1HR0C

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hr0C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hr0C02
2D7VA 1XMQC 2JMPA 2UXDC 4B3MC 1HR0C 1I94C 4JV5C 2E8FA 4JI3C 1MKYA 2UUBC 1EGAA 4NOZA 1JOSA 4MH4A 1HNZC 4DCTA 5LMUC 2KZFA 4JI0C 1N34C 3AF6A 4DR1C 4JI8C 2UUCC 2CY1A 3J81D 3CJEA 2HHHC 2ASBA 4DR6C 1IBMC 1IBLC 3R9WA 2UXCC 2UXBC 2HJGA 4MTNA 4GKKC 5IWAC 1UKKA 4LF7C 1WH9A 4DR7C 2ATWA 4LF9C 1XMOC 2VQEC 4NXMC 2PN2A 1HH2P 5LMNC 1K0RA 4NXNC 1ZB8A 3GKUA 4JYAC 4DR3C 1IBKC 3AF5A 3LUSA 2VQFC 4LFBC 1VLAA 3R9XA 2OPLB 4X66C 4DV0C 1WF3A 1LQLA 2QL8A 4YY3C 4DV4C 1USPB 2CXCA 4LF8C 4DCVA 4LF6C 4DR2C 1L2FA 4JI7C 4DV5C 4B3TC 2ONFA 4DCUA 4DCSA 4DV7C 4AQYC 4DR5C 1J5EC 2ZM6C 1N36C 4DV1C 1XNRC 1N33C 5IT9D 4B3SC 4LFAC 1ZB9A 5FLXD 4K0KC 4DUYC 2UUAC 2E8CA 4XX2A 1PA4A 4JI1C 4LF5C 1N2FA 3I07A 4JI4C 5A2QD 1XNQC 4YHHC 4LF4C 1HNWC 4JI2C 2E8EA 1HNXC 4X65C 1FJGC 4DUZC 3OTOC 3JAMD 4JI5C 2DYJA 5BR8C 4LFCC 4B3RC 2XR1A 4JI6C 1NYEA 4KHPC 2E7GA 3T1YC 1USPA 4DV6C 2F4VC 1KKGA 2OPLA 4X62C 3IEVA 2E5LC 4GKJC 4BSZA 4OX9C 1N32C 1ML8A 2EGTA 3T1HC 4DR4C 4DV3C 1QWIA 2PT7G 4DV2C 3J80D 2BJOA 3IEUA 2UU9C 4X64C 3EERA 2YCBA 3J7AD
chains in the Genus database with same CATH superfamily
2D7VA 4RM3A 2P2FA 4B3MC 3DHVA 1MDFA 4MH4A 4PUGA 1HNZC 5JRHA 3A25A 5T8TA 1N34C 3J81D 3CW8X 3AY0A 3VNRA 2D1TA 4ISBA 2UXCC 2UXBC 4WV3A 2HJGA 3PROC 4FUTA 2MCQA 5GTDA 1WH9A 4DR7C 4LF9C 1XMOC 5LMNC 2YWCA 2ZZMA 3CQ1A 4G36A 3AF5A 3LUSA 1VLAA 4JM1A 3TUFA 2OPLB 4X66C 4DV0C 1XDXA 2M5HA 2KDNA 1PG3A 5LCIA 4DR2C 4JI7C 1MD9A 4DV5C 1XRAA 3CQ3A 4BC9A 2OO4A 3UX2A 3FCEA 4PHTA 3IMLA 5IT9D 1ZB9A 1MXAA 2QVYX 4PROC 3K6RA 4OXIA 5A2QD 1XNQC 4X65C 3E7WA 3A4IA 4JI5C 1V26A 2DYJA 4PUHA 4LFCC 3O2EA 4JI6C 3T1YC 4DV6C 4RVOA 4BBYA 2E0GA 2P20A 4KTVA 2OPLA 1YGTA 2MM9A 5BSWA 5ADZA 4R1LA 4GKJC 4RMNA 1T5DX 3T1HC 4DV3C 1QWIA 3I08A 4RLQA 2Y4NA 3J80D 3UX3A 3IEUA 3EERA 3LGXA 3J7AD 1O92A 5AE1A 3PBKA 4RLFA 2E8FA 4JI3C 1MKYA 3L8CA 2UUBC 1EGAA 1JOSA 4DCTA 2KZFA 1FLOA 2P02A 4PUIA 3AF6A 4R1MA 3G7SA 3N2QA 4I9FA 2HHHC 1IBLC 4G37A 2QVXX 2DPLA 3LNVA 1XHJA 2JNVA 1IB8A 5IWAC 2ATWA 2VZEA 3TQIA 4IZ6A 5BSUA 2VQFC 2ZZNA 1LQLA 4HPVA 1PG4A 5K85A 4DV4C 2CXCA 4LF8C 4KTTA 2D28C 1L2FA 1QM4A 4DCSA 1J5EC 3A9UA 3LNOA 3GPCA 1XNRC 1P4EC 4LFAC 4ODJA 4K0KC 4FUQA 4K0BA 2E8CA 5BUSA 3UOWA 1N2FA 4EATA 2NCLA 3NYQA 4D4GA 4YHHC 4I9GA 4LE5A 1FJGC 4D4IA 3OTOC 3JAMD 5AE3A 1MDBA 3B7WA 2XR1A 2V7BA 1USPA 3TR3A 3FCCA 4X62C 3IEVA 1WCJA 1ULTA 1XRCA 4BSZA 4OX9C 1N32C 3L95X 2PG1E 3A26A 4L7IA 4B3SC 2P2QA 3DAYA 5DV9A 2UXDC 2JMPA 1HR0C 1I94C 4DG8A 1XRBA 4R0MA 5LMUC 2ZTBA 4DR1C 4OYCA 3FM7A 3CJEA 4DR6C 2CU6A 5BURA 4IR7A 3VNQA 5IFIA 1P4EA 1UKKA 5T8SA 4ZLPA 4LF7C 2QW0X 1BA3A 1O90A 2D27A 3GR1A 5BSVA 1ZB8A 3GKUA 4JYAC 1IBKC 4DG9A 5BSMA 3N54B 3SO4A 1O93A 3R9XA 2QL8A 4YY3C 3ETOA 5A19A 3RG2A 3TDEA 4DCVA 2WP0C 4RM2A 3LAXA 1MXCA 2P2MA 2ONFA 1RG9A 4DV7C 2BH1X 2Z51A 2VSQA 4AQYC 4DR5C 4NDNA 4D57A 2ZM6C 1N33C 5A1IA 1LCIA 4DUYC 2UUAC 1PA4A 5BSRA 4JI1C 4LF5C 2MMAB 2QVZX 5KEIA 2YWBA 4G1IA 2E8EA 1RY2A 4PZPA 4L2ZA 2Y4OA 4DUZC 2D1SA 5BR8C 2D1RA 4B3RC 2PROA 1NY8A 2E7GA 3IPLA 2F4VC 1KKGA 5A1GA 3R44A 5H9UA 1P7LA 1VEHA 1M6XC 2P2JA 2WD9A 2EGTA 4DR4C 4TPSB 4FTFA 2PT7G 2BJOA 2UU9C 4X64C 1XMQC 3UEBA 3PESA 4JV5C 2M5OA 4NOZA 2AYAA 2Y27A 4GS5A 3NI2A 3EQ6A 4JI0C 3UZ0A 4JI8C 2UUCC 2CY1A 5CZXA 3NYRA 2ASBA 5AE2A 1IBMC 1MXBA 3R9WA 4RVNA 4BCAA 2YX1A 4MTNA 1YJ7A 4GKKC 3DLPX 5BSTA 2VQEC 2P2BA 2PN2A 4NXMC 1HH2P 1K0RA 4NXNC 3GR0A 1T5HX 2D1QA 2KZ0A 4DR3C 1UWDA 3NPDA 4LFBC 1TH5A 1V60A 5BUQA 5K8FA 1WF3A 3KXWA 3VNSA 5CZVA 3A9VA 1USPB 4GXRA 1XS3A 4LF6C 3E7XA 3CW9A 4B3TC 3S82A 4DCUA 3H2TA 1N36C 4DV1C 1GPMA 5KYVA 5FLXD 3ETCA 4WS9A 1FUGA 4XX2A 4L4QA 4BC7A 3I07A 1PU1A 3CQ2A 4JI4C 4LF4C 1HNWC 4JI2C 1HNXC 1M6XA 2DHMA 1AMUA 4GXQA 4U5YD 1NYEA 4KHPC 5E7QA 2OBVA 2E5LC 3RV2A 4ZJZA 4D56A 1ML8A 1O9TA 5KYTA 1V25A 3C5EA 4DV2C 2YCBA
chains in the Genus database with same CATH topology
2D7VA 4RM3A 2P2FA 4B3MC 3DHVA 1MDFA 4MH4A 1HNZC 5JRHA 5T8TA 1N34C 3J81D 3CW8X 3VNRA 2D1TA 4ISBA 2UXCC 2UXBC 4WV3A 2HJGA 3PROC 4FUTA 5GTDA 1WH9A 4DR7C 4LF9C 1XMOC 5LMNC 2YWCA 4G36A 3AF5A 3LUSA 1VLAA 4JM1A 3TUFA 2OPLB 4X66C 4DV0C 1PG3A 4DR2C 4JI7C 1MD9A 4DV5C 1XRAA 4BC9A 2OO4A 3FCEA 4PHTA 3IMLA 5IT9D 1ZB9A 1MXAA 2QVYX 4PROC 4OXIA 5A2QD 1XNQC 4X65C 3E7WA 3A4IA 4JI5C 1V26A 2DYJA 4LFCC 4JI6C 3T1YC 4DV6C 4RVOA 4BBYA 2E0GA 2P20A 4KTVA 2OPLA 5BSWA 5ADZA 4R1LA 4GKJC 4RMNA 1T5DX 3T1HC 4DV3C 1QWIA 3I08A 4RLQA 2Y4NA 3J80D 3IEUA 3EERA 3LGXA 3J7AD 1O92A 5AE1A 3PBKA 4RLFA 2E8FA 4JI3C 1MKYA 3L8CA 2UUBC 1EGAA 1JOSA 4DCTA 2KZFA 2P02A 3AF6A 4R1MA 3G7SA 3N2QA 4I9FA 2HHHC 1IBLC 4G37A 2QVXX 2DPLA 3LNVA 5IWAC 2ATWA 2VZEA 3TQIA 4IZ6A 5BSUA 2VQFC 1LQLA 4HPVA 1PG4A 5K85A 4DV4C 2CXCA 4LF8C 4KTTA 2D28C 1L2FA 1QM4A 4DCSA 1J5EC 3A9UA 3GPCA 1XNRC 4LFAC 4ODJA 4K0KC 4FUQA 4K0BA 2E8CA 5BUSA 1N2FA 3UOWA 4EATA 3NYQA 4D4GA 4YHHC 4I9GA 4LE5A 1FJGC 4D4IA 3OTOC 3JAMD 5AE3A 1MDBA 3B7WA 2XR1A 2V7BA 1USPA 3FCCA 4X62C 3IEVA 1ULTA 1XRCA 4BSZA 4OX9C 1N32C 3L95X 4L7IA 4B3SC 2P2QA 3DAYA 5DV9A 2UXDC 2JMPA 1HR0C 1I94C 4DG8A 1XRBA 4R0MA 5LMUC 4DR1C 4OYCA 3CJEA 4DR6C 5BURA 4IR7A 3VNQA 5IFIA 1UKKA 5T8SA 4ZLPA 4LF7C 2QW0X 1BA3A 1O90A 2D27A 3GR1A 5BSVA 1ZB8A 3GKUA 4JYAC 1IBKC 4DG9A 5BSMA 3N54B 3SO4A 1O93A 3R9XA 2QL8A 4YY3C 3ETOA 5A19A 3RG2A 3TDEA 4DCVA 2WP0C 4RM2A 3LAXA 1MXCA 2P2MA 2ONFA 1RG9A 4DV7C 2BH1X 2VSQA 4AQYC 4DR5C 4NDNA 4D57A 2ZM6C 1N33C 5A1IA 1LCIA 4DUYC 2UUAC 1PA4A 5BSRA 4LF5C 4JI1C 2QVZX 5KEIA 2YWBA 4G1IA 2E8EA 1RY2A 4PZPA 4L2ZA 2Y4OA 4DUZC 2D1SA 5BR8C 2D1RA 4B3RC 2PROA 2E7GA 3IPLA 2F4VC 1KKGA 5A1GA 3R44A 5H9UA 1P7LA 2P2JA 2WD9A 2EGTA 4DR4C 4TPSB 4FTFA 2PT7G 2BJOA 2UU9C 4X64C 1XMQC 3PESA 4JV5C 4NOZA 2AYAA 2Y27A 4GS5A 3NI2A 3EQ6A 4JI0C 3UZ0A 4JI8C 2UUCC 2CY1A 5CZXA 3NYRA 2ASBA 5AE2A 1IBMC 1MXBA 3R9WA 4RVNA 4BCAA 4MTNA 1YJ7A 4GKKC 3DLPX 5BSTA 2VQEC 2P2BA 2PN2A 4NXMC 1HH2P 1K0RA 4NXNC 3GR0A 1T5HX 2D1QA 4DR3C 3NPDA 4LFBC 5BUQA 5K8FA 1WF3A 3KXWA 3VNSA 5CZVA 3A9VA 1USPB 4GXRA 4LF6C 3E7XA 3CW9A 4B3TC 3S82A 4DCUA 3H2TA 1N36C 4DV1C 1GPMA 5KYVA 5FLXD 3ETCA 4WS9A 1FUGA 4XX2A 4L4QA 4BC7A 3I07A 4JI4C 4LF4C 1HNWC 4JI2C 1HNXC 1AMUA 4GXQA 4U5YD 1NYEA 4KHPC 5E7QA 2OBVA 2E5LC 3RV2A 4ZJZA 4D56A 1ML8A 1O9TA 1V25A 3C5EA 5KYTA 4DV2C 2YCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7V A;  1XMQ C;  2JMP A;  2UXD C;  4B3M C;  1HR0 C;  1I94 C;  4JV5 C;  2E8F A;  4JI3 C;  1MKY A;  2UUB C;  1EGA A;  4NOZ A;  1JOS A;  4MH4 A;  1HNZ C;  4DCT A;  5LMU C;  2KZF A;  4JI0 C;  1N34 C;  3AF6 A;  4DR1 C;  4JI8 C;  2UUC C;  2CY1 A;  3J81 D;  3CJE A;  2HHH C;  2ASB A;  4DR6 C;  1IBM C;  1IBL C;  3R9W A;  2UXC C;  2UXB C;  2HJG A;  4MTN A;  4GKK C;  5IWA C;  1UKK A;  4LF7 C;  1WH9 A;  4DR7 C;  2ATW A;  4LF9 C;  1XMO C;  2VQE C;  4NXM C;  2PN2 A;  1HH2 P;  5LMN C;  1K0R A;  4NXN C;  1ZB8 A;  3GKU A;  4JYA C;  4DR3 C;  1IBK C;  3AF5 A;  3LUS A;  2VQF C;  4LFB C;  1VLA A;  3R9X A;  2OPL B;  4X66 C;  4DV0 C;  1WF3 A;  1LQL A;  2QL8 A;  4YY3 C;  4DV4 C;  1USP B;  2CXC A;  4LF8 C;  4DCV A;  4LF6 C;  4DR2 C;  1L2F A;  4JI7 C;  4DV5 C;  4B3T C;  2ONF A;  4DCU A;  4DCS A;  4DV7 C;  4AQY C;  4DR5 C;  1J5E C;  2ZM6 C;  1N36 C;  4DV1 C;  1XNR C;  1N33 C;  5IT9 D;  4B3S C;  4LFA C;  1ZB9 A;  5FLX D;  4K0K C;  4DUY C;  2UUA C;  2E8C A;  4XX2 A;  1PA4 A;  4JI1 C;  4LF5 C;  1N2F A;  3I07 A;  4JI4 C;  5A2Q D;  1XNQ C;  4YHH C;  4LF4 C;  1HNW C;  4JI2 C;  2E8E A;  1HNX C;  4X65 C;  1FJG C;  4DUZ C;  3OTO C;  3JAM D;  4JI5 C;  2DYJ A;  5BR8 C;  4LFC C;  4B3R C;  2XR1 A;  4JI6 C;  1NYE A;  4KHP C;  2E7G A;  3T1Y C;  1USP A;  4DV6 C;  2F4V C;  1KKG A;  2OPL A;  4X62 C;  3IEV A;  2E5L C;  4GKJ C;  4BSZ A;  4OX9 C;  1N32 C;  1ML8 A;  2EGT A;  3T1H C;  4DR4 C;  4DV3 C;  1QWI A;  2PT7 G;  4DV2 C;  3J80 D;  2BJO A;  3IEU A;  2UU9 C;  4X64 C;  3EER A;  2YCB A;  3J7A D; 
#chains in the Genus database with same CATH topology
 2D7V A;  4RM3 A;  2P2F A;  4B3M C;  3DHV A;  1MDF A;  4MH4 A;  4PUG A;  1HNZ C;  5JRH A;  3A25 A;  5T8T A;  1N34 C;  3J81 D;  3CW8 X;  3AY0 A;  3VNR A;  2D1T A;  4ISB A;  2UXC C;  2UXB C;  4WV3 A;  2HJG A;  3PRO C;  4FUT A;  2MCQ A;  5GTD A;  1WH9 A;  4DR7 C;  4LF9 C;  1XMO C;  5LMN C;  2YWC A;  2ZZM A;  3CQ1 A;  4G36 A;  3AF5 A;  3LUS A;  1VLA A;  4JM1 A;  3TUF A;  2OPL B;  4X66 C;  4DV0 C;  1XDX A;  2M5H A;  2KDN A;  1PG3 A;  5LCI A;  4DR2 C;  4JI7 C;  1MD9 A;  4DV5 C;  1XRA A;  3CQ3 A;  4BC9 A;  2OO4 A;  3UX2 A;  3FCE A;  4PHT A;  3IML A;  5IT9 D;  1ZB9 A;  1MXA A;  2QVY X;  4PRO C;  3K6R A;  4OXI A;  5A2Q D;  1XNQ C;  4X65 C;  3E7W A;  3A4I A;  4JI5 C;  1V26 A;  2DYJ A;  4PUH A;  4LFC C;  3O2E A;  4JI6 C;  3T1Y C;  4DV6 C;  4RVO A;  4BBY A;  2E0G A;  2P20 A;  4KTV A;  2OPL A;  1YGT A;  2MM9 A;  5BSW A;  5ADZ A;  4R1L A;  4GKJ C;  4RMN A;  1T5D X;  3T1H C;  4DV3 C;  1QWI A;  3I08 A;  4RLQ A;  2Y4N A;  3J80 D;  3UX3 A;  3IEU A;  3EER A;  3LGX A;  3J7A D;  1O92 A;  5AE1 A;  3PBK A;  4RLF A;  2E8F A;  4JI3 C;  1MKY A;  3L8C A;  2UUB C;  1EGA A;  1JOS A;  4DCT A;  2KZF A;  1FLO A;  2P02 A;  4PUI A;  3AF6 A;  4R1M A;  3G7S A;  3N2Q A;  4I9F A;  2HHH C;  1IBL C;  4G37 A;  2QVX X;  2DPL A;  3LNV A;  1XHJ A;  2JNV A;  1IB8 A;  5IWA C;  2ATW A;  2VZE A;  3TQI A;  4IZ6 A;  5BSU A;  2VQF C;  2ZZN A;  1LQL A;  4HPV A;  1PG4 A;  5K85 A;  4DV4 C;  2CXC A;  4LF8 C;  4KTT A;  2D28 C;  1L2F A;  1QM4 A;  4DCS A;  1J5E C;  3A9U A;  3LNO A;  3GPC A;  1XNR C;  1P4E C;  4LFA C;  4ODJ A;  4K0K C;  4FUQ A;  4K0B A;  2E8C A;  5BUS A;  3UOW A;  1N2F A;  4EAT A;  2NCL A;  3NYQ A;  4D4G A;  4YHH C;  4I9G A;  4LE5 A;  1FJG C;  4D4I A;  3OTO C;  3JAM D;  5AE3 A;  1MDB A;  3B7W A;  2XR1 A;  2V7B A;  1USP A;  3TR3 A;  3FCC A;  4X62 C;  3IEV A;  1WCJ A;  1ULT A;  1XRC A;  4BSZ A;  4OX9 C;  1N32 C;  3L95 X;  2PG1 E;  3A26 A;  4L7I A;  4B3S C;  2P2Q A;  3DAY A;  5DV9 A;  2UXD C;  2JMP A;  1HR0 C;  1I94 C;  4DG8 A;  1XRB A;  4R0M A;  5LMU C;  2ZTB A;  4DR1 C;  4OYC A;  3FM7 A;  3CJE A;  4DR6 C;  2CU6 A;  5BUR A;  4IR7 A;  3VNQ A;  5IFI A;  1P4E A;  1UKK A;  5T8S A;  4ZLP A;  4LF7 C;  2QW0 X;  1BA3 A;  1O90 A;  2D27 A;  3GR1 A;  5BSV A;  1ZB8 A;  3GKU A;  4JYA C;  1IBK C;  4DG9 A;  5BSM A;  3N54 B;  3SO4 A;  1O93 A;  3R9X A;  2QL8 A;  4YY3 C;  3ETO A;  5A19 A;  3RG2 A;  3TDE A;  4DCV A;  2WP0 C;  4RM2 A;  3LAX A;  1MXC A;  2P2M A;  2ONF A;  1RG9 A;  4DV7 C;  2BH1 X;  2Z51 A;  2VSQ A;  4AQY C;  4DR5 C;  4NDN A;  4D57 A;  2ZM6 C;  1N33 C;  5A1I A;  1LCI A;  4DUY C;  2UUA C;  1PA4 A;  5BSR A;  4JI1 C;  4LF5 C;  2MMA B;  2QVZ X;  5KEI A;  2YWB A;  4G1I A;  2E8E A;  1RY2 A;  4PZP A;  4L2Z A;  2Y4O A;  4DUZ C;  2D1S A;  5BR8 C;  2D1R A;  4B3R C;  2PRO A;  1NY8 A;  2E7G A;  3IPL A;  2F4V C;  1KKG A;  5A1G A;  3R44 A;  5H9U A;  1P7L A;  1VEH A;  1M6X C;  2P2J A;  2WD9 A;  2EGT A;  4DR4 C;  4TPS B;  4FTF A;  2PT7 G;  2BJO A;  2UU9 C;  4X64 C;  1XMQ C;  3UEB A;  3PES A;  4JV5 C;  2M5O A;  4NOZ A;  2AYA A;  2Y27 A;  4GS5 A;  3NI2 A;  3EQ6 A;  4JI0 C;  3UZ0 A;  4JI8 C;  2UUC C;  2CY1 A;  5CZX A;  3NYR A;  2ASB A;  5AE2 A;  1IBM C;  1MXB A;  3R9W A;  4RVN A;  4BCA A;  2YX1 A;  4MTN A;  1YJ7 A;  4GKK C;  3DLP X;  5BST A;  2VQE C;  2P2B A;  2PN2 A;  4NXM C;  1HH2 P;  1K0R A;  4NXN C;  3GR0 A;  1T5H X;  2D1Q A;  2KZ0 A;  4DR3 C;  1UWD A;  3NPD A;  4LFB C;  1TH5 A;  1V60 A;  5BUQ A;  5K8F A;  1WF3 A;  3KXW A;  3VNS A;  5CZV A;  3A9V A;  1USP B;  4GXR A;  1XS3 A;  4LF6 C;  3E7X A;  3CW9 A;  4B3T C;  3S82 A;  4DCU A;  3H2T A;  1N36 C;  4DV1 C;  1GPM A;  5KYV A;  5FLX D;  3ETC A;  4WS9 A;  1FUG A;  4XX2 A;  4L4Q A;  4BC7 A;  3I07 A;  1PU1 A;  3CQ2 A;  4JI4 C;  4LF4 C;  1HNW C;  4JI2 C;  1HNX C;  1M6X A;  2DHM A;  1AMU A;  4GXQ A;  4U5Y D;  1NYE A;  4KHP C;  5E7Q A;  2OBV A;  2E5L C;  3RV2 A;  4ZJZ A;  4D56 A;  1ML8 A;  1O9T A;  5KYT A;  1V25 A;  3C5E A;  4DV2 C;  2YCB A; 
#chains in the Genus database with same CATH homology
 2D7V A;  4RM3 A;  2P2F A;  4B3M C;  3DHV A;  1MDF A;  4MH4 A;  1HNZ C;  5JRH A;  5T8T A;  1N34 C;  3J81 D;  3CW8 X;  3VNR A;  2D1T A;  4ISB A;  2UXC C;  2UXB C;  4WV3 A;  2HJG A;  3PRO C;  4FUT A;  5GTD A;  1WH9 A;  4DR7 C;  4LF9 C;  1XMO C;  5LMN C;  2YWC A;  4G36 A;  3AF5 A;  3LUS A;  1VLA A;  4JM1 A;  3TUF A;  2OPL B;  4X66 C;  4DV0 C;  1PG3 A;  4DR2 C;  4JI7 C;  1MD9 A;  4DV5 C;  1XRA A;  4BC9 A;  2OO4 A;  3FCE A;  4PHT A;  3IML A;  5IT9 D;  1ZB9 A;  1MXA A;  2QVY X;  4PRO C;  4OXI A;  5A2Q D;  1XNQ C;  4X65 C;  3E7W A;  3A4I A;  4JI5 C;  1V26 A;  2DYJ A;  4LFC C;  4JI6 C;  3T1Y C;  4DV6 C;  4RVO A;  4BBY A;  2E0G A;  2P20 A;  4KTV A;  2OPL A;  5BSW A;  5ADZ A;  4R1L A;  4GKJ C;  4RMN A;  1T5D X;  3T1H C;  4DV3 C;  1QWI A;  3I08 A;  4RLQ A;  2Y4N A;  3J80 D;  3IEU A;  3EER A;  3LGX A;  3J7A D;  1O92 A;  5AE1 A;  3PBK A;  4RLF A;  2E8F A;  4JI3 C;  1MKY A;  3L8C A;  2UUB C;  1EGA A;  1JOS A;  4DCT A;  2KZF A;  2P02 A;  3AF6 A;  4R1M A;  3G7S A;  3N2Q A;  4I9F A;  2HHH C;  1IBL C;  4G37 A;  2QVX X;  2DPL A;  3LNV A;  5IWA C;  2ATW A;  2VZE A;  3TQI A;  4IZ6 A;  5BSU A;  2VQF C;  1LQL A;  4HPV A;  1PG4 A;  5K85 A;  4DV4 C;  2CXC A;  4LF8 C;  4KTT A;  2D28 C;  1L2F A;  1QM4 A;  4DCS A;  1J5E C;  3A9U A;  3GPC A;  1XNR C;  4LFA C;  4ODJ A;  4K0K C;  4FUQ A;  4K0B A;  2E8C A;  5BUS A;  1N2F A;  3UOW A;  4EAT A;  3NYQ A;  4D4G A;  4YHH C;  4I9G A;  4LE5 A;  1FJG C;  4D4I A;  3OTO C;  3JAM D;  5AE3 A;  1MDB A;  3B7W A;  2XR1 A;  2V7B A;  1USP A;  3FCC A;  4X62 C;  3IEV A;  1ULT A;  1XRC A;  4BSZ A;  4OX9 C;  1N32 C;  3L95 X;  4L7I A;  4B3S C;  2P2Q A;  3DAY A;  5DV9 A;  2UXD C;  2JMP A;  1HR0 C;  1I94 C;  4DG8 A;  1XRB A;  4R0M A;  5LMU C;  4DR1 C;  4OYC A;  3CJE A;  4DR6 C;  5BUR A;  4IR7 A;  3VNQ A;  5IFI A;  1UKK A;  5T8S A;  4ZLP A;  4LF7 C;  2QW0 X;  1BA3 A;  1O90 A;  2D27 A;  3GR1 A;  5BSV A;  1ZB8 A;  3GKU A;  4JYA C;  1IBK C;  4DG9 A;  5BSM A;  3N54 B;  3SO4 A;  1O93 A;  3R9X A;  2QL8 A;  4YY3 C;  3ETO A;  5A19 A;  3RG2 A;  3TDE A;  4DCV A;  2WP0 C;  4RM2 A;  3LAX A;  1MXC A;  2P2M A;  2ONF A;  1RG9 A;  4DV7 C;  2BH1 X;  2VSQ A;  4AQY C;  4DR5 C;  4NDN A;  4D57 A;  2ZM6 C;  1N33 C;  5A1I A;  1LCI A;  4DUY C;  2UUA C;  1PA4 A;  5BSR A;  4LF5 C;  4JI1 C;  2QVZ X;  5KEI A;  2YWB A;  4G1I A;  2E8E A;  1RY2 A;  4PZP A;  4L2Z A;  2Y4O A;  4DUZ C;  2D1S A;  5BR8 C;  2D1R A;  4B3R C;  2PRO A;  2E7G A;  3IPL A;  2F4V C;  1KKG A;  5A1G A;  3R44 A;  5H9U A;  1P7L A;  2P2J A;  2WD9 A;  2EGT A;  4DR4 C;  4TPS B;  4FTF A;  2PT7 G;  2BJO A;  2UU9 C;  4X64 C;  1XMQ C;  3PES A;  4JV5 C;  4NOZ A;  2AYA A;  2Y27 A;  4GS5 A;  3NI2 A;  3EQ6 A;  4JI0 C;  3UZ0 A;  4JI8 C;  2UUC C;  2CY1 A;  5CZX A;  3NYR A;  2ASB A;  5AE2 A;  1IBM C;  1MXB A;  3R9W A;  4RVN A;  4BCA A;  4MTN A;  1YJ7 A;  4GKK C;  3DLP X;  5BST A;  2VQE C;  2P2B A;  2PN2 A;  4NXM C;  1HH2 P;  1K0R A;  4NXN C;  3GR0 A;  1T5H X;  2D1Q A;  4DR3 C;  3NPD A;  4LFB C;  5BUQ A;  5K8F A;  1WF3 A;  3KXW A;  3VNS A;  5CZV A;  3A9V A;  1USP B;  4GXR A;  4LF6 C;  3E7X A;  3CW9 A;  4B3T C;  3S82 A;  4DCU A;  3H2T A;  1N36 C;  4DV1 C;  1GPM A;  5KYV A;  5FLX D;  3ETC A;  4WS9 A;  1FUG A;  4XX2 A;  4L4Q A;  4BC7 A;  3I07 A;  4JI4 C;  4LF4 C;  1HNW C;  4JI2 C;  1HNX C;  1AMU A;  4GXQ A;  4U5Y D;  1NYE A;  4KHP C;  5E7Q A;  2OBV A;  2E5L C;  3RV2 A;  4ZJZ A;  4D56 A;  1ML8 A;  1O9T A;  1V25 A;  3C5E A;  5KYT A;  4DV2 C;  2YCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...