PROC 4DCVA 2YWBA 2BJOA 2ZZMA 2PROA 1MDFA 3GR0A 4MH4A 4LF5C 4NDNA 3DAYA 5LCIA 1WF3A 3NYRA 4DV3C 3GR1A 3IEUA 4NOZA 2D1SA 2E8FA 3CW8X 4DR6C 4ODJA 2D28C 1MXBA 5KYTA 1MD9A 2VQEC 2KDNA 4DCTA 2WP0C 5GTDA 3ETOA 3J7AD 3IPLA 2JMPA 5FLXD 4G37A 3T1YC 1RY2A 3R9WA 2P2QA 3AF5A 5AE3A 4DR5C 1XRAA 2NCLA 3N54B 4RMNA 2UUAC 2YWCA 3PESA 1MDBA 2BH1X 4EATA 1IBKC 4RLQA 3NI2A 1J5EC 5BSUA 3L95X 4OYCA 2QVZX 2P02A 2KZFA 1PG4A 4D57A 2QVYX 1XS3A 3R44A 4DR7C 2UXDC 1HNZC 2XR1A 1IBLC 3NYQA 1O93A 3A4IA 2VZEA 1UKKA 1ULTA 4JYAC 3H2TA 5K85A 5JRHA 2YX1A 3B7WA 3PROC 2MCQA 4RLFA 1M6XC 2M5OA 1HNXC 4RVOA 4L4QA 3EERA 3GKUA 4KTTA 4LF7C 4DCUA 2OPLB 4NXNC 1GPMA 3UEBA 4DV6C 4LFCC 3SO4A 2MM9A 1O92A 4JI2C 4KTVA 4G1IA 4JI4C 4ZLPA 2UUCC 1XRBA 3TQIA 4JI7C 1LQLA 4LFAC 1N2FA 5BSMA 5BSRA 4DV4C 1O9TA 4DR2C 4GKJC 1IBMC 2WD9A 4GS5A 3UX3A 4JI6C 1MXCA 2VQFC 4DV2C 5BSVA 1QWIA 5DV9A 5CZXA 4B3RC 2OO4A 2DHMA 2M5HA 1USPB 3I07A 2PT7G 1WCJA 3RG2A 5T8TA 2UU9C 4DR1C 2ONFA 3L8CA 1P4EC 3UX2A 3VNQA 5BUSA 1EGAA 2YCBA 3CQ1A 4GXQA 4X65C 5IT9D 1PA4A 2Y4NA 2HHHC 5BUQA 2UUBC 3JAMD 2Z51A 4L7IA 4WS9A 1RG9A 3FCCA 4JI5C 3CJEA 2ZTBA 4X64C 3TUFA 2CXCA 4DUZC 5A19A 1FLOA 2E8EA 3GPCA 2Y4OA 1USPA 2Y27A 4JI3C 4X62C 4B3MC 2E7GA 1O90A 3TDEA 4YY3C 2CU6A 5KYVA 3RV2A 3CQ3A 4YHHC 1YJ7A 4FUTA 3IEVA 3VNSA 5ADZA 4PUIA 4PHTA 3TR3A 4OX9C 1FUGA 4PUHA 1BA3A 2P2FA 4U5YD 5A2QD 2KZ0A 2D1TA 4TPSB 1WH9A 3A26A 5LMUC 3ETCA 4RM2A 2P2BA 1PG3A 4LE5A 5BURA 2D7VA 3OTOC 1YGTA 4D4GA 3J81D 4JV5C 4G36A 5IWAC 1AMUA 4GXRA 1I94C 5BSWA 1ML8A 4R0MA 4I9FA 1XDXA 2JNVA 1XNQC 4PZPA 4JI1C 2ASBA 4RVNA 2MMAB 1P7LA 2OBVA 2E0GA 4JM1A 1HR0C 1N32C 2ATWA 1V26A 4B3SC 2QVXX 5BR8C 4FUQA 2D1QA 3UOWA 3AY0A
chains in the Genus database with same CATH topology
3G7SA 4LF4C 4AQYC 4B3TC 3C5EA 5CZVA 3R9XA 2DPLA 4DV0C 4GKKC 2OPLA 3LNVA 3DHVA 5A1IA 1V25A 2P2JA 2QL8A 1FJGC 1T5DX 4FTFA 2UXCC 1N33C 4LF6C 5AE2A 4RM3A 4BC9A 2EGTA 4XX2A 1HH2P 4JI8C 1ZB9A 1XNRC 1LCIA 4BCAA 1JOSA 4R1LA 5E7QA 2P2MA 5K8FA 4OXIA 3DLPX 4IZ6A 3LUSA 5A1GA 4DG9A 3VNRA 4DR3C 2QW0X 3NPDA 4LF9C 4NXMC 4IR7A 3IMLA 3E7XA 3E7WA 5T8SA 2HJGA 2VSQA 4ISBA 5IFIA 2P20A 3FCEA 1NYEA 4KHPC 4X66C 4BSZA 5KEIA 2UXBC 1VLAA 4ZJZA 1QM4A 4LF8C 2D1RA 3LGXA 1MXAA 2F4VC 3A9UA 2E8CA 1K0RA 5BSTA 1HNWC 4DV1C 4DUYC 1XMQC 3S82A 3AF6A 2V7BA 4HPVA 2AYAA 4R1MA 4DV5C 3PBKA 3J80D 2E5LC 1XRCA 4I9GA 3LAXA 2ZM6C 4BC7A 2DYJA 4DCSA 1N34C 5AE1A 4WV3A 5LMNC 4DV7C 4D56A 3A9VA 1L2FA 2D27A 1N36C 1ZB8A 4LFBC 2CY1A 4JI0C 3I08A 3KXWA 4K0KC 2PN2A 1KKGA 3CW9A 4DR4C 3N2QA 4BBYA 4K0BA 3EQ6A 3UZ0A 4L2ZA 1XMOC 5H9UA 1T5HX 3T1HC 4D4IA 1MKYA 4MTNA 4DG8A 4PROC 4DCVA 2YWBA 2BJOA 2PROA 1MDFA 3GR0A 4MH4A 4LF5C 4NDNA 3DAYA 1WF3A 3NYRA 4DV3C 3GR1A 3IEUA 4NOZA 2D1SA 2E8FA 3CW8X 4DR6C 4ODJA 2D28C 1MXBA 5KYTA 1MD9A 2VQEC 4DCTA 2WP0C 5GTDA 3ETOA 3J7AD 3IPLA 2JMPA 5FLXD 4G37A 3T1YC 1RY2A 3R9WA 2P2QA 3AF5A 5AE3A 4DR5C 1XRAA 3N54B 4RMNA 2UUAC 2YWCA 3PESA 1MDBA 2BH1X 4EATA 1IBKC 4RLQA 3NI2A 1J5EC 5BSUA 3L95X 4OYCA 2QVZX 2P02A 2KZFA 1PG4A 4D57A 2QVYX 3R44A 4DR7C 2UXDC 1HNZC 2XR1A 1IBLC 3NYQA 1O93A 3A4IA 2VZEA 1UKKA 1ULTA 4JYAC 3H2TA 5K85A 5JRHA 3B7WA 3PROC 4RLFA 1HNXC 4RVOA 4L4QA 3EERA 3GKUA 4KTTA 4LF7C 4DCUA 2OPLB 4NXNC 1GPMA 4DV6C 4LFCC 3SO4A 1O92A 4JI2C 4KTVA 4G1IA 4JI4C 4ZLPA 2UUCC 1XRBA 3TQIA 4JI7C 1LQLA 4LFAC 1N2FA 5BSMA 5BSRA 4DV4C 4DR2C 1O9TA 4GKJC 1IBMC 2WD9A 4GS5A 4JI6C 1MXCA 2VQFC 4DV2C 5BSVA 1QWIA 5DV9A 5CZXA 4B3RC 2OO4A 1USPB 3I07A 2PT7G 3RG2A 5T8TA 2UU9C 4DR1C 2ONFA 3L8CA 3VNQA 5BUSA 1EGAA 2YCBA 4GXQA 4X65C 5IT9D 1PA4A 2Y4NA 2HHHC 5BUQA 2UUBC 3JAMD 4L7IA 4WS9A 1RG9A 3FCCA 4JI5C 3CJEA 4X64C 3TUFA 2CXCA 4DUZC 5A19A 2E8EA 3GPCA 2Y4OA 1USPA 2Y27A 4JI3C 4X62C 4B3MC 2E7GA 1O90A 3TDEA 4YY3C 5KYVA 3RV2A 4YHHC 1YJ7A 4FUTA 3IEVA 3VNSA 5ADZA 4PHTA 4OX9C 1FUGA 1BA3A 2P2FA 4U5YD 5A2QD 2D1TA 4TPSB 1WH9A 5LMUC 3ETCA 4RM2A 2P2BA 1PG3A 4LE5A 5BURA 2D7VA 3OTOC 4D4GA 3J81D 4JV5C 4G36A 5IWAC 1AMUA 4GXRA 1I94C 5BSWA 1ML8A 4R0MA 4I9FA 1XNQC 4PZPA 4JI1C 2ASBA 4RVNA 1P7LA 2OBVA 2E0GA 4JM1A 1HR0C 1N32C 2ATWA 1V26A 4B3SC 2QVXX 5BR8C 4FUQA 2D1QA 3UOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AF6 A;  2KZF A;  4LF4 C;  1EGA A;  4DV5 C;  4AQY C;  2YCB A;  4B3T C;  3J80 D;  2E5L C;  4X65 C;  5IT9 D;  3R9X A;  4DR7 C;  2UXD C;  1PA4 A;  2HHH C;  1HNZ C;  2XR1 A;  1IBL C;  4DV0 C;  2ZM6 C;  4GKK C;  2DYJ A;  2OPL A;  2UUB C;  3JAM D;  4DCS A;  1N34 C;  2QL8 A;  1FJG C;  2UXC C;  5LMN C;  1N33 C;  4JI5 C;  1UKK A;  4DV7 C;  3CJE A;  4JYA C;  4X64 C;  1L2F A;  1N36 C;  4LF6 C;  2CXC A;  4DUZ C;  1ZB8 A;  4LFB C;  2CY1 A;  4JI0 C;  1HNX C;  2E8E A;  2EGT A;  4XX2 A;  1USP A;  4K0K C;  2PN2 A;  4JI3 C;  1KKG A;  1HH2 P;  4JI8 C;  4DR4 C;  1ZB9 A;  1XNR C;  1JOS A;  4X62 C;  4B3M C;  3EER A;  2E7G A;  3GKU A;  4YY3 C;  4LF7 C;  3LUS A;  4YHH C;  4DCU A;  3IEV A;  1XMO C;  3T1H C;  2OPL B;  1MKY A;  4MTN A;  4DR3 C;  4NXN C;  4LFC C;  4DV6 C;  4LF9 C;  4DCV A;  4NXM C;  4OX9 C;  2BJO A;  4JI2 C;  2HJG A;  4JI4 C;  5A2Q D;  4MH4 A;  4LF5 C;  2UUC C;  1WH9 A;  5LMU C;  4JI7 C;  1WF3 A;  1LQL A;  4DV3 C;  4LFA C;  3IEU A;  4NOZ A;  2E8F A;  4DR6 C;  1N2F A;  2D7V A;  3OTO C;  4DV4 C;  2VQE C;  4DCT A;  1NYE A;  4KHP C;  4X66 C;  4BSZ A;  4DR2 C;  3J81 D;  4GKJ C;  2UXB C;  1VLA A;  1IBM C;  3J7A D;  4LF8 C;  4JV5 C;  5IWA C;  2JMP A;  5FLX D;  1I94 C;  4JI6 C;  2VQF C;  4DV2 C;  3R9W A;  3T1Y C;  1ML8 A;  2F4V C;  1QWI A;  3AF5 A;  4DR5 C;  1XNQ C;  4JI1 C;  2ASB A;  2E8C A;  1K0R A;  4B3R C;  2UUA C;  1USP B;  3I07 A;  2PT7 G;  1IBK C;  2UU9 C;  4DR1 C;  1HNW C;  1HR0 C;  4DV1 C;  2ONF A;  1N32 C;  1J5E C;  4DUY C;  2ATW A;  4B3S C;  1XMQ C;  5BR8 C; 
#chains in the Genus database with same CATH topology
 3G7S A;  4LF4 C;  1PU1 A;  4AQY C;  1M6X A;  4B3T C;  3C5E A;  5CZV A;  1UWD A;  3R9X A;  2DPL A;  4DV0 C;  4GKK C;  2OPL A;  3LNV A;  3DHV A;  5A1I A;  1V25 A;  3LNO A;  2P2J A;  2QL8 A;  1FJG C;  1T5D X;  4FTF A;  3K6R A;  2UXC C;  1N33 C;  4LF6 C;  5AE2 A;  3A25 A;  4RM3 A;  4BC9 A;  2EGT A;  4XX2 A;  1HH2 P;  4JI8 C;  1ZB9 A;  1XNR C;  1LCI A;  4BCA A;  1JOS A;  4R1L A;  5E7Q A;  2P2M A;  5K8F A;  1V60 A;  4OXI A;  3DLP X;  4IZ6 A;  3LUS A;  5A1G A;  4DG9 A;  3VNR A;  4DR3 C;  2QW0 X;  3NPD A;  4LF9 C;  4NXM C;  1IB8 A;  4IR7 A;  3IML A;  3E7X A;  3E7W A;  5T8S A;  2HJG A;  3FM7 A;  2VSQ A;  4ISB A;  5IFI A;  2P20 A;  3O2E A;  1P4E A;  4PUG A;  3FCE A;  1NYE A;  4KHP C;  1XHJ A;  4X66 C;  4BSZ A;  5KEI A;  2UXB C;  1VLA A;  4ZJZ A;  1QM4 A;  4LF8 C;  2D1R A;  3LGX A;  1MXA A;  2F4V C;  3A9U A;  2PG1 E;  1VEH A;  2E8C A;  1K0R A;  5BST A;  1HNW C;  4DV1 C;  4DUY C;  1XMQ C;  3S82 A;  3AF6 A;  2V7B A;  4HPV A;  2AYA A;  4R1M A;  4DV5 C;  3PBK A;  3J80 D;  2E5L C;  1XRC A;  1NY8 A;  4I9G A;  3LAX A;  2ZM6 C;  4BC7 A;  2DYJ A;  4DCS A;  1N34 C;  5AE1 A;  4WV3 A;  5LMN C;  4DV7 C;  4D56 A;  3A9V A;  1L2F A;  2D27 A;  1TH5 A;  1N36 C;  1ZB8 A;  4LFB C;  2CY1 A;  4JI0 C;  3I08 A;  3KXW A;  4K0K C;  2PN2 A;  1KKG A;  3CW9 A;  4DR4 C;  2ZZN A;  3N2Q A;  4BBY A;  4K0B A;  3EQ6 A;  3UZ0 A;  3CQ2 A;  4L2Z A;  1XMO C;  5H9U A;  1T5H X;  3T1H C;  4D4I A;  1MKY A;  4MTN A;  4DG8 A;  4PRO C;  4DCV A;  2YWB A;  2BJO A;  2ZZM A;  2PRO A;  1MDF A;  3GR0 A;  4MH4 A;  4LF5 C;  4NDN A;  3DAY A;  5LCI A;  1WF3 A;  3NYR A;  4DV3 C;  3GR1 A;  3IEU A;  4NOZ A;  2D1S A;  2E8F A;  3CW8 X;  4DR6 C;  4ODJ A;  2D28 C;  1MXB A;  5KYT A;  1MD9 A;  2VQE C;  2KDN A;  4DCT A;  2WP0 C;  5GTD A;  3ETO A;  3J7A D;  3IPL A;  2JMP A;  5FLX D;  4G37 A;  3T1Y C;  1RY2 A;  3R9W A;  2P2Q A;  3AF5 A;  5AE3 A;  4DR5 C;  1XRA A;  2NCL A;  3N54 B;  4RMN A;  2UUA C;  2YWC A;  3PES A;  1MDB A;  2BH1 X;  4EAT A;  1IBK C;  4RLQ A;  3NI2 A;  1J5E C;  5BSU A;  3L95 X;  4OYC A;  2QVZ X;  2P02 A;  2KZF A;  1PG4 A;  4D57 A;  2QVY X;  1XS3 A;  3R44 A;  4DR7 C;  2UXD C;  1HNZ C;  2XR1 A;  1IBL C;  3NYQ A;  1O93 A;  3A4I A;  2VZE A;  1UKK A;  1ULT A;  4JYA C;  3H2T A;  5K85 A;  5JRH A;  2YX1 A;  3B7W A;  3PRO C;  2MCQ A;  4RLF A;  1M6X C;  2M5O A;  1HNX C;  4RVO A;  4L4Q A;  3EER A;  3GKU A;  4KTT A;  4LF7 C;  4DCU A;  2OPL B;  4NXN C;  1GPM A;  3UEB A;  4DV6 C;  4LFC C;  3SO4 A;  2MM9 A;  1O92 A;  4JI2 C;  4KTV A;  4G1I A;  4JI4 C;  4ZLP A;  2UUC C;  1XRB A;  3TQI A;  4JI7 C;  1LQL A;  4LFA C;  1N2F A;  5BSM A;  5BSR A;  4DV4 C;  1O9T A;  4DR2 C;  4GKJ C;  1IBM C;  2WD9 A;  4GS5 A;  3UX3 A;  4JI6 C;  1MXC A;  2VQF C;  4DV2 C;  5BSV A;  1QWI A;  5DV9 A;  5CZX A;  4B3R C;  2OO4 A;  2DHM A;  2M5H A;  1USP B;  3I07 A;  2PT7 G;  1WCJ A;  3RG2 A;  5T8T A;  2UU9 C;  4DR1 C;  2ONF A;  3L8C A;  1P4E C;  3UX2 A;  3VNQ A;  5BUS A;  1EGA A;  2YCB A;  3CQ1 A;  4GXQ A;  4X65 C;  5IT9 D;  1PA4 A;  2Y4N A;  2HHH C;  5BUQ A;  2UUB C;  3JAM D;  2Z51 A;  4L7I A;  4WS9 A;  1RG9 A;  3FCC A;  4JI5 C;  3CJE A;  2ZTB A;  4X64 C;  3TUF A;  2CXC A;  4DUZ C;  5A19 A;  1FLO A;  2E8E A;  3GPC A;  2Y4O A;  1USP A;  2Y27 A;  4JI3 C;  4X62 C;  4B3M C;  2E7G A;  1O90 A;  3TDE A;  4YY3 C;  2CU6 A;  5KYV A;  3RV2 A;  3CQ3 A;  4YHH C;  1YJ7 A;  4FUT A;  3IEV A;  3VNS A;  5ADZ A;  4PUI A;  4PHT A;  3TR3 A;  4OX9 C;  1FUG A;  4PUH A;  1BA3 A;  2P2F A;  4U5Y D;  5A2Q D;  2KZ0 A;  2D1T A;  4TPS B;  1WH9 A;  3A26 A;  5LMU C;  3ETC A;  4RM2 A;  2P2B A;  1PG3 A;  4LE5 A;  5BUR A;  2D7V A;  3OTO C;  1YGT A;  4D4G A;  3J81 D;  4JV5 C;  4G36 A;  5IWA C;  1AMU A;  4GXR A;  1I94 C;  5BSW A;  1ML8 A;  4R0M A;  4I9F A;  1XDX A;  2JNV A;  1XNQ C;  4PZP A;  4JI1 C;  2ASB A;  4RVN A;  2MMA B;  1P7L A;  2OBV A;  2E0G A;  4JM1 A;  1HR0 C;  1N32 C;  2ATW A;  1V26 A;  4B3S C;  2QVX X;  5BR8 C;  4FUQ A;  2D1Q A;  3UOW A;  3AY0 A; 
#chains in the Genus database with same CATH homology
 3G7S A;  4LF4 C;  4AQY C;  4B3T C;  3C5E A;  5CZV A;  3R9X A;  2DPL A;  4DV0 C;  4GKK C;  2OPL A;  3LNV A;  3DHV A;  5A1I A;  1V25 A;  2P2J A;  2QL8 A;  1FJG C;  1T5D X;  4FTF A;  2UXC C;  1N33 C;  4LF6 C;  5AE2 A;  4RM3 A;  4BC9 A;  2EGT A;  4XX2 A;  1HH2 P;  4JI8 C;  1ZB9 A;  1XNR C;  1LCI A;  4BCA A;  1JOS A;  4R1L A;  5E7Q A;  2P2M A;  5K8F A;  4OXI A;  3DLP X;  4IZ6 A;  3LUS A;  5A1G A;  4DG9 A;  3VNR A;  4DR3 C;  2QW0 X;  3NPD A;  4LF9 C;  4NXM C;  4IR7 A;  3IML A;  3E7X A;  3E7W A;  5T8S A;  2HJG A;  2VSQ A;  4ISB A;  5IFI A;  2P20 A;  3FCE A;  1NYE A;  4KHP C;  4X66 C;  4BSZ A;  5KEI A;  2UXB C;  1VLA A;  4ZJZ A;  1QM4 A;  4LF8 C;  2D1R A;  3LGX A;  1MXA A;  2F4V C;  3A9U A;  2E8C A;  1K0R A;  5BST A;  1HNW C;  4DV1 C;  4DUY C;  1XMQ C;  3S82 A;  3AF6 A;  2V7B A;  4HPV A;  2AYA A;  4R1M A;  4DV5 C;  3PBK A;  3J80 D;  2E5L C;  1XRC A;  4I9G A;  3LAX A;  2ZM6 C;  4BC7 A;  2DYJ A;  4DCS A;  1N34 C;  5AE1 A;  4WV3 A;  5LMN C;  4DV7 C;  4D56 A;  3A9V A;  1L2F A;  2D27 A;  1N36 C;  1ZB8 A;  4LFB C;  2CY1 A;  4JI0 C;  3I08 A;  3KXW A;  4K0K C;  2PN2 A;  1KKG A;  3CW9 A;  4DR4 C;  3N2Q A;  4BBY A;  4K0B A;  3EQ6 A;  3UZ0 A;  4L2Z A;  1XMO C;  5H9U A;  1T5H X;  3T1H C;  4D4I A;  1MKY A;  4MTN A;  4DG8 A;  4PRO C;  4DCV A;  2YWB A;  2BJO A;  2PRO A;  1MDF A;  3GR0 A;  4MH4 A;  4LF5 C;  4NDN A;  3DAY A;  1WF3 A;  3NYR A;  4DV3 C;  3GR1 A;  3IEU A;  4NOZ A;  2D1S A;  2E8F A;  3CW8 X;  4DR6 C;  4ODJ A;  2D28 C;  1MXB A;  5KYT A;  1MD9 A;  2VQE C;  4DCT A;  2WP0 C;  5GTD A;  3ETO A;  3J7A D;  3IPL A;  2JMP A;  5FLX D;  4G37 A;  3T1Y C;  1RY2 A;  3R9W A;  2P2Q A;  3AF5 A;  5AE3 A;  4DR5 C;  1XRA A;  3N54 B;  4RMN A;  2UUA C;  2YWC A;  3PES A;  1MDB A;  2BH1 X;  4EAT A;  1IBK C;  4RLQ A;  3NI2 A;  1J5E C;  5BSU A;  3L95 X;  4OYC A;  2QVZ X;  2P02 A;  2KZF A;  1PG4 A;  4D57 A;  2QVY X;  3R44 A;  4DR7 C;  2UXD C;  1HNZ C;  2XR1 A;  1IBL C;  3NYQ A;  1O93 A;  3A4I A;  2VZE A;  1UKK A;  1ULT A;  4JYA C;  3H2T A;  5K85 A;  5JRH A;  3B7W A;  3PRO C;  4RLF A;  1HNX C;  4RVO A;  4L4Q A;  3EER A;  3GKU A;  4KTT A;  4LF7 C;  4DCU A;  2OPL B;  4NXN C;  1GPM A;  4DV6 C;  4LFC C;  3SO4 A;  1O92 A;  4JI2 C;  4KTV A;  4G1I A;  4JI4 C;  4ZLP A;  2UUC C;  1XRB A;  3TQI A;  4JI7 C;  1LQL A;  4LFA C;  1N2F A;  5BSM A;  5BSR A;  4DV4 C;  4DR2 C;  1O9T A;  4GKJ C;  1IBM C;  2WD9 A;  4GS5 A;  4JI6 C;  1MXC A;  2VQF C;  4DV2 C;  5BSV A;  1QWI A;  5DV9 A;  5CZX A;  4B3R C;  2OO4 A;  1USP B;  3I07 A;  2PT7 G;  3RG2 A;  5T8T A;  2UU9 C;  4DR1 C;  2ONF A;  3L8C A;  3VNQ A;  5BUS A;  1EGA A;  2YCB A;  4GXQ A;  4X65 C;  5IT9 D;  1PA4 A;  2Y4N A;  2HHH C;  5BUQ A;  2UUB C;  3JAM D;  4L7I A;  4WS9 A;  1RG9 A;  3FCC A;  4JI5 C;  3CJE A;  4X64 C;  3TUF A;  2CXC A;  4DUZ C;  5A19 A;  2E8E A;  3GPC A;  2Y4O A;  1USP A;  2Y27 A;  4JI3 C;  4X62 C;  4B3M C;  2E7G A;  1O90 A;  3TDE A;  4YY3 C;  5KYV A;  3RV2 A;  4YHH C;  1YJ7 A;  4FUT A;  3IEV A;  3VNS A;  5ADZ A;  4PHT A;  4OX9 C;  1FUG A;  1BA3 A;  2P2F A;  4U5Y D;  5A2Q D;  2D1T A;  4TPS B;  1WH9 A;  5LMU C;  3ETC A;  4RM2 A;  2P2B A;  1PG3 A;  4LE5 A;  5BUR A;  2D7V A;  3OTO C;  4D4G A;  3J81 D;  4JV5 C;  4G36 A;  5IWA C;  1AMU A;  4GXR A;  1I94 C;  5BSW A;  1ML8 A;  4R0M A;  4I9F A;  1XNQ C;  4PZP A;  4JI1 C;  2ASB A;  4RVN A;  1P7L A;  2OBV A;  2E0G A;  4JM1 A;  1HR0 C;  1N32 C;  2ATW A;  1V26 A;  4B3S C;  2QVX X;  5BR8 C;  4FUQ A;  2D1Q A;  3UOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...