4DV5C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv5C02
4DUZC 2CXCA 2YCBA 4MH4A 4DV0C 4JYAC 5IWAC 4B3TC 4GKJC 2D7VA 4JI4C 1VLAA 3I07A 4B3RC 2KZFA 5LMNC 1N33C 4JI2C 2UXCC 4DV5C 1J5EC 4K0KC 4JI0C 4DV7C 2OPLB 4DCSA 4DV3C 1HNZC 1LQLA 3OTOC 4YY3C 1JOSA 3R9XA 1USPB 2JMPA 2ZM6C 4OX9C 4X64C 5A2QD 4LF9C 2ATWA 1ZB9A 1L2FA 2E8EA 2UUAC 4DV1C 4LF7C 1N2FA 4LF4C 4LF8C 1QWIA 4NXMC 4KHPC 1IBLC 2F4VC 4DR5C 2EGTA 4DR1C 3AF6A 4DR3C 1HR0C 2UXBC 1HH2P 2QL8A 1HNWC 4DV6C 5IT9D 4B3MC 2ONFA 3AF5A 3IEVA 4LFAC 1PA4A 2PT7G 1I94C 4DR7C 2VQFC 1N32C 4NXNC 1EGAA 2E7GA 3EERA 1N36C 2UXDC 1XMQC 4LF6C 4B3SC 4DV4C 1WH9A 1KKGA 1HNXC 4X62C 4NOZA 4LFCC 4DCTA 1K0RA 1MKYA 3T1YC 4JI8C 4JI5C 4DV2C 1UKKA 5LMUC 4LFBC 4DCVA 4JV5C 4X65C 4DUYC 3J7AD 1USPA 2E5LC 1IBMC 2ASBA 1ZB8A 2CY1A 1IBKC 1WF3A 4MTNA 4GKKC 4JI1C 1XMOC 2XR1A 4JI3C 5FLXD 2BJOA 3CJEA 1ML8A 4YHHC 2OPLA 4DCUA 1XNQC 3IEUA 2E8FA 4JI6C 1XNRC 3T1HC 3LUSA 3J80D 4DR6C 4JI7C 1FJGC 1NYEA 4XX2A 4DR4C 2UUCC 2UUBC 2E8CA 3JAMD 2HHHC 2DYJA 4DR2C 3J81D 2UU9C 4LF5C 5BR8C 2VQEC 4X66C 4BSZA 4AQYC 2PN2A 1N34C 2HJGA 3R9WA 3GKUA
chains in the Genus database with same CATH superfamily
4G36A 1O92A 4DV0C 4PUHA 4L7IA 1MXBA 3KXWA 1M6XA 4JI4C 2ZTBA 4EATA 4B3RC 3A9UA 5LMNC 1N33C 1O9TA 4JI2C 1J5EC 1FUGA 2D1TA 4G1IA 4JI0C 1T5HX 4DV3C 1LQLA 2YX1A 2D1RA 2JMPA 4OX9C 2MCQA 5AE3A 5A1GA 2QW0X 4DV1C 2OBVA 1N2FA 3GR0A 4LF8C 4NXMC 3R44A 1P4EC 3LGXA 3CQ2A 4DR1C 1RY2A 2UXBC 1ULTA 2KDNA 3NYRA 4GXQA 3UX3A 4DR7C 4I9FA 1N32C 1VEHA 3UX2A 4NXNC 1EGAA 4R1MA 1XMQC 4ISBA 5T8SA 1V25A 2P2MA 2QVZX 2Y27A 1KKGA 3S82A 1PG3A 5BUQA 4NOZA 1K0RA 5K85A 3L95X 3PROC 5LMUC 4LFBC 4DCVA 1IB8A 2YWCA 1PG4A 1USPA 5BSRA 1QM4A 1ZB8A 3A4IA 4I9GA 5K8FA 3ETCA 3K6RA 3LNVA 2QVXX 4PZPA 3CJEA 4YHHC 3PBKA 2ZZNA 4JI6C 4HPVA 2PROA 4D57A 1NYEA 4WV3A 1MDFA 2DYJA 4DR2C 4D56A 4AQYC 4OXIA 3C5EA 3GKUA 4RLFA 4ZJZA 4JYAC 4B3TC 4GKJC 3I07A 2MM9A 4RLQA 1WCJA 5A19A 2OPLB 3FCCA 2M5OA 4YY3C 3B7WA 4PUIA 3R9XA 3NYQA 5BSUA 4OYCA 3N2QA 1LCIA 4X64C 5A2QD 5AE2A 2E8EA 2UUAC 4LF4C 1QWIA 3UZ0A 3DAYA 2M5HA 5DV9A 2EGTA 3AF6A 4DV6C 5IT9D 1O90A 3AF5A 3IEVA 2PG1E 4FTFA 1PA4A 2VQFC 4FUTA 3TDEA 3TUFA 5T8TA 3DLPX 4LF6C 5CZXA 4B3SC 4DV4C 2CU6A 4PROC 1XRAA 1TH5A 1MDBA 2AYAA 4JI8C 1P7LA 4DUYC 1FLOA 1UWDA 1IBMC 2ASBA 3FCEA 3LNOA 3GPCA 1AMUA 1WF3A 4MTNA 4GKKC 3O2EA 1XMOC 4L4QA 2V7BA 5KYTA 4PHTA 3IPLA 2OPLA 5H9UA 3IEUA 1XNQC 2E8FA 2P02A 2QVYX 5BUSA 1FJGC 4JI7C 4DR4C 3GR1A 2E8CA 5IFIA 1XRCA 2P2QA 4LF5C 5BR8C 2VQEC 4X66C 3TR3A 5BSMA 4BSZA 5BSWA 2HJGA 5E7QA 2WP0C 3E7XA 3A26A 4MH4A 1GPMA 5IWAC 2P2JA 2E0GA 2JNVA 2D7VA 2Y4NA 3PESA 3L8CA 2MMAB 1VLAA 5GTDA 4K0KC 3CQ3A 3DHVA 4DV7C 4D4GA 4DCSA 3CW9A 5KYVA 2ATWA 4BC7A 1L2FA 4D4IA 4LF7C 1XRBA 5ADZA 4KHPC 2YWBA 1XHJA 1IBLC 2QL8A 3NPDA 3TQIA 4B3MC 4R0MA 2ONFA 4R1LA 4FUQA 2PT7G 1I94C 4G37A 3A25A 4KTVA 4LE5A 5CZVA 1MXAA 2E7GA 1N36C 2UXDC 3EQ6A 3N54B 1YGTA 2D1SA 1MXCA 1WH9A 1RG9A 1HNXC 5KEIA 2KZ0A 1YJ7A 4DCTA 4LFCC 1MKYA 4DV2C 1UKKA 3J7AD 5JRHA 4IZ6A 2E5LC 1XS3A 4ODJA 3A9VA 4RM2A 2WD9A 2ZZMA 4U5YD 2CY1A 2Y4OA 1V60A 4JI3C 5LCIA 2BJOA 2DHMA 4NDNA 3E7WA 1O93A 3J80D 4DR6C 4PUGA 4JM1A 3JAMD 2HHHC 3J81D 2UU9C 2PN2A 1N34C 4GXRA 4DUZC 2VZEA 2D1QA 2CXCA 2YCBA 3NI2A 3UEBA 3H2TA 4RMNA 3VNQA 2BH1X 5BSTA 3CQ1A 3G7SA 5BSVA 2KZFA 5AE1A 2UXCC 4DV5C 4WS9A 3CW8X 4KTTA 3RV2A 1HNZC 3OTOC 1P4EA 1JOSA 1USPB 2P2BA 4RVOA 2ZM6C 3FM7A 2P20A 3LAXA 4LF9C 1ZB9A 5BURA 3VNSA 1MD9A 1M6XC 1XDXA 2F4VC 4DR5C 1NY8A 2D28C 4DR3C 1HR0C 1HH2P 1HNWC 4DG9A 4BCAA 4BBYA 4LFAC 4L2ZA 4ZLPA 2P2FA 2OO4A 4TPSB 3EERA 4K0BA 4RM3A 3AY0A 4BC9A 4DG8A 4IR7A 4RVNA 3ETOA 3UOWA 2DPLA 4X62C 3T1YC 4JI5C 4JV5C 4X65C 3VNRA 2D27A 3IMLA 3SO4A 1BA3A 1IBKC 3I08A 1T5DX 4JI1C 1PU1A 2XR1A 5FLXD 1ML8A 2NCLA 2VSQA 4DCUA 1XNRC 3T1HC 3LUSA 1V26A 5A1IA 4XX2A 2UUCC 2UUBC 3RG2A 4GS5A 2Z51A 3R9WA
chains in the Genus database with same CATH topology
4G36A 1O92A 4DV0C 4L7IA 1MXBA 3KXWA 4JI4C 4EATA 4B3RC 3A9UA 5LMNC 1N33C 1O9TA 4JI2C 1J5EC 1FUGA 2D1TA 4G1IA 4JI0C 1T5HX 4DV3C 1LQLA 2D1RA 2JMPA 4OX9C 5AE3A 5A1GA 2QW0X 4DV1C 2OBVA 1N2FA 3GR0A 4LF8C 4NXMC 3R44A 3LGXA 4DR1C 1RY2A 2UXBC 1ULTA 3NYRA 4GXQA 4DR7C 4I9FA 1N32C 4NXNC 1EGAA 4R1MA 1XMQC 4ISBA 5T8SA 1V25A 2P2MA 2QVZX 2Y27A 1KKGA 3S82A 1PG3A 5BUQA 4NOZA 1K0RA 5K85A 3L95X 3PROC 5LMUC 4LFBC 4DCVA 2YWCA 1PG4A 1USPA 5BSRA 1QM4A 1ZB8A 3A4IA 4I9GA 5K8FA 3ETCA 3LNVA 2QVXX 4PZPA 3CJEA 4YHHC 3PBKA 4JI6C 4HPVA 2PROA 4D57A 1NYEA 4WV3A 1MDFA 2DYJA 4DR2C 4D56A 4AQYC 4OXIA 3C5EA 3GKUA 4RLFA 4ZJZA 4JYAC 4B3TC 4GKJC 3I07A 4RLQA 5A19A 2OPLB 3FCCA 4YY3C 3B7WA 3R9XA 3NYQA 5BSUA 4OYCA 3N2QA 1LCIA 4X64C 5A2QD 5AE2A 2E8EA 2UUAC 4LF4C 1QWIA 3UZ0A 3DAYA 5DV9A 2EGTA 3AF6A 4DV6C 5IT9D 1O90A 3AF5A 3IEVA 4FTFA 1PA4A 2VQFC 4FUTA 3TDEA 3TUFA 5T8TA 3DLPX 4LF6C 5CZXA 4B3SC 4DV4C 4PROC 1XRAA 1MDBA 2AYAA 4JI8C 1P7LA 4DUYC 1IBMC 2ASBA 3FCEA 3GPCA 1AMUA 1WF3A 4MTNA 4GKKC 1XMOC 4L4QA 2V7BA 5KYTA 4PHTA 3IPLA 2OPLA 5H9UA 3IEUA 1XNQC 2E8FA 2P02A 2QVYX 5BUSA 1FJGC 4JI7C 4DR4C 3GR1A 2E8CA 5IFIA 1XRCA 2P2QA 4LF5C 5BR8C 2VQEC 4X66C 5BSMA 4BSZA 5BSWA 2HJGA 5E7QA 2WP0C 3E7XA 4MH4A 1GPMA 5IWAC 2P2JA 2E0GA 2D7VA 2Y4NA 3PESA 3L8CA 1VLAA 5GTDA 4K0KC 3DHVA 4DV7C 4D4GA 4DCSA 3CW9A 5KYVA 2ATWA 4BC7A 1L2FA 4D4IA 4LF7C 1XRBA 5ADZA 4KHPC 2YWBA 1IBLC 2QL8A 3NPDA 3TQIA 4B3MC 4R0MA 2ONFA 4R1LA 4FUQA 2PT7G 1I94C 4G37A 4KTVA 4LE5A 5CZVA 1MXAA 2E7GA 1N36C 2UXDC 3EQ6A 3N54B 2D1SA 1MXCA 1WH9A 1RG9A 1HNXC 5KEIA 1YJ7A 4DCTA 4LFCC 1MKYA 4DV2C 1UKKA 3J7AD 5JRHA 4IZ6A 2E5LC 4ODJA 3A9VA 4RM2A 2WD9A 4U5YD 2CY1A 2Y4OA 4JI3C 2BJOA 4NDNA 3E7WA 1O93A 3J80D 4DR6C 4JM1A 3JAMD 2HHHC 3J81D 2UU9C 2PN2A 1N34C 4GXRA 4DUZC 2VZEA 2D1QA 2CXCA 2YCBA 3NI2A 3H2TA 4RMNA 3VNQA 2BH1X 5BSTA 3G7SA 5BSVA 2KZFA 5AE1A 2UXCC 4DV5C 4WS9A 3CW8X 4KTTA 3RV2A 1HNZC 3OTOC 1JOSA 1USPB 2P2BA 4RVOA 2ZM6C 2P20A 3LAXA 4LF9C 1ZB9A 5BURA 3VNSA 1MD9A 2F4VC 4DR5C 2D28C 4DR3C 1HR0C 1HH2P 1HNWC 4DG9A 4BCAA 4BBYA 4LFAC 4L2ZA 4ZLPA 2P2FA 2OO4A 4TPSB 3EERA 4K0BA 4RM3A 4DG8A 4BC9A 4IR7A 4RVNA 3ETOA 3UOWA 2DPLA 4X62C 3T1YC 4JI5C 4JV5C 4X65C 3VNRA 2D27A 3IMLA 3SO4A 1BA3A 1IBKC 3I08A 1T5DX 4JI1C 2XR1A 5FLXD 1ML8A 2VSQA 4DCUA 1XNRC 3T1HC 3LUSA 1V26A 5A1IA 4XX2A 2UUCC 2UUBC 3RG2A 4GS5A 3R9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ C;  2CXC A;  2YCB A;  4MH4 A;  4DV0 C;  4JYA C;  5IWA C;  4B3T C;  4GKJ C;  2D7V A;  4JI4 C;  1VLA A;  3I07 A;  4B3R C;  2KZF A;  5LMN C;  1N33 C;  4JI2 C;  2UXC C;  4DV5 C;  1J5E C;  4K0K C;  4JI0 C;  4DV7 C;  2OPL B;  4DCS A;  4DV3 C;  1HNZ C;  1LQL A;  3OTO C;  4YY3 C;  1JOS A;  3R9X A;  1USP B;  2JMP A;  2ZM6 C;  4OX9 C;  4X64 C;  5A2Q D;  4LF9 C;  2ATW A;  1ZB9 A;  1L2F A;  2E8E A;  2UUA C;  4DV1 C;  4LF7 C;  1N2F A;  4LF4 C;  4LF8 C;  1QWI A;  4NXM C;  4KHP C;  1IBL C;  2F4V C;  4DR5 C;  2EGT A;  4DR1 C;  3AF6 A;  4DR3 C;  1HR0 C;  2UXB C;  1HH2 P;  2QL8 A;  1HNW C;  4DV6 C;  5IT9 D;  4B3M C;  2ONF A;  3AF5 A;  3IEV A;  4LFA C;  1PA4 A;  2PT7 G;  1I94 C;  4DR7 C;  2VQF C;  1N32 C;  4NXN C;  1EGA A;  2E7G A;  3EER A;  1N36 C;  2UXD C;  1XMQ C;  4LF6 C;  4B3S C;  4DV4 C;  1WH9 A;  1KKG A;  1HNX C;  4X62 C;  4NOZ A;  4LFC C;  4DCT A;  1K0R A;  1MKY A;  3T1Y C;  4JI8 C;  4JI5 C;  4DV2 C;  1UKK A;  5LMU C;  4LFB C;  4DCV A;  4JV5 C;  4X65 C;  4DUY C;  3J7A D;  1USP A;  2E5L C;  1IBM C;  2ASB A;  1ZB8 A;  2CY1 A;  1IBK C;  1WF3 A;  4MTN A;  4GKK C;  4JI1 C;  1XMO C;  2XR1 A;  4JI3 C;  5FLX D;  2BJO A;  3CJE A;  1ML8 A;  4YHH C;  2OPL A;  4DCU A;  1XNQ C;  3IEU A;  2E8F A;  4JI6 C;  1XNR C;  3T1H C;  3LUS A;  3J80 D;  4DR6 C;  4JI7 C;  1FJG C;  1NYE A;  4XX2 A;  4DR4 C;  2UUC C;  2UUB C;  2E8C A;  3JAM D;  2HHH C;  2DYJ A;  4DR2 C;  3J81 D;  2UU9 C;  4LF5 C;  5BR8 C;  2VQE C;  4X66 C;  4BSZ A;  4AQY C;  2PN2 A;  1N34 C;  2HJG A;  3R9W A;  3GKU A; 
#chains in the Genus database with same CATH topology
 4G36 A;  1O92 A;  4DV0 C;  4PUH A;  4L7I A;  1MXB A;  3KXW A;  1M6X A;  4JI4 C;  2ZTB A;  4EAT A;  4B3R C;  3A9U A;  5LMN C;  1N33 C;  1O9T A;  4JI2 C;  1J5E C;  1FUG A;  2D1T A;  4G1I A;  4JI0 C;  1T5H X;  4DV3 C;  1LQL A;  2YX1 A;  2D1R A;  2JMP A;  4OX9 C;  2MCQ A;  5AE3 A;  5A1G A;  2QW0 X;  4DV1 C;  2OBV A;  1N2F A;  3GR0 A;  4LF8 C;  4NXM C;  3R44 A;  1P4E C;  3LGX A;  3CQ2 A;  4DR1 C;  1RY2 A;  2UXB C;  1ULT A;  2KDN A;  3NYR A;  4GXQ A;  3UX3 A;  4DR7 C;  4I9F A;  1N32 C;  1VEH A;  3UX2 A;  4NXN C;  1EGA A;  4R1M A;  1XMQ C;  4ISB A;  5T8S A;  1V25 A;  2P2M A;  2QVZ X;  2Y27 A;  1KKG A;  3S82 A;  1PG3 A;  5BUQ A;  4NOZ A;  1K0R A;  5K85 A;  3L95 X;  3PRO C;  5LMU C;  4LFB C;  4DCV A;  1IB8 A;  2YWC A;  1PG4 A;  1USP A;  5BSR A;  1QM4 A;  1ZB8 A;  3A4I A;  4I9G A;  5K8F A;  3ETC A;  3K6R A;  3LNV A;  2QVX X;  4PZP A;  3CJE A;  4YHH C;  3PBK A;  2ZZN A;  4JI6 C;  4HPV A;  2PRO A;  4D57 A;  1NYE A;  4WV3 A;  1MDF A;  2DYJ A;  4DR2 C;  4D56 A;  4AQY C;  4OXI A;  3C5E A;  3GKU A;  4RLF A;  4ZJZ A;  4JYA C;  4B3T C;  4GKJ C;  3I07 A;  2MM9 A;  4RLQ A;  1WCJ A;  5A19 A;  2OPL B;  3FCC A;  2M5O A;  4YY3 C;  3B7W A;  4PUI A;  3R9X A;  3NYQ A;  5BSU A;  4OYC A;  3N2Q A;  1LCI A;  4X64 C;  5A2Q D;  5AE2 A;  2E8E A;  2UUA C;  4LF4 C;  1QWI A;  3UZ0 A;  3DAY A;  2M5H A;  5DV9 A;  2EGT A;  3AF6 A;  4DV6 C;  5IT9 D;  1O90 A;  3AF5 A;  3IEV A;  2PG1 E;  4FTF A;  1PA4 A;  2VQF C;  4FUT A;  3TDE A;  3TUF A;  5T8T A;  3DLP X;  4LF6 C;  5CZX A;  4B3S C;  4DV4 C;  2CU6 A;  4PRO C;  1XRA A;  1TH5 A;  1MDB A;  2AYA A;  4JI8 C;  1P7L A;  4DUY C;  1FLO A;  1UWD A;  1IBM C;  2ASB A;  3FCE A;  3LNO A;  3GPC A;  1AMU A;  1WF3 A;  4MTN A;  4GKK C;  3O2E A;  1XMO C;  4L4Q A;  2V7B A;  5KYT A;  4PHT A;  3IPL A;  2OPL A;  5H9U A;  3IEU A;  1XNQ C;  2E8F A;  2P02 A;  2QVY X;  5BUS A;  1FJG C;  4JI7 C;  4DR4 C;  3GR1 A;  2E8C A;  5IFI A;  1XRC A;  2P2Q A;  4LF5 C;  5BR8 C;  2VQE C;  4X66 C;  3TR3 A;  5BSM A;  4BSZ A;  5BSW A;  2HJG A;  5E7Q A;  2WP0 C;  3E7X A;  3A26 A;  4MH4 A;  1GPM A;  5IWA C;  2P2J A;  2E0G A;  2JNV A;  2D7V A;  2Y4N A;  3PES A;  3L8C A;  2MMA B;  1VLA A;  5GTD A;  4K0K C;  3CQ3 A;  3DHV A;  4DV7 C;  4D4G A;  4DCS A;  3CW9 A;  5KYV A;  2ATW A;  4BC7 A;  1L2F A;  4D4I A;  4LF7 C;  1XRB A;  5ADZ A;  4KHP C;  2YWB A;  1XHJ A;  1IBL C;  2QL8 A;  3NPD A;  3TQI A;  4B3M C;  4R0M A;  2ONF A;  4R1L A;  4FUQ A;  2PT7 G;  1I94 C;  4G37 A;  3A25 A;  4KTV A;  4LE5 A;  5CZV A;  1MXA A;  2E7G A;  1N36 C;  2UXD C;  3EQ6 A;  3N54 B;  1YGT A;  2D1S A;  1MXC A;  1WH9 A;  1RG9 A;  1HNX C;  5KEI A;  2KZ0 A;  1YJ7 A;  4DCT A;  4LFC C;  1MKY A;  4DV2 C;  1UKK A;  3J7A D;  5JRH A;  4IZ6 A;  2E5L C;  1XS3 A;  4ODJ A;  3A9V A;  4RM2 A;  2WD9 A;  2ZZM A;  4U5Y D;  2CY1 A;  2Y4O A;  1V60 A;  4JI3 C;  5LCI A;  2BJO A;  2DHM A;  4NDN A;  3E7W A;  1O93 A;  3J80 D;  4DR6 C;  4PUG A;  4JM1 A;  3JAM D;  2HHH C;  3J81 D;  2UU9 C;  2PN2 A;  1N34 C;  4GXR A;  4DUZ C;  2VZE A;  2D1Q A;  2CXC A;  2YCB A;  3NI2 A;  3UEB A;  3H2T A;  4RMN A;  3VNQ A;  2BH1 X;  5BST A;  3CQ1 A;  3G7S A;  5BSV A;  2KZF A;  5AE1 A;  2UXC C;  4DV5 C;  4WS9 A;  3CW8 X;  4KTT A;  3RV2 A;  1HNZ C;  3OTO C;  1P4E A;  1JOS A;  1USP B;  2P2B A;  4RVO A;  2ZM6 C;  3FM7 A;  2P20 A;  3LAX A;  4LF9 C;  1ZB9 A;  5BUR A;  3VNS A;  1MD9 A;  1M6X C;  1XDX A;  2F4V C;  4DR5 C;  1NY8 A;  2D28 C;  4DR3 C;  1HR0 C;  1HH2 P;  1HNW C;  4DG9 A;  4BCA A;  4BBY A;  4LFA C;  4L2Z A;  4ZLP A;  2P2F A;  2OO4 A;  4TPS B;  3EER A;  4K0B A;  4RM3 A;  3AY0 A;  4BC9 A;  4DG8 A;  4IR7 A;  4RVN A;  3ETO A;  3UOW A;  2DPL A;  4X62 C;  3T1Y C;  4JI5 C;  4JV5 C;  4X65 C;  3VNR A;  2D27 A;  3IML A;  3SO4 A;  1BA3 A;  1IBK C;  3I08 A;  1T5D X;  4JI1 C;  1PU1 A;  2XR1 A;  5FLX D;  1ML8 A;  2NCL A;  2VSQ A;  4DCU A;  1XNR C;  3T1H C;  3LUS A;  1V26 A;  5A1I A;  4XX2 A;  2UUC C;  2UUB C;  3RG2 A;  4GS5 A;  2Z51 A;  3R9W A; 
#chains in the Genus database with same CATH homology
 4G36 A;  1O92 A;  4DV0 C;  4L7I A;  1MXB A;  3KXW A;  4JI4 C;  4EAT A;  4B3R C;  3A9U A;  5LMN C;  1N33 C;  1O9T A;  4JI2 C;  1J5E C;  1FUG A;  2D1T A;  4G1I A;  4JI0 C;  1T5H X;  4DV3 C;  1LQL A;  2D1R A;  2JMP A;  4OX9 C;  5AE3 A;  5A1G A;  2QW0 X;  4DV1 C;  2OBV A;  1N2F A;  3GR0 A;  4LF8 C;  4NXM C;  3R44 A;  3LGX A;  4DR1 C;  1RY2 A;  2UXB C;  1ULT A;  3NYR A;  4GXQ A;  4DR7 C;  4I9F A;  1N32 C;  4NXN C;  1EGA A;  4R1M A;  1XMQ C;  4ISB A;  5T8S A;  1V25 A;  2P2M A;  2QVZ X;  2Y27 A;  1KKG A;  3S82 A;  1PG3 A;  5BUQ A;  4NOZ A;  1K0R A;  5K85 A;  3L95 X;  3PRO C;  5LMU C;  4LFB C;  4DCV A;  2YWC A;  1PG4 A;  1USP A;  5BSR A;  1QM4 A;  1ZB8 A;  3A4I A;  4I9G A;  5K8F A;  3ETC A;  3LNV A;  2QVX X;  4PZP A;  3CJE A;  4YHH C;  3PBK A;  4JI6 C;  4HPV A;  2PRO A;  4D57 A;  1NYE A;  4WV3 A;  1MDF A;  2DYJ A;  4DR2 C;  4D56 A;  4AQY C;  4OXI A;  3C5E A;  3GKU A;  4RLF A;  4ZJZ A;  4JYA C;  4B3T C;  4GKJ C;  3I07 A;  4RLQ A;  5A19 A;  2OPL B;  3FCC A;  4YY3 C;  3B7W A;  3R9X A;  3NYQ A;  5BSU A;  4OYC A;  3N2Q A;  1LCI A;  4X64 C;  5A2Q D;  5AE2 A;  2E8E A;  2UUA C;  4LF4 C;  1QWI A;  3UZ0 A;  3DAY A;  5DV9 A;  2EGT A;  3AF6 A;  4DV6 C;  5IT9 D;  1O90 A;  3AF5 A;  3IEV A;  4FTF A;  1PA4 A;  2VQF C;  4FUT A;  3TDE A;  3TUF A;  5T8T A;  3DLP X;  4LF6 C;  5CZX A;  4B3S C;  4DV4 C;  4PRO C;  1XRA A;  1MDB A;  2AYA A;  4JI8 C;  1P7L A;  4DUY C;  1IBM C;  2ASB A;  3FCE A;  3GPC A;  1AMU A;  1WF3 A;  4MTN A;  4GKK C;  1XMO C;  4L4Q A;  2V7B A;  5KYT A;  4PHT A;  3IPL A;  2OPL A;  5H9U A;  3IEU A;  1XNQ C;  2E8F A;  2P02 A;  2QVY X;  5BUS A;  1FJG C;  4JI7 C;  4DR4 C;  3GR1 A;  2E8C A;  5IFI A;  1XRC A;  2P2Q A;  4LF5 C;  5BR8 C;  2VQE C;  4X66 C;  5BSM A;  4BSZ A;  5BSW A;  2HJG A;  5E7Q A;  2WP0 C;  3E7X A;  4MH4 A;  1GPM A;  5IWA C;  2P2J A;  2E0G A;  2D7V A;  2Y4N A;  3PES A;  3L8C A;  1VLA A;  5GTD A;  4K0K C;  3DHV A;  4DV7 C;  4D4G A;  4DCS A;  3CW9 A;  5KYV A;  2ATW A;  4BC7 A;  1L2F A;  4D4I A;  4LF7 C;  1XRB A;  5ADZ A;  4KHP C;  2YWB A;  1IBL C;  2QL8 A;  3NPD A;  3TQI A;  4B3M C;  4R0M A;  2ONF A;  4R1L A;  4FUQ A;  2PT7 G;  1I94 C;  4G37 A;  4KTV A;  4LE5 A;  5CZV A;  1MXA A;  2E7G A;  1N36 C;  2UXD C;  3EQ6 A;  3N54 B;  2D1S A;  1MXC A;  1WH9 A;  1RG9 A;  1HNX C;  5KEI A;  1YJ7 A;  4DCT A;  4LFC C;  1MKY A;  4DV2 C;  1UKK A;  3J7A D;  5JRH A;  4IZ6 A;  2E5L C;  4ODJ A;  3A9V A;  4RM2 A;  2WD9 A;  4U5Y D;  2CY1 A;  2Y4O A;  4JI3 C;  2BJO A;  4NDN A;  3E7W A;  1O93 A;  3J80 D;  4DR6 C;  4JM1 A;  3JAM D;  2HHH C;  3J81 D;  2UU9 C;  2PN2 A;  1N34 C;  4GXR A;  4DUZ C;  2VZE A;  2D1Q A;  2CXC A;  2YCB A;  3NI2 A;  3H2T A;  4RMN A;  3VNQ A;  2BH1 X;  5BST A;  3G7S A;  5BSV A;  2KZF A;  5AE1 A;  2UXC C;  4DV5 C;  4WS9 A;  3CW8 X;  4KTT A;  3RV2 A;  1HNZ C;  3OTO C;  1JOS A;  1USP B;  2P2B A;  4RVO A;  2ZM6 C;  2P20 A;  3LAX A;  4LF9 C;  1ZB9 A;  5BUR A;  3VNS A;  1MD9 A;  2F4V C;  4DR5 C;  2D28 C;  4DR3 C;  1HR0 C;  1HH2 P;  1HNW C;  4DG9 A;  4BCA A;  4BBY A;  4LFA C;  4L2Z A;  4ZLP A;  2P2F A;  2OO4 A;  4TPS B;  3EER A;  4K0B A;  4RM3 A;  4DG8 A;  4BC9 A;  4IR7 A;  4RVN A;  3ETO A;  3UOW A;  2DPL A;  4X62 C;  3T1Y C;  4JI5 C;  4JV5 C;  4X65 C;  3VNR A;  2D27 A;  3IML A;  3SO4 A;  1BA3 A;  1IBK C;  3I08 A;  1T5D X;  4JI1 C;  2XR1 A;  5FLX D;  1ML8 A;  2VSQ A;  4DCU A;  1XNR C;  3T1H C;  3LUS A;  1V26 A;  5A1I A;  4XX2 A;  2UUC C;  2UUB C;  3RG2 A;  4GS5 A;  3R9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...