1HR0C

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hr0C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hr0C02
2BJOA 1WH9A 3EERA 2ZM6C 4LF9C 4MH4A 2UU9C 3CJEA 4LF8C 4OX9C 1ZB9A 4DV1C 2JMPA 1ML8A 5FLXD 4NOZA 1N2FA 1IBMC 2OPLA 3AF5A 4BSZA 1N34C 1HNXC 5IT9D 3JAMD 4KHPC 4DCSA 4GKKC 4K0KC 4DCTA 2YCBA 4JI8C 4LFCC 1WF3A 3T1YC 1HNZC 1MKYA 1J5EC 2UXCC 2CY1A 2PN2A 4JI1C 2XR1A 2D7VA 4DV6C 1XMOC 2E5LC 1IBKC 1IBLC 4DCUA 4DV5C 4NXNC 1L2FA 1PA4A 4LF4C 1VLAA 2VQEC 4AQYC 4B3RC 3R9XA 4YY3C 4DR7C 2DYJA 1FJGC 2E8CA 2HHHC 4B3SC 1NYEA 2QL8A 4DR4C 3T1HC 1HH2P 4B3MC 3IEVA 2ASBA 2CXCA 3R9WA 1K0RA 1HR0C 4YHHC 4LFBC 4JI5C 4JI0C 2UXBC 4XX2A 4B3TC 2ONFA 1UKKA 2E8EA 4DR3C 4DV2C 1JOSA 4DUYC 1EGAA 5LMUC 4DUZC 4X66C 2E7GA 1XMQC 4LF5C 4JYAC 5BR8C 3OTOC 2KZFA 4DR6C 4JI4C 1XNQC 5A2QD 2E8FA 2VQFC 3I07A 5LMNC 2UUBC 4DR2C 1I94C 4JI7C 4MTNA 3J81D 4JV5C 4DV4C 3J80D 4LF7C 2UXDC 4GKJC 2PT7G 1XNRC 2ATWA 4X65C 4DV0C 4DV3C 3LUSA 1ZB8A 4JI3C 2OPLB 2HJGA 3IEUA 5IWAC 4DV7C 2UUCC 1USPB 3AF6A 1QWIA 2EGTA 4LF6C 4X62C 2UUAC 4LFAC 1KKGA 1N32C 1LQLA 1USPA 4JI2C 4NXMC 4DR1C 2F4VC 4DR5C 1N33C 4JI6C 3GKUA 4X64C 1HNWC 1N36C 4DCVA 3J7AD
chains in the Genus database with same CATH superfamily
1WH9A 4LF9C 3UZ0A 5ADZA 4OYCA 3TDEA 3DLPX 5BSVA 5BSMA 3A9UA 3CJEA 3DHVA 1QM4A 5FLXD 2D1QA 1PU1A 2Y4OA 1FLOA 4D56A 1YGTA 3AF5A 5AE1A 4KTVA 5IT9D 2DHMA 4FUQA 4KHPC 4R1LA 3NYRA 4DG8A 2D28C 2QVYX 1J5EC 2PN2A 4RLFA 3H2TA 2XR1A 5BSUA 1V25A 1O92A 2WD9A 4DV6C 1XMOC 2CU6A 1IBLC 2Y4NA 4NXNC 3R9XA 4YY3C 1FJGC 2P2BA 1PG3A 1ULTA 1NYEA 1M6XC 1O93A 3T1HC 3L95X 4B3MC 2ASBA 2CXCA 1GPMA 4RM2A 5KEIA 2E8EA 5LCIA 5BSTA 4DUYC 1XDXA 5AE2A 4LF5C 5BR8C 4JI4C 2Z51A 1FUGA 3S82A 2VZEA 3LNVA 2VQFC 3I07A 5LMNC 4DR2C 1I94C 3LNOA 4MTNA 3VNSA 3TUFA 2PT7G 1XNRC 5CZXA 2ATWA 1IB8A 3LUSA 2PROA 3SO4A 3LGXA 2UUCC 3AF6A 4R1MA 3IPLA 2EGTA 3N2QA 2UUAC 4LFAC 1N32C 1LQLA 4DR5C 5K8FA 3CW8X 4JI6C 3GKUA 1N36C 3J7AD 2BJOA 3R44A 2MM9A 4MH4A 3B7WA 4DV1C 4GXRA 2JMPA 1ML8A 1N2FA 3A9VA 1IBMC 1TH5A 1XRCA 3JAMD 3ETOA 4DCSA 5BSWA 5DV9A 4GKKC 2WP0C 2ZZNA 4LFCC 3T1YC 1MKYA 2D1SA 4GS5A 2BH1X 1IBKC 3TR3A 3CQ1A 1L2FA 3GR1A 2MMAB 5A19A 2E8CA 3GPCA 2HHHC 4B3SC 2P2QA 1P4EC 1HH2P 3IEVA 3R9WA 3E7XA 4JI5C 4FTFA 1UKKA 4DV2C 3UOWA 3NPDA 5LMUC 4DUZC 3K6RA 4D57A 4PROC 1XMQC 2PG1E 3OTOC 2KZFA 5GTDA 1XNQC 2D27A 3DAYA 3A26A 4JV5C 4DV4C 4NDNA 5BSRA 4EATA 2ZZMA 4JM1A 3GR0A 2YX1A 5T8SA 2MCQA 4RVNA 4X65C 1ZB8A 4TPSB 2P2MA 3IEUA 1USPB 5H9UA 1WCJA 4BC9A 1QWIA 4D4IA 5A1IA 4ODJA 4LF6C 1MDBA 3UEBA 1KKGA 4NXMC 4PUGA 3A4IA 1PG4A 1N33C 4X64C 1HNWC 3NI2A 2P20A 2ZM6C 3VNRA 4R0MA 2UU9C 4LF8C 4IZ6A 4OX9C 1ZB9A 4PHTA 3PBKA 1UWDA 4ZJZA 4NOZA 2OPLA 4BSZA 4PUIA 1N34C 1HNXC 1BA3A 4HPVA 2P2FA 4DCTA 1P7LA 2E0GA 2UXCC 2CY1A 2M5HA 1M6XA 3VNQA 2D7VA 3E7WA 4DV5C 1XHJA 3UX3A 1PA4A 4IR7A 3TQIA 4KTTA 2DYJA 3CW9A 1T5HX 1XRBA 4DR4C 3I08A 4RM3A 5BUQA 3A25A 2D1TA 4BBYA 3FCCA 1HR0C 4L4QA 4LFBC 1O90A 2ONFA 1JOSA 5JRHA 1EGAA 4JYAC 4I9FA 4DR6C 4U5YD 3UX2A 2ZTBA 3CQ2A 2NCLA 1XRAA 4I9GA 2VSQA 1AMUA 5IFIA 1XS3A 4BC7A 2DPLA 4G1IA 3J80D 2UXDC 5AE3A 3C5EA 2M5OA 3N54B 1T5DX 2QVZX 4DV3C 2QW0X 4JI3C 2HJGA 5A1GA 4D4GA 4G36A 3KXWA 2AYAA 1USPA 4DR1C 2KDNA 2F4VC 1VEHA 2YWCA 4RVOA 2OO4A 4G37A 5CZVA 3EERA 1MXAA 4RMNA 3FM7A 4ISBA 5K85A 5T8TA 5KYVA 4WS9A 1V60A 1YJ7A 3NYQA 4K0KC 1V26A 2YCBA 4JI8C 1WF3A 1HNZC 4L2ZA 4JI1C 1P4EA 2JNVA 4PUHA 1O9TA 2E5LC 1RG9A 3G7SA 4DCUA 4DG9A 1LCIA 4LF4C 2V7BA 1VLAA 2VQEC 4AQYC 4B3RC 3PROC 4DR7C 4BCAA 5BUSA 2QL8A 4ZLPA 3PESA 1K0RA 4YHHC 2P2JA 4JI0C 2UXBC 4XX2A 1RY2A 4B3TC 3LAXA 4DR3C 3L8CA 4L7IA 2OBVA 2YWBA 4X66C 2E7GA 2Y27A 3ETCA 3FCEA 3AY0A 5E7QA 1MXBA 5A2QD 2E8FA 2UUBC 3RV2A 4JI7C 3J81D 3IMLA 3EQ6A 4LF7C 2KZ0A 4OXIA 4GKJC 4LE5A 1MDFA 1NY8A 4DV0C 2P02A 2OPLB 5IWAC 4DV7C 4RLQA 1MXCA 4GXQA 4FUTA 5BURA 3O2EA 4X62C 3CQ3A 4WV3A 4PZPA 2D1RA 4JI2C 4K0BA 1MD9A 2QVXX 4DCVA 5KYTA 3RG2A
chains in the Genus database with same CATH topology
1WH9A 4LF9C 3UZ0A 5ADZA 4OYCA 3TDEA 3DLPX 5BSVA 5BSMA 3A9UA 3CJEA 3DHVA 1QM4A 5FLXD 2D1QA 2Y4OA 4D56A 3AF5A 5AE1A 4KTVA 5IT9D 4FUQA 4KHPC 4R1LA 3NYRA 4DG8A 2D28C 2QVYX 1J5EC 2PN2A 4RLFA 3H2TA 2XR1A 5BSUA 1V25A 1O92A 2WD9A 4DV6C 1XMOC 1IBLC 2Y4NA 4NXNC 3R9XA 4YY3C 1FJGC 2P2BA 1PG3A 1ULTA 1NYEA 1O93A 3T1HC 3L95X 4B3MC 2ASBA 2CXCA 1GPMA 4RM2A 5KEIA 2E8EA 5BSTA 4DUYC 5AE2A 4LF5C 5BR8C 4JI4C 1FUGA 3S82A 2VZEA 3LNVA 2VQFC 3I07A 5LMNC 4DR2C 1I94C 4MTNA 3VNSA 3TUFA 2PT7G 1XNRC 5CZXA 2ATWA 3LUSA 2PROA 3SO4A 3LGXA 2UUCC 3AF6A 4R1MA 3IPLA 2EGTA 3N2QA 2UUAC 4LFAC 1N32C 1LQLA 4DR5C 5K8FA 3CW8X 4JI6C 3GKUA 1N36C 3J7AD 2BJOA 3R44A 4MH4A 3B7WA 4DV1C 4GXRA 2JMPA 1ML8A 1N2FA 3A9VA 1IBMC 1XRCA 3JAMD 3ETOA 4DCSA 5BSWA 5DV9A 4GKKC 2WP0C 4LFCC 3T1YC 1MKYA 2D1SA 4GS5A 2BH1X 1IBKC 1L2FA 3GR1A 5A19A 2E8CA 3GPCA 2HHHC 4B3SC 2P2QA 1HH2P 3IEVA 3R9WA 3E7XA 4JI5C 4FTFA 1UKKA 4DV2C 3UOWA 3NPDA 5LMUC 4DUZC 4D57A 4PROC 1XMQC 3OTOC 2KZFA 5GTDA 1XNQC 2D27A 3DAYA 4JV5C 4DV4C 4NDNA 5BSRA 4EATA 4JM1A 3GR0A 5T8SA 4RVNA 4X65C 1ZB8A 4TPSB 2P2MA 3IEUA 1USPB 5H9UA 4BC9A 1QWIA 4D4IA 5A1IA 4ODJA 4LF6C 1MDBA 1KKGA 4NXMC 3A4IA 1PG4A 1N33C 4X64C 1HNWC 3NI2A 2P20A 2ZM6C 3VNRA 4R0MA 2UU9C 4LF8C 4IZ6A 4OX9C 1ZB9A 4PHTA 3PBKA 4ZJZA 4NOZA 2OPLA 4BSZA 1N34C 1HNXC 1BA3A 4HPVA 2P2FA 4DCTA 1P7LA 2E0GA 2UXCC 2CY1A 3VNQA 2D7VA 3E7WA 4DV5C 1PA4A 4IR7A 3TQIA 4KTTA 2DYJA 3CW9A 1T5HX 1XRBA 4DR4C 3I08A 4RM3A 5BUQA 2D1TA 4BBYA 3FCCA 1HR0C 4L4QA 4LFBC 1O90A 2ONFA 1JOSA 5JRHA 1EGAA 4JYAC 4I9FA 4DR6C 4U5YD 1XRAA 4I9GA 2VSQA 1AMUA 5IFIA 4BC7A 2DPLA 4G1IA 3J80D 2UXDC 5AE3A 3C5EA 3N54B 1T5DX 2QVZX 4DV3C 2QW0X 4JI3C 2HJGA 5A1GA 4D4GA 4G36A 3KXWA 2AYAA 1USPA 4DR1C 2F4VC 2YWCA 4RVOA 2OO4A 4G37A 5CZVA 3EERA 1MXAA 4RMNA 4ISBA 5K85A 5T8TA 5KYVA 4WS9A 1YJ7A 3NYQA 4K0KC 1V26A 2YCBA 4JI8C 1WF3A 1HNZC 4L2ZA 4JI1C 1O9TA 2E5LC 1RG9A 3G7SA 4DCUA 4DG9A 1LCIA 4LF4C 2V7BA 1VLAA 2VQEC 4AQYC 4B3RC 3PROC 4DR7C 4BCAA 5BUSA 2QL8A 4ZLPA 3PESA 1K0RA 4YHHC 2P2JA 4JI0C 2UXBC 4XX2A 1RY2A 4B3TC 3LAXA 4DR3C 3L8CA 4L7IA 2OBVA 2YWBA 4X66C 2E7GA 2Y27A 3ETCA 3FCEA 5E7QA 1MXBA 5A2QD 2E8FA 2UUBC 3RV2A 4JI7C 3J81D 3IMLA 3EQ6A 4LF7C 4OXIA 4GKJC 4LE5A 1MDFA 4DV0C 2P02A 2OPLB 5IWAC 4DV7C 4RLQA 1MXCA 4GXQA 4FUTA 5BURA 4X62C 4WV3A 4PZPA 2D1RA 4JI2C 4K0BA 1MD9A 2QVXX 4DCVA 5KYTA 3RG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJO A;  1WH9 A;  3EER A;  2ZM6 C;  4LF9 C;  4MH4 A;  2UU9 C;  3CJE A;  4LF8 C;  4OX9 C;  1ZB9 A;  4DV1 C;  2JMP A;  1ML8 A;  5FLX D;  4NOZ A;  1N2F A;  1IBM C;  2OPL A;  3AF5 A;  4BSZ A;  1N34 C;  1HNX C;  5IT9 D;  3JAM D;  4KHP C;  4DCS A;  4GKK C;  4K0K C;  4DCT A;  2YCB A;  4JI8 C;  4LFC C;  1WF3 A;  3T1Y C;  1HNZ C;  1MKY A;  1J5E C;  2UXC C;  2CY1 A;  2PN2 A;  4JI1 C;  2XR1 A;  2D7V A;  4DV6 C;  1XMO C;  2E5L C;  1IBK C;  1IBL C;  4DCU A;  4DV5 C;  4NXN C;  1L2F A;  1PA4 A;  4LF4 C;  1VLA A;  2VQE C;  4AQY C;  4B3R C;  3R9X A;  4YY3 C;  4DR7 C;  2DYJ A;  1FJG C;  2E8C A;  2HHH C;  4B3S C;  1NYE A;  2QL8 A;  4DR4 C;  3T1H C;  1HH2 P;  4B3M C;  3IEV A;  2ASB A;  2CXC A;  3R9W A;  1K0R A;  1HR0 C;  4YHH C;  4LFB C;  4JI5 C;  4JI0 C;  2UXB C;  4XX2 A;  4B3T C;  2ONF A;  1UKK A;  2E8E A;  4DR3 C;  4DV2 C;  1JOS A;  4DUY C;  1EGA A;  5LMU C;  4DUZ C;  4X66 C;  2E7G A;  1XMQ C;  4LF5 C;  4JYA C;  5BR8 C;  3OTO C;  2KZF A;  4DR6 C;  4JI4 C;  1XNQ C;  5A2Q D;  2E8F A;  2VQF C;  3I07 A;  5LMN C;  2UUB C;  4DR2 C;  1I94 C;  4JI7 C;  4MTN A;  3J81 D;  4JV5 C;  4DV4 C;  3J80 D;  4LF7 C;  2UXD C;  4GKJ C;  2PT7 G;  1XNR C;  2ATW A;  4X65 C;  4DV0 C;  4DV3 C;  3LUS A;  1ZB8 A;  4JI3 C;  2OPL B;  2HJG A;  3IEU A;  5IWA C;  4DV7 C;  2UUC C;  1USP B;  3AF6 A;  1QWI A;  2EGT A;  4LF6 C;  4X62 C;  2UUA C;  4LFA C;  1KKG A;  1N32 C;  1LQL A;  1USP A;  4JI2 C;  4NXM C;  4DR1 C;  2F4V C;  4DR5 C;  1N33 C;  4JI6 C;  3GKU A;  4X64 C;  1HNW C;  1N36 C;  4DCV A;  3J7A D; 
#chains in the Genus database with same CATH topology
 1WH9 A;  4LF9 C;  3UZ0 A;  5ADZ A;  4OYC A;  3TDE A;  3DLP X;  5BSV A;  5BSM A;  3A9U A;  3CJE A;  3DHV A;  1QM4 A;  5FLX D;  2D1Q A;  1PU1 A;  2Y4O A;  1FLO A;  4D56 A;  1YGT A;  3AF5 A;  5AE1 A;  4KTV A;  5IT9 D;  2DHM A;  4FUQ A;  4KHP C;  4R1L A;  3NYR A;  4DG8 A;  2D28 C;  2QVY X;  1J5E C;  2PN2 A;  4RLF A;  3H2T A;  2XR1 A;  5BSU A;  1V25 A;  1O92 A;  2WD9 A;  4DV6 C;  1XMO C;  2CU6 A;  1IBL C;  2Y4N A;  4NXN C;  3R9X A;  4YY3 C;  1FJG C;  2P2B A;  1PG3 A;  1ULT A;  1NYE A;  1M6X C;  1O93 A;  3T1H C;  3L95 X;  4B3M C;  2ASB A;  2CXC A;  1GPM A;  4RM2 A;  5KEI A;  2E8E A;  5LCI A;  5BST A;  4DUY C;  1XDX A;  5AE2 A;  4LF5 C;  5BR8 C;  4JI4 C;  2Z51 A;  1FUG A;  3S82 A;  2VZE A;  3LNV A;  2VQF C;  3I07 A;  5LMN C;  4DR2 C;  1I94 C;  3LNO A;  4MTN A;  3VNS A;  3TUF A;  2PT7 G;  1XNR C;  5CZX A;  2ATW A;  1IB8 A;  3LUS A;  2PRO A;  3SO4 A;  3LGX A;  2UUC C;  3AF6 A;  4R1M A;  3IPL A;  2EGT A;  3N2Q A;  2UUA C;  4LFA C;  1N32 C;  1LQL A;  4DR5 C;  5K8F A;  3CW8 X;  4JI6 C;  3GKU A;  1N36 C;  3J7A D;  2BJO A;  3R44 A;  2MM9 A;  4MH4 A;  3B7W A;  4DV1 C;  4GXR A;  2JMP A;  1ML8 A;  1N2F A;  3A9V A;  1IBM C;  1TH5 A;  1XRC A;  3JAM D;  3ETO A;  4DCS A;  5BSW A;  5DV9 A;  4GKK C;  2WP0 C;  2ZZN A;  4LFC C;  3T1Y C;  1MKY A;  2D1S A;  4GS5 A;  2BH1 X;  1IBK C;  3TR3 A;  3CQ1 A;  1L2F A;  3GR1 A;  2MMA B;  5A19 A;  2E8C A;  3GPC A;  2HHH C;  4B3S C;  2P2Q A;  1P4E C;  1HH2 P;  3IEV A;  3R9W A;  3E7X A;  4JI5 C;  4FTF A;  1UKK A;  4DV2 C;  3UOW A;  3NPD A;  5LMU C;  4DUZ C;  3K6R A;  4D57 A;  4PRO C;  1XMQ C;  2PG1 E;  3OTO C;  2KZF A;  5GTD A;  1XNQ C;  2D27 A;  3DAY A;  3A26 A;  4JV5 C;  4DV4 C;  4NDN A;  5BSR A;  4EAT A;  2ZZM A;  4JM1 A;  3GR0 A;  2YX1 A;  5T8S A;  2MCQ A;  4RVN A;  4X65 C;  1ZB8 A;  4TPS B;  2P2M A;  3IEU A;  1USP B;  5H9U A;  1WCJ A;  4BC9 A;  1QWI A;  4D4I A;  5A1I A;  4ODJ A;  4LF6 C;  1MDB A;  3UEB A;  1KKG A;  4NXM C;  4PUG A;  3A4I A;  1PG4 A;  1N33 C;  4X64 C;  1HNW C;  3NI2 A;  2P20 A;  2ZM6 C;  3VNR A;  4R0M A;  2UU9 C;  4LF8 C;  4IZ6 A;  4OX9 C;  1ZB9 A;  4PHT A;  3PBK A;  1UWD A;  4ZJZ A;  4NOZ A;  2OPL A;  4BSZ A;  4PUI A;  1N34 C;  1HNX C;  1BA3 A;  4HPV A;  2P2F A;  4DCT A;  1P7L A;  2E0G A;  2UXC C;  2CY1 A;  2M5H A;  1M6X A;  3VNQ A;  2D7V A;  3E7W A;  4DV5 C;  1XHJ A;  3UX3 A;  1PA4 A;  4IR7 A;  3TQI A;  4KTT A;  2DYJ A;  3CW9 A;  1T5H X;  1XRB A;  4DR4 C;  3I08 A;  4RM3 A;  5BUQ A;  3A25 A;  2D1T A;  4BBY A;  3FCC A;  1HR0 C;  4L4Q A;  4LFB C;  1O90 A;  2ONF A;  1JOS A;  5JRH A;  1EGA A;  4JYA C;  4I9F A;  4DR6 C;  4U5Y D;  3UX2 A;  2ZTB A;  3CQ2 A;  2NCL A;  1XRA A;  4I9G A;  2VSQ A;  1AMU A;  5IFI A;  1XS3 A;  4BC7 A;  2DPL A;  4G1I A;  3J80 D;  2UXD C;  5AE3 A;  3C5E A;  2M5O A;  3N54 B;  1T5D X;  2QVZ X;  4DV3 C;  2QW0 X;  4JI3 C;  2HJG A;  5A1G A;  4D4G A;  4G36 A;  3KXW A;  2AYA A;  1USP A;  4DR1 C;  2KDN A;  2F4V C;  1VEH A;  2YWC A;  4RVO A;  2OO4 A;  4G37 A;  5CZV A;  3EER A;  1MXA A;  4RMN A;  3FM7 A;  4ISB A;  5K85 A;  5T8T A;  5KYV A;  4WS9 A;  1V60 A;  1YJ7 A;  3NYQ A;  4K0K C;  1V26 A;  2YCB A;  4JI8 C;  1WF3 A;  1HNZ C;  4L2Z A;  4JI1 C;  1P4E A;  2JNV A;  4PUH A;  1O9T A;  2E5L C;  1RG9 A;  3G7S A;  4DCU A;  4DG9 A;  1LCI A;  4LF4 C;  2V7B A;  1VLA A;  2VQE C;  4AQY C;  4B3R C;  3PRO C;  4DR7 C;  4BCA A;  5BUS A;  2QL8 A;  4ZLP A;  3PES A;  1K0R A;  4YHH C;  2P2J A;  4JI0 C;  2UXB C;  4XX2 A;  1RY2 A;  4B3T C;  3LAX A;  4DR3 C;  3L8C A;  4L7I A;  2OBV A;  2YWB A;  4X66 C;  2E7G A;  2Y27 A;  3ETC A;  3FCE A;  3AY0 A;  5E7Q A;  1MXB A;  5A2Q D;  2E8F A;  2UUB C;  3RV2 A;  4JI7 C;  3J81 D;  3IML A;  3EQ6 A;  4LF7 C;  2KZ0 A;  4OXI A;  4GKJ C;  4LE5 A;  1MDF A;  1NY8 A;  4DV0 C;  2P02 A;  2OPL B;  5IWA C;  4DV7 C;  4RLQ A;  1MXC A;  4GXQ A;  4FUT A;  5BUR A;  3O2E A;  4X62 C;  3CQ3 A;  4WV3 A;  4PZP A;  2D1R A;  4JI2 C;  4K0B A;  1MD9 A;  2QVX X;  4DCV A;  5KYT A;  3RG2 A; 
#chains in the Genus database with same CATH homology
 1WH9 A;  4LF9 C;  3UZ0 A;  5ADZ A;  4OYC A;  3TDE A;  3DLP X;  5BSV A;  5BSM A;  3A9U A;  3CJE A;  3DHV A;  1QM4 A;  5FLX D;  2D1Q A;  2Y4O A;  4D56 A;  3AF5 A;  5AE1 A;  4KTV A;  5IT9 D;  4FUQ A;  4KHP C;  4R1L A;  3NYR A;  4DG8 A;  2D28 C;  2QVY X;  1J5E C;  2PN2 A;  4RLF A;  3H2T A;  2XR1 A;  5BSU A;  1V25 A;  1O92 A;  2WD9 A;  4DV6 C;  1XMO C;  1IBL C;  2Y4N A;  4NXN C;  3R9X A;  4YY3 C;  1FJG C;  2P2B A;  1PG3 A;  1ULT A;  1NYE A;  1O93 A;  3T1H C;  3L95 X;  4B3M C;  2ASB A;  2CXC A;  1GPM A;  4RM2 A;  5KEI A;  2E8E A;  5BST A;  4DUY C;  5AE2 A;  4LF5 C;  5BR8 C;  4JI4 C;  1FUG A;  3S82 A;  2VZE A;  3LNV A;  2VQF C;  3I07 A;  5LMN C;  4DR2 C;  1I94 C;  4MTN A;  3VNS A;  3TUF A;  2PT7 G;  1XNR C;  5CZX A;  2ATW A;  3LUS A;  2PRO A;  3SO4 A;  3LGX A;  2UUC C;  3AF6 A;  4R1M A;  3IPL A;  2EGT A;  3N2Q A;  2UUA C;  4LFA C;  1N32 C;  1LQL A;  4DR5 C;  5K8F A;  3CW8 X;  4JI6 C;  3GKU A;  1N36 C;  3J7A D;  2BJO A;  3R44 A;  4MH4 A;  3B7W A;  4DV1 C;  4GXR A;  2JMP A;  1ML8 A;  1N2F A;  3A9V A;  1IBM C;  1XRC A;  3JAM D;  3ETO A;  4DCS A;  5BSW A;  5DV9 A;  4GKK C;  2WP0 C;  4LFC C;  3T1Y C;  1MKY A;  2D1S A;  4GS5 A;  2BH1 X;  1IBK C;  1L2F A;  3GR1 A;  5A19 A;  2E8C A;  3GPC A;  2HHH C;  4B3S C;  2P2Q A;  1HH2 P;  3IEV A;  3R9W A;  3E7X A;  4JI5 C;  4FTF A;  1UKK A;  4DV2 C;  3UOW A;  3NPD A;  5LMU C;  4DUZ C;  4D57 A;  4PRO C;  1XMQ C;  3OTO C;  2KZF A;  5GTD A;  1XNQ C;  2D27 A;  3DAY A;  4JV5 C;  4DV4 C;  4NDN A;  5BSR A;  4EAT A;  4JM1 A;  3GR0 A;  5T8S A;  4RVN A;  4X65 C;  1ZB8 A;  4TPS B;  2P2M A;  3IEU A;  1USP B;  5H9U A;  4BC9 A;  1QWI A;  4D4I A;  5A1I A;  4ODJ A;  4LF6 C;  1MDB A;  1KKG A;  4NXM C;  3A4I A;  1PG4 A;  1N33 C;  4X64 C;  1HNW C;  3NI2 A;  2P20 A;  2ZM6 C;  3VNR A;  4R0M A;  2UU9 C;  4LF8 C;  4IZ6 A;  4OX9 C;  1ZB9 A;  4PHT A;  3PBK A;  4ZJZ A;  4NOZ A;  2OPL A;  4BSZ A;  1N34 C;  1HNX C;  1BA3 A;  4HPV A;  2P2F A;  4DCT A;  1P7L A;  2E0G A;  2UXC C;  2CY1 A;  3VNQ A;  2D7V A;  3E7W A;  4DV5 C;  1PA4 A;  4IR7 A;  3TQI A;  4KTT A;  2DYJ A;  3CW9 A;  1T5H X;  1XRB A;  4DR4 C;  3I08 A;  4RM3 A;  5BUQ A;  2D1T A;  4BBY A;  3FCC A;  1HR0 C;  4L4Q A;  4LFB C;  1O90 A;  2ONF A;  1JOS A;  5JRH A;  1EGA A;  4JYA C;  4I9F A;  4DR6 C;  4U5Y D;  1XRA A;  4I9G A;  2VSQ A;  1AMU A;  5IFI A;  4BC7 A;  2DPL A;  4G1I A;  3J80 D;  2UXD C;  5AE3 A;  3C5E A;  3N54 B;  1T5D X;  2QVZ X;  4DV3 C;  2QW0 X;  4JI3 C;  2HJG A;  5A1G A;  4D4G A;  4G36 A;  3KXW A;  2AYA A;  1USP A;  4DR1 C;  2F4V C;  2YWC A;  4RVO A;  2OO4 A;  4G37 A;  5CZV A;  3EER A;  1MXA A;  4RMN A;  4ISB A;  5K85 A;  5T8T A;  5KYV A;  4WS9 A;  1YJ7 A;  3NYQ A;  4K0K C;  1V26 A;  2YCB A;  4JI8 C;  1WF3 A;  1HNZ C;  4L2Z A;  4JI1 C;  1O9T A;  2E5L C;  1RG9 A;  3G7S A;  4DCU A;  4DG9 A;  1LCI A;  4LF4 C;  2V7B A;  1VLA A;  2VQE C;  4AQY C;  4B3R C;  3PRO C;  4DR7 C;  4BCA A;  5BUS A;  2QL8 A;  4ZLP A;  3PES A;  1K0R A;  4YHH C;  2P2J A;  4JI0 C;  2UXB C;  4XX2 A;  1RY2 A;  4B3T C;  3LAX A;  4DR3 C;  3L8C A;  4L7I A;  2OBV A;  2YWB A;  4X66 C;  2E7G A;  2Y27 A;  3ETC A;  3FCE A;  5E7Q A;  1MXB A;  5A2Q D;  2E8F A;  2UUB C;  3RV2 A;  4JI7 C;  3J81 D;  3IML A;  3EQ6 A;  4LF7 C;  4OXI A;  4GKJ C;  4LE5 A;  1MDF A;  4DV0 C;  2P02 A;  2OPL B;  5IWA C;  4DV7 C;  4RLQ A;  1MXC A;  4GXQ A;  4FUT A;  5BUR A;  4X62 C;  4WV3 A;  4PZP A;  2D1R A;  4JI2 C;  4K0B A;  1MD9 A;  2QVX X;  4DCV A;  5KYT A;  3RG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...