4DV5C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv5C02
1ZB9A 2HHHC 3CJEA 4LF4C 3T1YC 4BSZA 2OPLB 4X64C 1VLAA 1WH9A 3GKUA 1ML8A 1N32C 4B3SC 4DV0C 1HNWC 5FLXD 4DV4C 3IEVA 2ATWA 4DUZC 2JMPA 4DCUA 4LF5C 3J81D 1L2FA 1N36C 4LF9C 1WF3A 2UUAC 1FJGC 2UU9C 4B3TC 4LF6C 4NOZA 1KKGA 3LUSA 2XR1A 2E8FA 4JI1C 5LMNC 4JI2C 4K0KC 2EGTA 1HNXC 2UXBC 3J7AD 2BJOA 4DV7C 2UUCC 1MKYA 2UXCC 5BR8C 2VQEC 1LQLA 5IT9D 1HNZC 1UKKA 1HR0C 4DV1C 2CXCA 4GKKC 4JV5C 2E7GA 2DYJA 4LF8C 4DCVA 4GKJC 4DR3C 4X65C 1N34C 3J80D 2OPLA 2VQFC 4B3MC 1HH2P 4DR6C 4LFBC 4NXMC 2E5LC 3R9XA 4DR7C 2YCBA 2CY1A 1JOSA 1EGAA 4AQYC 2UUBC 4X62C 4JI8C 4DV3C 3R9WA 2ASBA 2KZFA 4DCTA 4DV2C 2UXDC 1I94C 3AF5A 1USPB 4JI3C 2HJGA 4DR1C 4LFCC 1XNQC 2F4VC 4KHPC 4NXNC 1PA4A 4DCSA 3IEUA 2ONFA 2QL8A 4LF7C 3JAMD 4DR2C 4YY3C 4JYAC 2E8EA 4DV6C 1ZB8A 3EERA 4DV5C 1N33C 3T1HC 3I07A 4X66C 4JI0C 1XMQC 4LFAC 4B3RC 1N2FA 2ZM6C 5IWAC 2E8CA 1IBKC 4MTNA 2PT7G 4JI7C 4YHHC 4DUYC 2PN2A 4DR4C 5LMUC 4DR5C 4JI6C 1K0RA 4XX2A 4MH4A 4JI5C 1IBMC 1J5EC 4JI4C 4OX9C 1XMOC 1IBLC 1XNRC 5A2QD 1QWIA 3OTOC 3AF6A 1NYEA 1USPA 2D7VA
chains in the Genus database with same CATH superfamily
1ZB9A 2V7BA 3LGXA 4X64C 3UEBA 1WH9A 3B7WA 3FCCA 3A26A 1HNWC 4TPSB 5BUSA 3J81D 4G1IA 1FJGC 4NOZA 5KYTA 2UUCC 1MKYA 2UXCC 1PG4A 3LNVA 2VQEC 1LQLA 5BSUA 2BH1X 4DV1C 3K6RA 1M6XC 4GKKC 5K8FA 3C5EA 3TQIA 1HH2P 4DR6C 4DR7C 1JOSA 1EGAA 1XRBA 4IR7A 4LE5A 5K85A 4JI8C 4KTTA 4DV3C 5AE1A 5IFIA 2KZFA 2ZZMA 1FUGA 4GXRA 1M6XA 1XNQC 2F4VC 4BCAA 1PA4A 1MDBA 3UX2A 3S82A 2QL8A 3SO4A 1V26A 5JRHA 4LF7C 4RLQA 4ISBA 4JYAC 4DV6C 1XRAA 2ZZNA 4DV5C 1N33C 4X66C 2KZ0A 4JI0C 1PU1A 1P7LA 3IMLA 5BSWA 5T8SA 3A9VA 2KDNA 4RMNA 5IWAC 5BSVA 2D1QA 2PT7G 3NYQA 3GR1A 2P2QA 4K0BA 4DR5C 2MCQA 5BSTA 4OX9C 3AF6A 1NYEA 1USPA 2D7VA 2Y4NA 3FCEA 2YWBA 4L2ZA 5KYVA 2OPLB 1P4EC 2QVYX 1N32C 2DHMA 3IEVA 1UWDA 2JMPA 5AE3A 1V60A 1FLOA 1N36C 2UU9C 4R1LA 4KTVA 5LMNC 4PUHA 2EGTA 1HNXC 2QVXX 2D28C 2BJOA 4NDNA 4DV7C 1V25A 4ODJA 5KEIA 4IZ6A 1P4EA 2Z51A 1HNZC 5IT9D 1IB8A 5A1GA 2E0GA 2CXCA 3UZ0A 2WP0C 3CQ1A 3CW9A 3NPDA 2DYJA 1XDXA 2PG1E 4DR3C 1N34C 4U5YD 3J80D 3PROC 5LCIA 4L7IA 2WD9A 2VQFC 4B3MC 3R9XA 2D1SA 2QW0X 5DV9A 2YCBA 2CY1A 2D27A 3E7WA 1T5DX 2ASBA 3ETOA 4I9FA 4DV2C 2UXDC 3IPLA 1I94C 3AF5A 4OXIA 3TDEA 4KHPC 4PUGA 4DCSA 1O92A 5CZVA 2ONFA 1O9TA 4YY3C 4FUQA 1NY8A 3I07A 1XMQC 4HPVA 3NI2A 2VZEA 4ZLPA 4B3RC 4DG9A 2ZM6C 4RLFA 2P2BA 2PROA 1IBKC 4MTNA 1RG9A 4I9GA 4YHHC 4DR4C 5LMUC 4JI6C 1K0RA 3GR0A 3E7XA 2AYAA 3I08A 1XMOC 2M5OA 3VNRA 1QWIA 4GKJC 4FUTA 2HHHC 4BBYA 4LF4C 3EQ6A 4BSZA 1MDFA 2P2MA 2VSQA 1VLAA 5H9UA 5T8TA 3GKUA 1ML8A 4B3SC 4DV0C 3VNQA 5FLXD 1ULTA 4DCUA 4LF5C 2Y4OA 1L2FA 1WF3A 2UUAC 2JNVA 3H2TA 4PHTA 4D56A 4GS5A 4JI2C 4K0KC 1MXBA 2UXBC 3RG2A 3CW8X 1TH5A 4G36A 5BUQA 4ZJZA 3L95X 4JV5C 2QVZX 4D4IA 2MM9A 2ZTBA 4X65C 3ETCA 1VEHA 5A19A 4NXMC 4WS9A 2E5LC 2D1TA 1AMUA 1MXAA 3DHVA 3UOWA 3R9WA 4RVNA 4DCTA 2Y27A 1USPB 4JI3C 1O90A 1YGTA 1BA3A 4PZPA 3KXWA 2D1RA 2P2FA 2E8EA 2DPLA 1YJ7A 4LFAC 3A25A 2P02A 3LAXA 3PESA 4PROC 1O93A 3N2QA 1MD9A 2PN2A 4MH4A 1XRCA 4R1MA 1WCJA 4JI4C 2NCLA 4JM1A 4RM2A 1IBLC 5E7QA 5A2QD 5BSMA 3CJEA 3T1YC 2P20A 1LCIA 3GPCA 3AY0A 4DV4C 2ATWA 3LNOA 4DUZC 2OO4A 1QM4A 4LF9C 2P2JA 2YWCA 4BC9A 4PUIA 3DLPX 2YX1A 4B3TC 4LF6C 1KKGA 3LUSA 2XR1A 2E8FA 4JI1C 4FTFA 2CU6A 3J7AD 4DG8A 5BR8C 3NYRA 1UKKA 1HR0C 4WV3A 1T5HX 1MXCA 3TUFA 3VNSA 2E7GA 2M5HA 3CQ3A 4LF8C 4DCVA 3PBKA 4RM3A 5A1IA 2OPLA 3N54B 4LFBC 1GPMA 4AQYC 2UUBC 4X62C 4L4QA 4EATA 3FM7A 5BSRA 3A4IA 2MMAB 4OYCA 3TR3A 2HJGA 3RV2A 4DR1C 4LFCC 3CQ2A 3R44A 4NXNC 3L8CA 4D57A 3IEUA 4RVOA 4R0MA 5ADZA 3O2EA 4D4GA 3DAYA 1XHJA 3JAMD 4DR2C 1XS3A 3A9UA 1ZB8A 4BC7A 3EERA 3G7SA 3T1HC 5GTDA 1N2FA 2E8CA 5BURA 4JI7C 1PG3A 4DUYC 4G37A 4XX2A 5AE2A 4JI5C 1IBMC 1J5EC 1XNRC 3UX3A 5CZXA 1RY2A 2OBVA 3OTOC 4GXQA
chains in the Genus database with same CATH topology
1ZB9A 2V7BA 3LGXA 4X64C 1WH9A 3B7WA 3FCCA 1HNWC 4TPSB 5BUSA 3J81D 4G1IA 1FJGC 4NOZA 5KYTA 2UUCC 1MKYA 2UXCC 1PG4A 3LNVA 2VQEC 1LQLA 5BSUA 2BH1X 4DV1C 4GKKC 5K8FA 3C5EA 3TQIA 1HH2P 4DR6C 4DR7C 1JOSA 1EGAA 1XRBA 4IR7A 4LE5A 5K85A 4JI8C 4KTTA 4DV3C 5AE1A 5IFIA 2KZFA 1FUGA 4GXRA 1XNQC 2F4VC 4BCAA 1PA4A 1MDBA 3S82A 2QL8A 3SO4A 1V26A 5JRHA 4LF7C 4RLQA 4ISBA 4JYAC 4DV6C 1XRAA 4DV5C 1N33C 4X66C 4JI0C 1P7LA 3IMLA 5BSWA 5T8SA 3A9VA 4RMNA 5IWAC 5BSVA 2D1QA 2PT7G 3NYQA 3GR1A 2P2QA 4K0BA 4DR5C 5BSTA 4OX9C 3AF6A 1NYEA 1USPA 2D7VA 2Y4NA 3FCEA 2YWBA 4L2ZA 5KYVA 2OPLB 2QVYX 1N32C 3IEVA 2JMPA 5AE3A 1N36C 2UU9C 4R1LA 4KTVA 5LMNC 2EGTA 1HNXC 2QVXX 2D28C 2BJOA 4NDNA 4DV7C 1V25A 4ODJA 5KEIA 4IZ6A 1HNZC 5IT9D 5A1GA 2E0GA 2CXCA 3UZ0A 2WP0C 3CW9A 3NPDA 2DYJA 4DR3C 1N34C 4U5YD 3J80D 3PROC 4L7IA 2WD9A 2VQFC 4B3MC 3R9XA 2D1SA 2QW0X 5DV9A 2YCBA 2CY1A 2D27A 3E7WA 1T5DX 2ASBA 3ETOA 4I9FA 4DV2C 2UXDC 3IPLA 1I94C 3AF5A 4OXIA 3TDEA 4KHPC 1O92A 4DCSA 5CZVA 2ONFA 1O9TA 4YY3C 4FUQA 3I07A 1XMQC 4HPVA 3NI2A 2VZEA 4ZLPA 4B3RC 4DG9A 2ZM6C 4RLFA 2P2BA 2PROA 1IBKC 4MTNA 1RG9A 4I9GA 4YHHC 4DR4C 5LMUC 4JI6C 1K0RA 3GR0A 3E7XA 2AYAA 3I08A 1XMOC 3VNRA 1QWIA 4GKJC 4FUTA 2HHHC 4BBYA 4LF4C 3EQ6A 4BSZA 1MDFA 2P2MA 2VSQA 1VLAA 5H9UA 5T8TA 3GKUA 1ML8A 4B3SC 4DV0C 3VNQA 5FLXD 1ULTA 4DCUA 4LF5C 2Y4OA 1L2FA 1WF3A 2UUAC 3H2TA 4PHTA 4D56A 4GS5A 4JI2C 4K0KC 1MXBA 2UXBC 3RG2A 3CW8X 4G36A 5BUQA 4ZJZA 3L95X 4JV5C 2QVZX 4D4IA 4X65C 3ETCA 5A19A 4NXMC 4WS9A 2E5LC 2D1TA 1AMUA 1MXAA 3DHVA 3UOWA 3R9WA 4RVNA 4DCTA 2Y27A 1USPB 4JI3C 1O90A 1BA3A 4PZPA 3KXWA 2D1RA 2P2FA 2E8EA 2DPLA 1YJ7A 4LFAC 2P02A 3LAXA 3PESA 4PROC 1O93A 3N2QA 1MD9A 2PN2A 4MH4A 1XRCA 4R1MA 4JI4C 4JM1A 4RM2A 1IBLC 5E7QA 5A2QD 5BSMA 3CJEA 3T1YC 2P20A 1LCIA 3GPCA 4DV4C 2ATWA 4DUZC 2OO4A 1QM4A 4LF9C 2P2JA 2YWCA 4BC9A 3DLPX 4B3TC 4LF6C 1KKGA 3LUSA 2XR1A 2E8FA 4JI1C 4FTFA 3J7AD 4DG8A 5BR8C 3NYRA 1UKKA 1HR0C 4WV3A 1T5HX 1MXCA 3TUFA 3VNSA 2E7GA 4LF8C 4DCVA 3PBKA 4RM3A 5A1IA 2OPLA 3N54B 4LFBC 1GPMA 4AQYC 2UUBC 4X62C 4L4QA 4EATA 5BSRA 3A4IA 4OYCA 2HJGA 3RV2A 4DR1C 4LFCC 3R44A 4NXNC 3L8CA 4D57A 3IEUA 4RVOA 4R0MA 5ADZA 4D4GA 3DAYA 3JAMD 4DR2C 3A9UA 1ZB8A 4BC7A 3EERA 3G7SA 3T1HC 5GTDA 1N2FA 2E8CA 5BURA 4JI7C 1PG3A 4DUYC 4G37A 4XX2A 5AE2A 4JI5C 1IBMC 1J5EC 1XNRC 5CZXA 1RY2A 2OBVA 3OTOC 4GXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB9 A;  2HHH C;  3CJE A;  4LF4 C;  3T1Y C;  4BSZ A;  2OPL B;  4X64 C;  1VLA A;  1WH9 A;  3GKU A;  1ML8 A;  1N32 C;  4B3S C;  4DV0 C;  1HNW C;  5FLX D;  4DV4 C;  3IEV A;  2ATW A;  4DUZ C;  2JMP A;  4DCU A;  4LF5 C;  3J81 D;  1L2F A;  1N36 C;  4LF9 C;  1WF3 A;  2UUA C;  1FJG C;  2UU9 C;  4B3T C;  4LF6 C;  4NOZ A;  1KKG A;  3LUS A;  2XR1 A;  2E8F A;  4JI1 C;  5LMN C;  4JI2 C;  4K0K C;  2EGT A;  1HNX C;  2UXB C;  3J7A D;  2BJO A;  4DV7 C;  2UUC C;  1MKY A;  2UXC C;  5BR8 C;  2VQE C;  1LQL A;  5IT9 D;  1HNZ C;  1UKK A;  1HR0 C;  4DV1 C;  2CXC A;  4GKK C;  4JV5 C;  2E7G A;  2DYJ A;  4LF8 C;  4DCV A;  4GKJ C;  4DR3 C;  4X65 C;  1N34 C;  3J80 D;  2OPL A;  2VQF C;  4B3M C;  1HH2 P;  4DR6 C;  4LFB C;  4NXM C;  2E5L C;  3R9X A;  4DR7 C;  2YCB A;  2CY1 A;  1JOS A;  1EGA A;  4AQY C;  2UUB C;  4X62 C;  4JI8 C;  4DV3 C;  3R9W A;  2ASB A;  2KZF A;  4DCT A;  4DV2 C;  2UXD C;  1I94 C;  3AF5 A;  1USP B;  4JI3 C;  2HJG A;  4DR1 C;  4LFC C;  1XNQ C;  2F4V C;  4KHP C;  4NXN C;  1PA4 A;  4DCS A;  3IEU A;  2ONF A;  2QL8 A;  4LF7 C;  3JAM D;  4DR2 C;  4YY3 C;  4JYA C;  2E8E A;  4DV6 C;  1ZB8 A;  3EER A;  4DV5 C;  1N33 C;  3T1H C;  3I07 A;  4X66 C;  4JI0 C;  1XMQ C;  4LFA C;  4B3R C;  1N2F A;  2ZM6 C;  5IWA C;  2E8C A;  1IBK C;  4MTN A;  2PT7 G;  4JI7 C;  4YHH C;  4DUY C;  2PN2 A;  4DR4 C;  5LMU C;  4DR5 C;  4JI6 C;  1K0R A;  4XX2 A;  4MH4 A;  4JI5 C;  1IBM C;  1J5E C;  4JI4 C;  4OX9 C;  1XMO C;  1IBL C;  1XNR C;  5A2Q D;  1QWI A;  3OTO C;  3AF6 A;  1NYE A;  1USP A;  2D7V A; 
#chains in the Genus database with same CATH topology
 1ZB9 A;  2V7B A;  3LGX A;  4X64 C;  3UEB A;  1WH9 A;  3B7W A;  3FCC A;  3A26 A;  1HNW C;  4TPS B;  5BUS A;  3J81 D;  4G1I A;  1FJG C;  4NOZ A;  5KYT A;  2UUC C;  1MKY A;  2UXC C;  1PG4 A;  3LNV A;  2VQE C;  1LQL A;  5BSU A;  2BH1 X;  4DV1 C;  3K6R A;  1M6X C;  4GKK C;  5K8F A;  3C5E A;  3TQI A;  1HH2 P;  4DR6 C;  4DR7 C;  1JOS A;  1EGA A;  1XRB A;  4IR7 A;  4LE5 A;  5K85 A;  4JI8 C;  4KTT A;  4DV3 C;  5AE1 A;  5IFI A;  2KZF A;  2ZZM A;  1FUG A;  4GXR A;  1M6X A;  1XNQ C;  2F4V C;  4BCA A;  1PA4 A;  1MDB A;  3UX2 A;  3S82 A;  2QL8 A;  3SO4 A;  1V26 A;  5JRH A;  4LF7 C;  4RLQ A;  4ISB A;  4JYA C;  4DV6 C;  1XRA A;  2ZZN A;  4DV5 C;  1N33 C;  4X66 C;  2KZ0 A;  4JI0 C;  1PU1 A;  1P7L A;  3IML A;  5BSW A;  5T8S A;  3A9V A;  2KDN A;  4RMN A;  5IWA C;  5BSV A;  2D1Q A;  2PT7 G;  3NYQ A;  3GR1 A;  2P2Q A;  4K0B A;  4DR5 C;  2MCQ A;  5BST A;  4OX9 C;  3AF6 A;  1NYE A;  1USP A;  2D7V A;  2Y4N A;  3FCE A;  2YWB A;  4L2Z A;  5KYV A;  2OPL B;  1P4E C;  2QVY X;  1N32 C;  2DHM A;  3IEV A;  1UWD A;  2JMP A;  5AE3 A;  1V60 A;  1FLO A;  1N36 C;  2UU9 C;  4R1L A;  4KTV A;  5LMN C;  4PUH A;  2EGT A;  1HNX C;  2QVX X;  2D28 C;  2BJO A;  4NDN A;  4DV7 C;  1V25 A;  4ODJ A;  5KEI A;  4IZ6 A;  1P4E A;  2Z51 A;  1HNZ C;  5IT9 D;  1IB8 A;  5A1G A;  2E0G A;  2CXC A;  3UZ0 A;  2WP0 C;  3CQ1 A;  3CW9 A;  3NPD A;  2DYJ A;  1XDX A;  2PG1 E;  4DR3 C;  1N34 C;  4U5Y D;  3J80 D;  3PRO C;  5LCI A;  4L7I A;  2WD9 A;  2VQF C;  4B3M C;  3R9X A;  2D1S A;  2QW0 X;  5DV9 A;  2YCB A;  2CY1 A;  2D27 A;  3E7W A;  1T5D X;  2ASB A;  3ETO A;  4I9F A;  4DV2 C;  2UXD C;  3IPL A;  1I94 C;  3AF5 A;  4OXI A;  3TDE A;  4KHP C;  4PUG A;  4DCS A;  1O92 A;  5CZV A;  2ONF A;  1O9T A;  4YY3 C;  4FUQ A;  1NY8 A;  3I07 A;  1XMQ C;  4HPV A;  3NI2 A;  2VZE A;  4ZLP A;  4B3R C;  4DG9 A;  2ZM6 C;  4RLF A;  2P2B A;  2PRO A;  1IBK C;  4MTN A;  1RG9 A;  4I9G A;  4YHH C;  4DR4 C;  5LMU C;  4JI6 C;  1K0R A;  3GR0 A;  3E7X A;  2AYA A;  3I08 A;  1XMO C;  2M5O A;  3VNR A;  1QWI A;  4GKJ C;  4FUT A;  2HHH C;  4BBY A;  4LF4 C;  3EQ6 A;  4BSZ A;  1MDF A;  2P2M A;  2VSQ A;  1VLA A;  5H9U A;  5T8T A;  3GKU A;  1ML8 A;  4B3S C;  4DV0 C;  3VNQ A;  5FLX D;  1ULT A;  4DCU A;  4LF5 C;  2Y4O A;  1L2F A;  1WF3 A;  2UUA C;  2JNV A;  3H2T A;  4PHT A;  4D56 A;  4GS5 A;  4JI2 C;  4K0K C;  1MXB A;  2UXB C;  3RG2 A;  3CW8 X;  1TH5 A;  4G36 A;  5BUQ A;  4ZJZ A;  3L95 X;  4JV5 C;  2QVZ X;  4D4I A;  2MM9 A;  2ZTB A;  4X65 C;  3ETC A;  1VEH A;  5A19 A;  4NXM C;  4WS9 A;  2E5L C;  2D1T A;  1AMU A;  1MXA A;  3DHV A;  3UOW A;  3R9W A;  4RVN A;  4DCT A;  2Y27 A;  1USP B;  4JI3 C;  1O90 A;  1YGT A;  1BA3 A;  4PZP A;  3KXW A;  2D1R A;  2P2F A;  2E8E A;  2DPL A;  1YJ7 A;  4LFA C;  3A25 A;  2P02 A;  3LAX A;  3PES A;  4PRO C;  1O93 A;  3N2Q A;  1MD9 A;  2PN2 A;  4MH4 A;  1XRC A;  4R1M A;  1WCJ A;  4JI4 C;  2NCL A;  4JM1 A;  4RM2 A;  1IBL C;  5E7Q A;  5A2Q D;  5BSM A;  3CJE A;  3T1Y C;  2P20 A;  1LCI A;  3GPC A;  3AY0 A;  4DV4 C;  2ATW A;  3LNO A;  4DUZ C;  2OO4 A;  1QM4 A;  4LF9 C;  2P2J A;  2YWC A;  4BC9 A;  4PUI A;  3DLP X;  2YX1 A;  4B3T C;  4LF6 C;  1KKG A;  3LUS A;  2XR1 A;  2E8F A;  4JI1 C;  4FTF A;  2CU6 A;  3J7A D;  4DG8 A;  5BR8 C;  3NYR A;  1UKK A;  1HR0 C;  4WV3 A;  1T5H X;  1MXC A;  3TUF A;  3VNS A;  2E7G A;  2M5H A;  3CQ3 A;  4LF8 C;  4DCV A;  3PBK A;  4RM3 A;  5A1I A;  2OPL A;  3N54 B;  4LFB C;  1GPM A;  4AQY C;  2UUB C;  4X62 C;  4L4Q A;  4EAT A;  3FM7 A;  5BSR A;  3A4I A;  2MMA B;  4OYC A;  3TR3 A;  2HJG A;  3RV2 A;  4DR1 C;  4LFC C;  3CQ2 A;  3R44 A;  4NXN C;  3L8C A;  4D57 A;  3IEU A;  4RVO A;  4R0M A;  5ADZ A;  3O2E A;  4D4G A;  3DAY A;  1XHJ A;  3JAM D;  4DR2 C;  1XS3 A;  3A9U A;  1ZB8 A;  4BC7 A;  3EER A;  3G7S A;  3T1H C;  5GTD A;  1N2F A;  2E8C A;  5BUR A;  4JI7 C;  1PG3 A;  4DUY C;  4G37 A;  4XX2 A;  5AE2 A;  4JI5 C;  1IBM C;  1J5E C;  1XNR C;  3UX3 A;  5CZX A;  1RY2 A;  2OBV A;  3OTO C;  4GXQ A; 
#chains in the Genus database with same CATH homology
 1ZB9 A;  2V7B A;  3LGX A;  4X64 C;  1WH9 A;  3B7W A;  3FCC A;  1HNW C;  4TPS B;  5BUS A;  3J81 D;  4G1I A;  1FJG C;  4NOZ A;  5KYT A;  2UUC C;  1MKY A;  2UXC C;  1PG4 A;  3LNV A;  2VQE C;  1LQL A;  5BSU A;  2BH1 X;  4DV1 C;  4GKK C;  5K8F A;  3C5E A;  3TQI A;  1HH2 P;  4DR6 C;  4DR7 C;  1JOS A;  1EGA A;  1XRB A;  4IR7 A;  4LE5 A;  5K85 A;  4JI8 C;  4KTT A;  4DV3 C;  5AE1 A;  5IFI A;  2KZF A;  1FUG A;  4GXR A;  1XNQ C;  2F4V C;  4BCA A;  1PA4 A;  1MDB A;  3S82 A;  2QL8 A;  3SO4 A;  1V26 A;  5JRH A;  4LF7 C;  4RLQ A;  4ISB A;  4JYA C;  4DV6 C;  1XRA A;  4DV5 C;  1N33 C;  4X66 C;  4JI0 C;  1P7L A;  3IML A;  5BSW A;  5T8S A;  3A9V A;  4RMN A;  5IWA C;  5BSV A;  2D1Q A;  2PT7 G;  3NYQ A;  3GR1 A;  2P2Q A;  4K0B A;  4DR5 C;  5BST A;  4OX9 C;  3AF6 A;  1NYE A;  1USP A;  2D7V A;  2Y4N A;  3FCE A;  2YWB A;  4L2Z A;  5KYV A;  2OPL B;  2QVY X;  1N32 C;  3IEV A;  2JMP A;  5AE3 A;  1N36 C;  2UU9 C;  4R1L A;  4KTV A;  5LMN C;  2EGT A;  1HNX C;  2QVX X;  2D28 C;  2BJO A;  4NDN A;  4DV7 C;  1V25 A;  4ODJ A;  5KEI A;  4IZ6 A;  1HNZ C;  5IT9 D;  5A1G A;  2E0G A;  2CXC A;  3UZ0 A;  2WP0 C;  3CW9 A;  3NPD A;  2DYJ A;  4DR3 C;  1N34 C;  4U5Y D;  3J80 D;  3PRO C;  4L7I A;  2WD9 A;  2VQF C;  4B3M C;  3R9X A;  2D1S A;  2QW0 X;  5DV9 A;  2YCB A;  2CY1 A;  2D27 A;  3E7W A;  1T5D X;  2ASB A;  3ETO A;  4I9F A;  4DV2 C;  2UXD C;  3IPL A;  1I94 C;  3AF5 A;  4OXI A;  3TDE A;  4KHP C;  1O92 A;  4DCS A;  5CZV A;  2ONF A;  1O9T A;  4YY3 C;  4FUQ A;  3I07 A;  1XMQ C;  4HPV A;  3NI2 A;  2VZE A;  4ZLP A;  4B3R C;  4DG9 A;  2ZM6 C;  4RLF A;  2P2B A;  2PRO A;  1IBK C;  4MTN A;  1RG9 A;  4I9G A;  4YHH C;  4DR4 C;  5LMU C;  4JI6 C;  1K0R A;  3GR0 A;  3E7X A;  2AYA A;  3I08 A;  1XMO C;  3VNR A;  1QWI A;  4GKJ C;  4FUT A;  2HHH C;  4BBY A;  4LF4 C;  3EQ6 A;  4BSZ A;  1MDF A;  2P2M A;  2VSQ A;  1VLA A;  5H9U A;  5T8T A;  3GKU A;  1ML8 A;  4B3S C;  4DV0 C;  3VNQ A;  5FLX D;  1ULT A;  4DCU A;  4LF5 C;  2Y4O A;  1L2F A;  1WF3 A;  2UUA C;  3H2T A;  4PHT A;  4D56 A;  4GS5 A;  4JI2 C;  4K0K C;  1MXB A;  2UXB C;  3RG2 A;  3CW8 X;  4G36 A;  5BUQ A;  4ZJZ A;  3L95 X;  4JV5 C;  2QVZ X;  4D4I A;  4X65 C;  3ETC A;  5A19 A;  4NXM C;  4WS9 A;  2E5L C;  2D1T A;  1AMU A;  1MXA A;  3DHV A;  3UOW A;  3R9W A;  4RVN A;  4DCT A;  2Y27 A;  1USP B;  4JI3 C;  1O90 A;  1BA3 A;  4PZP A;  3KXW A;  2D1R A;  2P2F A;  2E8E A;  2DPL A;  1YJ7 A;  4LFA C;  2P02 A;  3LAX A;  3PES A;  4PRO C;  1O93 A;  3N2Q A;  1MD9 A;  2PN2 A;  4MH4 A;  1XRC A;  4R1M A;  4JI4 C;  4JM1 A;  4RM2 A;  1IBL C;  5E7Q A;  5A2Q D;  5BSM A;  3CJE A;  3T1Y C;  2P20 A;  1LCI A;  3GPC A;  4DV4 C;  2ATW A;  4DUZ C;  2OO4 A;  1QM4 A;  4LF9 C;  2P2J A;  2YWC A;  4BC9 A;  3DLP X;  4B3T C;  4LF6 C;  1KKG A;  3LUS A;  2XR1 A;  2E8F A;  4JI1 C;  4FTF A;  3J7A D;  4DG8 A;  5BR8 C;  3NYR A;  1UKK A;  1HR0 C;  4WV3 A;  1T5H X;  1MXC A;  3TUF A;  3VNS A;  2E7G A;  4LF8 C;  4DCV A;  3PBK A;  4RM3 A;  5A1I A;  2OPL A;  3N54 B;  4LFB C;  1GPM A;  4AQY C;  2UUB C;  4X62 C;  4L4Q A;  4EAT A;  5BSR A;  3A4I A;  4OYC A;  2HJG A;  3RV2 A;  4DR1 C;  4LFC C;  3R44 A;  4NXN C;  3L8C A;  4D57 A;  3IEU A;  4RVO A;  4R0M A;  5ADZ A;  4D4G A;  3DAY A;  3JAM D;  4DR2 C;  3A9U A;  1ZB8 A;  4BC7 A;  3EER A;  3G7S A;  3T1H C;  5GTD A;  1N2F A;  2E8C A;  5BUR A;  4JI7 C;  1PG3 A;  4DUY C;  4G37 A;  4XX2 A;  5AE2 A;  4JI5 C;  1IBM C;  1J5E C;  1XNR C;  5CZX A;  1RY2 A;  2OBV A;  3OTO C;  4GXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...