4DV5C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv5C02
3CJEA 1USPA 1XNQC 3J80D 2CXCA 5IWAC 4DV2C 1IBLC 2E8FA 4DR1C 1KKGA 4X62C 5A2QD 2UUBC 1UKKA 1JOSA 4LF7C 4JI2C 4LF6C 4X64C 4DCTA 2HJGA 1N36C 2E7GA 3AF6A 1ML8A 1FJGC 2UXBC 4MTNA 4DCVA 4B3TC 4OX9C 4MH4A 2JMPA 4KHPC 2ZM6C 4B3SC 1N34C 2UUCC 4DR7C 4X66C 4JI0C 1WF3A 4DUYC 4JI4C 4DV4C 4JI8C 1ZB8A 4DR3C 4NOZA 4AQYC 4DCUA 4DV3C 4LF9C 2D7VA 1MKYA 1VLAA 2E8CA 3J81D 4LFBC 3IEVA 1N33C 1LQLA 1L2FA 2YCBA 4X65C 4YY3C 5FLXD 2DYJA 4JI1C 2ONFA 2UUAC 1PA4A 1XMQC 1HNWC 3J7AD 4DR2C 2UU9C 4LFCC 5LMNC 2VQFC 4JV5C 2OPLA 1J5EC 2XR1A 4B3RC 3I07A 4DUZC 2VQEC 2E5LC 4LF5C 4JI6C 4DV6C 2ASBA 2PN2A 2HHHC 2UXDC 1N2FA 2PT7G 1K0RA 5IT9D 2KZFA 4XX2A 4JI3C 2ATWA 4DV7C 4LF4C 1QWIA 5LMUC 4DV5C 4BSZA 4JYAC 3LUSA 3AF5A 1HNZC 2OPLB 1HR0C 4NXMC 2F4VC 4DR4C 3EERA 1WH9A 3T1YC 1NYEA 4GKJC 4JI5C 3IEUA 3R9WA 4LF8C 4GKKC 2CY1A 1HH2P 4B3MC 3R9XA 1USPB 2EGTA 3JAMD 4JI7C 4DR6C 4DR5C 1I94C 4K0KC 1N32C 4NXNC 2BJOA 4DV1C 2QL8A 3T1HC 1XMOC 1EGAA 5BR8C 3OTOC 4DCSA 1IBKC 2E8EA 4YHHC 1XNRC 1HNXC 2UXCC 3GKUA 4LFAC 1IBMC 1ZB9A 4DV0C
chains in the Genus database with same CATH superfamily
1XNQC 5BSRA 4L4QA 5IWAC 1IBLC 5T8TA 4BC9A 4X62C 5DV9A 5A2QD 3B7WA 5BSMA 5KYTA 2HJGA 1N36C 4MH4A 3N2QA 4B3SC 1QM4A 2QVZX 2WD9A 3UEBA 3R44A 2JNVA 3PBKA 4JI8C 1ZB8A 4DCUA 3IPLA 3PESA 1GPMA 5CZVA 4LFBC 1MDBA 2V7BA 3NYRA 5AE2A 4BBYA 1M6XC 3AY0A 1PU1A 2ONFA 1XMQC 4DR2C 3FM7A 5BSTA 5LMNC 4JV5C 2ZZNA 4B3RC 5A19A 4LF5C 2PROA 5BUQA 4D4IA 2MMAB 1K0RA 5IT9D 4RLFA 3DAYA 4PUIA 4JYAC 1O90A 1HNZC 2D27A 3E7XA 3NYQA 1WH9A 4IR7A 3CQ2A 2VSQA 4GKJC 4JI5C 3VNRA 4LF8C 4GXQA 2YWCA 4JM1A 1V60A 2EGTA 1PG4A 3KXWA 4JI7C 3RV2A 4DR5C 4D57A 1EGAA 2D28C 5BR8C 3OTOC 2D1QA 3CQ1A 1O92A 4G36A 1IB8A 4I9GA 5BSVA 3EQ6A 1MDFA 2QVYX 4DR1C 3A25A 1M6XA 4PZPA 4NDNA 2P2JA 3UX3A 4LF6C 3A26A 4RVOA 1MXCA 3PROC 3GR0A 3DHVA 2E7GA 3AF6A 1ML8A 1PG3A 4B3TC 1UWDA 1O9TA 1P7LA 1N34C 2YX1A 4DR7C 3CW8X 4X66C 3TDEA 3TUFA 4DUYC 4HPVA 4TPSB 4NOZA 1MD9A 2D7VA 1MKYA 1VLAA 3LNOA 2YWBA 3J81D 2P2MA 3TQIA 1XRCA 2VZEA 4PHTA 4EATA 3NPDA 4ODJA 4GXRA 3J7AD 1XS3A 2UU9C 4LFCC 4G1IA 2VQFC 4FUTA 5KYVA 2OPLA 3I07A 4I9FA 5E7QA 1YJ7A 4JI6C 3ETOA 4DV6C 2PN2A 3DLPX 3LAXA 4RM2A 2P2FA 4LF4C 1QWIA 2PG1E 3LUSA 3AF5A 1XDXA 2OPLB 4NXMC 3EERA 3T1YC 1NYEA 2QW0X 3IEUA 3R9WA 1V26A 3TR3A 4ZJZA 4OXIA 3ETCA 1XHJA 4FUQA 2OBVA 5T8SA 3JAMD 4DR6C 1I94C 4K0KC 1YGTA 4NXNC 4DV1C 3T1HC 4R0MA 1RG9A 3VNQA 4D56A 2Y27A 2E0GA 1XNRC 4WS9A 4LFAC 3A4IA 5AE1A 1RY2A 4DV0C 3K6RA 3J80D 1KKGA 2E8FA 4DG9A 5A1GA 2UUBC 5BUSA 1UKKA 1XRBA 1AMUA 4LF7C 2P2BA 4DCTA 5CZXA 4WV3A 1FJGC 4MTNA 4R1MA 4RM3A 2OO4A 2DPLA 4PUGA 4U5YD 5BSWA 4GS5A 1WF3A 2WP0C 4DR3C 3UX2A 4AQYC 1FUGA 5K8FA 2BH1X 3O2EA 1N33C 1LQLA 4RMNA 1L2FA 4YY3C 5FLXD 2P20A 4JI1C 1LCIA 1PA4A 2NCLA 1HNWC 5KEIA 2P2QA 3VNSA 1P4EA 2VQEC 4R1LA 1NY8A 5GTDA 2HHHC 2QVXX 1N2FA 1WCJA 2KZFA 4XX2A 2ATWA 4DV5C 3NI2A 2KDNA 1P4EC 3IMLA 2F4VC 4DR4C 2M5OA 4OYCA 4K0BA 5IFIA 1T5DX 3GR1A 4RVNA 1TH5A 4GKKC 5ADZA 3N54B 2CY1A 4BC7A 1HH2P 1MXBA 2Z51A 5BURA 1USPB 4B3MC 3R9XA 1MXAA 3RG2A 4L2ZA 2BJOA 4PROC 2QL8A 1XMOC 3E7WA 2DHMA 3S82A 4DCSA 1IBKC 2E8EA 2Y4OA 1HNXC 2KZ0A 1VEHA 1IBMC 1ZB9A 2UUCC 3CJEA 1USPA 3LGXA 1O93A 3CW9A 2CXCA 4DV2C 1XRAA 4LE5A 2P02A 1FLOA 1JOSA 4JI2C 4X64C 3SO4A 4PUHA 5A1IA 4ISBA 3G7SA 2UXBC 2ZTBA 4DCVA 4OX9C 3A9UA 2JMPA 4KHPC 2ZM6C 3A9VA 2CU6A 4JI0C 3FCCA 3UZ0A 3C5EA 4JI4C 4L7IA 4DV4C 1V25A 4DV3C 4LF9C 3CQ3A 3LNVA 2E8CA 1ULTA 3IEVA 5BSUA 4BCAA 5JRHA 2YCBA 4IZ6A 4X65C 4RLQA 2DYJA 2UUAC 3I08A 5LCIA 2M5HA 1J5EC 2XR1A 4DUZC 4FTFA 4KTVA 2E5LC 2ASBA 2UXDC 2PT7G 2MM9A 4JI3C 4DV7C 2ZZMA 5AE3A 5LMUC 4BSZA 3H2TA 3UOWA 1HR0C 5K85A 4D4GA 2AYAA 2MCQA 4DG8A 2D1SA 2Y4NA 4KTTA 3GPCA 3L95X 3FCEA 5H9UA 1BA3A 4G37A 2D1TA 3L8CA 1N32C 1T5HX 4YHHC 2UXCC 3GKUA 2D1RA 4ZLPA
chains in the Genus database with same CATH topology
1XNQC 5BSRA 4L4QA 5IWAC 1IBLC 5T8TA 4BC9A 4X62C 5DV9A 5A2QD 3B7WA 5BSMA 5KYTA 2HJGA 1N36C 4MH4A 3N2QA 4B3SC 1QM4A 2QVZX 2WD9A 3R44A 3PBKA 4JI8C 1ZB8A 4DCUA 3IPLA 3PESA 1GPMA 5CZVA 4LFBC 1MDBA 2V7BA 3NYRA 5AE2A 4BBYA 2ONFA 1XMQC 4DR2C 5BSTA 5LMNC 4JV5C 4B3RC 5A19A 4LF5C 2PROA 5BUQA 4D4IA 1K0RA 5IT9D 4RLFA 3DAYA 4JYAC 1O90A 1HNZC 2D27A 3E7XA 3NYQA 1WH9A 4IR7A 2VSQA 4GKJC 4JI5C 3VNRA 4LF8C 4GXQA 2YWCA 4JM1A 2EGTA 1PG4A 3KXWA 4JI7C 3RV2A 4DR5C 4D57A 1EGAA 2D28C 5BR8C 3OTOC 2D1QA 1O92A 4G36A 4I9GA 5BSVA 3EQ6A 1MDFA 2QVYX 4DR1C 4PZPA 4NDNA 2P2JA 4LF6C 4RVOA 1MXCA 3PROC 3GR0A 3DHVA 2E7GA 3AF6A 1ML8A 1PG3A 4B3TC 1O9TA 1P7LA 1N34C 4DR7C 3CW8X 4X66C 3TDEA 3TUFA 4DUYC 4HPVA 4TPSB 4NOZA 1MD9A 2D7VA 1MKYA 1VLAA 3J81D 2YWBA 2P2MA 3TQIA 1XRCA 2VZEA 4PHTA 4EATA 3NPDA 4ODJA 4GXRA 3J7AD 2UU9C 4LFCC 4G1IA 2VQFC 4FUTA 5KYVA 2OPLA 3I07A 4I9FA 5E7QA 1YJ7A 4JI6C 3ETOA 4DV6C 2PN2A 3DLPX 3LAXA 4RM2A 2P2FA 4LF4C 1QWIA 3LUSA 3AF5A 2OPLB 4NXMC 3EERA 3T1YC 1NYEA 2QW0X 3IEUA 3R9WA 1V26A 4ZJZA 4OXIA 3ETCA 4FUQA 2OBVA 5T8SA 3JAMD 4DR6C 1I94C 4K0KC 4NXNC 4DV1C 3T1HC 4R0MA 1RG9A 3VNQA 4D56A 2Y27A 2E0GA 1XNRC 4WS9A 4LFAC 3A4IA 5AE1A 1RY2A 4DV0C 3J80D 1KKGA 2E8FA 4DG9A 5A1GA 2UUBC 5BUSA 1UKKA 1XRBA 1AMUA 4LF7C 2P2BA 4DCTA 5CZXA 4WV3A 1FJGC 4MTNA 4R1MA 4RM3A 2OO4A 2DPLA 4U5YD 5BSWA 4GS5A 1WF3A 2WP0C 4DR3C 4AQYC 1FUGA 5K8FA 2BH1X 1N33C 1LQLA 4RMNA 1L2FA 4YY3C 5FLXD 2P20A 4JI1C 1LCIA 1PA4A 1HNWC 5KEIA 2P2QA 3VNSA 2VQEC 4R1LA 5GTDA 2HHHC 2QVXX 1N2FA 2KZFA 4XX2A 2ATWA 4DV5C 3NI2A 3IMLA 2F4VC 4DR4C 4OYCA 4K0BA 5IFIA 1T5DX 3GR1A 4RVNA 4GKKC 5ADZA 3N54B 2CY1A 1HH2P 1MXBA 4BC7A 4B3MC 5BURA 1USPB 3R9XA 1MXAA 3RG2A 4L2ZA 2BJOA 4PROC 2QL8A 1XMOC 3E7WA 3S82A 4DCSA 1IBKC 2E8EA 2Y4OA 1HNXC 1IBMC 1ZB9A 2UUCC 3CJEA 1USPA 3LGXA 1O93A 3CW9A 2CXCA 4DV2C 1XRAA 4LE5A 2P02A 1JOSA 4JI2C 4X64C 3SO4A 5A1IA 4ISBA 3G7SA 2UXBC 4DCVA 4OX9C 3A9UA 2JMPA 4KHPC 2ZM6C 3A9VA 4JI0C 3FCCA 3UZ0A 3C5EA 4JI4C 4L7IA 4DV4C 1V25A 4DV3C 4LF9C 3LNVA 2E8CA 1ULTA 3IEVA 5BSUA 4BCAA 5JRHA 2YCBA 4IZ6A 4X65C 4RLQA 2DYJA 2UUAC 3I08A 1J5EC 2XR1A 4DUZC 4FTFA 4KTVA 2E5LC 2ASBA 2UXDC 2PT7G 4JI3C 4DV7C 5AE3A 5LMUC 4BSZA 3H2TA 3UOWA 1HR0C 5K85A 4D4GA 2AYAA 4DG8A 2D1SA 2Y4NA 4KTTA 3GPCA 3L95X 3FCEA 5H9UA 1BA3A 4G37A 2D1TA 3L8CA 1N32C 1T5HX 4YHHC 2UXCC 3GKUA 2D1RA 4ZLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJE A;  1USP A;  1XNQ C;  3J80 D;  2CXC A;  5IWA C;  4DV2 C;  1IBL C;  2E8F A;  4DR1 C;  1KKG A;  4X62 C;  5A2Q D;  2UUB C;  1UKK A;  1JOS A;  4LF7 C;  4JI2 C;  4LF6 C;  4X64 C;  4DCT A;  2HJG A;  1N36 C;  2E7G A;  3AF6 A;  1ML8 A;  1FJG C;  2UXB C;  4MTN A;  4DCV A;  4B3T C;  4OX9 C;  4MH4 A;  2JMP A;  4KHP C;  2ZM6 C;  4B3S C;  1N34 C;  2UUC C;  4DR7 C;  4X66 C;  4JI0 C;  1WF3 A;  4DUY C;  4JI4 C;  4DV4 C;  4JI8 C;  1ZB8 A;  4DR3 C;  4NOZ A;  4AQY C;  4DCU A;  4DV3 C;  4LF9 C;  2D7V A;  1MKY A;  1VLA A;  2E8C A;  3J81 D;  4LFB C;  3IEV A;  1N33 C;  1LQL A;  1L2F A;  2YCB A;  4X65 C;  4YY3 C;  5FLX D;  2DYJ A;  4JI1 C;  2ONF A;  2UUA C;  1PA4 A;  1XMQ C;  1HNW C;  3J7A D;  4DR2 C;  2UU9 C;  4LFC C;  5LMN C;  2VQF C;  4JV5 C;  2OPL A;  1J5E C;  2XR1 A;  4B3R C;  3I07 A;  4DUZ C;  2VQE C;  2E5L C;  4LF5 C;  4JI6 C;  4DV6 C;  2ASB A;  2PN2 A;  2HHH C;  2UXD C;  1N2F A;  2PT7 G;  1K0R A;  5IT9 D;  2KZF A;  4XX2 A;  4JI3 C;  2ATW A;  4DV7 C;  4LF4 C;  1QWI A;  5LMU C;  4DV5 C;  4BSZ A;  4JYA C;  3LUS A;  3AF5 A;  1HNZ C;  2OPL B;  1HR0 C;  4NXM C;  2F4V C;  4DR4 C;  3EER A;  1WH9 A;  3T1Y C;  1NYE A;  4GKJ C;  4JI5 C;  3IEU A;  3R9W A;  4LF8 C;  4GKK C;  2CY1 A;  1HH2 P;  4B3M C;  3R9X A;  1USP B;  2EGT A;  3JAM D;  4JI7 C;  4DR6 C;  4DR5 C;  1I94 C;  4K0K C;  1N32 C;  4NXN C;  2BJO A;  4DV1 C;  2QL8 A;  3T1H C;  1XMO C;  1EGA A;  5BR8 C;  3OTO C;  4DCS A;  1IBK C;  2E8E A;  4YHH C;  1XNR C;  1HNX C;  2UXC C;  3GKU A;  4LFA C;  1IBM C;  1ZB9 A;  4DV0 C; 
#chains in the Genus database with same CATH topology
 1XNQ C;  5BSR A;  4L4Q A;  5IWA C;  1IBL C;  5T8T A;  4BC9 A;  4X62 C;  5DV9 A;  5A2Q D;  3B7W A;  5BSM A;  5KYT A;  2HJG A;  1N36 C;  4MH4 A;  3N2Q A;  4B3S C;  1QM4 A;  2QVZ X;  2WD9 A;  3UEB A;  3R44 A;  2JNV A;  3PBK A;  4JI8 C;  1ZB8 A;  4DCU A;  3IPL A;  3PES A;  1GPM A;  5CZV A;  4LFB C;  1MDB A;  2V7B A;  3NYR A;  5AE2 A;  4BBY A;  1M6X C;  3AY0 A;  1PU1 A;  2ONF A;  1XMQ C;  4DR2 C;  3FM7 A;  5BST A;  5LMN C;  4JV5 C;  2ZZN A;  4B3R C;  5A19 A;  4LF5 C;  2PRO A;  5BUQ A;  4D4I A;  2MMA B;  1K0R A;  5IT9 D;  4RLF A;  3DAY A;  4PUI A;  4JYA C;  1O90 A;  1HNZ C;  2D27 A;  3E7X A;  3NYQ A;  1WH9 A;  4IR7 A;  3CQ2 A;  2VSQ A;  4GKJ C;  4JI5 C;  3VNR A;  4LF8 C;  4GXQ A;  2YWC A;  4JM1 A;  1V60 A;  2EGT A;  1PG4 A;  3KXW A;  4JI7 C;  3RV2 A;  4DR5 C;  4D57 A;  1EGA A;  2D28 C;  5BR8 C;  3OTO C;  2D1Q A;  3CQ1 A;  1O92 A;  4G36 A;  1IB8 A;  4I9G A;  5BSV A;  3EQ6 A;  1MDF A;  2QVY X;  4DR1 C;  3A25 A;  1M6X A;  4PZP A;  4NDN A;  2P2J A;  3UX3 A;  4LF6 C;  3A26 A;  4RVO A;  1MXC A;  3PRO C;  3GR0 A;  3DHV A;  2E7G A;  3AF6 A;  1ML8 A;  1PG3 A;  4B3T C;  1UWD A;  1O9T A;  1P7L A;  1N34 C;  2YX1 A;  4DR7 C;  3CW8 X;  4X66 C;  3TDE A;  3TUF A;  4DUY C;  4HPV A;  4TPS B;  4NOZ A;  1MD9 A;  2D7V A;  1MKY A;  1VLA A;  3LNO A;  2YWB A;  3J81 D;  2P2M A;  3TQI A;  1XRC A;  2VZE A;  4PHT A;  4EAT A;  3NPD A;  4ODJ A;  4GXR A;  3J7A D;  1XS3 A;  2UU9 C;  4LFC C;  4G1I A;  2VQF C;  4FUT A;  5KYV A;  2OPL A;  3I07 A;  4I9F A;  5E7Q A;  1YJ7 A;  4JI6 C;  3ETO A;  4DV6 C;  2PN2 A;  3DLP X;  3LAX A;  4RM2 A;  2P2F A;  4LF4 C;  1QWI A;  2PG1 E;  3LUS A;  3AF5 A;  1XDX A;  2OPL B;  4NXM C;  3EER A;  3T1Y C;  1NYE A;  2QW0 X;  3IEU A;  3R9W A;  1V26 A;  3TR3 A;  4ZJZ A;  4OXI A;  3ETC A;  1XHJ A;  4FUQ A;  2OBV A;  5T8S A;  3JAM D;  4DR6 C;  1I94 C;  4K0K C;  1YGT A;  4NXN C;  4DV1 C;  3T1H C;  4R0M A;  1RG9 A;  3VNQ A;  4D56 A;  2Y27 A;  2E0G A;  1XNR C;  4WS9 A;  4LFA C;  3A4I A;  5AE1 A;  1RY2 A;  4DV0 C;  3K6R A;  3J80 D;  1KKG A;  2E8F A;  4DG9 A;  5A1G A;  2UUB C;  5BUS A;  1UKK A;  1XRB A;  1AMU A;  4LF7 C;  2P2B A;  4DCT A;  5CZX A;  4WV3 A;  1FJG C;  4MTN A;  4R1M A;  4RM3 A;  2OO4 A;  2DPL A;  4PUG A;  4U5Y D;  5BSW A;  4GS5 A;  1WF3 A;  2WP0 C;  4DR3 C;  3UX2 A;  4AQY C;  1FUG A;  5K8F A;  2BH1 X;  3O2E A;  1N33 C;  1LQL A;  4RMN A;  1L2F A;  4YY3 C;  5FLX D;  2P20 A;  4JI1 C;  1LCI A;  1PA4 A;  2NCL A;  1HNW C;  5KEI A;  2P2Q A;  3VNS A;  1P4E A;  2VQE C;  4R1L A;  1NY8 A;  5GTD A;  2HHH C;  2QVX X;  1N2F A;  1WCJ A;  2KZF A;  4XX2 A;  2ATW A;  4DV5 C;  3NI2 A;  2KDN A;  1P4E C;  3IML A;  2F4V C;  4DR4 C;  2M5O A;  4OYC A;  4K0B A;  5IFI A;  1T5D X;  3GR1 A;  4RVN A;  1TH5 A;  4GKK C;  5ADZ A;  3N54 B;  2CY1 A;  4BC7 A;  1HH2 P;  1MXB A;  2Z51 A;  5BUR A;  1USP B;  4B3M C;  3R9X A;  1MXA A;  3RG2 A;  4L2Z A;  2BJO A;  4PRO C;  2QL8 A;  1XMO C;  3E7W A;  2DHM A;  3S82 A;  4DCS A;  1IBK C;  2E8E A;  2Y4O A;  1HNX C;  2KZ0 A;  1VEH A;  1IBM C;  1ZB9 A;  2UUC C;  3CJE A;  1USP A;  3LGX A;  1O93 A;  3CW9 A;  2CXC A;  4DV2 C;  1XRA A;  4LE5 A;  2P02 A;  1FLO A;  1JOS A;  4JI2 C;  4X64 C;  3SO4 A;  4PUH A;  5A1I A;  4ISB A;  3G7S A;  2UXB C;  2ZTB A;  4DCV A;  4OX9 C;  3A9U A;  2JMP A;  4KHP C;  2ZM6 C;  3A9V A;  2CU6 A;  4JI0 C;  3FCC A;  3UZ0 A;  3C5E A;  4JI4 C;  4L7I A;  4DV4 C;  1V25 A;  4DV3 C;  4LF9 C;  3CQ3 A;  3LNV A;  2E8C A;  1ULT A;  3IEV A;  5BSU A;  4BCA A;  5JRH A;  2YCB A;  4IZ6 A;  4X65 C;  4RLQ A;  2DYJ A;  2UUA C;  3I08 A;  5LCI A;  2M5H A;  1J5E C;  2XR1 A;  4DUZ C;  4FTF A;  4KTV A;  2E5L C;  2ASB A;  2UXD C;  2PT7 G;  2MM9 A;  4JI3 C;  4DV7 C;  2ZZM A;  5AE3 A;  5LMU C;  4BSZ A;  3H2T A;  3UOW A;  1HR0 C;  5K85 A;  4D4G A;  2AYA A;  2MCQ A;  4DG8 A;  2D1S A;  2Y4N A;  4KTT A;  3GPC A;  3L95 X;  3FCE A;  5H9U A;  1BA3 A;  4G37 A;  2D1T A;  3L8C A;  1N32 C;  1T5H X;  4YHH C;  2UXC C;  3GKU A;  2D1R A;  4ZLP A; 
#chains in the Genus database with same CATH homology
 1XNQ C;  5BSR A;  4L4Q A;  5IWA C;  1IBL C;  5T8T A;  4BC9 A;  4X62 C;  5DV9 A;  5A2Q D;  3B7W A;  5BSM A;  5KYT A;  2HJG A;  1N36 C;  4MH4 A;  3N2Q A;  4B3S C;  1QM4 A;  2QVZ X;  2WD9 A;  3R44 A;  3PBK A;  4JI8 C;  1ZB8 A;  4DCU A;  3IPL A;  3PES A;  1GPM A;  5CZV A;  4LFB C;  1MDB A;  2V7B A;  3NYR A;  5AE2 A;  4BBY A;  2ONF A;  1XMQ C;  4DR2 C;  5BST A;  5LMN C;  4JV5 C;  4B3R C;  5A19 A;  4LF5 C;  2PRO A;  5BUQ A;  4D4I A;  1K0R A;  5IT9 D;  4RLF A;  3DAY A;  4JYA C;  1O90 A;  1HNZ C;  2D27 A;  3E7X A;  3NYQ A;  1WH9 A;  4IR7 A;  2VSQ A;  4GKJ C;  4JI5 C;  3VNR A;  4LF8 C;  4GXQ A;  2YWC A;  4JM1 A;  2EGT A;  1PG4 A;  3KXW A;  4JI7 C;  3RV2 A;  4DR5 C;  4D57 A;  1EGA A;  2D28 C;  5BR8 C;  3OTO C;  2D1Q A;  1O92 A;  4G36 A;  4I9G A;  5BSV A;  3EQ6 A;  1MDF A;  2QVY X;  4DR1 C;  4PZP A;  4NDN A;  2P2J A;  4LF6 C;  4RVO A;  1MXC A;  3PRO C;  3GR0 A;  3DHV A;  2E7G A;  3AF6 A;  1ML8 A;  1PG3 A;  4B3T C;  1O9T A;  1P7L A;  1N34 C;  4DR7 C;  3CW8 X;  4X66 C;  3TDE A;  3TUF A;  4DUY C;  4HPV A;  4TPS B;  4NOZ A;  1MD9 A;  2D7V A;  1MKY A;  1VLA A;  3J81 D;  2YWB A;  2P2M A;  3TQI A;  1XRC A;  2VZE A;  4PHT A;  4EAT A;  3NPD A;  4ODJ A;  4GXR A;  3J7A D;  2UU9 C;  4LFC C;  4G1I A;  2VQF C;  4FUT A;  5KYV A;  2OPL A;  3I07 A;  4I9F A;  5E7Q A;  1YJ7 A;  4JI6 C;  3ETO A;  4DV6 C;  2PN2 A;  3DLP X;  3LAX A;  4RM2 A;  2P2F A;  4LF4 C;  1QWI A;  3LUS A;  3AF5 A;  2OPL B;  4NXM C;  3EER A;  3T1Y C;  1NYE A;  2QW0 X;  3IEU A;  3R9W A;  1V26 A;  4ZJZ A;  4OXI A;  3ETC A;  4FUQ A;  2OBV A;  5T8S A;  3JAM D;  4DR6 C;  1I94 C;  4K0K C;  4NXN C;  4DV1 C;  3T1H C;  4R0M A;  1RG9 A;  3VNQ A;  4D56 A;  2Y27 A;  2E0G A;  1XNR C;  4WS9 A;  4LFA C;  3A4I A;  5AE1 A;  1RY2 A;  4DV0 C;  3J80 D;  1KKG A;  2E8F A;  4DG9 A;  5A1G A;  2UUB C;  5BUS A;  1UKK A;  1XRB A;  1AMU A;  4LF7 C;  2P2B A;  4DCT A;  5CZX A;  4WV3 A;  1FJG C;  4MTN A;  4R1M A;  4RM3 A;  2OO4 A;  2DPL A;  4U5Y D;  5BSW A;  4GS5 A;  1WF3 A;  2WP0 C;  4DR3 C;  4AQY C;  1FUG A;  5K8F A;  2BH1 X;  1N33 C;  1LQL A;  4RMN A;  1L2F A;  4YY3 C;  5FLX D;  2P20 A;  4JI1 C;  1LCI A;  1PA4 A;  1HNW C;  5KEI A;  2P2Q A;  3VNS A;  2VQE C;  4R1L A;  5GTD A;  2HHH C;  2QVX X;  1N2F A;  2KZF A;  4XX2 A;  2ATW A;  4DV5 C;  3NI2 A;  3IML A;  2F4V C;  4DR4 C;  4OYC A;  4K0B A;  5IFI A;  1T5D X;  3GR1 A;  4RVN A;  4GKK C;  5ADZ A;  3N54 B;  2CY1 A;  1HH2 P;  1MXB A;  4BC7 A;  4B3M C;  5BUR A;  1USP B;  3R9X A;  1MXA A;  3RG2 A;  4L2Z A;  2BJO A;  4PRO C;  2QL8 A;  1XMO C;  3E7W A;  3S82 A;  4DCS A;  1IBK C;  2E8E A;  2Y4O A;  1HNX C;  1IBM C;  1ZB9 A;  2UUC C;  3CJE A;  1USP A;  3LGX A;  1O93 A;  3CW9 A;  2CXC A;  4DV2 C;  1XRA A;  4LE5 A;  2P02 A;  1JOS A;  4JI2 C;  4X64 C;  3SO4 A;  5A1I A;  4ISB A;  3G7S A;  2UXB C;  4DCV A;  4OX9 C;  3A9U A;  2JMP A;  4KHP C;  2ZM6 C;  3A9V A;  4JI0 C;  3FCC A;  3UZ0 A;  3C5E A;  4JI4 C;  4L7I A;  4DV4 C;  1V25 A;  4DV3 C;  4LF9 C;  3LNV A;  2E8C A;  1ULT A;  3IEV A;  5BSU A;  4BCA A;  5JRH A;  2YCB A;  4IZ6 A;  4X65 C;  4RLQ A;  2DYJ A;  2UUA C;  3I08 A;  1J5E C;  2XR1 A;  4DUZ C;  4FTF A;  4KTV A;  2E5L C;  2ASB A;  2UXD C;  2PT7 G;  4JI3 C;  4DV7 C;  5AE3 A;  5LMU C;  4BSZ A;  3H2T A;  3UOW A;  1HR0 C;  5K85 A;  4D4G A;  2AYA A;  4DG8 A;  2D1S A;  2Y4N A;  4KTT A;  3GPC A;  3L95 X;  3FCE A;  5H9U A;  1BA3 A;  4G37 A;  2D1T A;  3L8C A;  1N32 C;  1T5H X;  4YHH C;  2UXC C;  3GKU A;  2D1R A;  4ZLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...