5BR8C

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5br8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5br8C02
4DV2C 3T1HC 4DCUA 4JI2C 1XMQC 2E5LC 1J5EC 2CY1A 3OTOC 2YCBA 4JV5C 3CJEA 1KKGA 2E8FA 2JMPA 2BJOA 4B3TC 1UKKA 2KZFA 4LF4C 3R9XA 4JYAC 5FLXD 1ZB8A 4JI3C 2ATWA 2F4VC 1LQLA 5IWAC 1PA4A 2PN2A 4JI8C 4B3MC 2VQEC 1VLAA 1USPA 4X64C 2UU9C 4DR6C 4DR1C 4XX2A 3GKUA 4DR2C 5IT9D 2ASBA 2UXBC 4X66C 2PT7G 3T1YC 3R9WA 4LF9C 1N2FA 4DV5C 1N33C 2EGTA 1FJGC 4LF7C 1HH2P 2OPLA 4X65C 2HJGA 4NOZA 4DR5C 2E8CA 1XNQC 4LFBC 3J7AD 2ZM6C 2E8EA 1XNRC 2UUBC 1HR0C 4DV3C 3LUSA 2D7VA 4DCVA 4DV1C 2ONFA 4GKJC 1I94C 4MH4A 4OX9C 1HNXC 4JI5C 1ZB9A 1N34C 2HHHC 4LF8C 4MTNA 4LFCC 3IEVA 1L2FA 4NXNC 4B3SC 1XMOC 1HNWC 3I07A 4DV7C 3AF6A 1N32C 1IBKC 4DR7C 1WH9A 4JI4C 2UUAC 4KHPC 4JI1C 2DYJA 1IBLC 1QWIA 2UUCC 1N36C 1IBMC 4DR4C 4DCSA 1WF3A 3J80D 4YY3C 4AQYC 3IEUA 2UXCC 5A2QD 3EERA 2VQFC 3J81D 4DV6C 2E7GA 2XR1A 2QL8A 4BSZA 1MKYA 4K0KC 4YHHC 1USPB 4JI0C 4LF5C 4LFAC 5LMNC 1JOSA 4DV4C 5BR8C 1K0RA 1ML8A 1NYEA 1HNZC 4GKKC 2UXDC 4DCTA 4DUYC 4JI7C 3AF5A 4X62C 4LF6C 5LMUC 4DUZC 1EGAA 4JI6C 2CXCA 4DV0C 4NXMC 2OPLB 4DR3C 3JAMD 4B3RC
chains in the Genus database with same CATH superfamily
3T1HC 4DCUA 1T5HX 5BSRA 3O2EA 4JV5C 1O93A 3CJEA 4BBYA 3DHVA 4B3TC 1RG9A 4JYAC 3H2TA 5FLXD 4JI3C 2ATWA 5CZXA 2PN2A 2KDNA 4DR1C 1FUGA 1WCJA 4X66C 1XHJA 1NY8A 3SO4A 2D1SA 3J7AD 5A1IA 4U5YD 4DR5C 4HPVA 1XDXA 4ODJA 1HR0C 2DHMA 3PBKA 2P2BA 1IB8A 4PROC 4MH4A 3NI2A 1HNXC 4OX9C 3KXWA 4JI5C 4RVNA 4D4IA 4PUHA 4MTNA 4TPSB 4NXNC 1MDBA 3K6RA 4R1LA 1V60A 2PROA 2VZEA 4G37A 5IFIA 5K8FA 2PG1E 4DR7C 4ZLPA 2DYJA 3TUFA 4KTVA 2MCQA 2UUCC 2D1QA 1UWDA 3J80D 5A1GA 2DPLA 3A4IA 3FM7A 2UXCC 1BA3A 1P4EA 4D57A 2M5HA 4BSZA 4K0KC 4LFAC 4DV4C 1ML8A 1NYEA 2QVXX 5BSMA 3A25A 5LMUC 1XRCA 2ZZMA 4RLFA 4JI6C 4DR3C 4B3RC 4JI2C 5BSVA 1XMQC 5BSTA 1MXCA 4GXQA 1KKGA 2KZ0A 3PROC 3R9XA 3A26A 1ZB8A 3E7WA 4G1IA 4R1MA 3ETCA 1USPA 3G7SA 3LGXA 3LAXA 2D1RA 4RVOA 1TH5A 4FUTA 4XX2A 3GKUA 2CU6A 3RG2A 3FCEA 3UOWA 2P2JA 1M6XC 4DV5C 2EGTA 4FUQA 4LF7C 4NOZA 3GR1A 4L2ZA 2UUBC 4DV1C 1P7LA 1I94C 3N54B 2JNVA 4I9GA 1V25A 4RMNA 2Y4OA 3IMLA 2QVZX 4KTTA 5T8SA 2HHHC 4LF8C 3N2QA 4DG8A 5AE1A 1L2FA 4B3SC 4D4GA 4BC9A 1O9TA 4R0MA 3UZ0A 3CW8X 4RM3A 4KHPC 1MXAA 3S82A 1N36C 1IBMC 5ADZA 4WV3A 3NPDA 3CQ1A 4EATA 3E7XA 4BC7A 3J81D 3GR0A 4DV6C 3DAYA 5H9UA 2WD9A 2QL8A 1MDFA 2OBVA 1USPB 4JI0C 4LF5C 5LMNC 2QW0X 2ZTBA 4GKKC 2WP0C 4DUYC 3UX2A 3AF5A 4LF6C 5CZVA 5BSUA 1PU1A 2D27A 5KEIA 2CXCA 4DV0C 5K85A 2D1TA 4LFCC 3JAMD 2Y27A 1VEHA 1MXBA 1O92A 1J5EC 1PG3A 2YCBA 5KYTA 2BJOA 2KZFA 3ETOA 4L4QA 5E7QA 1PA4A 4JI8C 2VQEC 1ULTA 3GPCA 1VLAA 4X64C 4DR6C 1MD9A 3B7WA 2UXBC 5AE3A 2PT7G 3T1YC 3R9WA 4LF9C 1AMUA 2Y4NA 4IR7A 1HH2P 2OPLA 3UX3A 5GTDA 2YWCA 3EQ6A 4I9FA 3LNVA 3LUSA 2ONFA 3L8CA 3NYQA 3A9VA 5AE2A 1ZB9A 1N34C 4K0BA 2MMAB 5BSWA 3I07A 3AF6A 1N32C 4WS9A 2OO4A 5BUQA 4JI4C 2UUAC 3I08A 4JI1C 1IBLC 5BUSA 3CQ3A 4ISBA 4PUIA 2V7BA 4YY3C 4AQYC 3TDEA 3VNRA 5A2QD 3DLPX 2P2MA 3EERA 5LCIA 4RM2A 4PZPA 2YX1A 2XR1A 3VNSA 2MM9A 4PHTA 4YHHC 1JOSA 5BR8C 1HNZC 2UXDC 4JI7C 4X62C 4DUZC 1V26A 3A9UA 4DG9A 1YJ7A 2OPLB 4OXIA 4GKJC 1M6XA 4DV2C 5BURA 4FTFA 4PUGA 2E5LC 2M5OA 5JRHA 4OYCA 1P4EC 2CY1A 3OTOC 1XS3A 4BCAA 2E8FA 2JMPA 3R44A 1UKKA 4LF4C 2F4VC 1LQLA 5IWAC 4LE5A 4B3MC 2P2FA 2UU9C 1QM4A 3TQIA 3IPLA 5IT9D 4DR2C 2ASBA 1RY2A 4D56A 4RLQA 1N33C 1N2FA 2YWBA 2P02A 2P20A 4ZJZA 1FJGC 4X65C 2HJGA 4LFBC 1XNQC 2E8CA 2ZM6C 2E8EA 1XNRC 1LCIA 1YGTA 3VNQA 4DV3C 2D7VA 2Z51A 4L7IA 4GXRA 4DCVA 5KYVA 2E0GA 3UEBA 1FLOA 3C5EA 3IEVA 4GS5A 2VSQA 1XMOC 5T8TA 1HNWC 3RV2A 4DV7C 4IZ6A 1GPMA 1IBKC 3LNOA 1WH9A 3FCCA 2P2QA 1QWIA 1XRAA 3PESA 4G36A 4DR4C 1WF3A 4DCSA 3TR3A 3IEUA 1O90A 5DV9A 2NCLA 2ZZNA 5A19A 2VQFC 2E7GA 2AYAA 1T5DX 3CQ2A 1XRBA 2BH1X 1K0RA 4NDNA 3AY0A 4DCTA 3L95X 1PG4A 3NYRA 4JM1A 2QVYX 3CW9A 1EGAA 2D28C 4NXMC 1MKYA
chains in the Genus database with same CATH topology
3T1HC 4DCUA 1T5HX 5BSRA 4JV5C 1O93A 3CJEA 4BBYA 3DHVA 4B3TC 1RG9A 4JYAC 3H2TA 5FLXD 4JI3C 2ATWA 5CZXA 2PN2A 4DR1C 1FUGA 4X66C 3SO4A 2D1SA 3J7AD 5A1IA 4U5YD 4DR5C 4HPVA 4ODJA 1HR0C 3PBKA 2P2BA 4PROC 4MH4A 3NI2A 1HNXC 4OX9C 3KXWA 4JI5C 4RVNA 4D4IA 4MTNA 4TPSB 4NXNC 1MDBA 4R1LA 2PROA 2VZEA 4G37A 5IFIA 5K8FA 4DR7C 4ZLPA 2DYJA 3TUFA 4KTVA 2UUCC 2D1QA 3J80D 5A1GA 2DPLA 3A4IA 2UXCC 1BA3A 4D57A 4BSZA 4K0KC 4LFAC 4DV4C 1ML8A 1NYEA 2QVXX 5BSMA 5LMUC 1XRCA 4RLFA 4JI6C 4DR3C 4B3RC 4JI2C 5BSVA 1XMQC 5BSTA 1MXCA 4GXQA 1KKGA 3PROC 3R9XA 1ZB8A 3E7WA 4G1IA 4R1MA 3ETCA 1USPA 3G7SA 3LGXA 3LAXA 2D1RA 4RVOA 4FUTA 4XX2A 3GKUA 3RG2A 3FCEA 3UOWA 2P2JA 4DV5C 2EGTA 4FUQA 4LF7C 4NOZA 3GR1A 4L2ZA 2UUBC 4DV1C 1P7LA 1I94C 3N54B 4I9GA 1V25A 4RMNA 2Y4OA 3IMLA 2QVZX 4KTTA 5T8SA 2HHHC 4LF8C 3N2QA 4DG8A 5AE1A 1L2FA 4B3SC 4D4GA 4BC9A 1O9TA 4R0MA 3UZ0A 3CW8X 4RM3A 4KHPC 1MXAA 3S82A 1N36C 1IBMC 5ADZA 4WV3A 3NPDA 4EATA 3E7XA 4BC7A 3J81D 3GR0A 4DV6C 3DAYA 5H9UA 2WD9A 2QL8A 1MDFA 2OBVA 1USPB 4JI0C 4LF5C 5LMNC 2QW0X 4GKKC 2WP0C 4DUYC 3AF5A 4LF6C 5CZVA 5BSUA 2D27A 5KEIA 2CXCA 4DV0C 5K85A 2D1TA 4LFCC 3JAMD 2Y27A 1MXBA 1O92A 1J5EC 1PG3A 2YCBA 5KYTA 2BJOA 2KZFA 3ETOA 4L4QA 5E7QA 1PA4A 4JI8C 2VQEC 1ULTA 3GPCA 1VLAA 4X64C 4DR6C 1MD9A 3B7WA 2UXBC 5AE3A 2PT7G 3T1YC 3R9WA 4LF9C 1AMUA 2Y4NA 4IR7A 1HH2P 2OPLA 5GTDA 2YWCA 3EQ6A 4I9FA 3LNVA 3LUSA 2ONFA 3L8CA 3NYQA 3A9VA 5AE2A 1ZB9A 1N34C 4K0BA 5BSWA 3I07A 3AF6A 1N32C 4WS9A 2OO4A 5BUQA 4JI4C 2UUAC 3I08A 4JI1C 1IBLC 5BUSA 4ISBA 2V7BA 4YY3C 4AQYC 3TDEA 3VNRA 5A2QD 3DLPX 2P2MA 3EERA 4RM2A 4PZPA 2XR1A 3VNSA 4PHTA 4YHHC 1JOSA 5BR8C 1HNZC 2UXDC 4JI7C 4X62C 4DUZC 1V26A 3A9UA 4DG9A 1YJ7A 2OPLB 4OXIA 4GKJC 4DV2C 5BURA 4FTFA 2E5LC 5JRHA 4OYCA 2CY1A 3OTOC 4BCAA 2E8FA 2JMPA 3R44A 1UKKA 4LF4C 2F4VC 1LQLA 5IWAC 4LE5A 4B3MC 2P2FA 2UU9C 1QM4A 3TQIA 3IPLA 5IT9D 4DR2C 2ASBA 1RY2A 4D56A 4RLQA 1N33C 1N2FA 2YWBA 2P02A 2P20A 4ZJZA 1FJGC 4X65C 2HJGA 4LFBC 1XNQC 2E8CA 2ZM6C 2E8EA 1XNRC 1LCIA 3VNQA 4DV3C 2D7VA 4L7IA 4GXRA 4DCVA 5KYVA 2E0GA 3C5EA 3IEVA 4GS5A 2VSQA 1XMOC 5T8TA 1HNWC 3RV2A 4DV7C 4IZ6A 1GPMA 1IBKC 1WH9A 3FCCA 2P2QA 1QWIA 1XRAA 3PESA 4G36A 4DR4C 1WF3A 4DCSA 3IEUA 1O90A 5DV9A 5A19A 2VQFC 2E7GA 2AYAA 1T5DX 1XRBA 2BH1X 1K0RA 4NDNA 4DCTA 3L95X 1PG4A 3NYRA 4JM1A 2QVYX 3CW9A 1EGAA 2D28C 4NXMC 1MKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 C;  3T1H C;  4DCU A;  4JI2 C;  1XMQ C;  2E5L C;  1J5E C;  2CY1 A;  3OTO C;  2YCB A;  4JV5 C;  3CJE A;  1KKG A;  2E8F A;  2JMP A;  2BJO A;  4B3T C;  1UKK A;  2KZF A;  4LF4 C;  3R9X A;  4JYA C;  5FLX D;  1ZB8 A;  4JI3 C;  2ATW A;  2F4V C;  1LQL A;  5IWA C;  1PA4 A;  2PN2 A;  4JI8 C;  4B3M C;  2VQE C;  1VLA A;  1USP A;  4X64 C;  2UU9 C;  4DR6 C;  4DR1 C;  4XX2 A;  3GKU A;  4DR2 C;  5IT9 D;  2ASB A;  2UXB C;  4X66 C;  2PT7 G;  3T1Y C;  3R9W A;  4LF9 C;  1N2F A;  4DV5 C;  1N33 C;  2EGT A;  1FJG C;  4LF7 C;  1HH2 P;  2OPL A;  4X65 C;  2HJG A;  4NOZ A;  4DR5 C;  2E8C A;  1XNQ C;  4LFB C;  3J7A D;  2ZM6 C;  2E8E A;  1XNR C;  2UUB C;  1HR0 C;  4DV3 C;  3LUS A;  2D7V A;  4DCV A;  4DV1 C;  2ONF A;  4GKJ C;  1I94 C;  4MH4 A;  4OX9 C;  1HNX C;  4JI5 C;  1ZB9 A;  1N34 C;  2HHH C;  4LF8 C;  4MTN A;  4LFC C;  3IEV A;  1L2F A;  4NXN C;  4B3S C;  1XMO C;  1HNW C;  3I07 A;  4DV7 C;  3AF6 A;  1N32 C;  1IBK C;  4DR7 C;  1WH9 A;  4JI4 C;  2UUA C;  4KHP C;  4JI1 C;  2DYJ A;  1IBL C;  1QWI A;  2UUC C;  1N36 C;  1IBM C;  4DR4 C;  4DCS A;  1WF3 A;  3J80 D;  4YY3 C;  4AQY C;  3IEU A;  2UXC C;  5A2Q D;  3EER A;  2VQF C;  3J81 D;  4DV6 C;  2E7G A;  2XR1 A;  2QL8 A;  4BSZ A;  1MKY A;  4K0K C;  4YHH C;  1USP B;  4JI0 C;  4LF5 C;  4LFA C;  5LMN C;  1JOS A;  4DV4 C;  5BR8 C;  1K0R A;  1ML8 A;  1NYE A;  1HNZ C;  4GKK C;  2UXD C;  4DCT A;  4DUY C;  4JI7 C;  3AF5 A;  4X62 C;  4LF6 C;  5LMU C;  4DUZ C;  1EGA A;  4JI6 C;  2CXC A;  4DV0 C;  4NXM C;  2OPL B;  4DR3 C;  3JAM D;  4B3R C; 
#chains in the Genus database with same CATH topology
 3T1H C;  4DCU A;  1T5H X;  5BSR A;  3O2E A;  4JV5 C;  1O93 A;  3CJE A;  4BBY A;  3DHV A;  4B3T C;  1RG9 A;  4JYA C;  3H2T A;  5FLX D;  4JI3 C;  2ATW A;  5CZX A;  2PN2 A;  2KDN A;  4DR1 C;  1FUG A;  1WCJ A;  4X66 C;  1XHJ A;  1NY8 A;  3SO4 A;  2D1S A;  3J7A D;  5A1I A;  4U5Y D;  4DR5 C;  4HPV A;  1XDX A;  4ODJ A;  1HR0 C;  2DHM A;  3PBK A;  2P2B A;  1IB8 A;  4PRO C;  4MH4 A;  3NI2 A;  1HNX C;  4OX9 C;  3KXW A;  4JI5 C;  4RVN A;  4D4I A;  4PUH A;  4MTN A;  4TPS B;  4NXN C;  1MDB A;  3K6R A;  4R1L A;  1V60 A;  2PRO A;  2VZE A;  4G37 A;  5IFI A;  5K8F A;  2PG1 E;  4DR7 C;  4ZLP A;  2DYJ A;  3TUF A;  4KTV A;  2MCQ A;  2UUC C;  2D1Q A;  1UWD A;  3J80 D;  5A1G A;  2DPL A;  3A4I A;  3FM7 A;  2UXC C;  1BA3 A;  1P4E A;  4D57 A;  2M5H A;  4BSZ A;  4K0K C;  4LFA C;  4DV4 C;  1ML8 A;  1NYE A;  2QVX X;  5BSM A;  3A25 A;  5LMU C;  1XRC A;  2ZZM A;  4RLF A;  4JI6 C;  4DR3 C;  4B3R C;  4JI2 C;  5BSV A;  1XMQ C;  5BST A;  1MXC A;  4GXQ A;  1KKG A;  2KZ0 A;  3PRO C;  3R9X A;  3A26 A;  1ZB8 A;  3E7W A;  4G1I A;  4R1M A;  3ETC A;  1USP A;  3G7S A;  3LGX A;  3LAX A;  2D1R A;  4RVO A;  1TH5 A;  4FUT A;  4XX2 A;  3GKU A;  2CU6 A;  3RG2 A;  3FCE A;  3UOW A;  2P2J A;  1M6X C;  4DV5 C;  2EGT A;  4FUQ A;  4LF7 C;  4NOZ A;  3GR1 A;  4L2Z A;  2UUB C;  4DV1 C;  1P7L A;  1I94 C;  3N54 B;  2JNV A;  4I9G A;  1V25 A;  4RMN A;  2Y4O A;  3IML A;  2QVZ X;  4KTT A;  5T8S A;  2HHH C;  4LF8 C;  3N2Q A;  4DG8 A;  5AE1 A;  1L2F A;  4B3S C;  4D4G A;  4BC9 A;  1O9T A;  4R0M A;  3UZ0 A;  3CW8 X;  4RM3 A;  4KHP C;  1MXA A;  3S82 A;  1N36 C;  1IBM C;  5ADZ A;  4WV3 A;  3NPD A;  3CQ1 A;  4EAT A;  3E7X A;  4BC7 A;  3J81 D;  3GR0 A;  4DV6 C;  3DAY A;  5H9U A;  2WD9 A;  2QL8 A;  1MDF A;  2OBV A;  1USP B;  4JI0 C;  4LF5 C;  5LMN C;  2QW0 X;  2ZTB A;  4GKK C;  2WP0 C;  4DUY C;  3UX2 A;  3AF5 A;  4LF6 C;  5CZV A;  5BSU A;  1PU1 A;  2D27 A;  5KEI A;  2CXC A;  4DV0 C;  5K85 A;  2D1T A;  4LFC C;  3JAM D;  2Y27 A;  1VEH A;  1MXB A;  1O92 A;  1J5E C;  1PG3 A;  2YCB A;  5KYT A;  2BJO A;  2KZF A;  3ETO A;  4L4Q A;  5E7Q A;  1PA4 A;  4JI8 C;  2VQE C;  1ULT A;  3GPC A;  1VLA A;  4X64 C;  4DR6 C;  1MD9 A;  3B7W A;  2UXB C;  5AE3 A;  2PT7 G;  3T1Y C;  3R9W A;  4LF9 C;  1AMU A;  2Y4N A;  4IR7 A;  1HH2 P;  2OPL A;  3UX3 A;  5GTD A;  2YWC A;  3EQ6 A;  4I9F A;  3LNV A;  3LUS A;  2ONF A;  3L8C A;  3NYQ A;  3A9V A;  5AE2 A;  1ZB9 A;  1N34 C;  4K0B A;  2MMA B;  5BSW A;  3I07 A;  3AF6 A;  1N32 C;  4WS9 A;  2OO4 A;  5BUQ A;  4JI4 C;  2UUA C;  3I08 A;  4JI1 C;  1IBL C;  5BUS A;  3CQ3 A;  4ISB A;  4PUI A;  2V7B A;  4YY3 C;  4AQY C;  3TDE A;  3VNR A;  5A2Q D;  3DLP X;  2P2M A;  3EER A;  5LCI A;  4RM2 A;  4PZP A;  2YX1 A;  2XR1 A;  3VNS A;  2MM9 A;  4PHT A;  4YHH C;  1JOS A;  5BR8 C;  1HNZ C;  2UXD C;  4JI7 C;  4X62 C;  4DUZ C;  1V26 A;  3A9U A;  4DG9 A;  1YJ7 A;  2OPL B;  4OXI A;  4GKJ C;  1M6X A;  4DV2 C;  5BUR A;  4FTF A;  4PUG A;  2E5L C;  2M5O A;  5JRH A;  4OYC A;  1P4E C;  2CY1 A;  3OTO C;  1XS3 A;  4BCA A;  2E8F A;  2JMP A;  3R44 A;  1UKK A;  4LF4 C;  2F4V C;  1LQL A;  5IWA C;  4LE5 A;  4B3M C;  2P2F A;  2UU9 C;  1QM4 A;  3TQI A;  3IPL A;  5IT9 D;  4DR2 C;  2ASB A;  1RY2 A;  4D56 A;  4RLQ A;  1N33 C;  1N2F A;  2YWB A;  2P02 A;  2P20 A;  4ZJZ A;  1FJG C;  4X65 C;  2HJG A;  4LFB C;  1XNQ C;  2E8C A;  2ZM6 C;  2E8E A;  1XNR C;  1LCI A;  1YGT A;  3VNQ A;  4DV3 C;  2D7V A;  2Z51 A;  4L7I A;  4GXR A;  4DCV A;  5KYV A;  2E0G A;  3UEB A;  1FLO A;  3C5E A;  3IEV A;  4GS5 A;  2VSQ A;  1XMO C;  5T8T A;  1HNW C;  3RV2 A;  4DV7 C;  4IZ6 A;  1GPM A;  1IBK C;  3LNO A;  1WH9 A;  3FCC A;  2P2Q A;  1QWI A;  1XRA A;  3PES A;  4G36 A;  4DR4 C;  1WF3 A;  4DCS A;  3TR3 A;  3IEU A;  1O90 A;  5DV9 A;  2NCL A;  2ZZN A;  5A19 A;  2VQF C;  2E7G A;  2AYA A;  1T5D X;  3CQ2 A;  1XRB A;  2BH1 X;  1K0R A;  4NDN A;  3AY0 A;  4DCT A;  3L95 X;  1PG4 A;  3NYR A;  4JM1 A;  2QVY X;  3CW9 A;  1EGA A;  2D28 C;  4NXM C;  1MKY A; 
#chains in the Genus database with same CATH homology
 3T1H C;  4DCU A;  1T5H X;  5BSR A;  4JV5 C;  1O93 A;  3CJE A;  4BBY A;  3DHV A;  4B3T C;  1RG9 A;  4JYA C;  3H2T A;  5FLX D;  4JI3 C;  2ATW A;  5CZX A;  2PN2 A;  4DR1 C;  1FUG A;  4X66 C;  3SO4 A;  2D1S A;  3J7A D;  5A1I A;  4U5Y D;  4DR5 C;  4HPV A;  4ODJ A;  1HR0 C;  3PBK A;  2P2B A;  4PRO C;  4MH4 A;  3NI2 A;  1HNX C;  4OX9 C;  3KXW A;  4JI5 C;  4RVN A;  4D4I A;  4MTN A;  4TPS B;  4NXN C;  1MDB A;  4R1L A;  2PRO A;  2VZE A;  4G37 A;  5IFI A;  5K8F A;  4DR7 C;  4ZLP A;  2DYJ A;  3TUF A;  4KTV A;  2UUC C;  2D1Q A;  3J80 D;  5A1G A;  2DPL A;  3A4I A;  2UXC C;  1BA3 A;  4D57 A;  4BSZ A;  4K0K C;  4LFA C;  4DV4 C;  1ML8 A;  1NYE A;  2QVX X;  5BSM A;  5LMU C;  1XRC A;  4RLF A;  4JI6 C;  4DR3 C;  4B3R C;  4JI2 C;  5BSV A;  1XMQ C;  5BST A;  1MXC A;  4GXQ A;  1KKG A;  3PRO C;  3R9X A;  1ZB8 A;  3E7W A;  4G1I A;  4R1M A;  3ETC A;  1USP A;  3G7S A;  3LGX A;  3LAX A;  2D1R A;  4RVO A;  4FUT A;  4XX2 A;  3GKU A;  3RG2 A;  3FCE A;  3UOW A;  2P2J A;  4DV5 C;  2EGT A;  4FUQ A;  4LF7 C;  4NOZ A;  3GR1 A;  4L2Z A;  2UUB C;  4DV1 C;  1P7L A;  1I94 C;  3N54 B;  4I9G A;  1V25 A;  4RMN A;  2Y4O A;  3IML A;  2QVZ X;  4KTT A;  5T8S A;  2HHH C;  4LF8 C;  3N2Q A;  4DG8 A;  5AE1 A;  1L2F A;  4B3S C;  4D4G A;  4BC9 A;  1O9T A;  4R0M A;  3UZ0 A;  3CW8 X;  4RM3 A;  4KHP C;  1MXA A;  3S82 A;  1N36 C;  1IBM C;  5ADZ A;  4WV3 A;  3NPD A;  4EAT A;  3E7X A;  4BC7 A;  3J81 D;  3GR0 A;  4DV6 C;  3DAY A;  5H9U A;  2WD9 A;  2QL8 A;  1MDF A;  2OBV A;  1USP B;  4JI0 C;  4LF5 C;  5LMN C;  2QW0 X;  4GKK C;  2WP0 C;  4DUY C;  3AF5 A;  4LF6 C;  5CZV A;  5BSU A;  2D27 A;  5KEI A;  2CXC A;  4DV0 C;  5K85 A;  2D1T A;  4LFC C;  3JAM D;  2Y27 A;  1MXB A;  1O92 A;  1J5E C;  1PG3 A;  2YCB A;  5KYT A;  2BJO A;  2KZF A;  3ETO A;  4L4Q A;  5E7Q A;  1PA4 A;  4JI8 C;  2VQE C;  1ULT A;  3GPC A;  1VLA A;  4X64 C;  4DR6 C;  1MD9 A;  3B7W A;  2UXB C;  5AE3 A;  2PT7 G;  3T1Y C;  3R9W A;  4LF9 C;  1AMU A;  2Y4N A;  4IR7 A;  1HH2 P;  2OPL A;  5GTD A;  2YWC A;  3EQ6 A;  4I9F A;  3LNV A;  3LUS A;  2ONF A;  3L8C A;  3NYQ A;  3A9V A;  5AE2 A;  1ZB9 A;  1N34 C;  4K0B A;  5BSW A;  3I07 A;  3AF6 A;  1N32 C;  4WS9 A;  2OO4 A;  5BUQ A;  4JI4 C;  2UUA C;  3I08 A;  4JI1 C;  1IBL C;  5BUS A;  4ISB A;  2V7B A;  4YY3 C;  4AQY C;  3TDE A;  3VNR A;  5A2Q D;  3DLP X;  2P2M A;  3EER A;  4RM2 A;  4PZP A;  2XR1 A;  3VNS A;  4PHT A;  4YHH C;  1JOS A;  5BR8 C;  1HNZ C;  2UXD C;  4JI7 C;  4X62 C;  4DUZ C;  1V26 A;  3A9U A;  4DG9 A;  1YJ7 A;  2OPL B;  4OXI A;  4GKJ C;  4DV2 C;  5BUR A;  4FTF A;  2E5L C;  5JRH A;  4OYC A;  2CY1 A;  3OTO C;  4BCA A;  2E8F A;  2JMP A;  3R44 A;  1UKK A;  4LF4 C;  2F4V C;  1LQL A;  5IWA C;  4LE5 A;  4B3M C;  2P2F A;  2UU9 C;  1QM4 A;  3TQI A;  3IPL A;  5IT9 D;  4DR2 C;  2ASB A;  1RY2 A;  4D56 A;  4RLQ A;  1N33 C;  1N2F A;  2YWB A;  2P02 A;  2P20 A;  4ZJZ A;  1FJG C;  4X65 C;  2HJG A;  4LFB C;  1XNQ C;  2E8C A;  2ZM6 C;  2E8E A;  1XNR C;  1LCI A;  3VNQ A;  4DV3 C;  2D7V A;  4L7I A;  4GXR A;  4DCV A;  5KYV A;  2E0G A;  3C5E A;  3IEV A;  4GS5 A;  2VSQ A;  1XMO C;  5T8T A;  1HNW C;  3RV2 A;  4DV7 C;  4IZ6 A;  1GPM A;  1IBK C;  1WH9 A;  3FCC A;  2P2Q A;  1QWI A;  1XRA A;  3PES A;  4G36 A;  4DR4 C;  1WF3 A;  4DCS A;  3IEU A;  1O90 A;  5DV9 A;  5A19 A;  2VQF C;  2E7G A;  2AYA A;  1T5D X;  1XRB A;  2BH1 X;  1K0R A;  4NDN A;  4DCT A;  3L95 X;  1PG4 A;  3NYR A;  4JM1 A;  2QVY X;  3CW9 A;  1EGA A;  2D28 C;  4NXM C;  1MKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...