1HR0C

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hr0C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hr0C02
1ML8A 2E8FA 1QWIA 3T1YC 4B3SC 1XMOC 4YY3C 4DR3C 2UXCC 2VQFC 1N33C 4LF6C 4JYAC 2YCBA 4DV4C 2BJOA 4LF8C 3EERA 1PA4A 4OX9C 4LFBC 4K0KC 2CXCA 1LQLA 1WF3A 1NYEA 1HNZC 3LUSA 2VQEC 4LF7C 4MTNA 4GKKC 4LFAC 3J81D 2CY1A 2UUCC 1ZB8A 1HH2P 2PT7G 5BR8C 4DV0C 5IT9D 4JV5C 4JI0C 3AF5A 2F4VC 4MH4A 4DV2C 4DR1C 4JI3C 1JOSA 4B3RC 1USPA 2D7VA 3J80D 4DR2C 2KZFA 4DV6C 3T1HC 2XR1A 1ZB9A 2UXBC 4NXNC 4LF4C 2JMPA 4DR6C 4DR7C 1N34C 4JI1C 3IEVA 5IWAC 4LFCC 4JI2C 3R9XA 1FJGC 4KHPC 1N32C 1VLAA 4X65C 3CJEA 3IEUA 2DYJA 1USPB 3JAMD 2ATWA 4XX2A 1I94C 2ZM6C 1IBMC 1EGAA 4JI8C 2E5LC 4YHHC 5FLXD 4LF9C 3I07A 4NXMC 1K0RA 4GKJC 4DUZC 4AQYC 1XNRC 2UXDC 1KKGA 2UUBC 3J7AD 4DV1C 2EGTA 4DR4C 4X62C 1IBKC 4JI4C 1WH9A 1UKKA 5A2QD 4B3MC 1HNWC 4DV7C 2HJGA 4JI7C 1N36C 2OPLB 5LMNC 2OPLA 2QL8A 2PN2A 4DCSA 1MKYA 2ONFA 4LF5C 4DCTA 2E8CA 4BSZA 5LMUC 4DV3C 4NOZA 4DCVA 4JI5C 4DUYC 1HR0C 1HNXC 1J5EC 3AF6A 4DR5C 1XNQC 3OTOC 4DCUA 1XMQC 4X64C 2UUAC 2ASBA 3GKUA 2HHHC 4JI6C 2E7GA 2E8EA 4B3TC 3R9WA 4X66C 2UU9C 1N2FA 1L2FA 4DV5C 1IBLC
chains in the Genus database with same CATH superfamily
1XRCA 2MM9A 1XMOC 4FUTA 2PG1E 3EERA 1PA4A 3H2TA 4LFBC 1WF3A 4GKKC 4MTNA 4PUHA 3CQ3A 3J81D 5BUQA 4D57A 4HPVA 5AE2A 3SO4A 2PROA 3FCCA 4RLQA 4BC9A 4JM1A 4ZLPA 3N54B 4DR2C 4L2ZA 2AYAA 4NXNC 4IR7A 5BSTA 3DLPX 4G1IA 4DR7C 1RY2A 5IWAC 3IEVA 4KTVA 4NDNA 1XHJA 2JNVA 3L8CA 3A4IA 1VLAA 3UX3A 3S82A 2DYJA 3E7XA 1FUGA 3JAMD 5T8TA 2ZM6C 1IBMC 1EGAA 2MCQA 3R44A 5BSVA 1TH5A 4RVOA 1LCIA 2E5LC 4YHHC 4LF9C 1K0RA 2UXDC 4R1LA 4I9GA 4OYCA 4JI4C 2Y4NA 1WH9A 5A2QD 2ZZMA 3B7WA 3CW9A 1M6XA 4DV3C 2D1TA 4BCAA 5K85A 4R0MA 3G7SA 1XMQC 4FUQA 3CQ1A 3TUFA 1T5DX 4JI6C 2E8EA 4B3TC 5AE1A 2UU9C 3RG2A 3LNOA 2QW0X 4DV5C 1IBLC 3IPLA 5ADZA 2UXCC 2VQFC 1N33C 4LF6C 4DV4C 2BJOA 5BUSA 1XRAA 1V26A 1UWDA 5BURA 3VNQA 3GPCA 5T8SA 4PUIA 1NYEA 3UOWA 2VQEC 4LF7C 3A9VA 1O9TA 1WCJA 2CY1A 2DPLA 1HH2P 5BR8C 3FCEA 5CZVA 5IT9D 4JI0C 3AF5A 4MH4A 2P2QA 4JI3C 2D1SA 2OBVA 3A25A 3PROC 1V60A 4WV3A 4DG8A 4GXRA 5GTDA 2UXBC 4D4IA 4LFCC 1P4EA 3R9XA 1FJGC 1N32C 1IB8A 4X65C 4PUGA 3CJEA 5AE3A 1USPB 3VNRA 3DAYA 5BSRA 5IFIA 4OXIA 3LAXA 4D56A 2WD9A 2Y27A 2P2MA 4JI8C 2QVYX 3I07A 4GKJC 3KXWA 4DUZC 2UUBC 2M5OA 3J7AD 5K8FA 2Z51A 2KDNA 4TPSB 2ZTBA 4B3MC 2D27A 4DV7C 2HJGA 3DHVA 2OPLA 4DCSA 4LF5C 4DCTA 3K6RA 2VSQA 1O92A 5LMUC 4GXQA 2M5HA 3NYRA 2D1RA 1J5EC 3AF6A 3OTOC 4DCUA 4X64C 2ASBA 3GKUA 4LE5A 4RMNA 1MDFA 2YX1A 3EQ6A 3LNVA 1L2FA 2D28C 1V25A 1VEHA 1ML8A 1XRBA 4B3SC 2D1QA 4JYAC 1GPMA 4LF8C 5BSUA 3NPDA 1BA3A 1LQLA 1HNZC 4LFAC 2ZZNA 2E0GA 4JV5C 5KEIA 1ULTA 4KTTA 4DV2C 5H9UA 4DR1C 4B3RC 3J80D 2KZFA 4DV6C 3T1HC 2XR1A 1ZB9A 5LCIA 3NI2A 1N34C 5CZXA 4JI1C 3I08A 4R1MA 3A26A 4L4QA 5KYVA 1PU1A 3GR1A 2QVXX 4RVNA 3IEUA 2ATWA 4L7IA 1YJ7A 1NY8A 5FLXD 2YWCA 2P02A 4NXMC 1O93A 2P2JA 4WS9A 2EGTA 4DR4C 1IBKC 2OO4A 4ISBA 5JRHA 4FTFA 1HNWC 4G37A 4JI7C 2OPLB 5LMNC 1P7LA 4ZJZA 3CQ2A 2PN2A 3CW8X 1O90A 2E8CA 1T5HX 1PG4A 1QM4A 4BSZA 1AMUA 4NOZA 4JI5C 3A9UA 2WP0C 1XNQC 3NYQA 2UUAC 3R9WA 2E7GA 4X66C 1N2FA 1MXAA 4DG9A 2E8FA 1QWIA 2NCLA 3T1YC 2CU6A 4YY3C 5A1GA 4DR3C 1M6XC 2YCBA 3AY0A 2KZ0A 3C5EA 4OX9C 4K0KC 2CXCA 3O2EA 3LUSA 1MXBA 2Y4OA 3TDEA 4I9FA 2UUCC 1ZB8A 2PT7G 4DV0C 3PESA 1MXCA 4IZ6A 4BBYA 2BH1X 5DV9A 2F4VC 1PG3A 1JOSA 1USPA 4RM3A 2D7VA 3IMLA 4K0BA 3GR0A 5A1IA 2YWBA 2P2BA 4RLFA 4LF4C 2JMPA 4DR6C 5KYTA 3TR3A 4G36A 3L95X 4JI2C 4BC7A 4KHPC 3UX2A 3E7WA 4PZPA 3UZ0A 1MD9A 4GS5A 1RG9A 5BSMA 3LGXA 4XX2A 1MDBA 1I94C 3UEBA 3N2QA 5A19A 1YGTA 1XDXA 4RM2A 4AQYC 1P4EC 1XNRC 3ETCA 4ODJA 4D4GA 2QVZX 3ETOA 1KKGA 3RV2A 4DV1C 4PROC 4X62C 2MMAB 1UKKA 5E7QA 3VNSA 1N36C 3TQIA 4EATA 2QL8A 3FM7A 2V7BA 2P2FA 1MKYA 2ONFA 3PBKA 1FLOA 2VZEA 4U5YD 4PHTA 4DCVA 5BSWA 4DUYC 1HR0C 1HNXC 4DR5C 1XS3A 2DHMA 2HHHC 2P20A
chains in the Genus database with same CATH topology
1XRCA 1XMOC 4FUTA 3EERA 1PA4A 3H2TA 4LFBC 1WF3A 4GKKC 4MTNA 3J81D 5BUQA 4D57A 4HPVA 5AE2A 3SO4A 2PROA 3FCCA 4RLQA 4BC9A 4JM1A 4ZLPA 3N54B 4DR2C 4L2ZA 2AYAA 4NXNC 4IR7A 5BSTA 3DLPX 4G1IA 4DR7C 1RY2A 5IWAC 3IEVA 4KTVA 4NDNA 3L8CA 3A4IA 1VLAA 3S82A 2DYJA 3E7XA 1FUGA 3JAMD 5T8TA 2ZM6C 1IBMC 1EGAA 3R44A 5BSVA 4RVOA 1LCIA 2E5LC 4YHHC 4LF9C 1K0RA 2UXDC 4R1LA 4I9GA 4OYCA 4JI4C 2Y4NA 1WH9A 5A2QD 3B7WA 3CW9A 4DV3C 2D1TA 4BCAA 5K85A 4R0MA 3G7SA 1XMQC 4FUQA 3TUFA 1T5DX 4JI6C 2E8EA 4B3TC 5AE1A 2UU9C 3RG2A 2QW0X 4DV5C 1IBLC 3IPLA 5ADZA 2UXCC 2VQFC 1N33C 4LF6C 4DV4C 2BJOA 5BUSA 1XRAA 1V26A 5BURA 3VNQA 3GPCA 5T8SA 1NYEA 3UOWA 2VQEC 4LF7C 3A9VA 1O9TA 2CY1A 2DPLA 1HH2P 5BR8C 3FCEA 5CZVA 5IT9D 4JI0C 3AF5A 4MH4A 2P2QA 4JI3C 2D1SA 2OBVA 3PROC 4WV3A 4DG8A 4GXRA 5GTDA 2UXBC 4D4IA 4LFCC 3R9XA 1FJGC 1N32C 4X65C 3CJEA 5AE3A 1USPB 3VNRA 3DAYA 5BSRA 5IFIA 4OXIA 3LAXA 4D56A 2WD9A 2Y27A 2P2MA 4JI8C 2QVYX 3I07A 4GKJC 3KXWA 4DUZC 2UUBC 3J7AD 5K8FA 4TPSB 4B3MC 2D27A 4DV7C 2HJGA 3DHVA 2OPLA 4DCSA 4LF5C 4DCTA 2VSQA 1O92A 5LMUC 4GXQA 3NYRA 2D1RA 1J5EC 3AF6A 3OTOC 4DCUA 4X64C 2ASBA 3GKUA 4LE5A 4RMNA 1MDFA 3EQ6A 3LNVA 1L2FA 2D28C 1V25A 1ML8A 1XRBA 4B3SC 2D1QA 4JYAC 1GPMA 4LF8C 5BSUA 3NPDA 1BA3A 1LQLA 1HNZC 4LFAC 2E0GA 4JV5C 5KEIA 1ULTA 4KTTA 4DV2C 5H9UA 4DR1C 4B3RC 3J80D 2KZFA 4DV6C 3T1HC 2XR1A 1ZB9A 3NI2A 1N34C 5CZXA 4JI1C 3I08A 4R1MA 4L4QA 5KYVA 3GR1A 2QVXX 4RVNA 3IEUA 2ATWA 4L7IA 1YJ7A 5FLXD 2YWCA 2P02A 4NXMC 1O93A 2P2JA 4WS9A 2EGTA 4DR4C 1IBKC 2OO4A 4ISBA 5JRHA 4FTFA 1HNWC 4G37A 4JI7C 2OPLB 5LMNC 1P7LA 4ZJZA 2PN2A 3CW8X 1O90A 2E8CA 1T5HX 1PG4A 1QM4A 4BSZA 1AMUA 4NOZA 4JI5C 3A9UA 2WP0C 1XNQC 3NYQA 2UUAC 3R9WA 2E7GA 4X66C 1N2FA 1MXAA 4DG9A 2E8FA 1QWIA 3T1YC 4YY3C 5A1GA 4DR3C 2YCBA 3C5EA 4OX9C 4K0KC 2CXCA 3LUSA 1MXBA 2Y4OA 3TDEA 4I9FA 2UUCC 1ZB8A 2PT7G 4DV0C 3PESA 1MXCA 4IZ6A 4BBYA 2BH1X 5DV9A 2F4VC 1PG3A 1JOSA 1USPA 4RM3A 2D7VA 3IMLA 4K0BA 3GR0A 5A1IA 2YWBA 2P2BA 4RLFA 4LF4C 2JMPA 4DR6C 5KYTA 4G36A 3L95X 4JI2C 4BC7A 4KHPC 3UZ0A 3E7WA 4PZPA 1MD9A 4GS5A 1RG9A 5BSMA 3LGXA 4XX2A 1MDBA 1I94C 3N2QA 5A19A 4RM2A 4AQYC 1XNRC 3ETCA 4ODJA 4D4GA 2QVZX 3ETOA 1KKGA 3RV2A 4DV1C 4PROC 4X62C 1UKKA 5E7QA 3VNSA 1N36C 3TQIA 4EATA 2QL8A 2V7BA 2P2FA 1MKYA 2ONFA 3PBKA 2VZEA 4U5YD 4PHTA 4DCVA 5BSWA 4DUYC 1HR0C 1HNXC 4DR5C 2HHHC 2P20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  2E8F A;  1QWI A;  3T1Y C;  4B3S C;  1XMO C;  4YY3 C;  4DR3 C;  2UXC C;  2VQF C;  1N33 C;  4LF6 C;  4JYA C;  2YCB A;  4DV4 C;  2BJO A;  4LF8 C;  3EER A;  1PA4 A;  4OX9 C;  4LFB C;  4K0K C;  2CXC A;  1LQL A;  1WF3 A;  1NYE A;  1HNZ C;  3LUS A;  2VQE C;  4LF7 C;  4MTN A;  4GKK C;  4LFA C;  3J81 D;  2CY1 A;  2UUC C;  1ZB8 A;  1HH2 P;  2PT7 G;  5BR8 C;  4DV0 C;  5IT9 D;  4JV5 C;  4JI0 C;  3AF5 A;  2F4V C;  4MH4 A;  4DV2 C;  4DR1 C;  4JI3 C;  1JOS A;  4B3R C;  1USP A;  2D7V A;  3J80 D;  4DR2 C;  2KZF A;  4DV6 C;  3T1H C;  2XR1 A;  1ZB9 A;  2UXB C;  4NXN C;  4LF4 C;  2JMP A;  4DR6 C;  4DR7 C;  1N34 C;  4JI1 C;  3IEV A;  5IWA C;  4LFC C;  4JI2 C;  3R9X A;  1FJG C;  4KHP C;  1N32 C;  1VLA A;  4X65 C;  3CJE A;  3IEU A;  2DYJ A;  1USP B;  3JAM D;  2ATW A;  4XX2 A;  1I94 C;  2ZM6 C;  1IBM C;  1EGA A;  4JI8 C;  2E5L C;  4YHH C;  5FLX D;  4LF9 C;  3I07 A;  4NXM C;  1K0R A;  4GKJ C;  4DUZ C;  4AQY C;  1XNR C;  2UXD C;  1KKG A;  2UUB C;  3J7A D;  4DV1 C;  2EGT A;  4DR4 C;  4X62 C;  1IBK C;  4JI4 C;  1WH9 A;  1UKK A;  5A2Q D;  4B3M C;  1HNW C;  4DV7 C;  2HJG A;  4JI7 C;  1N36 C;  2OPL B;  5LMN C;  2OPL A;  2QL8 A;  2PN2 A;  4DCS A;  1MKY A;  2ONF A;  4LF5 C;  4DCT A;  2E8C A;  4BSZ A;  5LMU C;  4DV3 C;  4NOZ A;  4DCV A;  4JI5 C;  4DUY C;  1HR0 C;  1HNX C;  1J5E C;  3AF6 A;  4DR5 C;  1XNQ C;  3OTO C;  4DCU A;  1XMQ C;  4X64 C;  2UUA C;  2ASB A;  3GKU A;  2HHH C;  4JI6 C;  2E7G A;  2E8E A;  4B3T C;  3R9W A;  4X66 C;  2UU9 C;  1N2F A;  1L2F A;  4DV5 C;  1IBL C; 
#chains in the Genus database with same CATH topology
 1XRC A;  2MM9 A;  1XMO C;  4FUT A;  2PG1 E;  3EER A;  1PA4 A;  3H2T A;  4LFB C;  1WF3 A;  4GKK C;  4MTN A;  4PUH A;  3CQ3 A;  3J81 D;  5BUQ A;  4D57 A;  4HPV A;  5AE2 A;  3SO4 A;  2PRO A;  3FCC A;  4RLQ A;  4BC9 A;  4JM1 A;  4ZLP A;  3N54 B;  4DR2 C;  4L2Z A;  2AYA A;  4NXN C;  4IR7 A;  5BST A;  3DLP X;  4G1I A;  4DR7 C;  1RY2 A;  5IWA C;  3IEV A;  4KTV A;  4NDN A;  1XHJ A;  2JNV A;  3L8C A;  3A4I A;  1VLA A;  3UX3 A;  3S82 A;  2DYJ A;  3E7X A;  1FUG A;  3JAM D;  5T8T A;  2ZM6 C;  1IBM C;  1EGA A;  2MCQ A;  3R44 A;  5BSV A;  1TH5 A;  4RVO A;  1LCI A;  2E5L C;  4YHH C;  4LF9 C;  1K0R A;  2UXD C;  4R1L A;  4I9G A;  4OYC A;  4JI4 C;  2Y4N A;  1WH9 A;  5A2Q D;  2ZZM A;  3B7W A;  3CW9 A;  1M6X A;  4DV3 C;  2D1T A;  4BCA A;  5K85 A;  4R0M A;  3G7S A;  1XMQ C;  4FUQ A;  3CQ1 A;  3TUF A;  1T5D X;  4JI6 C;  2E8E A;  4B3T C;  5AE1 A;  2UU9 C;  3RG2 A;  3LNO A;  2QW0 X;  4DV5 C;  1IBL C;  3IPL A;  5ADZ A;  2UXC C;  2VQF C;  1N33 C;  4LF6 C;  4DV4 C;  2BJO A;  5BUS A;  1XRA A;  1V26 A;  1UWD A;  5BUR A;  3VNQ A;  3GPC A;  5T8S A;  4PUI A;  1NYE A;  3UOW A;  2VQE C;  4LF7 C;  3A9V A;  1O9T A;  1WCJ A;  2CY1 A;  2DPL A;  1HH2 P;  5BR8 C;  3FCE A;  5CZV A;  5IT9 D;  4JI0 C;  3AF5 A;  4MH4 A;  2P2Q A;  4JI3 C;  2D1S A;  2OBV A;  3A25 A;  3PRO C;  1V60 A;  4WV3 A;  4DG8 A;  4GXR A;  5GTD A;  2UXB C;  4D4I A;  4LFC C;  1P4E A;  3R9X A;  1FJG C;  1N32 C;  1IB8 A;  4X65 C;  4PUG A;  3CJE A;  5AE3 A;  1USP B;  3VNR A;  3DAY A;  5BSR A;  5IFI A;  4OXI A;  3LAX A;  4D56 A;  2WD9 A;  2Y27 A;  2P2M A;  4JI8 C;  2QVY X;  3I07 A;  4GKJ C;  3KXW A;  4DUZ C;  2UUB C;  2M5O A;  3J7A D;  5K8F A;  2Z51 A;  2KDN A;  4TPS B;  2ZTB A;  4B3M C;  2D27 A;  4DV7 C;  2HJG A;  3DHV A;  2OPL A;  4DCS A;  4LF5 C;  4DCT A;  3K6R A;  2VSQ A;  1O92 A;  5LMU C;  4GXQ A;  2M5H A;  3NYR A;  2D1R A;  1J5E C;  3AF6 A;  3OTO C;  4DCU A;  4X64 C;  2ASB A;  3GKU A;  4LE5 A;  4RMN A;  1MDF A;  2YX1 A;  3EQ6 A;  3LNV A;  1L2F A;  2D28 C;  1V25 A;  1VEH A;  1ML8 A;  1XRB A;  4B3S C;  2D1Q A;  4JYA C;  1GPM A;  4LF8 C;  5BSU A;  3NPD A;  1BA3 A;  1LQL A;  1HNZ C;  4LFA C;  2ZZN A;  2E0G A;  4JV5 C;  5KEI A;  1ULT A;  4KTT A;  4DV2 C;  5H9U A;  4DR1 C;  4B3R C;  3J80 D;  2KZF A;  4DV6 C;  3T1H C;  2XR1 A;  1ZB9 A;  5LCI A;  3NI2 A;  1N34 C;  5CZX A;  4JI1 C;  3I08 A;  4R1M A;  3A26 A;  4L4Q A;  5KYV A;  1PU1 A;  3GR1 A;  2QVX X;  4RVN A;  3IEU A;  2ATW A;  4L7I A;  1YJ7 A;  1NY8 A;  5FLX D;  2YWC A;  2P02 A;  4NXM C;  1O93 A;  2P2J A;  4WS9 A;  2EGT A;  4DR4 C;  1IBK C;  2OO4 A;  4ISB A;  5JRH A;  4FTF A;  1HNW C;  4G37 A;  4JI7 C;  2OPL B;  5LMN C;  1P7L A;  4ZJZ A;  3CQ2 A;  2PN2 A;  3CW8 X;  1O90 A;  2E8C A;  1T5H X;  1PG4 A;  1QM4 A;  4BSZ A;  1AMU A;  4NOZ A;  4JI5 C;  3A9U A;  2WP0 C;  1XNQ C;  3NYQ A;  2UUA C;  3R9W A;  2E7G A;  4X66 C;  1N2F A;  1MXA A;  4DG9 A;  2E8F A;  1QWI A;  2NCL A;  3T1Y C;  2CU6 A;  4YY3 C;  5A1G A;  4DR3 C;  1M6X C;  2YCB A;  3AY0 A;  2KZ0 A;  3C5E A;  4OX9 C;  4K0K C;  2CXC A;  3O2E A;  3LUS A;  1MXB A;  2Y4O A;  3TDE A;  4I9F A;  2UUC C;  1ZB8 A;  2PT7 G;  4DV0 C;  3PES A;  1MXC A;  4IZ6 A;  4BBY A;  2BH1 X;  5DV9 A;  2F4V C;  1PG3 A;  1JOS A;  1USP A;  4RM3 A;  2D7V A;  3IML A;  4K0B A;  3GR0 A;  5A1I A;  2YWB A;  2P2B A;  4RLF A;  4LF4 C;  2JMP A;  4DR6 C;  5KYT A;  3TR3 A;  4G36 A;  3L95 X;  4JI2 C;  4BC7 A;  4KHP C;  3UX2 A;  3E7W A;  4PZP A;  3UZ0 A;  1MD9 A;  4GS5 A;  1RG9 A;  5BSM A;  3LGX A;  4XX2 A;  1MDB A;  1I94 C;  3UEB A;  3N2Q A;  5A19 A;  1YGT A;  1XDX A;  4RM2 A;  4AQY C;  1P4E C;  1XNR C;  3ETC A;  4ODJ A;  4D4G A;  2QVZ X;  3ETO A;  1KKG A;  3RV2 A;  4DV1 C;  4PRO C;  4X62 C;  2MMA B;  1UKK A;  5E7Q A;  3VNS A;  1N36 C;  3TQI A;  4EAT A;  2QL8 A;  3FM7 A;  2V7B A;  2P2F A;  1MKY A;  2ONF A;  3PBK A;  1FLO A;  2VZE A;  4U5Y D;  4PHT A;  4DCV A;  5BSW A;  4DUY C;  1HR0 C;  1HNX C;  4DR5 C;  1XS3 A;  2DHM A;  2HHH C;  2P20 A; 
#chains in the Genus database with same CATH homology
 1XRC A;  1XMO C;  4FUT A;  3EER A;  1PA4 A;  3H2T A;  4LFB C;  1WF3 A;  4GKK C;  4MTN A;  3J81 D;  5BUQ A;  4D57 A;  4HPV A;  5AE2 A;  3SO4 A;  2PRO A;  3FCC A;  4RLQ A;  4BC9 A;  4JM1 A;  4ZLP A;  3N54 B;  4DR2 C;  4L2Z A;  2AYA A;  4NXN C;  4IR7 A;  5BST A;  3DLP X;  4G1I A;  4DR7 C;  1RY2 A;  5IWA C;  3IEV A;  4KTV A;  4NDN A;  3L8C A;  3A4I A;  1VLA A;  3S82 A;  2DYJ A;  3E7X A;  1FUG A;  3JAM D;  5T8T A;  2ZM6 C;  1IBM C;  1EGA A;  3R44 A;  5BSV A;  4RVO A;  1LCI A;  2E5L C;  4YHH C;  4LF9 C;  1K0R A;  2UXD C;  4R1L A;  4I9G A;  4OYC A;  4JI4 C;  2Y4N A;  1WH9 A;  5A2Q D;  3B7W A;  3CW9 A;  4DV3 C;  2D1T A;  4BCA A;  5K85 A;  4R0M A;  3G7S A;  1XMQ C;  4FUQ A;  3TUF A;  1T5D X;  4JI6 C;  2E8E A;  4B3T C;  5AE1 A;  2UU9 C;  3RG2 A;  2QW0 X;  4DV5 C;  1IBL C;  3IPL A;  5ADZ A;  2UXC C;  2VQF C;  1N33 C;  4LF6 C;  4DV4 C;  2BJO A;  5BUS A;  1XRA A;  1V26 A;  5BUR A;  3VNQ A;  3GPC A;  5T8S A;  1NYE A;  3UOW A;  2VQE C;  4LF7 C;  3A9V A;  1O9T A;  2CY1 A;  2DPL A;  1HH2 P;  5BR8 C;  3FCE A;  5CZV A;  5IT9 D;  4JI0 C;  3AF5 A;  4MH4 A;  2P2Q A;  4JI3 C;  2D1S A;  2OBV A;  3PRO C;  4WV3 A;  4DG8 A;  4GXR A;  5GTD A;  2UXB C;  4D4I A;  4LFC C;  3R9X A;  1FJG C;  1N32 C;  4X65 C;  3CJE A;  5AE3 A;  1USP B;  3VNR A;  3DAY A;  5BSR A;  5IFI A;  4OXI A;  3LAX A;  4D56 A;  2WD9 A;  2Y27 A;  2P2M A;  4JI8 C;  2QVY X;  3I07 A;  4GKJ C;  3KXW A;  4DUZ C;  2UUB C;  3J7A D;  5K8F A;  4TPS B;  4B3M C;  2D27 A;  4DV7 C;  2HJG A;  3DHV A;  2OPL A;  4DCS A;  4LF5 C;  4DCT A;  2VSQ A;  1O92 A;  5LMU C;  4GXQ A;  3NYR A;  2D1R A;  1J5E C;  3AF6 A;  3OTO C;  4DCU A;  4X64 C;  2ASB A;  3GKU A;  4LE5 A;  4RMN A;  1MDF A;  3EQ6 A;  3LNV A;  1L2F A;  2D28 C;  1V25 A;  1ML8 A;  1XRB A;  4B3S C;  2D1Q A;  4JYA C;  1GPM A;  4LF8 C;  5BSU A;  3NPD A;  1BA3 A;  1LQL A;  1HNZ C;  4LFA C;  2E0G A;  4JV5 C;  5KEI A;  1ULT A;  4KTT A;  4DV2 C;  5H9U A;  4DR1 C;  4B3R C;  3J80 D;  2KZF A;  4DV6 C;  3T1H C;  2XR1 A;  1ZB9 A;  3NI2 A;  1N34 C;  5CZX A;  4JI1 C;  3I08 A;  4R1M A;  4L4Q A;  5KYV A;  3GR1 A;  2QVX X;  4RVN A;  3IEU A;  2ATW A;  4L7I A;  1YJ7 A;  5FLX D;  2YWC A;  2P02 A;  4NXM C;  1O93 A;  2P2J A;  4WS9 A;  2EGT A;  4DR4 C;  1IBK C;  2OO4 A;  4ISB A;  5JRH A;  4FTF A;  1HNW C;  4G37 A;  4JI7 C;  2OPL B;  5LMN C;  1P7L A;  4ZJZ A;  2PN2 A;  3CW8 X;  1O90 A;  2E8C A;  1T5H X;  1PG4 A;  1QM4 A;  4BSZ A;  1AMU A;  4NOZ A;  4JI5 C;  3A9U A;  2WP0 C;  1XNQ C;  3NYQ A;  2UUA C;  3R9W A;  2E7G A;  4X66 C;  1N2F A;  1MXA A;  4DG9 A;  2E8F A;  1QWI A;  3T1Y C;  4YY3 C;  5A1G A;  4DR3 C;  2YCB A;  3C5E A;  4OX9 C;  4K0K C;  2CXC A;  3LUS A;  1MXB A;  2Y4O A;  3TDE A;  4I9F A;  2UUC C;  1ZB8 A;  2PT7 G;  4DV0 C;  3PES A;  1MXC A;  4IZ6 A;  4BBY A;  2BH1 X;  5DV9 A;  2F4V C;  1PG3 A;  1JOS A;  1USP A;  4RM3 A;  2D7V A;  3IML A;  4K0B A;  3GR0 A;  5A1I A;  2YWB A;  2P2B A;  4RLF A;  4LF4 C;  2JMP A;  4DR6 C;  5KYT A;  4G36 A;  3L95 X;  4JI2 C;  4BC7 A;  4KHP C;  3UZ0 A;  3E7W A;  4PZP A;  1MD9 A;  4GS5 A;  1RG9 A;  5BSM A;  3LGX A;  4XX2 A;  1MDB A;  1I94 C;  3N2Q A;  5A19 A;  4RM2 A;  4AQY C;  1XNR C;  3ETC A;  4ODJ A;  4D4G A;  2QVZ X;  3ETO A;  1KKG A;  3RV2 A;  4DV1 C;  4PRO C;  4X62 C;  1UKK A;  5E7Q A;  3VNS A;  1N36 C;  3TQI A;  4EAT A;  2QL8 A;  2V7B A;  2P2F A;  1MKY A;  2ONF A;  3PBK A;  2VZE A;  4U5Y D;  4PHT A;  4DCV A;  5BSW A;  4DUY C;  1HR0 C;  1HNX C;  4DR5 C;  2HHH C;  2P20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...