5BR8C

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5br8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5br8C02
2BJOA 1ZB9A 4JYAC 1XNQC 4YHHC 4GKKC 3R9XA 2UXCC 2F4VC 1UKKA 3GKUA 4LFCC 3T1HC 4NXMC 1N2FA 2ASBA 4JI6C 1IBLC 4DUYC 1ML8A 3OTOC 1FJGC 2CXCA 3CJEA 3IEUA 5A2QD 4JI2C 4B3SC 3J80D 4DV6C 3R9WA 2ONFA 2UU9C 4DV1C 4X62C 2OPLA 1J5EC 2HJGA 4JI8C 2VQFC 2ZM6C 4DR1C 1IBMC 4JI3C 2XR1A 1USPA 4DR6C 1XNRC 1HNWC 1WF3A 4JI5C 1KKGA 4NOZA 4DV3C 5IT9D 3AF5A 3J7AD 4JI1C 1WH9A 2ATWA 4KHPC 1HNZC 4MH4A 2KZFA 4LFBC 1EGAA 4JI7C 4LF9C 4JV5C 1HH2P 2E8CA 1NYEA 4DV7C 3J81D 2DYJA 1HR0C 4MTNA 4DR3C 1N33C 4DR4C 4AQYC 1HNXC 1MKYA 3EERA 2UUAC 1ZB8A 4DR2C 2UXBC 2D7VA 4DR5C 2CY1A 2E8EA 1N32C 4LFAC 4GKJC 5BR8C 3LUSA 3I07A 4DV4C 4DV2C 2JMPA 2E7GA 4LF4C 1K0RA 2PT7G 2EGTA 1USPB 1JOSA 3JAMD 4DV5C 1L2FA 1N34C 4OX9C 4DCSA 4DCUA 4BSZA 1XMQC 2VQEC 2UUBC 5LMNC 2PN2A 1I94C 1XMOC 3T1YC 2YCBA 5FLXD 3IEVA 4DR7C 4X66C 1PA4A 4X64C 4LF8C 4JI4C 4DCVA 1QWIA 1VLAA 2E5LC 1LQLA 4B3MC 5IWAC 4DUZC 2E8FA 2QL8A 4XX2A 3AF6A 1IBKC 4LF6C 5LMUC 4B3TC 4B3RC 4YY3C 4X65C 4DCTA 4DV0C 2UXDC 1N36C 4JI0C 4LF7C 4NXNC 2UUCC 4K0KC 4LF5C 2HHHC 2OPLB
chains in the Genus database with same CATH superfamily
2BJOA 5KYTA 4JYAC 1YJ7A 5BSUA 4GKKC 2YWBA 2UXCC 3GKUA 3LNVA 4R1MA 1O93A 2YWCA 2ASBA 2CXCA 5A2QD 3IEUA 4JI2C 4WV3A 4DV6C 5K85A 5BUQA 3R9WA 2P2QA 1GPMA 2HJGA 4L4QA 5IFIA 3G7SA 2XR1A 3VNRA 4DR6C 1KKGA 5A19A 1WH9A 4RVNA 5AE1A 4ZLPA 4FUQA 1HH2P 3J81D 2P02A 1HNXC 4G36A 3CQ1A 3LAXA 3EERA 2PROA 4DR2C 2UXBC 2E8EA 2ZZMA 3RV2A 5E7QA 5LCIA 2D1QA 3L8CA 3SO4A 5GTDA 4DV2C 2JMPA 5AE3A 4HPVA 3GPCA 2VZEA 3LGXA 3B7WA 4D4IA 2PT7G 1JOSA 1RG9A 1N34C 4BSZA 2Z51A 1TH5A 3NYQA 2PN2A 5FLXD 5T8SA 4DG9A 2V7BA 4B3MC 2E8FA 3E7WA 4D57A 4XX2A 4LF6C 5LMUC 4B3TC 4B3RC 4YY3C 4DV0C 3UX3A 4NXNC 5AE2A 2HHHC 3UEBA 3CW8X 4DG8A 3O2EA 1MXAA 3R44A 5H9UA 2D1TA 1UKKA 4PHTA 3T1HC 4NXMC 2ZZNA 4IZ6A 1V60A 2CU6A 1AMUA 1N2FA 4JI6C 4DUYC 1ML8A 4RLQA 4PROC 3VNQA 4R1LA 3CJEA 4GXRA 3GR0A 3AY0A 1XRCA 4U5YD 4DV1C 2QVXX 2OPLA 4JI8C 1J5EC 2P20A 1IBMC 4OYCA 4JI3C 1HNWC 4NOZA 2D1SA 2Y4NA 2ATWA 4KTTA 3CW9A 2KZFA 4LFBC 4JI7C 2E8CA 1NYEA 1NY8A 5CZVA 2DYJA 1HR0C 4MTNA 2UUAC 2D7VA 4I9FA 4DR5C 4TPSB 2CY1A 1QM4A 1V26A 1N32C 2JNVA 2OBVA 3I08A 5BR8C 4DV4C 3PESA 5KEIA 1LCIA 4RM3A 4ISBA 1M6XC 4LF4C 5KYVA 5BSVA 2QVZX 1XRAA 4G37A 2EGTA 4WS9A 1XHJA 1P4EC 3A9UA 4BCAA 2VQEC 3T1YC 1O90A 2YCBA 3L95X 4PUGA 4DR7C 4GS5A 2P2MA 2D1RA 1PA4A 4FUTA 4X64C 3NPDA 1T5DX 4FTFA 4K0BA 2E5LC 1LQLA 4DUZC 1XS3A 4G1IA 2E0GA 3UX2A 1YGTA 2MMAB 4DCTA 3DHVA 2Y27A 1ZB9A 5BSTA 1XNQC 1MDFA 5CZXA 4YHHC 4RMNA 2VSQA 2F4VC 4GXQA 5DV9A 4LFCC 1M6XA 3EQ6A 3OTOC 1FJGC 1V25A 4BBYA 1IB8A 5T8TA 2ONFA 4L2ZA 1MD9A 2QW0X 2UU9C 3PBKA 4X62C 5K8FA 2P2FA 3FCEA 2VQFC 2ZM6C 4DR1C 1XDXA 2OO4A 2DPLA 1XNRC 1WF3A 2ZTBA 3FM7A 5IT9D 3N54B 3J7AD 4KHPC 3TQIA 2PG1E 1EGAA 4LF9C 4JV5C 2WP0C 4AQYC 3ETCA 3RG2A 4EATA 4JM1A 4BC7A 2MM9A 2E7GA 3H2TA 3TUFA 3JAMD 1L2FA 4DCUA 5BUSA 3N2QA 3IMLA 3KXWA 2UUBC 1RY2A 4BC9A 5LMNC 4I9GA 1PU1A 1I94C 5BSMA 3IEVA 4X66C 2Y4OA 4LF8C 2M5HA 1VLAA 5IWAC 1O92A 2BH1X 3DAYA 3AF6A 1MDBA 1XRBA 4OXIA 4X65C 2M5OA 2UXDC 3S82A 4JI0C 1N36C 4LF7C 4K0KC 3C5EA 2OPLB 3IPLA 3TDEA 5BSWA 3R9XA 3CQ2A 1P4EA 1ULTA 4D4GA 1WCJA 4ODJA 1IBLC 3NI2A 1FUGA 5JRHA 4IR7A 4B3SC 4R0MA 3TR3A 3J80D 2KZ0A 1T5HX 3PROC 2KDNA 1P7LA 1PG3A 1USPA 4JI5C 5A1GA 3GR1A 4DV3C 3AF5A 4JI1C 4KTVA 1HNZC 4RM2A 4MH4A 5BURA 4DV7C 2MCQA 4D56A 2P2JA 4DR3C 1N33C 4DR4C 2YX1A 2NCLA 3E7XA 2D28C 1MKYA 4RVOA 1ZB8A 4RLFA 1BA3A 5A1IA 3A25A 1MXCA 2DHMA 4LFAC 4GKJC 1PG4A 4PUHA 3LUSA 3I07A 2WD9A 2AYAA 4NDNA 3VNSA 1K0RA 3A4IA 5ADZA 1USPB 4DV5C 4PZPA 4OX9C 2D27A 4DCSA 3DLPX 1XMQC 4LE5A 4ZJZA 3FCCA 3A26A 1XMOC 3K6RA 3NYRA 3A9VA 1FLOA 3CQ3A 3ETOA 4JI4C 4DCVA 1QWIA 5BSRA 4L7IA 2QL8A 1IBKC 1MXBA 3UZ0A 2P2BA 1VEHA 4PUIA 1UWDA 3LNOA 1O9TA 3UOWA 2UUCC 4LF5C 2QVYX
chains in the Genus database with same CATH topology
2BJOA 5KYTA 4JYAC 1YJ7A 5BSUA 4GKKC 2YWBA 2UXCC 3GKUA 3LNVA 4R1MA 1O93A 2YWCA 2ASBA 2CXCA 5A2QD 3IEUA 4JI2C 4WV3A 4DV6C 5K85A 5BUQA 3R9WA 2P2QA 1GPMA 2HJGA 4L4QA 5IFIA 3G7SA 2XR1A 3VNRA 4DR6C 1KKGA 5A19A 1WH9A 4RVNA 5AE1A 4ZLPA 4FUQA 1HH2P 3J81D 2P02A 1HNXC 4G36A 3LAXA 3EERA 2PROA 4DR2C 2UXBC 2E8EA 3RV2A 5E7QA 2D1QA 3L8CA 3SO4A 5GTDA 4DV2C 2JMPA 5AE3A 4HPVA 3GPCA 2VZEA 3LGXA 3B7WA 4D4IA 2PT7G 1JOSA 1RG9A 1N34C 4BSZA 3NYQA 2PN2A 5FLXD 5T8SA 4DG9A 2V7BA 4B3MC 2E8FA 3E7WA 4D57A 4XX2A 4LF6C 5LMUC 4B3TC 4B3RC 4YY3C 4DV0C 4NXNC 5AE2A 2HHHC 3CW8X 4DG8A 1MXAA 3R44A 5H9UA 2D1TA 1UKKA 4PHTA 3T1HC 4NXMC 4IZ6A 1AMUA 1N2FA 4JI6C 4DUYC 1ML8A 4RLQA 4PROC 3VNQA 4R1LA 3CJEA 4GXRA 3GR0A 1XRCA 4U5YD 4DV1C 2QVXX 2OPLA 4JI8C 1J5EC 2P20A 1IBMC 4OYCA 4JI3C 1HNWC 4NOZA 2D1SA 2Y4NA 2ATWA 4KTTA 3CW9A 2KZFA 4LFBC 4JI7C 2E8CA 1NYEA 5CZVA 2DYJA 1HR0C 4MTNA 2UUAC 2D7VA 4I9FA 4DR5C 4TPSB 2CY1A 1QM4A 1V26A 1N32C 2OBVA 3I08A 5BR8C 4DV4C 3PESA 5KEIA 1LCIA 4RM3A 4ISBA 4LF4C 5KYVA 5BSVA 2QVZX 1XRAA 4G37A 2EGTA 4WS9A 3A9UA 4BCAA 2VQEC 3T1YC 1O90A 2YCBA 3L95X 4DR7C 4GS5A 2P2MA 2D1RA 1PA4A 4FUTA 4X64C 3NPDA 1T5DX 4FTFA 4K0BA 2E5LC 1LQLA 4DUZC 4G1IA 2E0GA 4DCTA 3DHVA 2Y27A 1ZB9A 5BSTA 1XNQC 1MDFA 5CZXA 4YHHC 4RMNA 2VSQA 2F4VC 4GXQA 5DV9A 4LFCC 3EQ6A 3OTOC 1FJGC 1V25A 4BBYA 5T8TA 2ONFA 4L2ZA 1MD9A 2QW0X 2UU9C 3PBKA 4X62C 5K8FA 2P2FA 3FCEA 2VQFC 2ZM6C 4DR1C 2OO4A 2DPLA 1XNRC 1WF3A 5IT9D 3N54B 3J7AD 4KHPC 3TQIA 1EGAA 4LF9C 4JV5C 2WP0C 4AQYC 3ETCA 3RG2A 4EATA 4JM1A 4BC7A 2E7GA 3H2TA 3TUFA 3JAMD 1L2FA 4DCUA 5BUSA 3N2QA 3IMLA 3KXWA 2UUBC 1RY2A 4BC9A 5LMNC 4I9GA 1I94C 5BSMA 3IEVA 4X66C 2Y4OA 4LF8C 1VLAA 5IWAC 1O92A 2BH1X 3DAYA 3AF6A 1MDBA 1XRBA 4OXIA 4X65C 2UXDC 3S82A 4JI0C 1N36C 4LF7C 4K0KC 3C5EA 2OPLB 3IPLA 3TDEA 5BSWA 3R9XA 1ULTA 4D4GA 4ODJA 1IBLC 3NI2A 1FUGA 5JRHA 4IR7A 4B3SC 4R0MA 3J80D 1T5HX 3PROC 1P7LA 1PG3A 1USPA 4JI5C 5A1GA 3GR1A 4DV3C 3AF5A 4JI1C 4KTVA 1HNZC 4RM2A 4MH4A 5BURA 4DV7C 4D56A 2P2JA 4DR3C 1N33C 4DR4C 3E7XA 2D28C 1MKYA 4RVOA 1ZB8A 4RLFA 1BA3A 5A1IA 1MXCA 4LFAC 4GKJC 1PG4A 3LUSA 3I07A 2WD9A 2AYAA 4NDNA 3VNSA 1K0RA 3A4IA 5ADZA 1USPB 4DV5C 4PZPA 4OX9C 2D27A 4DCSA 3DLPX 1XMQC 4LE5A 4ZJZA 3FCCA 1XMOC 3NYRA 3A9VA 3ETOA 4JI4C 4DCVA 1QWIA 5BSRA 4L7IA 2QL8A 1IBKC 1MXBA 3UZ0A 2P2BA 1O9TA 3UOWA 2UUCC 4LF5C 2QVYX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJO A;  1ZB9 A;  4JYA C;  1XNQ C;  4YHH C;  4GKK C;  3R9X A;  2UXC C;  2F4V C;  1UKK A;  3GKU A;  4LFC C;  3T1H C;  4NXM C;  1N2F A;  2ASB A;  4JI6 C;  1IBL C;  4DUY C;  1ML8 A;  3OTO C;  1FJG C;  2CXC A;  3CJE A;  3IEU A;  5A2Q D;  4JI2 C;  4B3S C;  3J80 D;  4DV6 C;  3R9W A;  2ONF A;  2UU9 C;  4DV1 C;  4X62 C;  2OPL A;  1J5E C;  2HJG A;  4JI8 C;  2VQF C;  2ZM6 C;  4DR1 C;  1IBM C;  4JI3 C;  2XR1 A;  1USP A;  4DR6 C;  1XNR C;  1HNW C;  1WF3 A;  4JI5 C;  1KKG A;  4NOZ A;  4DV3 C;  5IT9 D;  3AF5 A;  3J7A D;  4JI1 C;  1WH9 A;  2ATW A;  4KHP C;  1HNZ C;  4MH4 A;  2KZF A;  4LFB C;  1EGA A;  4JI7 C;  4LF9 C;  4JV5 C;  1HH2 P;  2E8C A;  1NYE A;  4DV7 C;  3J81 D;  2DYJ A;  1HR0 C;  4MTN A;  4DR3 C;  1N33 C;  4DR4 C;  4AQY C;  1HNX C;  1MKY A;  3EER A;  2UUA C;  1ZB8 A;  4DR2 C;  2UXB C;  2D7V A;  4DR5 C;  2CY1 A;  2E8E A;  1N32 C;  4LFA C;  4GKJ C;  5BR8 C;  3LUS A;  3I07 A;  4DV4 C;  4DV2 C;  2JMP A;  2E7G A;  4LF4 C;  1K0R A;  2PT7 G;  2EGT A;  1USP B;  1JOS A;  3JAM D;  4DV5 C;  1L2F A;  1N34 C;  4OX9 C;  4DCS A;  4DCU A;  4BSZ A;  1XMQ C;  2VQE C;  2UUB C;  5LMN C;  2PN2 A;  1I94 C;  1XMO C;  3T1Y C;  2YCB A;  5FLX D;  3IEV A;  4DR7 C;  4X66 C;  1PA4 A;  4X64 C;  4LF8 C;  4JI4 C;  4DCV A;  1QWI A;  1VLA A;  2E5L C;  1LQL A;  4B3M C;  5IWA C;  4DUZ C;  2E8F A;  2QL8 A;  4XX2 A;  3AF6 A;  1IBK C;  4LF6 C;  5LMU C;  4B3T C;  4B3R C;  4YY3 C;  4X65 C;  4DCT A;  4DV0 C;  2UXD C;  1N36 C;  4JI0 C;  4LF7 C;  4NXN C;  2UUC C;  4K0K C;  4LF5 C;  2HHH C;  2OPL B; 
#chains in the Genus database with same CATH topology
 2BJO A;  5KYT A;  4JYA C;  1YJ7 A;  5BSU A;  4GKK C;  2YWB A;  2UXC C;  3GKU A;  3LNV A;  4R1M A;  1O93 A;  2YWC A;  2ASB A;  2CXC A;  5A2Q D;  3IEU A;  4JI2 C;  4WV3 A;  4DV6 C;  5K85 A;  5BUQ A;  3R9W A;  2P2Q A;  1GPM A;  2HJG A;  4L4Q A;  5IFI A;  3G7S A;  2XR1 A;  3VNR A;  4DR6 C;  1KKG A;  5A19 A;  1WH9 A;  4RVN A;  5AE1 A;  4ZLP A;  4FUQ A;  1HH2 P;  3J81 D;  2P02 A;  1HNX C;  4G36 A;  3CQ1 A;  3LAX A;  3EER A;  2PRO A;  4DR2 C;  2UXB C;  2E8E A;  2ZZM A;  3RV2 A;  5E7Q A;  5LCI A;  2D1Q A;  3L8C A;  3SO4 A;  5GTD A;  4DV2 C;  2JMP A;  5AE3 A;  4HPV A;  3GPC A;  2VZE A;  3LGX A;  3B7W A;  4D4I A;  2PT7 G;  1JOS A;  1RG9 A;  1N34 C;  4BSZ A;  2Z51 A;  1TH5 A;  3NYQ A;  2PN2 A;  5FLX D;  5T8S A;  4DG9 A;  2V7B A;  4B3M C;  2E8F A;  3E7W A;  4D57 A;  4XX2 A;  4LF6 C;  5LMU C;  4B3T C;  4B3R C;  4YY3 C;  4DV0 C;  3UX3 A;  4NXN C;  5AE2 A;  2HHH C;  3UEB A;  3CW8 X;  4DG8 A;  3O2E A;  1MXA A;  3R44 A;  5H9U A;  2D1T A;  1UKK A;  4PHT A;  3T1H C;  4NXM C;  2ZZN A;  4IZ6 A;  1V60 A;  2CU6 A;  1AMU A;  1N2F A;  4JI6 C;  4DUY C;  1ML8 A;  4RLQ A;  4PRO C;  3VNQ A;  4R1L A;  3CJE A;  4GXR A;  3GR0 A;  3AY0 A;  1XRC A;  4U5Y D;  4DV1 C;  2QVX X;  2OPL A;  4JI8 C;  1J5E C;  2P20 A;  1IBM C;  4OYC A;  4JI3 C;  1HNW C;  4NOZ A;  2D1S A;  2Y4N A;  2ATW A;  4KTT A;  3CW9 A;  2KZF A;  4LFB C;  4JI7 C;  2E8C A;  1NYE A;  1NY8 A;  5CZV A;  2DYJ A;  1HR0 C;  4MTN A;  2UUA C;  2D7V A;  4I9F A;  4DR5 C;  4TPS B;  2CY1 A;  1QM4 A;  1V26 A;  1N32 C;  2JNV A;  2OBV A;  3I08 A;  5BR8 C;  4DV4 C;  3PES A;  5KEI A;  1LCI A;  4RM3 A;  4ISB A;  1M6X C;  4LF4 C;  5KYV A;  5BSV A;  2QVZ X;  1XRA A;  4G37 A;  2EGT A;  4WS9 A;  1XHJ A;  1P4E C;  3A9U A;  4BCA A;  2VQE C;  3T1Y C;  1O90 A;  2YCB A;  3L95 X;  4PUG A;  4DR7 C;  4GS5 A;  2P2M A;  2D1R A;  1PA4 A;  4FUT A;  4X64 C;  3NPD A;  1T5D X;  4FTF A;  4K0B A;  2E5L C;  1LQL A;  4DUZ C;  1XS3 A;  4G1I A;  2E0G A;  3UX2 A;  1YGT A;  2MMA B;  4DCT A;  3DHV A;  2Y27 A;  1ZB9 A;  5BST A;  1XNQ C;  1MDF A;  5CZX A;  4YHH C;  4RMN A;  2VSQ A;  2F4V C;  4GXQ A;  5DV9 A;  4LFC C;  1M6X A;  3EQ6 A;  3OTO C;  1FJG C;  1V25 A;  4BBY A;  1IB8 A;  5T8T A;  2ONF A;  4L2Z A;  1MD9 A;  2QW0 X;  2UU9 C;  3PBK A;  4X62 C;  5K8F A;  2P2F A;  3FCE A;  2VQF C;  2ZM6 C;  4DR1 C;  1XDX A;  2OO4 A;  2DPL A;  1XNR C;  1WF3 A;  2ZTB A;  3FM7 A;  5IT9 D;  3N54 B;  3J7A D;  4KHP C;  3TQI A;  2PG1 E;  1EGA A;  4LF9 C;  4JV5 C;  2WP0 C;  4AQY C;  3ETC A;  3RG2 A;  4EAT A;  4JM1 A;  4BC7 A;  2MM9 A;  2E7G A;  3H2T A;  3TUF A;  3JAM D;  1L2F A;  4DCU A;  5BUS A;  3N2Q A;  3IML A;  3KXW A;  2UUB C;  1RY2 A;  4BC9 A;  5LMN C;  4I9G A;  1PU1 A;  1I94 C;  5BSM A;  3IEV A;  4X66 C;  2Y4O A;  4LF8 C;  2M5H A;  1VLA A;  5IWA C;  1O92 A;  2BH1 X;  3DAY A;  3AF6 A;  1MDB A;  1XRB A;  4OXI A;  4X65 C;  2M5O A;  2UXD C;  3S82 A;  4JI0 C;  1N36 C;  4LF7 C;  4K0K C;  3C5E A;  2OPL B;  3IPL A;  3TDE A;  5BSW A;  3R9X A;  3CQ2 A;  1P4E A;  1ULT A;  4D4G A;  1WCJ A;  4ODJ A;  1IBL C;  3NI2 A;  1FUG A;  5JRH A;  4IR7 A;  4B3S C;  4R0M A;  3TR3 A;  3J80 D;  2KZ0 A;  1T5H X;  3PRO C;  2KDN A;  1P7L A;  1PG3 A;  1USP A;  4JI5 C;  5A1G A;  3GR1 A;  4DV3 C;  3AF5 A;  4JI1 C;  4KTV A;  1HNZ C;  4RM2 A;  4MH4 A;  5BUR A;  4DV7 C;  2MCQ A;  4D56 A;  2P2J A;  4DR3 C;  1N33 C;  4DR4 C;  2YX1 A;  2NCL A;  3E7X A;  2D28 C;  1MKY A;  4RVO A;  1ZB8 A;  4RLF A;  1BA3 A;  5A1I A;  3A25 A;  1MXC A;  2DHM A;  4LFA C;  4GKJ C;  1PG4 A;  4PUH A;  3LUS A;  3I07 A;  2WD9 A;  2AYA A;  4NDN A;  3VNS A;  1K0R A;  3A4I A;  5ADZ A;  1USP B;  4DV5 C;  4PZP A;  4OX9 C;  2D27 A;  4DCS A;  3DLP X;  1XMQ C;  4LE5 A;  4ZJZ A;  3FCC A;  3A26 A;  1XMO C;  3K6R A;  3NYR A;  3A9V A;  1FLO A;  3CQ3 A;  3ETO A;  4JI4 C;  4DCV A;  1QWI A;  5BSR A;  4L7I A;  2QL8 A;  1IBK C;  1MXB A;  3UZ0 A;  2P2B A;  1VEH A;  4PUI A;  1UWD A;  3LNO A;  1O9T A;  3UOW A;  2UUC C;  4LF5 C;  2QVY X; 
#chains in the Genus database with same CATH homology
 2BJO A;  5KYT A;  4JYA C;  1YJ7 A;  5BSU A;  4GKK C;  2YWB A;  2UXC C;  3GKU A;  3LNV A;  4R1M A;  1O93 A;  2YWC A;  2ASB A;  2CXC A;  5A2Q D;  3IEU A;  4JI2 C;  4WV3 A;  4DV6 C;  5K85 A;  5BUQ A;  3R9W A;  2P2Q A;  1GPM A;  2HJG A;  4L4Q A;  5IFI A;  3G7S A;  2XR1 A;  3VNR A;  4DR6 C;  1KKG A;  5A19 A;  1WH9 A;  4RVN A;  5AE1 A;  4ZLP A;  4FUQ A;  1HH2 P;  3J81 D;  2P02 A;  1HNX C;  4G36 A;  3LAX A;  3EER A;  2PRO A;  4DR2 C;  2UXB C;  2E8E A;  3RV2 A;  5E7Q A;  2D1Q A;  3L8C A;  3SO4 A;  5GTD A;  4DV2 C;  2JMP A;  5AE3 A;  4HPV A;  3GPC A;  2VZE A;  3LGX A;  3B7W A;  4D4I A;  2PT7 G;  1JOS A;  1RG9 A;  1N34 C;  4BSZ A;  3NYQ A;  2PN2 A;  5FLX D;  5T8S A;  4DG9 A;  2V7B A;  4B3M C;  2E8F A;  3E7W A;  4D57 A;  4XX2 A;  4LF6 C;  5LMU C;  4B3T C;  4B3R C;  4YY3 C;  4DV0 C;  4NXN C;  5AE2 A;  2HHH C;  3CW8 X;  4DG8 A;  1MXA A;  3R44 A;  5H9U A;  2D1T A;  1UKK A;  4PHT A;  3T1H C;  4NXM C;  4IZ6 A;  1AMU A;  1N2F A;  4JI6 C;  4DUY C;  1ML8 A;  4RLQ A;  4PRO C;  3VNQ A;  4R1L A;  3CJE A;  4GXR A;  3GR0 A;  1XRC A;  4U5Y D;  4DV1 C;  2QVX X;  2OPL A;  4JI8 C;  1J5E C;  2P20 A;  1IBM C;  4OYC A;  4JI3 C;  1HNW C;  4NOZ A;  2D1S A;  2Y4N A;  2ATW A;  4KTT A;  3CW9 A;  2KZF A;  4LFB C;  4JI7 C;  2E8C A;  1NYE A;  5CZV A;  2DYJ A;  1HR0 C;  4MTN A;  2UUA C;  2D7V A;  4I9F A;  4DR5 C;  4TPS B;  2CY1 A;  1QM4 A;  1V26 A;  1N32 C;  2OBV A;  3I08 A;  5BR8 C;  4DV4 C;  3PES A;  5KEI A;  1LCI A;  4RM3 A;  4ISB A;  4LF4 C;  5KYV A;  5BSV A;  2QVZ X;  1XRA A;  4G37 A;  2EGT A;  4WS9 A;  3A9U A;  4BCA A;  2VQE C;  3T1Y C;  1O90 A;  2YCB A;  3L95 X;  4DR7 C;  4GS5 A;  2P2M A;  2D1R A;  1PA4 A;  4FUT A;  4X64 C;  3NPD A;  1T5D X;  4FTF A;  4K0B A;  2E5L C;  1LQL A;  4DUZ C;  4G1I A;  2E0G A;  4DCT A;  3DHV A;  2Y27 A;  1ZB9 A;  5BST A;  1XNQ C;  1MDF A;  5CZX A;  4YHH C;  4RMN A;  2VSQ A;  2F4V C;  4GXQ A;  5DV9 A;  4LFC C;  3EQ6 A;  3OTO C;  1FJG C;  1V25 A;  4BBY A;  5T8T A;  2ONF A;  4L2Z A;  1MD9 A;  2QW0 X;  2UU9 C;  3PBK A;  4X62 C;  5K8F A;  2P2F A;  3FCE A;  2VQF C;  2ZM6 C;  4DR1 C;  2OO4 A;  2DPL A;  1XNR C;  1WF3 A;  5IT9 D;  3N54 B;  3J7A D;  4KHP C;  3TQI A;  1EGA A;  4LF9 C;  4JV5 C;  2WP0 C;  4AQY C;  3ETC A;  3RG2 A;  4EAT A;  4JM1 A;  4BC7 A;  2E7G A;  3H2T A;  3TUF A;  3JAM D;  1L2F A;  4DCU A;  5BUS A;  3N2Q A;  3IML A;  3KXW A;  2UUB C;  1RY2 A;  4BC9 A;  5LMN C;  4I9G A;  1I94 C;  5BSM A;  3IEV A;  4X66 C;  2Y4O A;  4LF8 C;  1VLA A;  5IWA C;  1O92 A;  2BH1 X;  3DAY A;  3AF6 A;  1MDB A;  1XRB A;  4OXI A;  4X65 C;  2UXD C;  3S82 A;  4JI0 C;  1N36 C;  4LF7 C;  4K0K C;  3C5E A;  2OPL B;  3IPL A;  3TDE A;  5BSW A;  3R9X A;  1ULT A;  4D4G A;  4ODJ A;  1IBL C;  3NI2 A;  1FUG A;  5JRH A;  4IR7 A;  4B3S C;  4R0M A;  3J80 D;  1T5H X;  3PRO C;  1P7L A;  1PG3 A;  1USP A;  4JI5 C;  5A1G A;  3GR1 A;  4DV3 C;  3AF5 A;  4JI1 C;  4KTV A;  1HNZ C;  4RM2 A;  4MH4 A;  5BUR A;  4DV7 C;  4D56 A;  2P2J A;  4DR3 C;  1N33 C;  4DR4 C;  3E7X A;  2D28 C;  1MKY A;  4RVO A;  1ZB8 A;  4RLF A;  1BA3 A;  5A1I A;  1MXC A;  4LFA C;  4GKJ C;  1PG4 A;  3LUS A;  3I07 A;  2WD9 A;  2AYA A;  4NDN A;  3VNS A;  1K0R A;  3A4I A;  5ADZ A;  1USP B;  4DV5 C;  4PZP A;  4OX9 C;  2D27 A;  4DCS A;  3DLP X;  1XMQ C;  4LE5 A;  4ZJZ A;  3FCC A;  1XMO C;  3NYR A;  3A9V A;  3ETO A;  4JI4 C;  4DCV A;  1QWI A;  5BSR A;  4L7I A;  2QL8 A;  1IBK C;  1MXB A;  3UZ0 A;  2P2B A;  1O9T A;  3UOW A;  2UUC C;  4LF5 C;  2QVY X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...