4YY3C

30s ribosomal subunit- higb complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4yy3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4yy3C02
4X65C 3J81D 4LF4C 4GKJC 4X62C 3T1HC 1XMOC 4JI5C 1HNWC 1ML8A 4DUYC 2E8EA 2E8CA 4DR3C 1KKGA 1J5EC 2PT7G 2E8FA 2E5LC 4DCVA 4JI2C 3EERA 1NYEA 2UUCC 2JMPA 4DV2C 4DR1C 1VLAA 2PN2A 1UKKA 1ZB9A 2E7GA 4OX9C 4LF7C 4JYAC 4NOZA 2UXBC 4DV0C 4DCTA 2UUAC 4DV1C 3R9XA 4NXNC 4LFCC 4JI4C 4B3SC 4DCSA 2UU9C 4JI1C 4GKKC 4LF5C 4MTNA 3JAMD 1MKYA 2QL8A 4DV5C 2ATWA 3I07A 4X64C 4LF9C 4DUZC 4JI8C 4BSZA 1N36C 1QWIA 1FJGC 2HJGA 4LF8C 2UUBC 4DV7C 3GKUA 2ASBA 3IEUA 4DR7C 2UXDC 4YY3C 1N33C 2CY1A 4DV6C 5LMUC 2UXCC 3CJEA 1N34C 5IWAC 4B3MC 1HH2P 2ZM6C 4KHPC 4JV5C 4JI3C 1HNXC 1K0RA 1HNZC 2EGTA 4MH4A 2HHHC 4DR2C 3IEVA 4JI7C 2VQFC 1JOSA 1USPA 4AQYC 3AF6A 1IBMC 3T1YC 5BR8C 4DR5C 4YHHC 3J80D 3R9WA 1WH9A 4B3TC 2VQEC 2BJOA 5LMNC 4DV3C 1XNQC 2CXCA 1USPB 2F4VC 1XNRC 4JI0C 2YCBA 1HR0C 4DR4C 5A2QD 1XMQC 2ONFA 1IBKC 1N2FA 1ZB8A 4LFBC 2OPLB 4JI6C 3LUSA 4B3RC 1PA4A 1N32C 3OTOC 4K0KC 4XX2A 4X66C 1WF3A 4LFAC 4DV4C 5IT9D 4LF6C 4DR6C 1LQLA 3J7AD 2KZFA 4NXMC 3AF5A 1I94C 1L2FA 2OPLA 1IBLC 4DCUA 2DYJA 1EGAA 5FLXD 2D7VA 2XR1A
chains in the Genus database with same CATH superfamily
4X65C 4LF4C 3LAXA 4BC9A 1P4EA 3LNVA 2E8EA 3TUFA 1J5EC 1IB8A 3EQ6A 1O93A 1MXBA 1NYEA 2Z51A 4DR1C 3RV2A 3S82A 3I08A 2D1SA 3FCEA 2QVYX 4GXRA 2PG1E 4DCTA 1TH5A 4NXNC 4LFCC 3CW9A 4B3SC 4DCSA 4MTNA 1MKYA 2ATWA 3UX3A 4DUZC 1QWIA 5CZVA 4LF8C 3GKUA 2AYAA 3IEUA 4DR7C 1N34C 2VZEA 1UWDA 4B3MC 2EGTA 3IEVA 4JI7C 1XRCA 2OBVA 1USPA 4AQYC 5KYVA 3T1YC 5BSMA 4DR5C 4R0MA 4G36A 4B3TC 5K8FA 3NYQA 4GXQA 5E7QA 3DAYA 4JI0C 3UOWA 3K6RA 2M5OA 3ETCA 4LFBC 2P2FA 4B3RC 2YWBA 5AE1A 1LCIA 5BSUA 3VNQA 3J7AD 3NYRA 4U5YD 4GKJC 4FUQA 4BBYA 1T5HX 4DUYC 2E8CA 1KKGA 2DHMA 4DCVA 3EERA 1AMUA 1V25A 5BSWA 3RG2A 1PU1A 2UUCC 1XRAA 1XS3A 1ZB9A 2E7GA 4WS9A 4LE5A 4LF7C 4D56A 4PZPA 4NOZA 2BH1X 2E0GA 2UUAC 4DV1C 3H2TA 5AE2A 4L4QA 3TR3A 5KYTA 3GR0A 4GKKC 2NCLA 4RM2A 4X64C 2PROA 3PROC 4JI8C 4BSZA 1N36C 1GPMA 4PUGA 2UUBC 2V7BA 4DV7C 3C5EA 3VNSA 1N33C 4DV6C 3B7WA 4D4IA 4KHPC 1WCJA 1HNXC 1K0RA 4G37A 1HNZC 4DR2C 4R1LA 3AF6A 4R1MA 5A1GA 5BR8C 4YHHC 4PHTA 3DLPX 1WH9A 2P2JA 1MXAA 1NY8A 4HPVA 1USPB 3N2QA 3ETOA 2QVZX 1XHJA 3GR1A 1P4EC 2P20A 3LUSA 4PROC 5T8SA 4I9GA 4K0KC 2KDNA 1WF3A 4LFAC 4DR6C 2Y4NA 4D57A 4IR7A 4NXMC 4WV3A 1I94C 1IBLC 4I9FA 4ISBA 2D7VA 4TPSB 1XMOC 3L8CA 3SO4A 3A9VA 4JI5C 3CQ2A 1MDBA 4DG8A 4DR3C 2PT7G 2E8FA 2D1TA 4D4GA 1PG4A 3TQIA 3CW8X 1VLAA 2PN2A 1ULTA 2D1RA 4OX9C 4JYAC 1T5DX 3R9XA 2KZ0A 3G7SA 4PUIA 5BURA 5GTDA 2MMAB 2WP0C 4BCAA 4JI1C 2OO4A 4LF5C 3A4IA 3JAMD 4DV5C 2QL8A 3GPCA 3I07A 4FUTA 2WD9A 4RVNA 2QVXX 1FJGC 2HJGA 3NPDA 2CY1A 5LMUC 2UXCC 5BSVA 5IWAC 4JV5C 4FTFA 4JI3C 2P2BA 2HHHC 5DV9A 1JOSA 4KTVA 1M6XA 2JNVA 2YWCA 3R44A 3J80D 3R9WA 2Y27A 2P02A 3FM7A 3CQ3A 4L2ZA 4DG9A 1FLOA 5LMNC 5BUSA 2YCBA 1HR0C 1QM4A 3IPLA 3PBKA 1O9TA 1V26A 2D1QA 5H9UA 2YX1A 1ZB8A 2OPLB 1RG9A 2CU6A 4ZLPA 4GS5A 5A1IA 3OTOC 4IZ6A 4XX2A 2ZZNA 5IT9D 4LF6C 3E7XA 3AF5A 5A19A 2OPLA 3NI2A 3E7WA 1MD9A 4DCUA 2DYJA 1EGAA 5FLXD 4EATA 2XR1A 3J81D 5BSTA 4X62C 3T1HC 5AE3A 3AY0A 1O92A 1HNWC 1V60A 1ML8A 3A26A 5T8TA 2Y4OA 3DHVA 1M6XC 2E5LC 4PUHA 4JI2C 1VEHA 1MDFA 5KEIA 1PG3A 2JMPA 4DV2C 3CQ1A 1UKKA 3UX2A 5IFIA 1XDXA 2UXBC 1YJ7A 4ODJA 4DV0C 2P2MA 3A9UA 2ZZMA 4K0BA 4JI4C 4RMNA 5JRHA 5BUQA 1XRBA 2UU9C 3A25A 3FCCA 4LF9C 1BA3A 1O90A 1P7LA 2MM9A 4RM3A 4RLQA 5BSRA 3VNRA 4OYCA 4KTTA 2ASBA 2UXDC 2VSQA 4NDNA 4YY3C 3LGXA 3PESA 4JM1A 4OXIA 3CJEA 5ADZA 2ZTBA 1HH2P 2P2QA 4RVOA 2ZM6C 3L95X 4ZJZA 4MH4A 2QW0X 2VQFC 3O2EA 3LNOA 5LCIA 3UEBA 1IBMC 3UZ0A 1FUGA 2VQEC 2BJOA 1XNQC 4DV3C 2CXCA 3KXWA 2F4VC 1XNRC 4DR4C 4L7IA 5A2QD 1MXCA 2ONFA 1XMQC 1N2FA 1IBKC 4JI6C 2D28C 3IMLA 3TDEA 5CZXA 1PA4A 1N32C 1YGTA 4RLFA 4G1IA 4X66C 4BC7A 5K85A 2M5HA 4DV4C 1RY2A 1LQLA 2MCQA 2KZFA 2DPLA 1L2FA 2D27A 3N54B
chains in the Genus database with same CATH topology
4X65C 4LF4C 3LAXA 4BC9A 3LNVA 2E8EA 3TUFA 1J5EC 3EQ6A 1O93A 1MXBA 1NYEA 4DR1C 3RV2A 3S82A 3I08A 2D1SA 3FCEA 2QVYX 4GXRA 4DCTA 4NXNC 4LFCC 3CW9A 4B3SC 4DCSA 4MTNA 1MKYA 2ATWA 4DUZC 1QWIA 5CZVA 4LF8C 3GKUA 2AYAA 3IEUA 4DR7C 1N34C 2VZEA 4B3MC 2EGTA 3IEVA 4JI7C 1XRCA 2OBVA 1USPA 4AQYC 5KYVA 3T1YC 5BSMA 4DR5C 4R0MA 4G36A 4B3TC 5K8FA 3NYQA 4GXQA 5E7QA 3DAYA 4JI0C 3UOWA 3ETCA 4LFBC 2P2FA 4B3RC 2YWBA 5AE1A 1LCIA 5BSUA 3VNQA 3J7AD 3NYRA 4U5YD 4GKJC 4FUQA 4BBYA 1T5HX 4DUYC 2E8CA 1KKGA 4DCVA 3EERA 1AMUA 1V25A 5BSWA 3RG2A 2UUCC 1XRAA 1ZB9A 2E7GA 4WS9A 4LE5A 4LF7C 4D56A 4PZPA 4NOZA 2BH1X 2E0GA 2UUAC 4DV1C 3H2TA 5AE2A 4L4QA 5KYTA 3GR0A 4GKKC 4RM2A 4X64C 2PROA 3PROC 4JI8C 4BSZA 1N36C 1GPMA 2UUBC 2V7BA 4DV7C 3C5EA 3VNSA 1N33C 4DV6C 3B7WA 4D4IA 4KHPC 1HNXC 1K0RA 4G37A 1HNZC 4DR2C 4R1LA 3AF6A 4R1MA 5A1GA 5BR8C 4YHHC 4PHTA 3DLPX 1WH9A 2P2JA 1MXAA 4HPVA 1USPB 3N2QA 3ETOA 2QVZX 3GR1A 2P20A 3LUSA 4PROC 5T8SA 4I9GA 4K0KC 1WF3A 4LFAC 4DR6C 2Y4NA 4D57A 4IR7A 4NXMC 4WV3A 1I94C 1IBLC 4I9FA 4ISBA 2D7VA 4TPSB 1XMOC 3L8CA 3SO4A 3A9VA 4JI5C 1MDBA 4DG8A 4DR3C 2PT7G 2E8FA 2D1TA 4D4GA 1PG4A 3TQIA 3CW8X 1VLAA 2PN2A 1ULTA 2D1RA 4OX9C 4JYAC 1T5DX 3R9XA 3G7SA 5BURA 5GTDA 2WP0C 4BCAA 4JI1C 2OO4A 4LF5C 3A4IA 3JAMD 4DV5C 2QL8A 3GPCA 3I07A 4FUTA 2WD9A 4RVNA 2QVXX 1FJGC 2HJGA 3NPDA 2CY1A 5LMUC 2UXCC 5BSVA 5IWAC 4JV5C 4FTFA 4JI3C 2P2BA 2HHHC 5DV9A 1JOSA 4KTVA 2YWCA 3R44A 3J80D 3R9WA 2Y27A 2P02A 4L2ZA 4DG9A 5LMNC 5BUSA 2YCBA 1HR0C 1QM4A 3IPLA 3PBKA 1O9TA 1V26A 2D1QA 5H9UA 1ZB8A 2OPLB 1RG9A 4ZLPA 4GS5A 5A1IA 3OTOC 4IZ6A 4XX2A 5IT9D 4LF6C 3E7XA 3AF5A 5A19A 2OPLA 3NI2A 3E7WA 1MD9A 4DCUA 2DYJA 1EGAA 5FLXD 4EATA 2XR1A 3J81D 5BSTA 4X62C 3T1HC 5AE3A 1O92A 1HNWC 1ML8A 5T8TA 2Y4OA 3DHVA 2E5LC 4JI2C 5KEIA 1MDFA 1PG3A 2JMPA 4DV2C 1UKKA 5IFIA 2UXBC 1YJ7A 4ODJA 4DV0C 2P2MA 3A9UA 4K0BA 4JI4C 4RMNA 5JRHA 5BUQA 1XRBA 2UU9C 3FCCA 4LF9C 1BA3A 1O90A 1P7LA 4RM3A 4RLQA 5BSRA 3VNRA 4OYCA 4KTTA 2ASBA 2UXDC 2VSQA 4NDNA 4YY3C 3LGXA 3PESA 4JM1A 4OXIA 3CJEA 5ADZA 1HH2P 2P2QA 4RVOA 2ZM6C 3L95X 4ZJZA 4MH4A 2QW0X 2VQFC 1IBMC 3UZ0A 1FUGA 2VQEC 2BJOA 1XNQC 4DV3C 2CXCA 3KXWA 2F4VC 1XNRC 4DR4C 4L7IA 5A2QD 1MXCA 2ONFA 1XMQC 1N2FA 1IBKC 4JI6C 2D28C 3IMLA 3TDEA 5CZXA 1PA4A 1N32C 4RLFA 4G1IA 4X66C 4BC7A 5K85A 4DV4C 1RY2A 1LQLA 2KZFA 2DPLA 1L2FA 2D27A 3N54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 C;  3J81 D;  4LF4 C;  4GKJ C;  4X62 C;  3T1H C;  1XMO C;  4JI5 C;  1HNW C;  1ML8 A;  4DUY C;  2E8E A;  2E8C A;  4DR3 C;  1KKG A;  1J5E C;  2PT7 G;  2E8F A;  2E5L C;  4DCV A;  4JI2 C;  3EER A;  1NYE A;  2UUC C;  2JMP A;  4DV2 C;  4DR1 C;  1VLA A;  2PN2 A;  1UKK A;  1ZB9 A;  2E7G A;  4OX9 C;  4LF7 C;  4JYA C;  4NOZ A;  2UXB C;  4DV0 C;  4DCT A;  2UUA C;  4DV1 C;  3R9X A;  4NXN C;  4LFC C;  4JI4 C;  4B3S C;  4DCS A;  2UU9 C;  4JI1 C;  4GKK C;  4LF5 C;  4MTN A;  3JAM D;  1MKY A;  2QL8 A;  4DV5 C;  2ATW A;  3I07 A;  4X64 C;  4LF9 C;  4DUZ C;  4JI8 C;  4BSZ A;  1N36 C;  1QWI A;  1FJG C;  2HJG A;  4LF8 C;  2UUB C;  4DV7 C;  3GKU A;  2ASB A;  3IEU A;  4DR7 C;  2UXD C;  4YY3 C;  1N33 C;  2CY1 A;  4DV6 C;  5LMU C;  2UXC C;  3CJE A;  1N34 C;  5IWA C;  4B3M C;  1HH2 P;  2ZM6 C;  4KHP C;  4JV5 C;  4JI3 C;  1HNX C;  1K0R A;  1HNZ C;  2EGT A;  4MH4 A;  2HHH C;  4DR2 C;  3IEV A;  4JI7 C;  2VQF C;  1JOS A;  1USP A;  4AQY C;  3AF6 A;  1IBM C;  3T1Y C;  5BR8 C;  4DR5 C;  4YHH C;  3J80 D;  3R9W A;  1WH9 A;  4B3T C;  2VQE C;  2BJO A;  5LMN C;  4DV3 C;  1XNQ C;  2CXC A;  1USP B;  2F4V C;  1XNR C;  4JI0 C;  2YCB A;  1HR0 C;  4DR4 C;  5A2Q D;  1XMQ C;  2ONF A;  1IBK C;  1N2F A;  1ZB8 A;  4LFB C;  2OPL B;  4JI6 C;  3LUS A;  4B3R C;  1PA4 A;  1N32 C;  3OTO C;  4K0K C;  4XX2 A;  4X66 C;  1WF3 A;  4LFA C;  4DV4 C;  5IT9 D;  4LF6 C;  4DR6 C;  1LQL A;  3J7A D;  2KZF A;  4NXM C;  3AF5 A;  1I94 C;  1L2F A;  2OPL A;  1IBL C;  4DCU A;  2DYJ A;  1EGA A;  5FLX D;  2D7V A;  2XR1 A; 
#chains in the Genus database with same CATH topology
 4X65 C;  4LF4 C;  3LAX A;  4BC9 A;  1P4E A;  3LNV A;  2E8E A;  3TUF A;  1J5E C;  1IB8 A;  3EQ6 A;  1O93 A;  1MXB A;  1NYE A;  2Z51 A;  4DR1 C;  3RV2 A;  3S82 A;  3I08 A;  2D1S A;  3FCE A;  2QVY X;  4GXR A;  2PG1 E;  4DCT A;  1TH5 A;  4NXN C;  4LFC C;  3CW9 A;  4B3S C;  4DCS A;  4MTN A;  1MKY A;  2ATW A;  3UX3 A;  4DUZ C;  1QWI A;  5CZV A;  4LF8 C;  3GKU A;  2AYA A;  3IEU A;  4DR7 C;  1N34 C;  2VZE A;  1UWD A;  4B3M C;  2EGT A;  3IEV A;  4JI7 C;  1XRC A;  2OBV A;  1USP A;  4AQY C;  5KYV A;  3T1Y C;  5BSM A;  4DR5 C;  4R0M A;  4G36 A;  4B3T C;  5K8F A;  3NYQ A;  4GXQ A;  5E7Q A;  3DAY A;  4JI0 C;  3UOW A;  3K6R A;  2M5O A;  3ETC A;  4LFB C;  2P2F A;  4B3R C;  2YWB A;  5AE1 A;  1LCI A;  5BSU A;  3VNQ A;  3J7A D;  3NYR A;  4U5Y D;  4GKJ C;  4FUQ A;  4BBY A;  1T5H X;  4DUY C;  2E8C A;  1KKG A;  2DHM A;  4DCV A;  3EER A;  1AMU A;  1V25 A;  5BSW A;  3RG2 A;  1PU1 A;  2UUC C;  1XRA A;  1XS3 A;  1ZB9 A;  2E7G A;  4WS9 A;  4LE5 A;  4LF7 C;  4D56 A;  4PZP A;  4NOZ A;  2BH1 X;  2E0G A;  2UUA C;  4DV1 C;  3H2T A;  5AE2 A;  4L4Q A;  3TR3 A;  5KYT A;  3GR0 A;  4GKK C;  2NCL A;  4RM2 A;  4X64 C;  2PRO A;  3PRO C;  4JI8 C;  4BSZ A;  1N36 C;  1GPM A;  4PUG A;  2UUB C;  2V7B A;  4DV7 C;  3C5E A;  3VNS A;  1N33 C;  4DV6 C;  3B7W A;  4D4I A;  4KHP C;  1WCJ A;  1HNX C;  1K0R A;  4G37 A;  1HNZ C;  4DR2 C;  4R1L A;  3AF6 A;  4R1M A;  5A1G A;  5BR8 C;  4YHH C;  4PHT A;  3DLP X;  1WH9 A;  2P2J A;  1MXA A;  1NY8 A;  4HPV A;  1USP B;  3N2Q A;  3ETO A;  2QVZ X;  1XHJ A;  3GR1 A;  1P4E C;  2P20 A;  3LUS A;  4PRO C;  5T8S A;  4I9G A;  4K0K C;  2KDN A;  1WF3 A;  4LFA C;  4DR6 C;  2Y4N A;  4D57 A;  4IR7 A;  4NXM C;  4WV3 A;  1I94 C;  1IBL C;  4I9F A;  4ISB A;  2D7V A;  4TPS B;  1XMO C;  3L8C A;  3SO4 A;  3A9V A;  4JI5 C;  3CQ2 A;  1MDB A;  4DG8 A;  4DR3 C;  2PT7 G;  2E8F A;  2D1T A;  4D4G A;  1PG4 A;  3TQI A;  3CW8 X;  1VLA A;  2PN2 A;  1ULT A;  2D1R A;  4OX9 C;  4JYA C;  1T5D X;  3R9X A;  2KZ0 A;  3G7S A;  4PUI A;  5BUR A;  5GTD A;  2MMA B;  2WP0 C;  4BCA A;  4JI1 C;  2OO4 A;  4LF5 C;  3A4I A;  3JAM D;  4DV5 C;  2QL8 A;  3GPC A;  3I07 A;  4FUT A;  2WD9 A;  4RVN A;  2QVX X;  1FJG C;  2HJG A;  3NPD A;  2CY1 A;  5LMU C;  2UXC C;  5BSV A;  5IWA C;  4JV5 C;  4FTF A;  4JI3 C;  2P2B A;  2HHH C;  5DV9 A;  1JOS A;  4KTV A;  1M6X A;  2JNV A;  2YWC A;  3R44 A;  3J80 D;  3R9W A;  2Y27 A;  2P02 A;  3FM7 A;  3CQ3 A;  4L2Z A;  4DG9 A;  1FLO A;  5LMN C;  5BUS A;  2YCB A;  1HR0 C;  1QM4 A;  3IPL A;  3PBK A;  1O9T A;  1V26 A;  2D1Q A;  5H9U A;  2YX1 A;  1ZB8 A;  2OPL B;  1RG9 A;  2CU6 A;  4ZLP A;  4GS5 A;  5A1I A;  3OTO C;  4IZ6 A;  4XX2 A;  2ZZN A;  5IT9 D;  4LF6 C;  3E7X A;  3AF5 A;  5A19 A;  2OPL A;  3NI2 A;  3E7W A;  1MD9 A;  4DCU A;  2DYJ A;  1EGA A;  5FLX D;  4EAT A;  2XR1 A;  3J81 D;  5BST A;  4X62 C;  3T1H C;  5AE3 A;  3AY0 A;  1O92 A;  1HNW C;  1V60 A;  1ML8 A;  3A26 A;  5T8T A;  2Y4O A;  3DHV A;  1M6X C;  2E5L C;  4PUH A;  4JI2 C;  1VEH A;  1MDF A;  5KEI A;  1PG3 A;  2JMP A;  4DV2 C;  3CQ1 A;  1UKK A;  3UX2 A;  5IFI A;  1XDX A;  2UXB C;  1YJ7 A;  4ODJ A;  4DV0 C;  2P2M A;  3A9U A;  2ZZM A;  4K0B A;  4JI4 C;  4RMN A;  5JRH A;  5BUQ A;  1XRB A;  2UU9 C;  3A25 A;  3FCC A;  4LF9 C;  1BA3 A;  1O90 A;  1P7L A;  2MM9 A;  4RM3 A;  4RLQ A;  5BSR A;  3VNR A;  4OYC A;  4KTT A;  2ASB A;  2UXD C;  2VSQ A;  4NDN A;  4YY3 C;  3LGX A;  3PES A;  4JM1 A;  4OXI A;  3CJE A;  5ADZ A;  2ZTB A;  1HH2 P;  2P2Q A;  4RVO A;  2ZM6 C;  3L95 X;  4ZJZ A;  4MH4 A;  2QW0 X;  2VQF C;  3O2E A;  3LNO A;  5LCI A;  3UEB A;  1IBM C;  3UZ0 A;  1FUG A;  2VQE C;  2BJO A;  1XNQ C;  4DV3 C;  2CXC A;  3KXW A;  2F4V C;  1XNR C;  4DR4 C;  4L7I A;  5A2Q D;  1MXC A;  2ONF A;  1XMQ C;  1N2F A;  1IBK C;  4JI6 C;  2D28 C;  3IML A;  3TDE A;  5CZX A;  1PA4 A;  1N32 C;  1YGT A;  4RLF A;  4G1I A;  4X66 C;  4BC7 A;  5K85 A;  2M5H A;  4DV4 C;  1RY2 A;  1LQL A;  2MCQ A;  2KZF A;  2DPL A;  1L2F A;  2D27 A;  3N54 B; 
#chains in the Genus database with same CATH homology
 4X65 C;  4LF4 C;  3LAX A;  4BC9 A;  3LNV A;  2E8E A;  3TUF A;  1J5E C;  3EQ6 A;  1O93 A;  1MXB A;  1NYE A;  4DR1 C;  3RV2 A;  3S82 A;  3I08 A;  2D1S A;  3FCE A;  2QVY X;  4GXR A;  4DCT A;  4NXN C;  4LFC C;  3CW9 A;  4B3S C;  4DCS A;  4MTN A;  1MKY A;  2ATW A;  4DUZ C;  1QWI A;  5CZV A;  4LF8 C;  3GKU A;  2AYA A;  3IEU A;  4DR7 C;  1N34 C;  2VZE A;  4B3M C;  2EGT A;  3IEV A;  4JI7 C;  1XRC A;  2OBV A;  1USP A;  4AQY C;  5KYV A;  3T1Y C;  5BSM A;  4DR5 C;  4R0M A;  4G36 A;  4B3T C;  5K8F A;  3NYQ A;  4GXQ A;  5E7Q A;  3DAY A;  4JI0 C;  3UOW A;  3ETC A;  4LFB C;  2P2F A;  4B3R C;  2YWB A;  5AE1 A;  1LCI A;  5BSU A;  3VNQ A;  3J7A D;  3NYR A;  4U5Y D;  4GKJ C;  4FUQ A;  4BBY A;  1T5H X;  4DUY C;  2E8C A;  1KKG A;  4DCV A;  3EER A;  1AMU A;  1V25 A;  5BSW A;  3RG2 A;  2UUC C;  1XRA A;  1ZB9 A;  2E7G A;  4WS9 A;  4LE5 A;  4LF7 C;  4D56 A;  4PZP A;  4NOZ A;  2BH1 X;  2E0G A;  2UUA C;  4DV1 C;  3H2T A;  5AE2 A;  4L4Q A;  5KYT A;  3GR0 A;  4GKK C;  4RM2 A;  4X64 C;  2PRO A;  3PRO C;  4JI8 C;  4BSZ A;  1N36 C;  1GPM A;  2UUB C;  2V7B A;  4DV7 C;  3C5E A;  3VNS A;  1N33 C;  4DV6 C;  3B7W A;  4D4I A;  4KHP C;  1HNX C;  1K0R A;  4G37 A;  1HNZ C;  4DR2 C;  4R1L A;  3AF6 A;  4R1M A;  5A1G A;  5BR8 C;  4YHH C;  4PHT A;  3DLP X;  1WH9 A;  2P2J A;  1MXA A;  4HPV A;  1USP B;  3N2Q A;  3ETO A;  2QVZ X;  3GR1 A;  2P20 A;  3LUS A;  4PRO C;  5T8S A;  4I9G A;  4K0K C;  1WF3 A;  4LFA C;  4DR6 C;  2Y4N A;  4D57 A;  4IR7 A;  4NXM C;  4WV3 A;  1I94 C;  1IBL C;  4I9F A;  4ISB A;  2D7V A;  4TPS B;  1XMO C;  3L8C A;  3SO4 A;  3A9V A;  4JI5 C;  1MDB A;  4DG8 A;  4DR3 C;  2PT7 G;  2E8F A;  2D1T A;  4D4G A;  1PG4 A;  3TQI A;  3CW8 X;  1VLA A;  2PN2 A;  1ULT A;  2D1R A;  4OX9 C;  4JYA C;  1T5D X;  3R9X A;  3G7S A;  5BUR A;  5GTD A;  2WP0 C;  4BCA A;  4JI1 C;  2OO4 A;  4LF5 C;  3A4I A;  3JAM D;  4DV5 C;  2QL8 A;  3GPC A;  3I07 A;  4FUT A;  2WD9 A;  4RVN A;  2QVX X;  1FJG C;  2HJG A;  3NPD A;  2CY1 A;  5LMU C;  2UXC C;  5BSV A;  5IWA C;  4JV5 C;  4FTF A;  4JI3 C;  2P2B A;  2HHH C;  5DV9 A;  1JOS A;  4KTV A;  2YWC A;  3R44 A;  3J80 D;  3R9W A;  2Y27 A;  2P02 A;  4L2Z A;  4DG9 A;  5LMN C;  5BUS A;  2YCB A;  1HR0 C;  1QM4 A;  3IPL A;  3PBK A;  1O9T A;  1V26 A;  2D1Q A;  5H9U A;  1ZB8 A;  2OPL B;  1RG9 A;  4ZLP A;  4GS5 A;  5A1I A;  3OTO C;  4IZ6 A;  4XX2 A;  5IT9 D;  4LF6 C;  3E7X A;  3AF5 A;  5A19 A;  2OPL A;  3NI2 A;  3E7W A;  1MD9 A;  4DCU A;  2DYJ A;  1EGA A;  5FLX D;  4EAT A;  2XR1 A;  3J81 D;  5BST A;  4X62 C;  3T1H C;  5AE3 A;  1O92 A;  1HNW C;  1ML8 A;  5T8T A;  2Y4O A;  3DHV A;  2E5L C;  4JI2 C;  5KEI A;  1MDF A;  1PG3 A;  2JMP A;  4DV2 C;  1UKK A;  5IFI A;  2UXB C;  1YJ7 A;  4ODJ A;  4DV0 C;  2P2M A;  3A9U A;  4K0B A;  4JI4 C;  4RMN A;  5JRH A;  5BUQ A;  1XRB A;  2UU9 C;  3FCC A;  4LF9 C;  1BA3 A;  1O90 A;  1P7L A;  4RM3 A;  4RLQ A;  5BSR A;  3VNR A;  4OYC A;  4KTT A;  2ASB A;  2UXD C;  2VSQ A;  4NDN A;  4YY3 C;  3LGX A;  3PES A;  4JM1 A;  4OXI A;  3CJE A;  5ADZ A;  1HH2 P;  2P2Q A;  4RVO A;  2ZM6 C;  3L95 X;  4ZJZ A;  4MH4 A;  2QW0 X;  2VQF C;  1IBM C;  3UZ0 A;  1FUG A;  2VQE C;  2BJO A;  1XNQ C;  4DV3 C;  2CXC A;  3KXW A;  2F4V C;  1XNR C;  4DR4 C;  4L7I A;  5A2Q D;  1MXC A;  2ONF A;  1XMQ C;  1N2F A;  1IBK C;  4JI6 C;  2D28 C;  3IML A;  3TDE A;  5CZX A;  1PA4 A;  1N32 C;  4RLF A;  4G1I A;  4X66 C;  4BC7 A;  5K85 A;  4DV4 C;  1RY2 A;  1LQL A;  2KZF A;  2DPL A;  1L2F A;  2D27 A;  3N54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...