1HR0C

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hr0C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hr0C02
1USPA 1HNZC 1WF3A 4NOZA 1N34C 1ZB9A 1XMOC 2UUCC 4LF6C 2ASBA 4X66C 2E5LC 4LFBC 4DR3C 4DR5C 3T1HC 4JI7C 3IEUA 1KKGA 5LMNC 4DV5C 2E8CA 4XX2A 2PN2A 1N32C 4JI8C 4X64C 5LMUC 4KHPC 2QL8A 4X65C 4LF5C 2XR1A 4B3SC 1UKKA 2ONFA 4B3TC 3J80D 1HNXC 4AQYC 4MTNA 1J5EC 2HHHC 3LUSA 4DV3C 2BJOA 4LF9C 4K0KC 3R9XA 4JV5C 2ZM6C 4DV1C 4DR1C 1WH9A 4MH4A 2DYJA 4DUZC 1EGAA 4DCVA 4YY3C 4LFCC 2CXCA 4DCSA 3JAMD 2OPLB 1N33C 1HR0C 1USPB 5IWAC 4DR6C 4YHHC 1QWIA 4BSZA 3R9WA 2E7GA 4B3RC 2UUBC 2UXCC 3OTOC 2PT7G 4JI3C 4JI2C 1IBLC 4DV0C 2UUAC 2ATWA 5BR8C 4JYAC 2KZFA 2YCBA 1HH2P 4LFAC 3IEVA 2E8EA 4NXMC 2VQEC 4JI0C 1LQLA 4DCTA 2D7VA 1I94C 4NXNC 3J7AD 2CY1A 5FLXD 2EGTA 1XMQC 3EERA 4DUYC 1ML8A 2UU9C 4OX9C 4JI4C 4DR2C 1ZB8A 1K0RA 1MKYA 4DV4C 5IT9D 1XNRC 2VQFC 4GKKC 1VLAA 2F4VC 4JI1C 3AF5A 1NYEA 3GKUA 1JOSA 1XNQC 4DCUA 1N36C 1IBKC 4X62C 4DR7C 4LF8C 2HJGA 5A2QD 4JI6C 3J81D 4JI5C 4DR4C 4DV7C 1HNWC 1N2FA 4GKJC 3AF6A 1IBMC 1PA4A 4LF7C 2JMPA 3CJEA 1FJGC 2UXBC 2UXDC 3T1YC 3I07A 4B3MC 4DV6C 2E8FA 2OPLA 4DV2C 4LF4C 1L2FA
chains in the Genus database with same CATH superfamily
1PG4A 2YX1A 1VEHA 3R44A 4DV5C 2E8CA 2PN2A 2DHMA 2QL8A 4X65C 4LF5C 2XR1A 1XRAA 5CZVA 4IR7A 3J80D 2WD9A 1J5EC 2BJOA 2P2MA 3CQ1A 2WP0C 4JV5C 4LE5A 4DCVA 4D4IA 5BUSA 2CXCA 4DCSA 3JAMD 1PU1A 4DG8A 4D4GA 1HR0C 1P7LA 1USPB 4YHHC 3S82A 4U5YD 1P4EC 4B3RC 2UXCC 3OTOC 3SO4A 4ZLPA 2PT7G 3CQ2A 3VNSA 5E7QA 4BC7A 2MMAB 3TQIA 4G36A 4RM3A 4JYAC 2KZFA 2YCBA 1HH2P 2E8EA 4PUGA 4ZJZA 5BSWA 1TH5A 2OBVA 2BH1X 5KYVA 4RLFA 4EATA 4BC9A 1QM4A 5FLXD 3EERA 4DUYC 1ML8A 5DV9A 2UU9C 4TPSB 4JI4C 3A4IA 4GKKC 1VLAA 4JI1C 3AF5A 3GKUA 4PUHA 1MXCA 1XS3A 1P4EA 1IBKC 2ZZMA 4D56A 4DV7C 1N2FA 1PA4A 2JMPA 4HPVA 3T1YC 3RV2A 3B7WA 5K8FA 2OPLA 1WF3A 1XRCA 1V60A 1ZB9A 3RG2A 3TDEA 2UUCC 2ASBA 4X66C 4DR3C 3AY0A 5AE1A 3IMLA 5LMNC 3N54B 4I9FA 1N32C 5LMUC 1YJ7A 3LNVA 2P02A 1HNXC 3PBKA 4RVOA 4K0BA 4MTNA 4DV3C 2PG1E 4LF9C 4K0KC 3R9XA 4DV1C 4DR1C 1O92A 2NCLA 2VSQA 4DUZC 1PG3A 4RMNA 3E7WA 4YY3C 1WCJA 3H2TA 1RY2A 4R1LA 2Y4OA 4KTTA 3VNQA 2E7GA 5LCIA 2KDNA 4JI3C 5KEIA 4JI2C 1XRBA 4WS9A 3EQ6A 4LFAC 3PROC 2CU6A 3ETCA 3DAYA 2VQEC 4IZ6A 4JI0C 1LQLA 4NXNC 3C5EA 2VZEA 1XMQC 2D27A 5IFIA 5BSVA 4OX9C 4DR2C 4PZPA 1ZB8A 1K0RA 5GTDA 4DV4C 5IT9D 3PESA 1AMUA 1XNRC 2VQFC 4BCAA 4L7IA 4PUIA 1MD9A 2ZTBA 2E0GA 1JOSA 2ZZNA 3A9VA 2YWCA 1XNQC 5BSUA 4DR7C 4L4QA 5A2QD 3J81D 3I07A 5BSMA 3O2EA 2E8FA 4BBYA 4DV2C 4LF4C 1USPA 4WV3A 4NOZA 1HNZC 3LGXA 5BSTA 4LFBC 3CQ3A 4DR5C 4RM2A 1BA3A 4JI7C 1MDBA 4XX2A 5ADZA 4X64C 4KHPC 2QVZX 4B3SC 2ONFA 2P20A 5KYTA 3GPCA 4OXIA 4B3TC 4FUTA 1MDFA 3NPDA 2HHHC 3LUSA 3UZ0A 1FLOA 5BSRA 5CZXA 4MH4A 3ETOA 4I9GA 1V26A 4FTFA 5K85A 4R0MA 5BUQA 4LFCC 1YGTA 1LCIA 3L8CA 5A1IA 5IWAC 2YWBA 4DR6C 1GPMA 1QWIA 5JRHA 2UUBC 1IB8A 2MCQA 3A25A 1IBLC 2UUAC 3NI2A 4RVNA 5A1GA 3UOWA 3FCCA 2QW0X 4DCTA 2P2FA 3FM7A 2M5OA 2D7VA 3J7AD 5H9UA 5A19A 2DPLA 2EGTA 1NY8A 2V7BA 4KTVA 4NDNA 3UX2A 3DLPX 3I08A 1MKYA 1O90A 5T8SA 1XDXA 2F4VC 1NYEA 3CW9A 4RLQA 3L95X 1N36C 2KZ0A 5AE2A 4LF8C 2HJGA 4PHTA 1HNWC 3LNOA 1O93A 1M6XC 4D57A 4GKJC 4GXQA 3K6RA 3CJEA 2UXDC 1T5DX 3A26A 4JM1A 4FUQA 2D1TA 3TUFA 1MXAA 2Y27A 1ULTA 1N34C 1XMOC 4L2ZA 4LF6C 2E5LC 1V25A 1T5HX 3T1HC 3IEUA 1KKGA 2D1QA 3N2QA 3NYQA 3LAXA 4JI8C 1UKKA 4AQYC 2P2QA 1O9TA 2ZM6C 1WH9A 1UWDA 2DYJA 2M5HA 3GR0A 3A9UA 1EGAA 4GS5A 1M6XA 2QVXX 3NYRA 2D28C 4G37A 5T8TA 2Y4NA 1RG9A 4GXRA 3VNRA 2OPLB 1N33C 3G7SA 4ODJA 2QVYX 4BSZA 3R9WA 2MM9A 2ATWA 4DV0C 2D1SA 3CW8X 2P2JA 5BR8C 2JNVA 3IEVA 3TR3A 4NXMC 2OO4A 4R1MA 3E7XA 1FUGA 2Z51A 3UEBA 2AYAA 1XHJA 4DG9A 4OYCA 3KXWA 1I94C 5BURA 2CY1A 3GR1A 4PROC 4ISBA 1MXBA 2P2BA 5AE3A 2PROA 3DHVA 3UX3A 4DCUA 4X62C 4DR4C 4JI5C 4JI6C 3AF6A 1IBMC 4LF7C 3FCEA 1FJGC 2UXBC 4B3MC 4DV6C 3IPLA 4G1IA 1L2FA 2D1RA
chains in the Genus database with same CATH topology
1PG4A 3R44A 4DV5C 2E8CA 2PN2A 2QL8A 4X65C 4LF5C 2XR1A 1XRAA 5CZVA 4IR7A 3J80D 2WD9A 1J5EC 2BJOA 2P2MA 2WP0C 4JV5C 4LE5A 4DCVA 4D4IA 5BUSA 2CXCA 4DCSA 3JAMD 4DG8A 4D4GA 1HR0C 1P7LA 1USPB 4YHHC 3S82A 4U5YD 4B3RC 2UXCC 3OTOC 3SO4A 4ZLPA 2PT7G 3VNSA 5E7QA 4BC7A 3TQIA 4G36A 4RM3A 4JYAC 2KZFA 2YCBA 1HH2P 2E8EA 4ZJZA 5BSWA 2OBVA 2BH1X 5KYVA 4RLFA 4EATA 4BC9A 1QM4A 5FLXD 3EERA 4DUYC 1ML8A 5DV9A 2UU9C 4TPSB 4JI4C 3A4IA 4GKKC 1VLAA 4JI1C 3AF5A 3GKUA 1MXCA 1IBKC 4D56A 4DV7C 1N2FA 1PA4A 2JMPA 4HPVA 3T1YC 3RV2A 3B7WA 5K8FA 2OPLA 1WF3A 1XRCA 1ZB9A 3RG2A 3TDEA 2UUCC 2ASBA 4X66C 4DR3C 5AE1A 3IMLA 5LMNC 3N54B 4I9FA 1N32C 5LMUC 1YJ7A 3LNVA 2P02A 1HNXC 3PBKA 4RVOA 4K0BA 4MTNA 4DV3C 4LF9C 4K0KC 3R9XA 4DV1C 4DR1C 1O92A 2VSQA 4DUZC 1PG3A 4RMNA 3E7WA 4YY3C 3H2TA 1RY2A 4R1LA 2Y4OA 4KTTA 3VNQA 2E7GA 4JI3C 5KEIA 4JI2C 1XRBA 4WS9A 3EQ6A 4LFAC 3PROC 3ETCA 3DAYA 2VQEC 4IZ6A 4JI0C 1LQLA 4NXNC 3C5EA 2VZEA 1XMQC 2D27A 5IFIA 5BSVA 4OX9C 4DR2C 4PZPA 1ZB8A 1K0RA 5GTDA 4DV4C 5IT9D 3PESA 1AMUA 1XNRC 2VQFC 4BCAA 4L7IA 1MD9A 2E0GA 1JOSA 3A9VA 2YWCA 1XNQC 5BSUA 4DR7C 4L4QA 5A2QD 3J81D 3I07A 5BSMA 2E8FA 4BBYA 4DV2C 4LF4C 1USPA 4WV3A 4NOZA 1HNZC 3LGXA 5BSTA 4LFBC 4DR5C 4RM2A 1BA3A 4JI7C 1MDBA 4XX2A 5ADZA 4X64C 4KHPC 2QVZX 4B3SC 2ONFA 2P20A 5KYTA 3GPCA 4OXIA 4B3TC 4FUTA 1MDFA 3NPDA 2HHHC 3LUSA 3UZ0A 5BSRA 5CZXA 4MH4A 3ETOA 4I9GA 1V26A 4FTFA 5K85A 4R0MA 5BUQA 4LFCC 1LCIA 3L8CA 5A1IA 5IWAC 2YWBA 4DR6C 1GPMA 1QWIA 5JRHA 2UUBC 1IBLC 2UUAC 3NI2A 4RVNA 5A1GA 3UOWA 3FCCA 2QW0X 4DCTA 2P2FA 2D7VA 3J7AD 5H9UA 5A19A 2DPLA 2EGTA 2V7BA 4KTVA 4NDNA 3DLPX 3I08A 1MKYA 1O90A 5T8SA 2F4VC 1NYEA 3CW9A 4RLQA 3L95X 1N36C 5AE2A 4LF8C 2HJGA 4PHTA 1HNWC 1O93A 4D57A 4GKJC 4GXQA 3CJEA 2UXDC 1T5DX 4JM1A 4FUQA 2D1TA 3TUFA 1MXAA 2Y27A 1ULTA 1N34C 1XMOC 4L2ZA 4LF6C 2E5LC 1V25A 1T5HX 3T1HC 3IEUA 1KKGA 2D1QA 3N2QA 3NYQA 3LAXA 4JI8C 1UKKA 4AQYC 2P2QA 1O9TA 2ZM6C 1WH9A 2DYJA 3GR0A 3A9UA 1EGAA 4GS5A 2QVXX 3NYRA 2D28C 4G37A 5T8TA 2Y4NA 1RG9A 4GXRA 3VNRA 2OPLB 1N33C 3G7SA 4ODJA 2QVYX 4BSZA 3R9WA 2ATWA 4DV0C 2D1SA 3CW8X 2P2JA 5BR8C 3IEVA 4NXMC 2OO4A 4R1MA 3E7XA 1FUGA 2AYAA 4DG9A 4OYCA 3KXWA 1I94C 5BURA 2CY1A 3GR1A 4PROC 4ISBA 1MXBA 2P2BA 5AE3A 2PROA 3DHVA 4DCUA 4X62C 4DR4C 4JI5C 4JI6C 3AF6A 1IBMC 4LF7C 3FCEA 1FJGC 2UXBC 4B3MC 4DV6C 3IPLA 4G1IA 1L2FA 2D1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  1HNZ C;  1WF3 A;  4NOZ A;  1N34 C;  1ZB9 A;  1XMO C;  2UUC C;  4LF6 C;  2ASB A;  4X66 C;  2E5L C;  4LFB C;  4DR3 C;  4DR5 C;  3T1H C;  4JI7 C;  3IEU A;  1KKG A;  5LMN C;  4DV5 C;  2E8C A;  4XX2 A;  2PN2 A;  1N32 C;  4JI8 C;  4X64 C;  5LMU C;  4KHP C;  2QL8 A;  4X65 C;  4LF5 C;  2XR1 A;  4B3S C;  1UKK A;  2ONF A;  4B3T C;  3J80 D;  1HNX C;  4AQY C;  4MTN A;  1J5E C;  2HHH C;  3LUS A;  4DV3 C;  2BJO A;  4LF9 C;  4K0K C;  3R9X A;  4JV5 C;  2ZM6 C;  4DV1 C;  4DR1 C;  1WH9 A;  4MH4 A;  2DYJ A;  4DUZ C;  1EGA A;  4DCV A;  4YY3 C;  4LFC C;  2CXC A;  4DCS A;  3JAM D;  2OPL B;  1N33 C;  1HR0 C;  1USP B;  5IWA C;  4DR6 C;  4YHH C;  1QWI A;  4BSZ A;  3R9W A;  2E7G A;  4B3R C;  2UUB C;  2UXC C;  3OTO C;  2PT7 G;  4JI3 C;  4JI2 C;  1IBL C;  4DV0 C;  2UUA C;  2ATW A;  5BR8 C;  4JYA C;  2KZF A;  2YCB A;  1HH2 P;  4LFA C;  3IEV A;  2E8E A;  4NXM C;  2VQE C;  4JI0 C;  1LQL A;  4DCT A;  2D7V A;  1I94 C;  4NXN C;  3J7A D;  2CY1 A;  5FLX D;  2EGT A;  1XMQ C;  3EER A;  4DUY C;  1ML8 A;  2UU9 C;  4OX9 C;  4JI4 C;  4DR2 C;  1ZB8 A;  1K0R A;  1MKY A;  4DV4 C;  5IT9 D;  1XNR C;  2VQF C;  4GKK C;  1VLA A;  2F4V C;  4JI1 C;  3AF5 A;  1NYE A;  3GKU A;  1JOS A;  1XNQ C;  4DCU A;  1N36 C;  1IBK C;  4X62 C;  4DR7 C;  4LF8 C;  2HJG A;  5A2Q D;  4JI6 C;  3J81 D;  4JI5 C;  4DR4 C;  4DV7 C;  1HNW C;  1N2F A;  4GKJ C;  3AF6 A;  1IBM C;  1PA4 A;  4LF7 C;  2JMP A;  3CJE A;  1FJG C;  2UXB C;  2UXD C;  3T1Y C;  3I07 A;  4B3M C;  4DV6 C;  2E8F A;  2OPL A;  4DV2 C;  4LF4 C;  1L2F A; 
#chains in the Genus database with same CATH topology
 1PG4 A;  2YX1 A;  1VEH A;  3R44 A;  4DV5 C;  2E8C A;  2PN2 A;  2DHM A;  2QL8 A;  4X65 C;  4LF5 C;  2XR1 A;  1XRA A;  5CZV A;  4IR7 A;  3J80 D;  2WD9 A;  1J5E C;  2BJO A;  2P2M A;  3CQ1 A;  2WP0 C;  4JV5 C;  4LE5 A;  4DCV A;  4D4I A;  5BUS A;  2CXC A;  4DCS A;  3JAM D;  1PU1 A;  4DG8 A;  4D4G A;  1HR0 C;  1P7L A;  1USP B;  4YHH C;  3S82 A;  4U5Y D;  1P4E C;  4B3R C;  2UXC C;  3OTO C;  3SO4 A;  4ZLP A;  2PT7 G;  3CQ2 A;  3VNS A;  5E7Q A;  4BC7 A;  2MMA B;  3TQI A;  4G36 A;  4RM3 A;  4JYA C;  2KZF A;  2YCB A;  1HH2 P;  2E8E A;  4PUG A;  4ZJZ A;  5BSW A;  1TH5 A;  2OBV A;  2BH1 X;  5KYV A;  4RLF A;  4EAT A;  4BC9 A;  1QM4 A;  5FLX D;  3EER A;  4DUY C;  1ML8 A;  5DV9 A;  2UU9 C;  4TPS B;  4JI4 C;  3A4I A;  4GKK C;  1VLA A;  4JI1 C;  3AF5 A;  3GKU A;  4PUH A;  1MXC A;  1XS3 A;  1P4E A;  1IBK C;  2ZZM A;  4D56 A;  4DV7 C;  1N2F A;  1PA4 A;  2JMP A;  4HPV A;  3T1Y C;  3RV2 A;  3B7W A;  5K8F A;  2OPL A;  1WF3 A;  1XRC A;  1V60 A;  1ZB9 A;  3RG2 A;  3TDE A;  2UUC C;  2ASB A;  4X66 C;  4DR3 C;  3AY0 A;  5AE1 A;  3IML A;  5LMN C;  3N54 B;  4I9F A;  1N32 C;  5LMU C;  1YJ7 A;  3LNV A;  2P02 A;  1HNX C;  3PBK A;  4RVO A;  4K0B A;  4MTN A;  4DV3 C;  2PG1 E;  4LF9 C;  4K0K C;  3R9X A;  4DV1 C;  4DR1 C;  1O92 A;  2NCL A;  2VSQ A;  4DUZ C;  1PG3 A;  4RMN A;  3E7W A;  4YY3 C;  1WCJ A;  3H2T A;  1RY2 A;  4R1L A;  2Y4O A;  4KTT A;  3VNQ A;  2E7G A;  5LCI A;  2KDN A;  4JI3 C;  5KEI A;  4JI2 C;  1XRB A;  4WS9 A;  3EQ6 A;  4LFA C;  3PRO C;  2CU6 A;  3ETC A;  3DAY A;  2VQE C;  4IZ6 A;  4JI0 C;  1LQL A;  4NXN C;  3C5E A;  2VZE A;  1XMQ C;  2D27 A;  5IFI A;  5BSV A;  4OX9 C;  4DR2 C;  4PZP A;  1ZB8 A;  1K0R A;  5GTD A;  4DV4 C;  5IT9 D;  3PES A;  1AMU A;  1XNR C;  2VQF C;  4BCA A;  4L7I A;  4PUI A;  1MD9 A;  2ZTB A;  2E0G A;  1JOS A;  2ZZN A;  3A9V A;  2YWC A;  1XNQ C;  5BSU A;  4DR7 C;  4L4Q A;  5A2Q D;  3J81 D;  3I07 A;  5BSM A;  3O2E A;  2E8F A;  4BBY A;  4DV2 C;  4LF4 C;  1USP A;  4WV3 A;  4NOZ A;  1HNZ C;  3LGX A;  5BST A;  4LFB C;  3CQ3 A;  4DR5 C;  4RM2 A;  1BA3 A;  4JI7 C;  1MDB A;  4XX2 A;  5ADZ A;  4X64 C;  4KHP C;  2QVZ X;  4B3S C;  2ONF A;  2P20 A;  5KYT A;  3GPC A;  4OXI A;  4B3T C;  4FUT A;  1MDF A;  3NPD A;  2HHH C;  3LUS A;  3UZ0 A;  1FLO A;  5BSR A;  5CZX A;  4MH4 A;  3ETO A;  4I9G A;  1V26 A;  4FTF A;  5K85 A;  4R0M A;  5BUQ A;  4LFC C;  1YGT A;  1LCI A;  3L8C A;  5A1I A;  5IWA C;  2YWB A;  4DR6 C;  1GPM A;  1QWI A;  5JRH A;  2UUB C;  1IB8 A;  2MCQ A;  3A25 A;  1IBL C;  2UUA C;  3NI2 A;  4RVN A;  5A1G A;  3UOW A;  3FCC A;  2QW0 X;  4DCT A;  2P2F A;  3FM7 A;  2M5O A;  2D7V A;  3J7A D;  5H9U A;  5A19 A;  2DPL A;  2EGT A;  1NY8 A;  2V7B A;  4KTV A;  4NDN A;  3UX2 A;  3DLP X;  3I08 A;  1MKY A;  1O90 A;  5T8S A;  1XDX A;  2F4V C;  1NYE A;  3CW9 A;  4RLQ A;  3L95 X;  1N36 C;  2KZ0 A;  5AE2 A;  4LF8 C;  2HJG A;  4PHT A;  1HNW C;  3LNO A;  1O93 A;  1M6X C;  4D57 A;  4GKJ C;  4GXQ A;  3K6R A;  3CJE A;  2UXD C;  1T5D X;  3A26 A;  4JM1 A;  4FUQ A;  2D1T A;  3TUF A;  1MXA A;  2Y27 A;  1ULT A;  1N34 C;  1XMO C;  4L2Z A;  4LF6 C;  2E5L C;  1V25 A;  1T5H X;  3T1H C;  3IEU A;  1KKG A;  2D1Q A;  3N2Q A;  3NYQ A;  3LAX A;  4JI8 C;  1UKK A;  4AQY C;  2P2Q A;  1O9T A;  2ZM6 C;  1WH9 A;  1UWD A;  2DYJ A;  2M5H A;  3GR0 A;  3A9U A;  1EGA A;  4GS5 A;  1M6X A;  2QVX X;  3NYR A;  2D28 C;  4G37 A;  5T8T A;  2Y4N A;  1RG9 A;  4GXR A;  3VNR A;  2OPL B;  1N33 C;  3G7S A;  4ODJ A;  2QVY X;  4BSZ A;  3R9W A;  2MM9 A;  2ATW A;  4DV0 C;  2D1S A;  3CW8 X;  2P2J A;  5BR8 C;  2JNV A;  3IEV A;  3TR3 A;  4NXM C;  2OO4 A;  4R1M A;  3E7X A;  1FUG A;  2Z51 A;  3UEB A;  2AYA A;  1XHJ A;  4DG9 A;  4OYC A;  3KXW A;  1I94 C;  5BUR A;  2CY1 A;  3GR1 A;  4PRO C;  4ISB A;  1MXB A;  2P2B A;  5AE3 A;  2PRO A;  3DHV A;  3UX3 A;  4DCU A;  4X62 C;  4DR4 C;  4JI5 C;  4JI6 C;  3AF6 A;  1IBM C;  4LF7 C;  3FCE A;  1FJG C;  2UXB C;  4B3M C;  4DV6 C;  3IPL A;  4G1I A;  1L2F A;  2D1R A; 
#chains in the Genus database with same CATH homology
 1PG4 A;  3R44 A;  4DV5 C;  2E8C A;  2PN2 A;  2QL8 A;  4X65 C;  4LF5 C;  2XR1 A;  1XRA A;  5CZV A;  4IR7 A;  3J80 D;  2WD9 A;  1J5E C;  2BJO A;  2P2M A;  2WP0 C;  4JV5 C;  4LE5 A;  4DCV A;  4D4I A;  5BUS A;  2CXC A;  4DCS A;  3JAM D;  4DG8 A;  4D4G A;  1HR0 C;  1P7L A;  1USP B;  4YHH C;  3S82 A;  4U5Y D;  4B3R C;  2UXC C;  3OTO C;  3SO4 A;  4ZLP A;  2PT7 G;  3VNS A;  5E7Q A;  4BC7 A;  3TQI A;  4G36 A;  4RM3 A;  4JYA C;  2KZF A;  2YCB A;  1HH2 P;  2E8E A;  4ZJZ A;  5BSW A;  2OBV A;  2BH1 X;  5KYV A;  4RLF A;  4EAT A;  4BC9 A;  1QM4 A;  5FLX D;  3EER A;  4DUY C;  1ML8 A;  5DV9 A;  2UU9 C;  4TPS B;  4JI4 C;  3A4I A;  4GKK C;  1VLA A;  4JI1 C;  3AF5 A;  3GKU A;  1MXC A;  1IBK C;  4D56 A;  4DV7 C;  1N2F A;  1PA4 A;  2JMP A;  4HPV A;  3T1Y C;  3RV2 A;  3B7W A;  5K8F A;  2OPL A;  1WF3 A;  1XRC A;  1ZB9 A;  3RG2 A;  3TDE A;  2UUC C;  2ASB A;  4X66 C;  4DR3 C;  5AE1 A;  3IML A;  5LMN C;  3N54 B;  4I9F A;  1N32 C;  5LMU C;  1YJ7 A;  3LNV A;  2P02 A;  1HNX C;  3PBK A;  4RVO A;  4K0B A;  4MTN A;  4DV3 C;  4LF9 C;  4K0K C;  3R9X A;  4DV1 C;  4DR1 C;  1O92 A;  2VSQ A;  4DUZ C;  1PG3 A;  4RMN A;  3E7W A;  4YY3 C;  3H2T A;  1RY2 A;  4R1L A;  2Y4O A;  4KTT A;  3VNQ A;  2E7G A;  4JI3 C;  5KEI A;  4JI2 C;  1XRB A;  4WS9 A;  3EQ6 A;  4LFA C;  3PRO C;  3ETC A;  3DAY A;  2VQE C;  4IZ6 A;  4JI0 C;  1LQL A;  4NXN C;  3C5E A;  2VZE A;  1XMQ C;  2D27 A;  5IFI A;  5BSV A;  4OX9 C;  4DR2 C;  4PZP A;  1ZB8 A;  1K0R A;  5GTD A;  4DV4 C;  5IT9 D;  3PES A;  1AMU A;  1XNR C;  2VQF C;  4BCA A;  4L7I A;  1MD9 A;  2E0G A;  1JOS A;  3A9V A;  2YWC A;  1XNQ C;  5BSU A;  4DR7 C;  4L4Q A;  5A2Q D;  3J81 D;  3I07 A;  5BSM A;  2E8F A;  4BBY A;  4DV2 C;  4LF4 C;  1USP A;  4WV3 A;  4NOZ A;  1HNZ C;  3LGX A;  5BST A;  4LFB C;  4DR5 C;  4RM2 A;  1BA3 A;  4JI7 C;  1MDB A;  4XX2 A;  5ADZ A;  4X64 C;  4KHP C;  2QVZ X;  4B3S C;  2ONF A;  2P20 A;  5KYT A;  3GPC A;  4OXI A;  4B3T C;  4FUT A;  1MDF A;  3NPD A;  2HHH C;  3LUS A;  3UZ0 A;  5BSR A;  5CZX A;  4MH4 A;  3ETO A;  4I9G A;  1V26 A;  4FTF A;  5K85 A;  4R0M A;  5BUQ A;  4LFC C;  1LCI A;  3L8C A;  5A1I A;  5IWA C;  2YWB A;  4DR6 C;  1GPM A;  1QWI A;  5JRH A;  2UUB C;  1IBL C;  2UUA C;  3NI2 A;  4RVN A;  5A1G A;  3UOW A;  3FCC A;  2QW0 X;  4DCT A;  2P2F A;  2D7V A;  3J7A D;  5H9U A;  5A19 A;  2DPL A;  2EGT A;  2V7B A;  4KTV A;  4NDN A;  3DLP X;  3I08 A;  1MKY A;  1O90 A;  5T8S A;  2F4V C;  1NYE A;  3CW9 A;  4RLQ A;  3L95 X;  1N36 C;  5AE2 A;  4LF8 C;  2HJG A;  4PHT A;  1HNW C;  1O93 A;  4D57 A;  4GKJ C;  4GXQ A;  3CJE A;  2UXD C;  1T5D X;  4JM1 A;  4FUQ A;  2D1T A;  3TUF A;  1MXA A;  2Y27 A;  1ULT A;  1N34 C;  1XMO C;  4L2Z A;  4LF6 C;  2E5L C;  1V25 A;  1T5H X;  3T1H C;  3IEU A;  1KKG A;  2D1Q A;  3N2Q A;  3NYQ A;  3LAX A;  4JI8 C;  1UKK A;  4AQY C;  2P2Q A;  1O9T A;  2ZM6 C;  1WH9 A;  2DYJ A;  3GR0 A;  3A9U A;  1EGA A;  4GS5 A;  2QVX X;  3NYR A;  2D28 C;  4G37 A;  5T8T A;  2Y4N A;  1RG9 A;  4GXR A;  3VNR A;  2OPL B;  1N33 C;  3G7S A;  4ODJ A;  2QVY X;  4BSZ A;  3R9W A;  2ATW A;  4DV0 C;  2D1S A;  3CW8 X;  2P2J A;  5BR8 C;  3IEV A;  4NXM C;  2OO4 A;  4R1M A;  3E7X A;  1FUG A;  2AYA A;  4DG9 A;  4OYC A;  3KXW A;  1I94 C;  5BUR A;  2CY1 A;  3GR1 A;  4PRO C;  4ISB A;  1MXB A;  2P2B A;  5AE3 A;  2PRO A;  3DHV A;  4DCU A;  4X62 C;  4DR4 C;  4JI5 C;  4JI6 C;  3AF6 A;  1IBM C;  4LF7 C;  3FCE A;  1FJG C;  2UXB C;  4B3M C;  4DV6 C;  3IPL A;  4G1I A;  1L2F A;  2D1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...