1HR0C

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hr0C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hr0C02
4X64C 4GKJC 4B3MC 4DV1C 4XX2A 4DCSA 2XR1A 4MTNA 4BSZA 4DR2C 4KHPC 4DCTA 2ASBA 4X65C 4LFCC 1IBLC 3CJEA 5BR8C 1ZB9A 3OTOC 4DV3C 1PA4A 1XMOC 4DR5C 1VLAA 4JI0C 4DV6C 1JOSA 4DV5C 3IEVA 1NYEA 4JI2C 2QL8A 4JI4C 1WF3A 4DUYC 4LF6C 2BJOA 1USPA 1L2FA 3IEUA 4NOZA 1HR0C 1ML8A 4DR3C 4JI8C 1HH2P 4LF5C 4X66C 2ATWA 2OPLB 1KKGA 2PN2A 4JI7C 2HHHC 1N2FA 2KZFA 4DV0C 2UXBC 1MKYA 3GKUA 4JYAC 1K0RA 2CXCA 4B3TC 4JV5C 1EGAA 5FLXD 2D7VA 4LF8C 4LF9C 3JAMD 2JMPA 4DR6C 2UXCC 2UUBC 2F4VC 4B3RC 4LFAC 2CY1A 1N32C 4JI6C 4X62C 1XNQC 2YCBA 1N34C 4LF7C 2E5LC 2PT7G 4DCUA 4DV2C 2E8FA 3J80D 4B3SC 1USPB 3EERA 4JI3C 1N33C 1WH9A 1ZB8A 2EGTA 2E8EA 3R9XA 3T1HC 2UU9C 4DR1C 5LMUC 2HJGA 2UUAC 1HNWC 2DYJA 4JI1C 4DV7C 1N36C 5IT9D 4YHHC 1I94C 4DCVA 4DUZC 4LF4C 3I07A 5IWAC 4MH4A 1HNXC 1XNRC 4K0KC 2UXDC 1FJGC 3J7AD 3LUSA 2ZM6C 4OX9C 1LQLA 3J81D 4DR4C 3AF5A 3R9WA 2UUCC 4DR7C 4GKKC 2E7GA 2VQEC 5A2QD 4DV4C 1UKKA 2ONFA 4NXNC 1QWIA 2VQFC 4YY3C 4AQYC 1J5EC 4NXMC 3AF6A 5LMNC 1XMQC 4JI5C 2E8CA 2OPLA 1HNZC 3T1YC 1IBMC 4LFBC 1IBKC
chains in the Genus database with same CATH superfamily
3PESA 4X64C 4GKJC 4B3MC 3FM7A 4DV1C 3E7WA 2D1TA 1O90A 4PUGA 2OBVA 4D4IA 5AE3A 3CJEA 3E7XA 1XS3A 4DR5C 4BBYA 4G37A 3DAYA 1JOSA 5K8FA 1NYEA 2QL8A 1ML8A 3LNVA 4DR3C 3CW9A 4IR7A 4LF5C 1XHJA 4X66C 2CU6A 1MXCA 5BSVA 4BCAA 2PN2A 2DPLA 1N2FA 3C5EA 1MKYA 4PROC 1K0RA 4B3TC 4G1IA 1MXAA 4JV5C 4LF8C 2JMPA 1YJ7A 2UUBC 2P02A 1QM4A 2NCLA 4I9GA 4OYCA 4D57A 4JI6C 2YCBA 3UX2A 3NYRA 4ZLPA 2QVYX 4DV2C 1PG3A 3R44A 4JI3C 3A9UA 2QW0X 4ISBA 3T1HC 3KXWA 2UUAC 3CQ3A 4GXRA 2DYJA 4DV7C 4ODJA 2QVZX 4I9FA 4PHTA 4DUZC 5IWAC 2AYAA 4LF4C 2P20A 4MH4A 3PROC 4KTVA 5BSTA 4R0MA 4OX9C 3J81D 4FUQA 3R9WA 1GPMA 4DR7C 3CW8X 3UEBA 5A2QD 2D1QA 2ONFA 3O2EA 5ADZA 2VQFC 4G36A 3A9VA 1FLOA 2OPLA 1HNZC 3LNOA 3SO4A 3L95X 2KZ0A 4XX2A 2OO4A 1VEHA 3ETOA 5H9UA 4D56A 4U5YD 5GTDA 4LFCC 1WCJA 5BR8C 1M6XA 5KYTA 4NDNA 1T5HX 1VLAA 4JI0C 4DV6C 1XRBA 4DV5C 2BH1X 3IEVA 1AMUA 4DUYC 1USPA 1L2FA 1HR0C 2D1SA 3GR0A 1YGTA 5CZXA 2Y27A 2MMAB 1MD9A 2OPLB 2PROA 1KKGA 4JI7C 2HHHC 1ULTA 3N54B 4L4QA 4ZJZA 1P4EC 3NPDA 2P2QA 1FUGA 5FLXD 4WS9A 4BC9A 2D7VA 4RLFA 2VSQA 2F4VC 2WD9A 2Y4OA 4LFAC 3GR1A 3CQ1A 2P2JA 3TR3A 1XNQC 2D1RA 2ZZMA 2E5LC 4DCUA 2E8FA 1USPB 5BUSA 1WH9A 2EGTA 2E8EA 3R9XA 4DR1C 3FCEA 2HJGA 3AY0A 5CZVA 4JI1C 5IT9D 4YHHC 5E7QA 3VNRA 1XNRC 5AE1A 2UXDC 1FJGC 3J7AD 3LUSA 4GS5A 4DR4C 4TPSB 2WP0C 3I08A 3L8CA 3UX3A 1RG9A 2VQEC 5IFIA 4DV4C 2Y4NA 1O92A 4YY3C 3AF6A 2D28C 3TQIA 1PG4A 3T1YC 3UZ0A 4DCSA 2XR1A 4DR2C 4KHPC 2ZZNA 4OXIA 4GXQA 4DCTA 1IBLC 2YWCA 5KYVA 2E0GA 4L2ZA 3OTOC 3B7WA 4DV3C 1IB8A 4PZPA 1MDBA 4RLQA 1O9TA 4JI2C 4EATA 2M5OA 2D27A 3H2TA 5BSMA 3RV2A 2ATWA 1UWDA 1NY8A 2MM9A 1V26A 1TH5A 2KZFA 4K0BA 2M5HA 3G7SA 4LF9C 4DR6C 4B3RC 2PG1E 4BC7A 2CY1A 3NYQA 3K6RA 4FUTA 4IZ6A 4FTFA 4PUIA 4D4GA 5BUQA 4LF7C 2PT7G 2QVXX 5DV9A 3J80D 4B3SC 4LE5A 5KEIA 1N33C 1XRAA 1BA3A 3S82A 4RM2A 4RMNA 1I94C 5K85A 3PBKA 4PUHA 5T8TA 3VNSA 3A25A 4RVOA 1HNXC 1V60A 1LQLA 3AF5A 4GKKC 4DG8A 5BSWA 4JM1A 1UKKA 3TUFA 4NXNC 1QWIA 2ZTBA 4AQYC 1J5EC 4NXMC 4DG9A 2E8CA 5A1IA 1IBMC 3N2QA 1IBKC 2YX1A 2P2MA 2P2BA 3RG2A 4MTNA 4BSZA 1XRCA 2ASBA 4X65C 1ZB9A 3VNQA 1V25A 1M6XC 1PA4A 1XMOC 2KDNA 4L7IA 5LCIA 5T8SA 3UOWA 4HPVA 1XDXA 5JRHA 4JI4C 1WF3A 4LF6C 2BJOA 3IEUA 4NOZA 1MXBA 4RVNA 4KTTA 4JI8C 3A4IA 1HH2P 3NI2A 1LCIA 4DV0C 2JNVA 2UXBC 3GKUA 5A1GA 4JYAC 2CXCA 1P4EA 1EGAA 3LAXA 4R1MA 1P7LA 3JAMD 2UXCC 1PU1A 1N32C 4X62C 5BSUA 1N34C 3EERA 2V7BA 3EQ6A 1ZB8A 2UU9C 1MDFA 3DHVA 5BURA 5LMUC 1HNWC 3IMLA 2MCQA 2YWBA 3CQ2A 5BSRA 1N36C 3FCCA 3GPCA 3A26A 4WV3A 3TDEA 3ETCA 4DCVA 3I07A 3IPLA 4R1LA 4K0KC 5AE2A 1O93A 2ZM6C 3LGXA 2P2FA 4RM3A 2Z51A 1T5DX 2UUCC 5A19A 2E7GA 3DLPX 5LMNC 1XMQC 4JI5C 2DHMA 2VZEA 1RY2A 4LFBC
chains in the Genus database with same CATH topology
3PESA 4X64C 4GKJC 4B3MC 4DV1C 3E7WA 2D1TA 1O90A 2OBVA 4D4IA 5AE3A 3CJEA 3E7XA 4DR5C 4BBYA 4G37A 3DAYA 1JOSA 5K8FA 1NYEA 2QL8A 1ML8A 3LNVA 4DR3C 3CW9A 4IR7A 4LF5C 4X66C 1MXCA 5BSVA 4BCAA 2PN2A 2DPLA 1N2FA 3C5EA 1MKYA 4PROC 1K0RA 4B3TC 4G1IA 1MXAA 4JV5C 4LF8C 2JMPA 1YJ7A 2UUBC 2P02A 1QM4A 4I9GA 4OYCA 4D57A 4JI6C 2YCBA 3NYRA 4ZLPA 2QVYX 4DV2C 1PG3A 3R44A 4JI3C 3A9UA 2QW0X 3T1HC 4ISBA 3KXWA 2UUAC 4GXRA 2DYJA 4DV7C 4ODJA 2QVZX 4DUZC 4I9FA 4PHTA 5IWAC 2AYAA 4LF4C 2P20A 4MH4A 3PROC 4KTVA 5BSTA 4R0MA 4OX9C 3J81D 4FUQA 3R9WA 1GPMA 4DR7C 3CW8X 5A2QD 2D1QA 2ONFA 5ADZA 2VQFC 4G36A 3A9VA 2OPLA 1HNZC 3SO4A 3L95X 4XX2A 2OO4A 4D56A 3ETOA 5H9UA 4U5YD 5GTDA 4LFCC 5BR8C 5KYTA 4NDNA 1T5HX 1VLAA 4JI0C 4DV6C 1XRBA 4DV5C 2BH1X 3IEVA 1AMUA 4DUYC 1USPA 1L2FA 1HR0C 2D1SA 3GR0A 5CZXA 2Y27A 1MD9A 2OPLB 2PROA 1KKGA 4JI7C 2HHHC 1ULTA 3N54B 4L4QA 4ZJZA 3NPDA 2P2QA 1FUGA 5FLXD 4WS9A 4BC9A 2D7VA 4RLFA 2VSQA 2F4VC 2WD9A 2Y4OA 4LFAC 3GR1A 2P2JA 1XNQC 2D1RA 2E5LC 4DCUA 2E8FA 1USPB 5BUSA 1WH9A 2EGTA 2E8EA 3R9XA 4DR1C 3FCEA 2HJGA 5CZVA 4JI1C 5IT9D 4YHHC 5E7QA 3VNRA 1XNRC 5AE1A 2UXDC 1FJGC 3J7AD 3LUSA 4GS5A 4DR4C 4TPSB 2WP0C 3I08A 3L8CA 1RG9A 2VQEC 5IFIA 4DV4C 2Y4NA 1O92A 4YY3C 3AF6A 2D28C 3TQIA 1PG4A 3T1YC 3UZ0A 4DCSA 2XR1A 4DR2C 4KHPC 4OXIA 4GXQA 4DCTA 1IBLC 2YWCA 5KYVA 2E0GA 4L2ZA 3OTOC 3B7WA 4DV3C 4PZPA 1MDBA 4RLQA 1O9TA 4JI2C 4EATA 2D27A 3H2TA 5BSMA 3RV2A 2ATWA 1V26A 2KZFA 4K0BA 3G7SA 4LF9C 4DR6C 4B3RC 4BC7A 2CY1A 3NYQA 4FUTA 4IZ6A 4FTFA 4D4GA 5BUQA 4LF7C 2PT7G 2QVXX 5DV9A 3J80D 4B3SC 4LE5A 5KEIA 1N33C 1XRAA 1BA3A 3S82A 4RM2A 4RMNA 1I94C 5K85A 3PBKA 5T8TA 3VNSA 1HNXC 4RVOA 1LQLA 3AF5A 4GKKC 4DG8A 5BSWA 4JM1A 1UKKA 3TUFA 4NXNC 1QWIA 4AQYC 1J5EC 4NXMC 4DG9A 2E8CA 5A1IA 1IBMC 3N2QA 1IBKC 2P2MA 2P2BA 3RG2A 4MTNA 4BSZA 1XRCA 2ASBA 4X65C 1ZB9A 3VNQA 1V25A 1PA4A 1XMOC 4L7IA 5T8SA 3UOWA 4HPVA 5JRHA 4JI4C 1WF3A 4LF6C 2BJOA 3IEUA 4NOZA 1MXBA 4RVNA 4KTTA 4JI8C 3A4IA 1HH2P 3NI2A 1LCIA 4DV0C 2UXBC 3GKUA 5A1GA 4JYAC 2CXCA 1EGAA 3LAXA 4R1MA 1P7LA 3JAMD 2UXCC 1N32C 4X62C 5BSUA 1N34C 3EERA 2V7BA 3EQ6A 1ZB8A 2UU9C 1MDFA 3DHVA 5BURA 5LMUC 1HNWC 3IMLA 2YWBA 5BSRA 1N36C 3FCCA 3GPCA 4WV3A 3TDEA 3ETCA 4DCVA 3I07A 3IPLA 4R1LA 4K0KC 5AE2A 1O93A 2ZM6C 3LGXA 2P2FA 4RM3A 1T5DX 2UUCC 5A19A 2E7GA 3DLPX 5LMNC 1XMQC 4JI5C 2VZEA 1RY2A 4LFBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 C;  4GKJ C;  4B3M C;  4DV1 C;  4XX2 A;  4DCS A;  2XR1 A;  4MTN A;  4BSZ A;  4DR2 C;  4KHP C;  4DCT A;  2ASB A;  4X65 C;  4LFC C;  1IBL C;  3CJE A;  5BR8 C;  1ZB9 A;  3OTO C;  4DV3 C;  1PA4 A;  1XMO C;  4DR5 C;  1VLA A;  4JI0 C;  4DV6 C;  1JOS A;  4DV5 C;  3IEV A;  1NYE A;  4JI2 C;  2QL8 A;  4JI4 C;  1WF3 A;  4DUY C;  4LF6 C;  2BJO A;  1USP A;  1L2F A;  3IEU A;  4NOZ A;  1HR0 C;  1ML8 A;  4DR3 C;  4JI8 C;  1HH2 P;  4LF5 C;  4X66 C;  2ATW A;  2OPL B;  1KKG A;  2PN2 A;  4JI7 C;  2HHH C;  1N2F A;  2KZF A;  4DV0 C;  2UXB C;  1MKY A;  3GKU A;  4JYA C;  1K0R A;  2CXC A;  4B3T C;  4JV5 C;  1EGA A;  5FLX D;  2D7V A;  4LF8 C;  4LF9 C;  3JAM D;  2JMP A;  4DR6 C;  2UXC C;  2UUB C;  2F4V C;  4B3R C;  4LFA C;  2CY1 A;  1N32 C;  4JI6 C;  4X62 C;  1XNQ C;  2YCB A;  1N34 C;  4LF7 C;  2E5L C;  2PT7 G;  4DCU A;  4DV2 C;  2E8F A;  3J80 D;  4B3S C;  1USP B;  3EER A;  4JI3 C;  1N33 C;  1WH9 A;  1ZB8 A;  2EGT A;  2E8E A;  3R9X A;  3T1H C;  2UU9 C;  4DR1 C;  5LMU C;  2HJG A;  2UUA C;  1HNW C;  2DYJ A;  4JI1 C;  4DV7 C;  1N36 C;  5IT9 D;  4YHH C;  1I94 C;  4DCV A;  4DUZ C;  4LF4 C;  3I07 A;  5IWA C;  4MH4 A;  1HNX C;  1XNR C;  4K0K C;  2UXD C;  1FJG C;  3J7A D;  3LUS A;  2ZM6 C;  4OX9 C;  1LQL A;  3J81 D;  4DR4 C;  3AF5 A;  3R9W A;  2UUC C;  4DR7 C;  4GKK C;  2E7G A;  2VQE C;  5A2Q D;  4DV4 C;  1UKK A;  2ONF A;  4NXN C;  1QWI A;  2VQF C;  4YY3 C;  4AQY C;  1J5E C;  4NXM C;  3AF6 A;  5LMN C;  1XMQ C;  4JI5 C;  2E8C A;  2OPL A;  1HNZ C;  3T1Y C;  1IBM C;  4LFB C;  1IBK C; 
#chains in the Genus database with same CATH topology
 3PES A;  4X64 C;  4GKJ C;  4B3M C;  3FM7 A;  4DV1 C;  3E7W A;  2D1T A;  1O90 A;  4PUG A;  2OBV A;  4D4I A;  5AE3 A;  3CJE A;  3E7X A;  1XS3 A;  4DR5 C;  4BBY A;  4G37 A;  3DAY A;  1JOS A;  5K8F A;  1NYE A;  2QL8 A;  1ML8 A;  3LNV A;  4DR3 C;  3CW9 A;  4IR7 A;  4LF5 C;  1XHJ A;  4X66 C;  2CU6 A;  1MXC A;  5BSV A;  4BCA A;  2PN2 A;  2DPL A;  1N2F A;  3C5E A;  1MKY A;  4PRO C;  1K0R A;  4B3T C;  4G1I A;  1MXA A;  4JV5 C;  4LF8 C;  2JMP A;  1YJ7 A;  2UUB C;  2P02 A;  1QM4 A;  2NCL A;  4I9G A;  4OYC A;  4D57 A;  4JI6 C;  2YCB A;  3UX2 A;  3NYR A;  4ZLP A;  2QVY X;  4DV2 C;  1PG3 A;  3R44 A;  4JI3 C;  3A9U A;  2QW0 X;  4ISB A;  3T1H C;  3KXW A;  2UUA C;  3CQ3 A;  4GXR A;  2DYJ A;  4DV7 C;  4ODJ A;  2QVZ X;  4I9F A;  4PHT A;  4DUZ C;  5IWA C;  2AYA A;  4LF4 C;  2P20 A;  4MH4 A;  3PRO C;  4KTV A;  5BST A;  4R0M A;  4OX9 C;  3J81 D;  4FUQ A;  3R9W A;  1GPM A;  4DR7 C;  3CW8 X;  3UEB A;  5A2Q D;  2D1Q A;  2ONF A;  3O2E A;  5ADZ A;  2VQF C;  4G36 A;  3A9V A;  1FLO A;  2OPL A;  1HNZ C;  3LNO A;  3SO4 A;  3L95 X;  2KZ0 A;  4XX2 A;  2OO4 A;  1VEH A;  3ETO A;  5H9U A;  4D56 A;  4U5Y D;  5GTD A;  4LFC C;  1WCJ A;  5BR8 C;  1M6X A;  5KYT A;  4NDN A;  1T5H X;  1VLA A;  4JI0 C;  4DV6 C;  1XRB A;  4DV5 C;  2BH1 X;  3IEV A;  1AMU A;  4DUY C;  1USP A;  1L2F A;  1HR0 C;  2D1S A;  3GR0 A;  1YGT A;  5CZX A;  2Y27 A;  2MMA B;  1MD9 A;  2OPL B;  2PRO A;  1KKG A;  4JI7 C;  2HHH C;  1ULT A;  3N54 B;  4L4Q A;  4ZJZ A;  1P4E C;  3NPD A;  2P2Q A;  1FUG A;  5FLX D;  4WS9 A;  4BC9 A;  2D7V A;  4RLF A;  2VSQ A;  2F4V C;  2WD9 A;  2Y4O A;  4LFA C;  3GR1 A;  3CQ1 A;  2P2J A;  3TR3 A;  1XNQ C;  2D1R A;  2ZZM A;  2E5L C;  4DCU A;  2E8F A;  1USP B;  5BUS A;  1WH9 A;  2EGT A;  2E8E A;  3R9X A;  4DR1 C;  3FCE A;  2HJG A;  3AY0 A;  5CZV A;  4JI1 C;  5IT9 D;  4YHH C;  5E7Q A;  3VNR A;  1XNR C;  5AE1 A;  2UXD C;  1FJG C;  3J7A D;  3LUS A;  4GS5 A;  4DR4 C;  4TPS B;  2WP0 C;  3I08 A;  3L8C A;  3UX3 A;  1RG9 A;  2VQE C;  5IFI A;  4DV4 C;  2Y4N A;  1O92 A;  4YY3 C;  3AF6 A;  2D28 C;  3TQI A;  1PG4 A;  3T1Y C;  3UZ0 A;  4DCS A;  2XR1 A;  4DR2 C;  4KHP C;  2ZZN A;  4OXI A;  4GXQ A;  4DCT A;  1IBL C;  2YWC A;  5KYV A;  2E0G A;  4L2Z A;  3OTO C;  3B7W A;  4DV3 C;  1IB8 A;  4PZP A;  1MDB A;  4RLQ A;  1O9T A;  4JI2 C;  4EAT A;  2M5O A;  2D27 A;  3H2T A;  5BSM A;  3RV2 A;  2ATW A;  1UWD A;  1NY8 A;  2MM9 A;  1V26 A;  1TH5 A;  2KZF A;  4K0B A;  2M5H A;  3G7S A;  4LF9 C;  4DR6 C;  4B3R C;  2PG1 E;  4BC7 A;  2CY1 A;  3NYQ A;  3K6R A;  4FUT A;  4IZ6 A;  4FTF A;  4PUI A;  4D4G A;  5BUQ A;  4LF7 C;  2PT7 G;  2QVX X;  5DV9 A;  3J80 D;  4B3S C;  4LE5 A;  5KEI A;  1N33 C;  1XRA A;  1BA3 A;  3S82 A;  4RM2 A;  4RMN A;  1I94 C;  5K85 A;  3PBK A;  4PUH A;  5T8T A;  3VNS A;  3A25 A;  4RVO A;  1HNX C;  1V60 A;  1LQL A;  3AF5 A;  4GKK C;  4DG8 A;  5BSW A;  4JM1 A;  1UKK A;  3TUF A;  4NXN C;  1QWI A;  2ZTB A;  4AQY C;  1J5E C;  4NXM C;  4DG9 A;  2E8C A;  5A1I A;  1IBM C;  3N2Q A;  1IBK C;  2YX1 A;  2P2M A;  2P2B A;  3RG2 A;  4MTN A;  4BSZ A;  1XRC A;  2ASB A;  4X65 C;  1ZB9 A;  3VNQ A;  1V25 A;  1M6X C;  1PA4 A;  1XMO C;  2KDN A;  4L7I A;  5LCI A;  5T8S A;  3UOW A;  4HPV A;  1XDX A;  5JRH A;  4JI4 C;  1WF3 A;  4LF6 C;  2BJO A;  3IEU A;  4NOZ A;  1MXB A;  4RVN A;  4KTT A;  4JI8 C;  3A4I A;  1HH2 P;  3NI2 A;  1LCI A;  4DV0 C;  2JNV A;  2UXB C;  3GKU A;  5A1G A;  4JYA C;  2CXC A;  1P4E A;  1EGA A;  3LAX A;  4R1M A;  1P7L A;  3JAM D;  2UXC C;  1PU1 A;  1N32 C;  4X62 C;  5BSU A;  1N34 C;  3EER A;  2V7B A;  3EQ6 A;  1ZB8 A;  2UU9 C;  1MDF A;  3DHV A;  5BUR A;  5LMU C;  1HNW C;  3IML A;  2MCQ A;  2YWB A;  3CQ2 A;  5BSR A;  1N36 C;  3FCC A;  3GPC A;  3A26 A;  4WV3 A;  3TDE A;  3ETC A;  4DCV A;  3I07 A;  3IPL A;  4R1L A;  4K0K C;  5AE2 A;  1O93 A;  2ZM6 C;  3LGX A;  2P2F A;  4RM3 A;  2Z51 A;  1T5D X;  2UUC C;  5A19 A;  2E7G A;  3DLP X;  5LMN C;  1XMQ C;  4JI5 C;  2DHM A;  2VZE A;  1RY2 A;  4LFB C; 
#chains in the Genus database with same CATH homology
 3PES A;  4X64 C;  4GKJ C;  4B3M C;  4DV1 C;  3E7W A;  2D1T A;  1O90 A;  2OBV A;  4D4I A;  5AE3 A;  3CJE A;  3E7X A;  4DR5 C;  4BBY A;  4G37 A;  3DAY A;  1JOS A;  5K8F A;  1NYE A;  2QL8 A;  1ML8 A;  3LNV A;  4DR3 C;  3CW9 A;  4IR7 A;  4LF5 C;  4X66 C;  1MXC A;  5BSV A;  4BCA A;  2PN2 A;  2DPL A;  1N2F A;  3C5E A;  1MKY A;  4PRO C;  1K0R A;  4B3T C;  4G1I A;  1MXA A;  4JV5 C;  4LF8 C;  2JMP A;  1YJ7 A;  2UUB C;  2P02 A;  1QM4 A;  4I9G A;  4OYC A;  4D57 A;  4JI6 C;  2YCB A;  3NYR A;  4ZLP A;  2QVY X;  4DV2 C;  1PG3 A;  3R44 A;  4JI3 C;  3A9U A;  2QW0 X;  3T1H C;  4ISB A;  3KXW A;  2UUA C;  4GXR A;  2DYJ A;  4DV7 C;  4ODJ A;  2QVZ X;  4DUZ C;  4I9F A;  4PHT A;  5IWA C;  2AYA A;  4LF4 C;  2P20 A;  4MH4 A;  3PRO C;  4KTV A;  5BST A;  4R0M A;  4OX9 C;  3J81 D;  4FUQ A;  3R9W A;  1GPM A;  4DR7 C;  3CW8 X;  5A2Q D;  2D1Q A;  2ONF A;  5ADZ A;  2VQF C;  4G36 A;  3A9V A;  2OPL A;  1HNZ C;  3SO4 A;  3L95 X;  4XX2 A;  2OO4 A;  4D56 A;  3ETO A;  5H9U A;  4U5Y D;  5GTD A;  4LFC C;  5BR8 C;  5KYT A;  4NDN A;  1T5H X;  1VLA A;  4JI0 C;  4DV6 C;  1XRB A;  4DV5 C;  2BH1 X;  3IEV A;  1AMU A;  4DUY C;  1USP A;  1L2F A;  1HR0 C;  2D1S A;  3GR0 A;  5CZX A;  2Y27 A;  1MD9 A;  2OPL B;  2PRO A;  1KKG A;  4JI7 C;  2HHH C;  1ULT A;  3N54 B;  4L4Q A;  4ZJZ A;  3NPD A;  2P2Q A;  1FUG A;  5FLX D;  4WS9 A;  4BC9 A;  2D7V A;  4RLF A;  2VSQ A;  2F4V C;  2WD9 A;  2Y4O A;  4LFA C;  3GR1 A;  2P2J A;  1XNQ C;  2D1R A;  2E5L C;  4DCU A;  2E8F A;  1USP B;  5BUS A;  1WH9 A;  2EGT A;  2E8E A;  3R9X A;  4DR1 C;  3FCE A;  2HJG A;  5CZV A;  4JI1 C;  5IT9 D;  4YHH C;  5E7Q A;  3VNR A;  1XNR C;  5AE1 A;  2UXD C;  1FJG C;  3J7A D;  3LUS A;  4GS5 A;  4DR4 C;  4TPS B;  2WP0 C;  3I08 A;  3L8C A;  1RG9 A;  2VQE C;  5IFI A;  4DV4 C;  2Y4N A;  1O92 A;  4YY3 C;  3AF6 A;  2D28 C;  3TQI A;  1PG4 A;  3T1Y C;  3UZ0 A;  4DCS A;  2XR1 A;  4DR2 C;  4KHP C;  4OXI A;  4GXQ A;  4DCT A;  1IBL C;  2YWC A;  5KYV A;  2E0G A;  4L2Z A;  3OTO C;  3B7W A;  4DV3 C;  4PZP A;  1MDB A;  4RLQ A;  1O9T A;  4JI2 C;  4EAT A;  2D27 A;  3H2T A;  5BSM A;  3RV2 A;  2ATW A;  1V26 A;  2KZF A;  4K0B A;  3G7S A;  4LF9 C;  4DR6 C;  4B3R C;  4BC7 A;  2CY1 A;  3NYQ A;  4FUT A;  4IZ6 A;  4FTF A;  4D4G A;  5BUQ A;  4LF7 C;  2PT7 G;  2QVX X;  5DV9 A;  3J80 D;  4B3S C;  4LE5 A;  5KEI A;  1N33 C;  1XRA A;  1BA3 A;  3S82 A;  4RM2 A;  4RMN A;  1I94 C;  5K85 A;  3PBK A;  5T8T A;  3VNS A;  1HNX C;  4RVO A;  1LQL A;  3AF5 A;  4GKK C;  4DG8 A;  5BSW A;  4JM1 A;  1UKK A;  3TUF A;  4NXN C;  1QWI A;  4AQY C;  1J5E C;  4NXM C;  4DG9 A;  2E8C A;  5A1I A;  1IBM C;  3N2Q A;  1IBK C;  2P2M A;  2P2B A;  3RG2 A;  4MTN A;  4BSZ A;  1XRC A;  2ASB A;  4X65 C;  1ZB9 A;  3VNQ A;  1V25 A;  1PA4 A;  1XMO C;  4L7I A;  5T8S A;  3UOW A;  4HPV A;  5JRH A;  4JI4 C;  1WF3 A;  4LF6 C;  2BJO A;  3IEU A;  4NOZ A;  1MXB A;  4RVN A;  4KTT A;  4JI8 C;  3A4I A;  1HH2 P;  3NI2 A;  1LCI A;  4DV0 C;  2UXB C;  3GKU A;  5A1G A;  4JYA C;  2CXC A;  1EGA A;  3LAX A;  4R1M A;  1P7L A;  3JAM D;  2UXC C;  1N32 C;  4X62 C;  5BSU A;  1N34 C;  3EER A;  2V7B A;  3EQ6 A;  1ZB8 A;  2UU9 C;  1MDF A;  3DHV A;  5BUR A;  5LMU C;  1HNW C;  3IML A;  2YWB A;  5BSR A;  1N36 C;  3FCC A;  3GPC A;  4WV3 A;  3TDE A;  3ETC A;  4DCV A;  3I07 A;  3IPL A;  4R1L A;  4K0K C;  5AE2 A;  1O93 A;  2ZM6 C;  3LGX A;  2P2F A;  4RM3 A;  1T5D X;  2UUC C;  5A19 A;  2E7G A;  3DLP X;  5LMN C;  1XMQ C;  4JI5 C;  2VZE A;  1RY2 A;  4LFB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...