5BR8C

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5br8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5br8C02
4LF7C 5LMUC 4GKKC 4DV7C 4LF6C 1QWIA 4DR7C 1HR0C 2E8EA 1ZB9A 1IBLC 4DV6C 3JAMD 1N2FA 4LFCC 2PN2A 2DYJA 2E5LC 2VQEC 1WH9A 2ZM6C 2JMPA 1FJGC 4B3RC 2UXDC 1IBKC 3T1YC 3R9WA 2ONFA 4NXNC 4DV0C 1N34C 2UUBC 4K0KC 4MH4A 2YCBA 4DV4C 4X66C 2UUAC 1ZB8A 1KKGA 3I07A 1L2FA 4NOZA 3T1HC 3EERA 1LQLA 5LMNC 1HNXC 2KZFA 5IWAC 1HNZC 4JV5C 1MKYA 3R9XA 4DV2C 4LF9C 1XNQC 4YHHC 4B3MC 4JI5C 1K0RA 3AF6A 2UXCC 4DV5C 4X64C 3J81D 4LF5C 4MTNA 5BR8C 1XNRC 5IT9D 4DR2C 4DV1C 3J7AD 3CJEA 4JI3C 2HHHC 4B3SC 4XX2A 2D7VA 1HNWC 4BSZA 5FLXD 5A2QD 4X65C 2CY1A 4JI6C 1N33C 2ATWA 4DR3C 2E8CA 2UU9C 2E7GA 3OTOC 4AQYC 2CXCA 1XMOC 4DR6C 2OPLA 4DCVA 4YY3C 2QL8A 2E8FA 3J80D 1I94C 2F4VC 1IBMC 4DR4C 4LF4C 4DV3C 2ASBA 1N32C 3GKUA 4LF8C 1NYEA 3AF5A 4DR1C 4JI2C 4DCSA 4LFAC 4DCUA 1EGAA 1WF3A 1USPA 1VLAA 3IEVA 4B3TC 2OPLB 3LUSA 4GKJC 2XR1A 2PT7G 4JI8C 1N36C 1UKKA 2EGTA 1ML8A 4JI0C 4JI4C 2HJGA 4OX9C 4X62C 2UXBC 4LFBC 4DUYC 2BJOA 4JYAC 1USPB 1JOSA 2UUCC 4JI1C 4DUZC 4DR5C 1HH2P 1PA4A 4DCTA 1XMQC 2VQFC 4NXMC 4KHPC 1J5EC 4JI7C 3IEUA
chains in the Genus database with same CATH superfamily
4RMNA 5LMUC 4GKKC 4L2ZA 2MCQA 4DV7C 4LF6C 1QWIA 4DR7C 1M6XA 4DV6C 3JAMD 5A19A 4KTTA 2PN2A 3A25A 2DYJA 3O2EA 3EQ6A 4JM1A 4FTFA 4WS9A 2ZM6C 1PG4A 2UXDC 1IBKC 2ONFA 3A9VA 4NXNC 4I9FA 4DV0C 1N34C 4K0KC 3NYQA 4MH4A 1O90A 2YCBA 1MXBA 3NYRA 3I07A 1L2FA 1RG9A 4PROC 4OYCA 5E7QA 4NOZA 3EERA 5KEIA 1FLOA 5KYVA 3DHVA 1XNQC 4JI5C 1K0RA 4D56A 1WCJA 2P2JA 5BR8C 2YX1A 5BSUA 2D28C 4DR2C 4DV1C 2CU6A 3CJEA 2BH1X 2QVZX 1HNWC 4JI6C 1XS3A 2CY1A 3UZ0A 2E8CA 3LAXA 4DR6C 1AMUA 3CQ1A 2E8FA 1I94C 4GXRA 5BSTA 4LF4C 4DV3C 1N32C 4NDNA 4ZLPA 4JI2C 2P2BA 2Y27A 1USPA 2YWCA 2OPLB 4ODJA 2M5OA 3UX3A 4I9GA 2EGTA 4JI0C 1VEHA 2HJGA 4BC9A 4X62C 2UXBC 3TR3A 1JOSA 1QM4A 5H9UA 2Y4NA 4D4IA 4KHPC 1J5EC 4JI7C 1FUGA 3N54B 3SO4A 2D1TA 1N2FA 5JRHA 2WP0C 2E5LC 2QW0X 4RVOA 2JMPA 4B3RC 3R9WA 3K6RA 4DV4C 3VNQA 3B7WA 1MDFA 3T1HC 5LMNC 1LQLA 4GS5A 5BUQA 1P4EC 5IWAC 2D1SA 5BSRA 3R9XA 3NI2A 2M5HA 4B3MC 3TUFA 4LE5A 4ISBA 5IT9D 2VZEA 3FM7A 1MXAA 4JI3C 2AYAA 2KZ0A 5DV9A 4BSZA 4DR3C 1BA3A 2WD9A 2ZTBA 4L7IA 2E7GA 2CXCA 3PROC 2OO4A 2DPLA 5LCIA 3A9UA 3VNSA 3J80D 2F4VC 4K0BA 4IZ6A 2ASBA 4IR7A 4DCSA 4DCUA 3GR0A 3TDEA 3IEVA 2D1RA 3LUSA 1MD9A 4JI8C 1N36C 1ML8A 4PUIA 3A26A 5BSVA 2MMAB 1XRBA 3AY0A 3PBKA 2PG1E 1M6XC 1P7LA 1XMQC 4G1IA 2JNVA 2VQFC 1XRAA 4NXMC 3G7SA 3UEBA 1GPMA 1HR0C 2E8EA 3A4IA 1IBLC 1RY2A 1V60A 3CW9A 2QVYX 5A1GA 2VQEC 3PESA 3ETCA 1NY8A 4G37A 1WH9A 1FJGC 2ZZMA 4X66C 2UUAC 1ZB8A 3N2QA 5IFIA 3I08A 3VNRA 1V26A 2Z51A 4R1LA 3E7XA 4L4QA 1HNXC 2P2QA 1MKYA 2ZZNA 5A1IA 4PHTA 4KTVA 2QVXX 3AF6A 1TH5A 3LGXA 4DV5C 4X64C 3J81D 4MTNA 1UWDA 1O9TA 1YJ7A 3LNOA 1XNRC 3L8CA 1MDBA 5CZXA 3IMLA 3DAYA 4R1MA 3GPCA 4XX2A 4RM3A 2P2MA 5K85A 2MM9A 1O92A 4X65C 5A2QD 1N33C 4PUHA 4RM2A 2UU9C 3E7WA 4AQYC 3H2TA 5BUSA 2PROA 1XMOC 2OPLA 3RV2A 4YY3C 1PG3A 1ULTA 4WV3A 3GKUA 3C5EA 1LCIA 3AF5A 2P02A 4HPVA 3CQ3A 2PT7G 2VSQA 1UKKA 5CZVA 4D4GA 4JI4C 3L95X 4RVNA 4DUYC 2BJOA 1MXCA 3IPLA 1USPB 3S82A 4JI1C 5ADZA 1V25A 4RLQA 4DUZC 4ZJZA 5T8SA 1PA4A 4DCTA 2V7BA 4R0MA 4LF7C 2KDNA 1ZB9A 1XRCA 3NPDA 1T5DX 4LFCC 4FUTA 5T8TA 4EATA 4DG9A 3DLPX 3KXWA 3R44A 3T1YC 4G36A 2UUBC 5AE3A 4RLFA 1KKGA 4BBYA 2D1QA 3LNVA 1IB8A 2KZFA 1HNZC 4JV5C 1XDXA 4DV2C 2E0GA 5KYTA 4LF9C 3ETOA 4DG8A 4YHHC 5AE1A 1P4EA 2UXCC 2YWBA 4LF5C 3GR1A 4FUQA 5GTDA 4U5YD 2P20A 1XHJA 3UOWA 3J7AD 4BCAA 2HHHC 5AE2A 4B3SC 2D27A 4PUGA 2D7VA 5FLXD 1T5HX 2ATWA 3FCEA 4BC7A 3RG2A 3OTOC 3UX2A 5BSWA 1PU1A 4DCVA 2QL8A 3CW8X 1IBMC 4DR4C 5K8FA 2DHMA 4LF8C 4PZPA 4TPSB 1NYEA 4DR1C 4LFAC 1EGAA 1WF3A 1VLAA 4D57A 4B3TC 3FCCA 4GKJC 2XR1A 5BURA 4OXIA 1O93A 4OX9C 2P2FA 2Y4OA 3TQIA 5BSMA 4LFBC 4JYAC 1YGTA 2OBVA 4GXQA 2UUCC 2NCLA 4DR5C 1HH2P 3CQ2A 3IEUA
chains in the Genus database with same CATH topology
4RMNA 5LMUC 4GKKC 4L2ZA 4DV7C 4LF6C 1QWIA 4DR7C 4DV6C 3JAMD 5A19A 4KTTA 2PN2A 2DYJA 3EQ6A 4JM1A 4FTFA 4WS9A 2ZM6C 1PG4A 2UXDC 1IBKC 2ONFA 3A9VA 4NXNC 4I9FA 4DV0C 1N34C 4K0KC 3NYQA 4MH4A 1O90A 2YCBA 1MXBA 3NYRA 3I07A 1L2FA 1RG9A 4PROC 4OYCA 5E7QA 4NOZA 3EERA 5KEIA 5KYVA 3DHVA 1XNQC 4JI5C 1K0RA 4D56A 2P2JA 5BR8C 5BSUA 2D28C 4DR2C 4DV1C 3CJEA 2BH1X 2QVZX 1HNWC 4JI6C 2CY1A 3UZ0A 2E8CA 3LAXA 4DR6C 1AMUA 2E8FA 1I94C 4GXRA 5BSTA 4LF4C 4DV3C 1N32C 4NDNA 4ZLPA 4JI2C 2P2BA 2Y27A 1USPA 2YWCA 2OPLB 4ODJA 4I9GA 2EGTA 4JI0C 2HJGA 4BC9A 4X62C 2UXBC 1JOSA 1QM4A 5H9UA 2Y4NA 4D4IA 4KHPC 1J5EC 4JI7C 1FUGA 3N54B 3SO4A 2D1TA 1N2FA 5JRHA 2WP0C 2E5LC 2QW0X 4RVOA 2JMPA 4B3RC 3R9WA 4DV4C 3VNQA 3B7WA 1MDFA 3T1HC 5LMNC 1LQLA 4GS5A 5BUQA 5IWAC 2D1SA 5BSRA 3R9XA 3NI2A 4B3MC 3TUFA 4LE5A 4ISBA 5IT9D 2VZEA 1MXAA 4JI3C 2AYAA 5DV9A 4BSZA 4DR3C 1BA3A 2WD9A 4L7IA 2E7GA 2CXCA 3PROC 2OO4A 2DPLA 3VNSA 3A9UA 3J80D 2F4VC 4K0BA 4IZ6A 2ASBA 4IR7A 4DCSA 4DCUA 3GR0A 3TDEA 3IEVA 2D1RA 3LUSA 1MD9A 4JI8C 1N36C 1ML8A 5BSVA 1XRBA 3PBKA 1P7LA 1XMQC 4G1IA 2VQFC 1XRAA 4NXMC 3G7SA 1GPMA 1HR0C 2E8EA 3A4IA 1IBLC 1RY2A 3CW9A 2QVYX 5A1GA 2VQEC 3PESA 3ETCA 4G37A 1WH9A 1FJGC 4X66C 2UUAC 1ZB8A 3N2QA 5IFIA 3I08A 3VNRA 1V26A 4R1LA 3E7XA 4L4QA 1HNXC 2P2QA 1MKYA 5A1IA 4PHTA 4KTVA 2QVXX 3AF6A 3LGXA 4DV5C 4X64C 3J81D 4MTNA 1O9TA 1YJ7A 1XNRC 3L8CA 1MDBA 5CZXA 3IMLA 3DAYA 4R1MA 3GPCA 4XX2A 4RM3A 2P2MA 5K85A 1O92A 4X65C 5A2QD 1N33C 4RM2A 2UU9C 3E7WA 4AQYC 3H2TA 5BUSA 2PROA 1XMOC 2OPLA 3RV2A 4YY3C 1PG3A 1ULTA 4WV3A 3GKUA 3C5EA 1LCIA 3AF5A 2P02A 4HPVA 2PT7G 2VSQA 1UKKA 5CZVA 4D4GA 4JI4C 3L95X 4RVNA 4DUYC 2BJOA 1MXCA 3IPLA 1USPB 3S82A 4JI1C 5ADZA 1V25A 4RLQA 4DUZC 4ZJZA 5T8SA 1PA4A 4DCTA 2V7BA 4R0MA 4LF7C 1ZB9A 1XRCA 3NPDA 1T5DX 4LFCC 4FUTA 5T8TA 4EATA 4DG9A 3DLPX 3KXWA 3R44A 3T1YC 4G36A 2UUBC 5AE3A 4RLFA 1KKGA 4BBYA 2D1QA 3LNVA 2KZFA 1HNZC 4JV5C 4DV2C 2E0GA 5KYTA 4LF9C 3ETOA 4DG8A 4YHHC 5AE1A 2UXCC 2YWBA 4LF5C 3GR1A 4FUQA 5GTDA 4U5YD 2P20A 3UOWA 3J7AD 4BCAA 2HHHC 5AE2A 4B3SC 2D27A 2D7VA 5FLXD 1T5HX 2ATWA 3FCEA 4BC7A 3RG2A 3OTOC 5BSWA 4DCVA 2QL8A 3CW8X 1IBMC 4DR4C 5K8FA 4LF8C 4PZPA 4TPSB 1NYEA 4DR1C 4LFAC 1EGAA 1WF3A 1VLAA 4D57A 4B3TC 3FCCA 4GKJC 2XR1A 5BURA 4OXIA 1O93A 4OX9C 2P2FA 2Y4OA 3TQIA 5BSMA 4LFBC 4JYAC 2OBVA 4GXQA 2UUCC 4DR5C 1HH2P 3IEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 C;  5LMU C;  4GKK C;  4DV7 C;  4LF6 C;  1QWI A;  4DR7 C;  1HR0 C;  2E8E A;  1ZB9 A;  1IBL C;  4DV6 C;  3JAM D;  1N2F A;  4LFC C;  2PN2 A;  2DYJ A;  2E5L C;  2VQE C;  1WH9 A;  2ZM6 C;  2JMP A;  1FJG C;  4B3R C;  2UXD C;  1IBK C;  3T1Y C;  3R9W A;  2ONF A;  4NXN C;  4DV0 C;  1N34 C;  2UUB C;  4K0K C;  4MH4 A;  2YCB A;  4DV4 C;  4X66 C;  2UUA C;  1ZB8 A;  1KKG A;  3I07 A;  1L2F A;  4NOZ A;  3T1H C;  3EER A;  1LQL A;  5LMN C;  1HNX C;  2KZF A;  5IWA C;  1HNZ C;  4JV5 C;  1MKY A;  3R9X A;  4DV2 C;  4LF9 C;  1XNQ C;  4YHH C;  4B3M C;  4JI5 C;  1K0R A;  3AF6 A;  2UXC C;  4DV5 C;  4X64 C;  3J81 D;  4LF5 C;  4MTN A;  5BR8 C;  1XNR C;  5IT9 D;  4DR2 C;  4DV1 C;  3J7A D;  3CJE A;  4JI3 C;  2HHH C;  4B3S C;  4XX2 A;  2D7V A;  1HNW C;  4BSZ A;  5FLX D;  5A2Q D;  4X65 C;  2CY1 A;  4JI6 C;  1N33 C;  2ATW A;  4DR3 C;  2E8C A;  2UU9 C;  2E7G A;  3OTO C;  4AQY C;  2CXC A;  1XMO C;  4DR6 C;  2OPL A;  4DCV A;  4YY3 C;  2QL8 A;  2E8F A;  3J80 D;  1I94 C;  2F4V C;  1IBM C;  4DR4 C;  4LF4 C;  4DV3 C;  2ASB A;  1N32 C;  3GKU A;  4LF8 C;  1NYE A;  3AF5 A;  4DR1 C;  4JI2 C;  4DCS A;  4LFA C;  4DCU A;  1EGA A;  1WF3 A;  1USP A;  1VLA A;  3IEV A;  4B3T C;  2OPL B;  3LUS A;  4GKJ C;  2XR1 A;  2PT7 G;  4JI8 C;  1N36 C;  1UKK A;  2EGT A;  1ML8 A;  4JI0 C;  4JI4 C;  2HJG A;  4OX9 C;  4X62 C;  2UXB C;  4LFB C;  4DUY C;  2BJO A;  4JYA C;  1USP B;  1JOS A;  2UUC C;  4JI1 C;  4DUZ C;  4DR5 C;  1HH2 P;  1PA4 A;  4DCT A;  1XMQ C;  2VQF C;  4NXM C;  4KHP C;  1J5E C;  4JI7 C;  3IEU A; 
#chains in the Genus database with same CATH topology
 4RMN A;  5LMU C;  4GKK C;  4L2Z A;  2MCQ A;  4DV7 C;  4LF6 C;  1QWI A;  4DR7 C;  1M6X A;  4DV6 C;  3JAM D;  5A19 A;  4KTT A;  2PN2 A;  3A25 A;  2DYJ A;  3O2E A;  3EQ6 A;  4JM1 A;  4FTF A;  4WS9 A;  2ZM6 C;  1PG4 A;  2UXD C;  1IBK C;  2ONF A;  3A9V A;  4NXN C;  4I9F A;  4DV0 C;  1N34 C;  4K0K C;  3NYQ A;  4MH4 A;  1O90 A;  2YCB A;  1MXB A;  3NYR A;  3I07 A;  1L2F A;  1RG9 A;  4PRO C;  4OYC A;  5E7Q A;  4NOZ A;  3EER A;  5KEI A;  1FLO A;  5KYV A;  3DHV A;  1XNQ C;  4JI5 C;  1K0R A;  4D56 A;  1WCJ A;  2P2J A;  5BR8 C;  2YX1 A;  5BSU A;  2D28 C;  4DR2 C;  4DV1 C;  2CU6 A;  3CJE A;  2BH1 X;  2QVZ X;  1HNW C;  4JI6 C;  1XS3 A;  2CY1 A;  3UZ0 A;  2E8C A;  3LAX A;  4DR6 C;  1AMU A;  3CQ1 A;  2E8F A;  1I94 C;  4GXR A;  5BST A;  4LF4 C;  4DV3 C;  1N32 C;  4NDN A;  4ZLP A;  4JI2 C;  2P2B A;  2Y27 A;  1USP A;  2YWC A;  2OPL B;  4ODJ A;  2M5O A;  3UX3 A;  4I9G A;  2EGT A;  4JI0 C;  1VEH A;  2HJG A;  4BC9 A;  4X62 C;  2UXB C;  3TR3 A;  1JOS A;  1QM4 A;  5H9U A;  2Y4N A;  4D4I A;  4KHP C;  1J5E C;  4JI7 C;  1FUG A;  3N54 B;  3SO4 A;  2D1T A;  1N2F A;  5JRH A;  2WP0 C;  2E5L C;  2QW0 X;  4RVO A;  2JMP A;  4B3R C;  3R9W A;  3K6R A;  4DV4 C;  3VNQ A;  3B7W A;  1MDF A;  3T1H C;  5LMN C;  1LQL A;  4GS5 A;  5BUQ A;  1P4E C;  5IWA C;  2D1S A;  5BSR A;  3R9X A;  3NI2 A;  2M5H A;  4B3M C;  3TUF A;  4LE5 A;  4ISB A;  5IT9 D;  2VZE A;  3FM7 A;  1MXA A;  4JI3 C;  2AYA A;  2KZ0 A;  5DV9 A;  4BSZ A;  4DR3 C;  1BA3 A;  2WD9 A;  2ZTB A;  4L7I A;  2E7G A;  2CXC A;  3PRO C;  2OO4 A;  2DPL A;  5LCI A;  3A9U A;  3VNS A;  3J80 D;  2F4V C;  4K0B A;  4IZ6 A;  2ASB A;  4IR7 A;  4DCS A;  4DCU A;  3GR0 A;  3TDE A;  3IEV A;  2D1R A;  3LUS A;  1MD9 A;  4JI8 C;  1N36 C;  1ML8 A;  4PUI A;  3A26 A;  5BSV A;  2MMA B;  1XRB A;  3AY0 A;  3PBK A;  2PG1 E;  1M6X C;  1P7L A;  1XMQ C;  4G1I A;  2JNV A;  2VQF C;  1XRA A;  4NXM C;  3G7S A;  3UEB A;  1GPM A;  1HR0 C;  2E8E A;  3A4I A;  1IBL C;  1RY2 A;  1V60 A;  3CW9 A;  2QVY X;  5A1G A;  2VQE C;  3PES A;  3ETC A;  1NY8 A;  4G37 A;  1WH9 A;  1FJG C;  2ZZM A;  4X66 C;  2UUA C;  1ZB8 A;  3N2Q A;  5IFI A;  3I08 A;  3VNR A;  1V26 A;  2Z51 A;  4R1L A;  3E7X A;  4L4Q A;  1HNX C;  2P2Q A;  1MKY A;  2ZZN A;  5A1I A;  4PHT A;  4KTV A;  2QVX X;  3AF6 A;  1TH5 A;  3LGX A;  4DV5 C;  4X64 C;  3J81 D;  4MTN A;  1UWD A;  1O9T A;  1YJ7 A;  3LNO A;  1XNR C;  3L8C A;  1MDB A;  5CZX A;  3IML A;  3DAY A;  4R1M A;  3GPC A;  4XX2 A;  4RM3 A;  2P2M A;  5K85 A;  2MM9 A;  1O92 A;  4X65 C;  5A2Q D;  1N33 C;  4PUH A;  4RM2 A;  2UU9 C;  3E7W A;  4AQY C;  3H2T A;  5BUS A;  2PRO A;  1XMO C;  2OPL A;  3RV2 A;  4YY3 C;  1PG3 A;  1ULT A;  4WV3 A;  3GKU A;  3C5E A;  1LCI A;  3AF5 A;  2P02 A;  4HPV A;  3CQ3 A;  2PT7 G;  2VSQ A;  1UKK A;  5CZV A;  4D4G A;  4JI4 C;  3L95 X;  4RVN A;  4DUY C;  2BJO A;  1MXC A;  3IPL A;  1USP B;  3S82 A;  4JI1 C;  5ADZ A;  1V25 A;  4RLQ A;  4DUZ C;  4ZJZ A;  5T8S A;  1PA4 A;  4DCT A;  2V7B A;  4R0M A;  4LF7 C;  2KDN A;  1ZB9 A;  1XRC A;  3NPD A;  1T5D X;  4LFC C;  4FUT A;  5T8T A;  4EAT A;  4DG9 A;  3DLP X;  3KXW A;  3R44 A;  3T1Y C;  4G36 A;  2UUB C;  5AE3 A;  4RLF A;  1KKG A;  4BBY A;  2D1Q A;  3LNV A;  1IB8 A;  2KZF A;  1HNZ C;  4JV5 C;  1XDX A;  4DV2 C;  2E0G A;  5KYT A;  4LF9 C;  3ETO A;  4DG8 A;  4YHH C;  5AE1 A;  1P4E A;  2UXC C;  2YWB A;  4LF5 C;  3GR1 A;  4FUQ A;  5GTD A;  4U5Y D;  2P20 A;  1XHJ A;  3UOW A;  3J7A D;  4BCA A;  2HHH C;  5AE2 A;  4B3S C;  2D27 A;  4PUG A;  2D7V A;  5FLX D;  1T5H X;  2ATW A;  3FCE A;  4BC7 A;  3RG2 A;  3OTO C;  3UX2 A;  5BSW A;  1PU1 A;  4DCV A;  2QL8 A;  3CW8 X;  1IBM C;  4DR4 C;  5K8F A;  2DHM A;  4LF8 C;  4PZP A;  4TPS B;  1NYE A;  4DR1 C;  4LFA C;  1EGA A;  1WF3 A;  1VLA A;  4D57 A;  4B3T C;  3FCC A;  4GKJ C;  2XR1 A;  5BUR A;  4OXI A;  1O93 A;  4OX9 C;  2P2F A;  2Y4O A;  3TQI A;  5BSM A;  4LFB C;  4JYA C;  1YGT A;  2OBV A;  4GXQ A;  2UUC C;  2NCL A;  4DR5 C;  1HH2 P;  3CQ2 A;  3IEU A; 
#chains in the Genus database with same CATH homology
 4RMN A;  5LMU C;  4GKK C;  4L2Z A;  4DV7 C;  4LF6 C;  1QWI A;  4DR7 C;  4DV6 C;  3JAM D;  5A19 A;  4KTT A;  2PN2 A;  2DYJ A;  3EQ6 A;  4JM1 A;  4FTF A;  4WS9 A;  2ZM6 C;  1PG4 A;  2UXD C;  1IBK C;  2ONF A;  3A9V A;  4NXN C;  4I9F A;  4DV0 C;  1N34 C;  4K0K C;  3NYQ A;  4MH4 A;  1O90 A;  2YCB A;  1MXB A;  3NYR A;  3I07 A;  1L2F A;  1RG9 A;  4PRO C;  4OYC A;  5E7Q A;  4NOZ A;  3EER A;  5KEI A;  5KYV A;  3DHV A;  1XNQ C;  4JI5 C;  1K0R A;  4D56 A;  2P2J A;  5BR8 C;  5BSU A;  2D28 C;  4DR2 C;  4DV1 C;  3CJE A;  2BH1 X;  2QVZ X;  1HNW C;  4JI6 C;  2CY1 A;  3UZ0 A;  2E8C A;  3LAX A;  4DR6 C;  1AMU A;  2E8F A;  1I94 C;  4GXR A;  5BST A;  4LF4 C;  4DV3 C;  1N32 C;  4NDN A;  4ZLP A;  4JI2 C;  2P2B A;  2Y27 A;  1USP A;  2YWC A;  2OPL B;  4ODJ A;  4I9G A;  2EGT A;  4JI0 C;  2HJG A;  4BC9 A;  4X62 C;  2UXB C;  1JOS A;  1QM4 A;  5H9U A;  2Y4N A;  4D4I A;  4KHP C;  1J5E C;  4JI7 C;  1FUG A;  3N54 B;  3SO4 A;  2D1T A;  1N2F A;  5JRH A;  2WP0 C;  2E5L C;  2QW0 X;  4RVO A;  2JMP A;  4B3R C;  3R9W A;  4DV4 C;  3VNQ A;  3B7W A;  1MDF A;  3T1H C;  5LMN C;  1LQL A;  4GS5 A;  5BUQ A;  5IWA C;  2D1S A;  5BSR A;  3R9X A;  3NI2 A;  4B3M C;  3TUF A;  4LE5 A;  4ISB A;  5IT9 D;  2VZE A;  1MXA A;  4JI3 C;  2AYA A;  5DV9 A;  4BSZ A;  4DR3 C;  1BA3 A;  2WD9 A;  4L7I A;  2E7G A;  2CXC A;  3PRO C;  2OO4 A;  2DPL A;  3VNS A;  3A9U A;  3J80 D;  2F4V C;  4K0B A;  4IZ6 A;  2ASB A;  4IR7 A;  4DCS A;  4DCU A;  3GR0 A;  3TDE A;  3IEV A;  2D1R A;  3LUS A;  1MD9 A;  4JI8 C;  1N36 C;  1ML8 A;  5BSV A;  1XRB A;  3PBK A;  1P7L A;  1XMQ C;  4G1I A;  2VQF C;  1XRA A;  4NXM C;  3G7S A;  1GPM A;  1HR0 C;  2E8E A;  3A4I A;  1IBL C;  1RY2 A;  3CW9 A;  2QVY X;  5A1G A;  2VQE C;  3PES A;  3ETC A;  4G37 A;  1WH9 A;  1FJG C;  4X66 C;  2UUA C;  1ZB8 A;  3N2Q A;  5IFI A;  3I08 A;  3VNR A;  1V26 A;  4R1L A;  3E7X A;  4L4Q A;  1HNX C;  2P2Q A;  1MKY A;  5A1I A;  4PHT A;  4KTV A;  2QVX X;  3AF6 A;  3LGX A;  4DV5 C;  4X64 C;  3J81 D;  4MTN A;  1O9T A;  1YJ7 A;  1XNR C;  3L8C A;  1MDB A;  5CZX A;  3IML A;  3DAY A;  4R1M A;  3GPC A;  4XX2 A;  4RM3 A;  2P2M A;  5K85 A;  1O92 A;  4X65 C;  5A2Q D;  1N33 C;  4RM2 A;  2UU9 C;  3E7W A;  4AQY C;  3H2T A;  5BUS A;  2PRO A;  1XMO C;  2OPL A;  3RV2 A;  4YY3 C;  1PG3 A;  1ULT A;  4WV3 A;  3GKU A;  3C5E A;  1LCI A;  3AF5 A;  2P02 A;  4HPV A;  2PT7 G;  2VSQ A;  1UKK A;  5CZV A;  4D4G A;  4JI4 C;  3L95 X;  4RVN A;  4DUY C;  2BJO A;  1MXC A;  3IPL A;  1USP B;  3S82 A;  4JI1 C;  5ADZ A;  1V25 A;  4RLQ A;  4DUZ C;  4ZJZ A;  5T8S A;  1PA4 A;  4DCT A;  2V7B A;  4R0M A;  4LF7 C;  1ZB9 A;  1XRC A;  3NPD A;  1T5D X;  4LFC C;  4FUT A;  5T8T A;  4EAT A;  4DG9 A;  3DLP X;  3KXW A;  3R44 A;  3T1Y C;  4G36 A;  2UUB C;  5AE3 A;  4RLF A;  1KKG A;  4BBY A;  2D1Q A;  3LNV A;  2KZF A;  1HNZ C;  4JV5 C;  4DV2 C;  2E0G A;  5KYT A;  4LF9 C;  3ETO A;  4DG8 A;  4YHH C;  5AE1 A;  2UXC C;  2YWB A;  4LF5 C;  3GR1 A;  4FUQ A;  5GTD A;  4U5Y D;  2P20 A;  3UOW A;  3J7A D;  4BCA A;  2HHH C;  5AE2 A;  4B3S C;  2D27 A;  2D7V A;  5FLX D;  1T5H X;  2ATW A;  3FCE A;  4BC7 A;  3RG2 A;  3OTO C;  5BSW A;  4DCV A;  2QL8 A;  3CW8 X;  1IBM C;  4DR4 C;  5K8F A;  4LF8 C;  4PZP A;  4TPS B;  1NYE A;  4DR1 C;  4LFA C;  1EGA A;  1WF3 A;  1VLA A;  4D57 A;  4B3T C;  3FCC A;  4GKJ C;  2XR1 A;  5BUR A;  4OXI A;  1O93 A;  4OX9 C;  2P2F A;  2Y4O A;  3TQI A;  5BSM A;  4LFB C;  4JYA C;  2OBV A;  4GXQ A;  2UUC C;  4DR5 C;  1HH2 P;  3IEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...