5BR8C

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5br8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5br8C02
5FLXD 4DV7C 3JAMD 1XNQC 1HNWC 3OTOC 1PA4A 4X66C 4DCSA 4X65C 1XNRC 2VQEC 4AQYC 1IBLC 3EERA 3IEUA 4GKJC 3LUSA 2E8EA 4NXMC 2D7VA 1IBMC 2HJGA 1K0RA 5IWAC 2PT7G 4DV5C 4K0KC 3J81D 4JI5C 2ASBA 4DR7C 2YCBA 4DCVA 4JI2C 1N36C 4JYAC 4LF4C 2HHHC 2JMPA 4DV2C 3AF6A 4DR6C 1ZB9A 2UXBC 4LF8C 1ZB8A 3AF5A 4B3SC 4LFCC 1KKGA 1WH9A 1N34C 1N32C 3R9WA 4LF7C 4JI7C 3J7AD 1NYEA 4B3MC 4DUYC 4DR5C 2ATWA 2XR1A 5A2QD 3J80D 5LMUC 1EGAA 4DR3C 2UUAC 2F4VC 4BSZA 1HNZC 5LMNC 4JV5C 4LFBC 1XMQC 4OX9C 1QWIA 2UU9C 4MH4A 1ML8A 1USPB 4X64C 1UKKA 1LQLA 2UUCC 2E8CA 4DV3C 1WF3A 1FJGC 4NOZA 3T1YC 4LFAC 1J5EC 2DYJA 4DV4C 4DV0C 2ONFA 4XX2A 2KZFA 1IBKC 4DCUA 2EGTA 4KHPC 4DV6C 4GKKC 4DV1C 2E7GA 1I94C 2QL8A 4X62C 4JI8C 3I07A 4YY3C 4B3RC 1HH2P 1JOSA 4DUZC 3T1HC 2UUBC 2E8FA 3IEVA 1N33C 2CY1A 4LF6C 3GKUA 4YHHC 2PN2A 4NXNC 4DR4C 1HR0C 1HNXC 1MKYA 2OPLA 2BJOA 4LF9C 1N2FA 4JI3C 1VLAA 4DR2C 2E5LC 2VQFC 4LF5C 4JI4C 5BR8C 4DR1C 5IT9D 2UXDC 3CJEA 4JI6C 1USPA 3R9XA 4MTNA 4JI1C 2UXCC 1L2FA 2OPLB 1XMOC 4JI0C 4DCTA 2CXCA 2ZM6C 4B3TC
chains in the Genus database with same CATH superfamily
3L8CA 1FUGA 4RM3A 4BCAA 1HNWC 2PG1E 1XRAA 1PA4A 1PU1A 4G1IA 3A26A 4AQYC 3PROC 3UZ0A 5BSVA 4KTVA 4NXMC 2D1SA 1IBMC 3NYQA 1MDBA 2QVZX 3TUFA 5T8SA 2PT7G 4D4GA 3NI2A 3J81D 2ASBA 1N36C 2VSQA 3TR3A 2JMPA 1ULTA 4DR6C 3AF6A 3E7XA 1O9TA 4DG9A 4OXIA 2YWCA 1ZB8A 3AF5A 5K85A 4LF8C 1KKGA 1WH9A 4JI7C 1MXCA 2P02A 4DG8A 4DUYC 3J80D 4FTFA 4RLQA 5LMUC 1P4EA 4K0BA 3GR1A 3DLPX 4LE5A 1M6XC 1XRCA 4OX9C 2UUCC 3CQ2A 3VNQA 1MXBA 1J5EC 1XRBA 4DCUA 4KHPC 1YJ7A 5AE1A 1V60A 2E0GA 1I94C 4X62C 1HH2P 4DUZC 3IEVA 4YHHC 4PZPA 2YX1A 4RMNA 3FM7A 2VQFC 4LF5C 4JI4C 4U5YD 5BR8C 1PG3A 5IT9D 2UXDC 2OBVA 4JI6C 3AY0A 1USPA 2UXCC 2OO4A 4JI0C 2CXCA 3DAYA 4B3TC 1V25A 3GPCA 4GXQA 4IR7A 2P2QA 1LCIA 3OTOC 4X66C 3TQIA 4DCSA 4X65C 3CQ3A 1VEHA 4GS5A 3VNRA 4BC7A 4GKJC 2D7VA 4I9GA 2M5HA 5AE3A 5IFIA 5IWAC 4HPVA 1NY8A 1XS3A 5CZXA 4JI2C 3B7WA 3LGXA 3KXWA 4JYAC 5K8FA 2Z51A 3H2TA 2Y4NA 3FCCA 1BA3A 4BC9A 4LF7C 3G7SA 4PROC 5BSTA 4FUQA 2DHMA 2XR1A 5A2QD 3N54B 1EGAA 2UUAC 4RLFA 2F4VC 4BSZA 3C5EA 3N2QA 2UU9C 4MH4A 1ML8A 4R1LA 1UKKA 4WS9A 4DV3C 4TPSB 4OYCA 1T5HX 1O93A 5KYTA 2WD9A 3T1YC 4LFAC 5BSUA 2DYJA 3VNSA 2ONFA 2KZFA 3S82A 2EGTA 3ETOA 4RVOA 2QL8A 1XDXA 2QVXX 1P4EC 4WV3A 4B3RC 1IB8A 1N33C 3I08A 4L2ZA 3A9UA 4LF6C 1XHJA 3UEBA 4NXNC 4DR4C 3ETCA 1MKYA 1V26A 2BJOA 4LF9C 1N2FA 1VLAA 2E5LC 5A1GA 4DR1C 4ZLPA 2MM9A 2P20A 3LNVA 3A25A 3CJEA 3LNOA 4ISBA 3R9XA 1XMOC 4DCTA 3IMLA 3RV2A 1MDFA 3JAMD 1XNRC 5BUQA 2VQEC 4PHTA 1IBLC 3PBKA 5KEIA 3IEUA 3LUSA 5JRHA 2HJGA 3R44A 3DHVA 3FCEA 2Y27A 3GR0A 5DV9A 4DV5C 2ZZNA 4K0KC 2ZTBA 4JI5C 2CU6A 2KZ0A 2YCBA 1UWDA 4RM2A 2KDNA 4LF4C 2HHHC 4DV2C 2UXBC 4PUGA 2P2BA 4LFCC 1N32C 5CZVA 3R9WA 1M6XA 5LCIA 3J7AD 1NYEA 1O90A 3UOWA 4B3MC 4DR5C 4G37A 2Y4OA 5A19A 1HNZC 4IZ6A 1USPB 5A1IA 4X64C 2E8CA 1WF3A 1FJGC 3A9VA 3NYRA 4DV4C 2ZZMA 4XX2A 2D1QA 1IBKC 5BSRA 3E7WA 5BSWA 4DV6C 4GKKC 4ODJA 4JI8C 1P7LA 1JOSA 3T1HC 2E8FA 1PG4A 2CY1A 3GKUA 5BSMA 1QM4A 2DPLA 2P2FA 4D57A 1HNXC 1O92A 3TDEA 1WCJA 5KYVA 2BH1X 1TH5A 3CQ1A 4DR2C 4D56A 4RVNA 2MCQA 5ADZA 2QVYX 4BBYA 2M5OA 2VZEA 3A4IA 4R0MA 1T5DX 5BUSA 4JI1C 1L2FA 1RG9A 2ZM6C 3L95X 5FLXD 3O2EA 4DV7C 1XNQC 2V7BA 3UX3A 5H9UA 3CW9A 1MXAA 3EERA 2E8EA 3NPDA 1K0RA 4DR7C 4DCVA 1GPMA 5GTDA 2NCLA 4GXRA 2MMAB 5AE2A 4NDNA 1ZB9A 1FLOA 4B3SC 3UX2A 4L7IA 1MD9A 1N34C 4D4IA 4FUTA 2ATWA 2D27A 2D1RA 4I9FA 4DR3C 1AMUA 5LMNC 4JV5C 4LFBC 1XMQC 1QWIA 2P2MA 1LQLA 5T8TA 4KTTA 4G36A 4NOZA 1YGTA 3RG2A 2D1TA 2AYAA 4DV0C 3K6RA 4PUIA 3IPLA 4ZJZA 2YWBA 2P2JA 2WP0C 4DV1C 2E7GA 3I07A 3CW8X 4YY3C 2UUBC 4R1MA 4JM1A 2PN2A 5E7QA 2JNVA 1HR0C 2OPLA 4PUHA 2PROA 3LAXA 4JI3C 1RY2A 2D28C 3PESA 3SO4A 4L4QA 3EQ6A 4EATA 4MTNA 5BURA 2OPLB 2QW0X
chains in the Genus database with same CATH topology
3L8CA 1FUGA 4RM3A 4BCAA 1HNWC 1XRAA 1PA4A 4G1IA 4AQYC 3PROC 3UZ0A 5BSVA 4KTVA 4NXMC 2D1SA 1IBMC 3NYQA 1MDBA 2QVZX 3TUFA 5T8SA 2PT7G 4D4GA 3NI2A 3J81D 2ASBA 1N36C 2VSQA 2JMPA 1ULTA 4DR6C 3AF6A 3E7XA 1O9TA 4DG9A 4OXIA 2YWCA 1ZB8A 3AF5A 5K85A 4LF8C 1KKGA 1WH9A 4JI7C 1MXCA 2P02A 4DG8A 4DUYC 3J80D 4FTFA 4RLQA 5LMUC 4K0BA 3GR1A 3DLPX 4LE5A 1XRCA 4OX9C 2UUCC 3VNQA 1MXBA 1J5EC 1XRBA 4DCUA 4KHPC 1YJ7A 5AE1A 2E0GA 1I94C 4X62C 1HH2P 4DUZC 3IEVA 4YHHC 4PZPA 4RMNA 2VQFC 4LF5C 4JI4C 4U5YD 5BR8C 1PG3A 5IT9D 2UXDC 2OBVA 4JI6C 1USPA 2UXCC 2OO4A 4JI0C 2CXCA 3DAYA 4B3TC 1V25A 3GPCA 4GXQA 4IR7A 2P2QA 1LCIA 3OTOC 4X66C 3TQIA 4DCSA 4X65C 4GS5A 3VNRA 4BC7A 4GKJC 2D7VA 4I9GA 5AE3A 5IFIA 5IWAC 4HPVA 5CZXA 4JI2C 3B7WA 3LGXA 3KXWA 4JYAC 5K8FA 3H2TA 2Y4NA 3FCCA 1BA3A 4BC9A 4LF7C 3G7SA 4PROC 5BSTA 4FUQA 2XR1A 5A2QD 3N54B 1EGAA 2UUAC 4RLFA 2F4VC 4BSZA 3C5EA 3N2QA 2UU9C 4MH4A 1ML8A 4R1LA 1UKKA 4WS9A 4DV3C 4TPSB 4OYCA 1T5HX 1O93A 5KYTA 2WD9A 3T1YC 4LFAC 5BSUA 2DYJA 3VNSA 2ONFA 2KZFA 3S82A 2EGTA 3ETOA 4RVOA 2QL8A 2QVXX 4WV3A 4B3RC 1N33C 3I08A 4L2ZA 3A9UA 4LF6C 4NXNC 4DR4C 3ETCA 1MKYA 1V26A 2BJOA 4LF9C 1N2FA 1VLAA 2E5LC 5A1GA 4DR1C 4ZLPA 2P20A 3LNVA 3CJEA 4ISBA 3R9XA 1XMOC 4DCTA 3IMLA 3RV2A 1MDFA 3JAMD 1XNRC 5BUQA 2VQEC 4PHTA 1IBLC 3PBKA 5KEIA 3IEUA 3LUSA 5JRHA 2HJGA 3R44A 3DHVA 3FCEA 2Y27A 3GR0A 5DV9A 4DV5C 4K0KC 4JI5C 2YCBA 4RM2A 4LF4C 2HHHC 4DV2C 2UXBC 2P2BA 4LFCC 1N32C 5CZVA 3R9WA 3J7AD 1NYEA 1O90A 3UOWA 4B3MC 4DR5C 4G37A 2Y4OA 5A19A 1HNZC 4IZ6A 1USPB 5A1IA 4X64C 2E8CA 1WF3A 1FJGC 3A9VA 3NYRA 4DV4C 4XX2A 2D1QA 1IBKC 5BSRA 3E7WA 5BSWA 4DV6C 4GKKC 4ODJA 4JI8C 1P7LA 1JOSA 3T1HC 2E8FA 1PG4A 2CY1A 3GKUA 5BSMA 1QM4A 2DPLA 2P2FA 4D57A 1HNXC 1O92A 3TDEA 5KYVA 2BH1X 4DR2C 4D56A 4RVNA 5ADZA 2QVYX 4BBYA 2VZEA 3A4IA 4R0MA 1T5DX 5BUSA 4JI1C 1L2FA 1RG9A 2ZM6C 3L95X 5FLXD 4DV7C 1XNQC 2V7BA 5H9UA 3CW9A 1MXAA 3EERA 2E8EA 3NPDA 1K0RA 4DR7C 4DCVA 1GPMA 5GTDA 4GXRA 5AE2A 4NDNA 1ZB9A 4B3SC 4L7IA 1MD9A 1N34C 4D4IA 4FUTA 2ATWA 2D27A 2D1RA 4I9FA 4DR3C 1AMUA 5LMNC 4JV5C 4LFBC 1XMQC 1QWIA 2P2MA 1LQLA 5T8TA 4KTTA 4G36A 4NOZA 3RG2A 2D1TA 2AYAA 4DV0C 3IPLA 4ZJZA 2YWBA 2P2JA 2WP0C 4DV1C 2E7GA 3I07A 3CW8X 4YY3C 2UUBC 4R1MA 4JM1A 2PN2A 5E7QA 1HR0C 2OPLA 2PROA 3LAXA 4JI3C 1RY2A 2D28C 3PESA 3SO4A 4L4QA 3EQ6A 4EATA 4MTNA 5BURA 2OPLB 2QW0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX D;  4DV7 C;  3JAM D;  1XNQ C;  1HNW C;  3OTO C;  1PA4 A;  4X66 C;  4DCS A;  4X65 C;  1XNR C;  2VQE C;  4AQY C;  1IBL C;  3EER A;  3IEU A;  4GKJ C;  3LUS A;  2E8E A;  4NXM C;  2D7V A;  1IBM C;  2HJG A;  1K0R A;  5IWA C;  2PT7 G;  4DV5 C;  4K0K C;  3J81 D;  4JI5 C;  2ASB A;  4DR7 C;  2YCB A;  4DCV A;  4JI2 C;  1N36 C;  4JYA C;  4LF4 C;  2HHH C;  2JMP A;  4DV2 C;  3AF6 A;  4DR6 C;  1ZB9 A;  2UXB C;  4LF8 C;  1ZB8 A;  3AF5 A;  4B3S C;  4LFC C;  1KKG A;  1WH9 A;  1N34 C;  1N32 C;  3R9W A;  4LF7 C;  4JI7 C;  3J7A D;  1NYE A;  4B3M C;  4DUY C;  4DR5 C;  2ATW A;  2XR1 A;  5A2Q D;  3J80 D;  5LMU C;  1EGA A;  4DR3 C;  2UUA C;  2F4V C;  4BSZ A;  1HNZ C;  5LMN C;  4JV5 C;  4LFB C;  1XMQ C;  4OX9 C;  1QWI A;  2UU9 C;  4MH4 A;  1ML8 A;  1USP B;  4X64 C;  1UKK A;  1LQL A;  2UUC C;  2E8C A;  4DV3 C;  1WF3 A;  1FJG C;  4NOZ A;  3T1Y C;  4LFA C;  1J5E C;  2DYJ A;  4DV4 C;  4DV0 C;  2ONF A;  4XX2 A;  2KZF A;  1IBK C;  4DCU A;  2EGT A;  4KHP C;  4DV6 C;  4GKK C;  4DV1 C;  2E7G A;  1I94 C;  2QL8 A;  4X62 C;  4JI8 C;  3I07 A;  4YY3 C;  4B3R C;  1HH2 P;  1JOS A;  4DUZ C;  3T1H C;  2UUB C;  2E8F A;  3IEV A;  1N33 C;  2CY1 A;  4LF6 C;  3GKU A;  4YHH C;  2PN2 A;  4NXN C;  4DR4 C;  1HR0 C;  1HNX C;  1MKY A;  2OPL A;  2BJO A;  4LF9 C;  1N2F A;  4JI3 C;  1VLA A;  4DR2 C;  2E5L C;  2VQF C;  4LF5 C;  4JI4 C;  5BR8 C;  4DR1 C;  5IT9 D;  2UXD C;  3CJE A;  4JI6 C;  1USP A;  3R9X A;  4MTN A;  4JI1 C;  2UXC C;  1L2F A;  2OPL B;  1XMO C;  4JI0 C;  4DCT A;  2CXC A;  2ZM6 C;  4B3T C; 
#chains in the Genus database with same CATH topology
 3L8C A;  1FUG A;  4RM3 A;  4BCA A;  1HNW C;  2PG1 E;  1XRA A;  1PA4 A;  1PU1 A;  4G1I A;  3A26 A;  4AQY C;  3PRO C;  3UZ0 A;  5BSV A;  4KTV A;  4NXM C;  2D1S A;  1IBM C;  3NYQ A;  1MDB A;  2QVZ X;  3TUF A;  5T8S A;  2PT7 G;  4D4G A;  3NI2 A;  3J81 D;  2ASB A;  1N36 C;  2VSQ A;  3TR3 A;  2JMP A;  1ULT A;  4DR6 C;  3AF6 A;  3E7X A;  1O9T A;  4DG9 A;  4OXI A;  2YWC A;  1ZB8 A;  3AF5 A;  5K85 A;  4LF8 C;  1KKG A;  1WH9 A;  4JI7 C;  1MXC A;  2P02 A;  4DG8 A;  4DUY C;  3J80 D;  4FTF A;  4RLQ A;  5LMU C;  1P4E A;  4K0B A;  3GR1 A;  3DLP X;  4LE5 A;  1M6X C;  1XRC A;  4OX9 C;  2UUC C;  3CQ2 A;  3VNQ A;  1MXB A;  1J5E C;  1XRB A;  4DCU A;  4KHP C;  1YJ7 A;  5AE1 A;  1V60 A;  2E0G A;  1I94 C;  4X62 C;  1HH2 P;  4DUZ C;  3IEV A;  4YHH C;  4PZP A;  2YX1 A;  4RMN A;  3FM7 A;  2VQF C;  4LF5 C;  4JI4 C;  4U5Y D;  5BR8 C;  1PG3 A;  5IT9 D;  2UXD C;  2OBV A;  4JI6 C;  3AY0 A;  1USP A;  2UXC C;  2OO4 A;  4JI0 C;  2CXC A;  3DAY A;  4B3T C;  1V25 A;  3GPC A;  4GXQ A;  4IR7 A;  2P2Q A;  1LCI A;  3OTO C;  4X66 C;  3TQI A;  4DCS A;  4X65 C;  3CQ3 A;  1VEH A;  4GS5 A;  3VNR A;  4BC7 A;  4GKJ C;  2D7V A;  4I9G A;  2M5H A;  5AE3 A;  5IFI A;  5IWA C;  4HPV A;  1NY8 A;  1XS3 A;  5CZX A;  4JI2 C;  3B7W A;  3LGX A;  3KXW A;  4JYA C;  5K8F A;  2Z51 A;  3H2T A;  2Y4N A;  3FCC A;  1BA3 A;  4BC9 A;  4LF7 C;  3G7S A;  4PRO C;  5BST A;  4FUQ A;  2DHM A;  2XR1 A;  5A2Q D;  3N54 B;  1EGA A;  2UUA C;  4RLF A;  2F4V C;  4BSZ A;  3C5E A;  3N2Q A;  2UU9 C;  4MH4 A;  1ML8 A;  4R1L A;  1UKK A;  4WS9 A;  4DV3 C;  4TPS B;  4OYC A;  1T5H X;  1O93 A;  5KYT A;  2WD9 A;  3T1Y C;  4LFA C;  5BSU A;  2DYJ A;  3VNS A;  2ONF A;  2KZF A;  3S82 A;  2EGT A;  3ETO A;  4RVO A;  2QL8 A;  1XDX A;  2QVX X;  1P4E C;  4WV3 A;  4B3R C;  1IB8 A;  1N33 C;  3I08 A;  4L2Z A;  3A9U A;  4LF6 C;  1XHJ A;  3UEB A;  4NXN C;  4DR4 C;  3ETC A;  1MKY A;  1V26 A;  2BJO A;  4LF9 C;  1N2F A;  1VLA A;  2E5L C;  5A1G A;  4DR1 C;  4ZLP A;  2MM9 A;  2P20 A;  3LNV A;  3A25 A;  3CJE A;  3LNO A;  4ISB A;  3R9X A;  1XMO C;  4DCT A;  3IML A;  3RV2 A;  1MDF A;  3JAM D;  1XNR C;  5BUQ A;  2VQE C;  4PHT A;  1IBL C;  3PBK A;  5KEI A;  3IEU A;  3LUS A;  5JRH A;  2HJG A;  3R44 A;  3DHV A;  3FCE A;  2Y27 A;  3GR0 A;  5DV9 A;  4DV5 C;  2ZZN A;  4K0K C;  2ZTB A;  4JI5 C;  2CU6 A;  2KZ0 A;  2YCB A;  1UWD A;  4RM2 A;  2KDN A;  4LF4 C;  2HHH C;  4DV2 C;  2UXB C;  4PUG A;  2P2B A;  4LFC C;  1N32 C;  5CZV A;  3R9W A;  1M6X A;  5LCI A;  3J7A D;  1NYE A;  1O90 A;  3UOW A;  4B3M C;  4DR5 C;  4G37 A;  2Y4O A;  5A19 A;  1HNZ C;  4IZ6 A;  1USP B;  5A1I A;  4X64 C;  2E8C A;  1WF3 A;  1FJG C;  3A9V A;  3NYR A;  4DV4 C;  2ZZM A;  4XX2 A;  2D1Q A;  1IBK C;  5BSR A;  3E7W A;  5BSW A;  4DV6 C;  4GKK C;  4ODJ A;  4JI8 C;  1P7L A;  1JOS A;  3T1H C;  2E8F A;  1PG4 A;  2CY1 A;  3GKU A;  5BSM A;  1QM4 A;  2DPL A;  2P2F A;  4D57 A;  1HNX C;  1O92 A;  3TDE A;  1WCJ A;  5KYV A;  2BH1 X;  1TH5 A;  3CQ1 A;  4DR2 C;  4D56 A;  4RVN A;  2MCQ A;  5ADZ A;  2QVY X;  4BBY A;  2M5O A;  2VZE A;  3A4I A;  4R0M A;  1T5D X;  5BUS A;  4JI1 C;  1L2F A;  1RG9 A;  2ZM6 C;  3L95 X;  5FLX D;  3O2E A;  4DV7 C;  1XNQ C;  2V7B A;  3UX3 A;  5H9U A;  3CW9 A;  1MXA A;  3EER A;  2E8E A;  3NPD A;  1K0R A;  4DR7 C;  4DCV A;  1GPM A;  5GTD A;  2NCL A;  4GXR A;  2MMA B;  5AE2 A;  4NDN A;  1ZB9 A;  1FLO A;  4B3S C;  3UX2 A;  4L7I A;  1MD9 A;  1N34 C;  4D4I A;  4FUT A;  2ATW A;  2D27 A;  2D1R A;  4I9F A;  4DR3 C;  1AMU A;  5LMN C;  4JV5 C;  4LFB C;  1XMQ C;  1QWI A;  2P2M A;  1LQL A;  5T8T A;  4KTT A;  4G36 A;  4NOZ A;  1YGT A;  3RG2 A;  2D1T A;  2AYA A;  4DV0 C;  3K6R A;  4PUI A;  3IPL A;  4ZJZ A;  2YWB A;  2P2J A;  2WP0 C;  4DV1 C;  2E7G A;  3I07 A;  3CW8 X;  4YY3 C;  2UUB C;  4R1M A;  4JM1 A;  2PN2 A;  5E7Q A;  2JNV A;  1HR0 C;  2OPL A;  4PUH A;  2PRO A;  3LAX A;  4JI3 C;  1RY2 A;  2D28 C;  3PES A;  3SO4 A;  4L4Q A;  3EQ6 A;  4EAT A;  4MTN A;  5BUR A;  2OPL B;  2QW0 X; 
#chains in the Genus database with same CATH homology
 3L8C A;  1FUG A;  4RM3 A;  4BCA A;  1HNW C;  1XRA A;  1PA4 A;  4G1I A;  4AQY C;  3PRO C;  3UZ0 A;  5BSV A;  4KTV A;  4NXM C;  2D1S A;  1IBM C;  3NYQ A;  1MDB A;  2QVZ X;  3TUF A;  5T8S A;  2PT7 G;  4D4G A;  3NI2 A;  3J81 D;  2ASB A;  1N36 C;  2VSQ A;  2JMP A;  1ULT A;  4DR6 C;  3AF6 A;  3E7X A;  1O9T A;  4DG9 A;  4OXI A;  2YWC A;  1ZB8 A;  3AF5 A;  5K85 A;  4LF8 C;  1KKG A;  1WH9 A;  4JI7 C;  1MXC A;  2P02 A;  4DG8 A;  4DUY C;  3J80 D;  4FTF A;  4RLQ A;  5LMU C;  4K0B A;  3GR1 A;  3DLP X;  4LE5 A;  1XRC A;  4OX9 C;  2UUC C;  3VNQ A;  1MXB A;  1J5E C;  1XRB A;  4DCU A;  4KHP C;  1YJ7 A;  5AE1 A;  2E0G A;  1I94 C;  4X62 C;  1HH2 P;  4DUZ C;  3IEV A;  4YHH C;  4PZP A;  4RMN A;  2VQF C;  4LF5 C;  4JI4 C;  4U5Y D;  5BR8 C;  1PG3 A;  5IT9 D;  2UXD C;  2OBV A;  4JI6 C;  1USP A;  2UXC C;  2OO4 A;  4JI0 C;  2CXC A;  3DAY A;  4B3T C;  1V25 A;  3GPC A;  4GXQ A;  4IR7 A;  2P2Q A;  1LCI A;  3OTO C;  4X66 C;  3TQI A;  4DCS A;  4X65 C;  4GS5 A;  3VNR A;  4BC7 A;  4GKJ C;  2D7V A;  4I9G A;  5AE3 A;  5IFI A;  5IWA C;  4HPV A;  5CZX A;  4JI2 C;  3B7W A;  3LGX A;  3KXW A;  4JYA C;  5K8F A;  3H2T A;  2Y4N A;  3FCC A;  1BA3 A;  4BC9 A;  4LF7 C;  3G7S A;  4PRO C;  5BST A;  4FUQ A;  2XR1 A;  5A2Q D;  3N54 B;  1EGA A;  2UUA C;  4RLF A;  2F4V C;  4BSZ A;  3C5E A;  3N2Q A;  2UU9 C;  4MH4 A;  1ML8 A;  4R1L A;  1UKK A;  4WS9 A;  4DV3 C;  4TPS B;  4OYC A;  1T5H X;  1O93 A;  5KYT A;  2WD9 A;  3T1Y C;  4LFA C;  5BSU A;  2DYJ A;  3VNS A;  2ONF A;  2KZF A;  3S82 A;  2EGT A;  3ETO A;  4RVO A;  2QL8 A;  2QVX X;  4WV3 A;  4B3R C;  1N33 C;  3I08 A;  4L2Z A;  3A9U A;  4LF6 C;  4NXN C;  4DR4 C;  3ETC A;  1MKY A;  1V26 A;  2BJO A;  4LF9 C;  1N2F A;  1VLA A;  2E5L C;  5A1G A;  4DR1 C;  4ZLP A;  2P20 A;  3LNV A;  3CJE A;  4ISB A;  3R9X A;  1XMO C;  4DCT A;  3IML A;  3RV2 A;  1MDF A;  3JAM D;  1XNR C;  5BUQ A;  2VQE C;  4PHT A;  1IBL C;  3PBK A;  5KEI A;  3IEU A;  3LUS A;  5JRH A;  2HJG A;  3R44 A;  3DHV A;  3FCE A;  2Y27 A;  3GR0 A;  5DV9 A;  4DV5 C;  4K0K C;  4JI5 C;  2YCB A;  4RM2 A;  4LF4 C;  2HHH C;  4DV2 C;  2UXB C;  2P2B A;  4LFC C;  1N32 C;  5CZV A;  3R9W A;  3J7A D;  1NYE A;  1O90 A;  3UOW A;  4B3M C;  4DR5 C;  4G37 A;  2Y4O A;  5A19 A;  1HNZ C;  4IZ6 A;  1USP B;  5A1I A;  4X64 C;  2E8C A;  1WF3 A;  1FJG C;  3A9V A;  3NYR A;  4DV4 C;  4XX2 A;  2D1Q A;  1IBK C;  5BSR A;  3E7W A;  5BSW A;  4DV6 C;  4GKK C;  4ODJ A;  4JI8 C;  1P7L A;  1JOS A;  3T1H C;  2E8F A;  1PG4 A;  2CY1 A;  3GKU A;  5BSM A;  1QM4 A;  2DPL A;  2P2F A;  4D57 A;  1HNX C;  1O92 A;  3TDE A;  5KYV A;  2BH1 X;  4DR2 C;  4D56 A;  4RVN A;  5ADZ A;  2QVY X;  4BBY A;  2VZE A;  3A4I A;  4R0M A;  1T5D X;  5BUS A;  4JI1 C;  1L2F A;  1RG9 A;  2ZM6 C;  3L95 X;  5FLX D;  4DV7 C;  1XNQ C;  2V7B A;  5H9U A;  3CW9 A;  1MXA A;  3EER A;  2E8E A;  3NPD A;  1K0R A;  4DR7 C;  4DCV A;  1GPM A;  5GTD A;  4GXR A;  5AE2 A;  4NDN A;  1ZB9 A;  4B3S C;  4L7I A;  1MD9 A;  1N34 C;  4D4I A;  4FUT A;  2ATW A;  2D27 A;  2D1R A;  4I9F A;  4DR3 C;  1AMU A;  5LMN C;  4JV5 C;  4LFB C;  1XMQ C;  1QWI A;  2P2M A;  1LQL A;  5T8T A;  4KTT A;  4G36 A;  4NOZ A;  3RG2 A;  2D1T A;  2AYA A;  4DV0 C;  3IPL A;  4ZJZ A;  2YWB A;  2P2J A;  2WP0 C;  4DV1 C;  2E7G A;  3I07 A;  3CW8 X;  4YY3 C;  2UUB C;  4R1M A;  4JM1 A;  2PN2 A;  5E7Q A;  1HR0 C;  2OPL A;  2PRO A;  3LAX A;  4JI3 C;  1RY2 A;  2D28 C;  3PES A;  3SO4 A;  4L4Q A;  3EQ6 A;  4EAT A;  4MTN A;  5BUR A;  2OPL B;  2QW0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...