4LF7C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 54
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf7C02
2ONFA 2PT7G 1XNRC 3AF5A 3I07A 3IEVA 3GKUA 4KHPC 4DR7C 2UUAC 3EERA 4DR5C 4JI5C 4DV4C 4DV6C 4LFCC 4DCTA 1LQLA 2ZM6C 4JI6C 1N32C 1HNXC 4JI8C 4B3RC 2CY1A 4NOZA 4JI3C 2VQEC 2E7GA 3OTOC 1ZB9A 4DCVA 1L2FA 5FLXD 4MTNA 1IBLC 3JAMD 4AQYC 2UUBC 4DCSA 1N36C 2UXDC 1EGAA 1XNQC 2PN2A 2OPLB 4K0KC 4LF6C 1XMQC 2E8EA 3T1YC 4JI0C 4LF9C 4DV0C 2F4VC 4GKKC 1FJGC 2ASBA 3IEUA 2UU9C 4LF8C 4DV2C 1K0RA 5LMNC 2YCBA 4X64C 4LF7C 1ML8A 4DCUA 1WH9A 4NXNC 4LFAC 4B3TC 5LMUC 4DUYC 2XR1A 5IWAC 1HNZC 1IBKC 4LF5C 4MH4A 1HR0C 4OX9C 4DR3C 4JI1C 2CXCA 2UXCC 4DUZC 2BJOA 2D7VA 1HNWC 3R9WA 4LF4C 3AF6A 1JOSA 1MKYA 1ZB8A 2JMPA 3CJEA 4DV3C 1VLAA 2UXBC 1PA4A 4DV5C 3J7AD 3J80D 4X66C 4B3SC 4DV1C 1USPA 3J81D 4B3MC 1UKKA 2EGTA 2VQFC 1N33C 1KKGA 1NYEA 1HH2P 5IT9D 2ATWA 2QL8A 2KZFA 2DYJA 5BR8C 4LFBC 4YY3C 1XMOC 4JI4C 2E8FA 4DR4C 1USPB 4JI2C 4JV5C 1N34C 4DR6C 1QWIA 1N2FA 1WF3A 4GKJC 1I94C 2E5LC 3R9XA 2UUCC 4DR2C 5A2QD 4XX2A 2OPLA 2E8CA 4DV7C 1IBMC 4YHHC 4DR1C 4JYAC 2HJGA 1J5EC 3LUSA 4BSZA 2HHHC 4X65C 4JI7C 3T1HC 4NXMC 4X62C
chains in the Genus database with same CATH superfamily
3PROC 3NYRA 1XNRC 3IEVA 1XRCA 4HPVA 4JI5C 4KTTA 4LFCC 4IZ6A 3CW8X 4I9GA 4NOZA 4JI3C 1O9TA 5T8TA 1YJ7A 5FLXD 1IBLC 3JAMD 3H2TA 4RM3A 2OPLB 4LF6C 1XMQC 4BCAA 3T1YC 4JI0C 5H9UA 4GKKC 4TPSB 3IEUA 3DLPX 2Y4NA 5IWAC 4ODJA 3N2QA 4EATA 4OX9C 1XS3A 4JM1A 2CXCA 5A1GA 2ZZNA 1ULTA 2UXCC 5BSRA 1XRAA 4RLFA 4LF4C 4ZJZA 3AF6A 3UX2A 4D57A 4DV3C 2JMPA 5BSUA 1P4EC 1VLAA 2UXBC 3J7AD 3TDEA 1IB8A 2QVZX 4DV1C 1USPA 4FUQA 3E7XA 1KKGA 3A26A 5IT9D 4GXQA 3G7SA 1PG3A 4JV5C 4JI2C 1N34C 4DR6C 1N2FA 1I94C 1RG9A 5A2QD 4YHHC 4OXIA 1J5EC 3LUSA 3N54B 1P7LA 2HHHC 2PROA 1MDBA 2BH1X 1V60A 2ONFA 5ADZA 2PT7G 3AF5A 3I07A 3UZ0A 4RVOA 4DCTA 1LQLA 4JI6C 1N32C 3R44A 4RLQA 4B3RC 2VQEC 3CW9A 1TH5A 4MTNA 4DCSA 1EGAA 4PUGA 1M6XA 3ETOA 2MM9A 4LF9C 2F4VC 2Y4OA 1FJGC 2UU9C 1MDFA 3C5EA 3L95X 1VEHA 4DG8A 4LF7C 5BSVA 4G37A 4B3TC 1O90A 4R1MA 1IBKC 4LF5C 4DR3C 4BC9A 4JI1C 2P02A 2YWCA 5KEIA 4R1LA 5LCIA 2D7VA 2ZTBA 5T8SA 4ISBA 2QVXX 1MD9A 2D1RA 1JOSA 5A1IA 3TR3A 4DV5C 4I9FA 4X66C 2P20A 3A9VA 2P2QA 2PG1E 1N33C 1T5DX 1V26A 4DG9A 1NYEA 5BUSA 2QL8A 2DYJA 2AYAA 2OO4A 3UEBA 5BR8C 1QM4A 5K85A 1T5HX 1XHJA 2WD9A 2NCLA 2Z51A 4DR4C 1O92A 1QWIA 1WF3A 3FM7A 2ZZMA 5K8FA 2E5LC 2D1TA 1RY2A 2KDNA 4DV7C 1WCJA 1LCIA 1MXAA 4BSZA 4WV3A 2D28C 3T1HC 1V25A 1FLOA 3GKUA 4OYCA 1PG4A 2UUAC 3E7WA 2OBVA 1BA3A 1HNXC 2P2BA 3NI2A 2CY1A 2E7GA 2YX1A 1M6XC 4AQYC 2VSQA 1N36C 2UXDC 4GS5A 5DV9A 1XNQC 3CQ1A 2PN2A 3K6RA 2Y27A 2E8EA 4PUHA 2QW0X 5BSTA 2ASBA 4LF8C 1K0RA 3DHVA 5LMNC 4GXRA 2YCBA 1YGTA 4NXNC 2P2MA 4LFAC 3TQIA 5LMUC 3EQ6A 4DUYC 4U5YD 2DPLA 2MMAB 4L7IA 5CZXA 2D1SA 3NPDA 5GTDA 3VNRA 5AE3A 1MXBA 2BJOA 4DUZC 1HNWC 3R9WA 2KZ0A 2JNVA 5IFIA 4G1IA 1MKYA 3GR1A 5AE2A 4L4QA 3RG2A 2E0GA 2VZEA 4B3SC 3J81D 4B3MC 1UKKA 2VQFC 3NYQA 2D27A 1HH2P 2ATWA 2KZFA 3UOWA 3B7WA 1XMOC 2E8FA 3LGXA 5BUQA 3LNVA 4GKJC 4BC7A 3GPCA 4G36A 3ETCA 4L2ZA 4LE5A 4PZPA 4DR2C 2P2FA 4XX2A 2WP0C 3LNOA 1IBMC 4JYAC 2HJGA 3IPLA 2M5OA 3A25A 3L8CA 4X62C 1XRBA 4KHPC 4DR7C 3S82A 3EERA 4DR5C 4DV4C 4DV6C 2DHMA 1AMUA 3SO4A 4RVNA 2ZM6C 3GR0A 3IMLA 1GPMA 4D56A 4NDNA 4PHTA 3FCEA 4JI8C 3OTOC 2CU6A 1ZB9A 4DCVA 1L2FA 4FUTA 4RM2A 3CQ2A 3RV2A 1PU1A 4K0KC 2YWBA 4DV0C 4DV2C 1UWDA 4KTVA 5A19A 3VNSA 4X64C 2M5HA 1MXCA 5BURA 2P2JA 4D4IA 1ML8A 4DCUA 1WH9A 4R0MA 2V7BA 2XR1A 3UX3A 2QVYX 1HNZC 5JRHA 4MH4A 1HR0C 4WS9A 2MCQA 4IR7A 5CZVA 5KYTA 4ZLPA 1FUGA 3I08A 3CJEA 1ZB8A 3DAYA 3PBKA 3PESA 3FCCA 1PA4A 4RMNA 5BSWA 3J80D 1P4EA 3A9UA 4K0BA 2EGTA 1XDXA 4PUIA 3O2EA 2D1QA 4LFBC 4YY3C 5KYVA 4JI4C 1USPB 4D4GA 3A4IA 1NY8A 4PROC 3R9XA 5AE1A 3CQ3A 3VNQA 3TUFA 2UUCC 4FTFA 2OPLA 3KXWA 2E8CA 5E7QA 4DR1C 3LAXA 3AY0A 4X65C 4JI7C 4NXMC 5BSMA 1O93A 4BBYA 2UUBC
chains in the Genus database with same CATH topology
3PROC 3NYRA 1XNRC 3IEVA 1XRCA 4HPVA 4JI5C 4KTTA 4LFCC 4IZ6A 3CW8X 4I9GA 4NOZA 4JI3C 1O9TA 5T8TA 1YJ7A 5FLXD 1IBLC 3JAMD 3H2TA 4RM3A 2OPLB 4LF6C 1XMQC 4BCAA 3T1YC 4JI0C 5H9UA 4GKKC 4TPSB 3IEUA 3DLPX 2Y4NA 5IWAC 4ODJA 3N2QA 4EATA 4OX9C 4JM1A 2CXCA 5A1GA 2UXCC 1ULTA 5BSRA 1XRAA 4RLFA 4LF4C 4ZJZA 3AF6A 4D57A 4DV3C 2JMPA 5BSUA 1VLAA 2UXBC 3J7AD 3TDEA 2QVZX 4DV1C 1USPA 4FUQA 3E7XA 1KKGA 5IT9D 4GXQA 3G7SA 1PG3A 4JV5C 4JI2C 1N34C 4DR6C 1N2FA 1I94C 1RG9A 5A2QD 4YHHC 4OXIA 1J5EC 3LUSA 3N54B 1P7LA 2HHHC 2PROA 1MDBA 2BH1X 2ONFA 5ADZA 2PT7G 3AF5A 3I07A 3UZ0A 4RVOA 4DCTA 1LQLA 4JI6C 1N32C 3R44A 4RLQA 4B3RC 2VQEC 3CW9A 4MTNA 4DCSA 1EGAA 3ETOA 4LF9C 2F4VC 2Y4OA 1FJGC 2UU9C 1MDFA 3C5EA 3L95X 4DG8A 4LF7C 5BSVA 4G37A 4B3TC 1O90A 4R1MA 1IBKC 4LF5C 4DR3C 4BC9A 4JI1C 2P02A 2YWCA 5KEIA 4R1LA 2D7VA 5T8SA 4ISBA 2QVXX 1MD9A 2D1RA 1JOSA 5A1IA 4DV5C 4I9FA 4X66C 2P20A 3A9VA 2P2QA 1N33C 1T5DX 1V26A 4DG9A 1NYEA 5BUSA 2QL8A 2DYJA 2AYAA 2OO4A 5BR8C 1QM4A 5K85A 1T5HX 2WD9A 4DR4C 1O92A 1QWIA 1WF3A 5K8FA 2E5LC 2D1TA 1RY2A 4DV7C 1LCIA 1MXAA 4BSZA 4WV3A 2D28C 3T1HC 1V25A 3GKUA 4OYCA 1PG4A 2UUAC 3E7WA 2OBVA 1BA3A 1HNXC 2P2BA 3NI2A 2CY1A 2E7GA 4AQYC 2VSQA 1N36C 2UXDC 4GS5A 5DV9A 1XNQC 2PN2A 2Y27A 2E8EA 2QW0X 5BSTA 2ASBA 4LF8C 1K0RA 3DHVA 5LMNC 4GXRA 2YCBA 4NXNC 2P2MA 4LFAC 3TQIA 5LMUC 3EQ6A 4DUYC 4U5YD 2DPLA 4L7IA 5CZXA 2D1SA 3NPDA 5GTDA 3VNRA 5AE3A 1MXBA 2BJOA 4DUZC 1HNWC 3R9WA 5IFIA 4G1IA 1MKYA 3GR1A 5AE2A 4L4QA 3RG2A 2E0GA 2VZEA 4B3SC 3J81D 4B3MC 1UKKA 2VQFC 3NYQA 2D27A 1HH2P 2ATWA 2KZFA 3UOWA 3B7WA 1XMOC 2E8FA 3LGXA 5BUQA 3LNVA 4GKJC 4BC7A 3GPCA 4G36A 3ETCA 4L2ZA 4LE5A 4PZPA 4DR2C 2P2FA 4XX2A 2WP0C 1IBMC 4JYAC 2HJGA 3IPLA 3L8CA 4X62C 1XRBA 4KHPC 4DR7C 3S82A 3EERA 4DR5C 4DV4C 4DV6C 1AMUA 3SO4A 4RVNA 2ZM6C 3GR0A 3IMLA 1GPMA 4D56A 4NDNA 4PHTA 3FCEA 4JI8C 3OTOC 1ZB9A 4DCVA 1L2FA 4FUTA 4RM2A 3RV2A 4K0KC 2YWBA 4DV0C 4DV2C 4KTVA 5A19A 3VNSA 4X64C 1MXCA 5BURA 2P2JA 4D4IA 1ML8A 4DCUA 1WH9A 4R0MA 2V7BA 2XR1A 2QVYX 1HNZC 5JRHA 4MH4A 1HR0C 4WS9A 4IR7A 5CZVA 5KYTA 4ZLPA 1FUGA 3I08A 3CJEA 1ZB8A 3DAYA 3PBKA 3PESA 3FCCA 1PA4A 4RMNA 5BSWA 3J80D 3A9UA 4K0BA 2EGTA 2D1QA 4LFBC 4YY3C 5KYVA 4JI4C 1USPB 4D4GA 3A4IA 4PROC 3R9XA 5AE1A 3VNQA 3TUFA 2UUCC 4FTFA 2OPLA 3KXWA 2E8CA 5E7QA 4DR1C 3LAXA 4X65C 4JI7C 4NXMC 5BSMA 1O93A 4BBYA 2UUBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONF A;  2PT7 G;  1XNR C;  3AF5 A;  3I07 A;  3IEV A;  3GKU A;  4KHP C;  4DR7 C;  2UUA C;  3EER A;  4DR5 C;  4JI5 C;  4DV4 C;  4DV6 C;  4LFC C;  4DCT A;  1LQL A;  2ZM6 C;  4JI6 C;  1N32 C;  1HNX C;  4JI8 C;  4B3R C;  2CY1 A;  4NOZ A;  4JI3 C;  2VQE C;  2E7G A;  3OTO C;  1ZB9 A;  4DCV A;  1L2F A;  5FLX D;  4MTN A;  1IBL C;  3JAM D;  4AQY C;  2UUB C;  4DCS A;  1N36 C;  2UXD C;  1EGA A;  1XNQ C;  2PN2 A;  2OPL B;  4K0K C;  4LF6 C;  1XMQ C;  2E8E A;  3T1Y C;  4JI0 C;  4LF9 C;  4DV0 C;  2F4V C;  4GKK C;  1FJG C;  2ASB A;  3IEU A;  2UU9 C;  4LF8 C;  4DV2 C;  1K0R A;  5LMN C;  2YCB A;  4X64 C;  4LF7 C;  1ML8 A;  4DCU A;  1WH9 A;  4NXN C;  4LFA C;  4B3T C;  5LMU C;  4DUY C;  2XR1 A;  5IWA C;  1HNZ C;  1IBK C;  4LF5 C;  4MH4 A;  1HR0 C;  4OX9 C;  4DR3 C;  4JI1 C;  2CXC A;  2UXC C;  4DUZ C;  2BJO A;  2D7V A;  1HNW C;  3R9W A;  4LF4 C;  3AF6 A;  1JOS A;  1MKY A;  1ZB8 A;  2JMP A;  3CJE A;  4DV3 C;  1VLA A;  2UXB C;  1PA4 A;  4DV5 C;  3J7A D;  3J80 D;  4X66 C;  4B3S C;  4DV1 C;  1USP A;  3J81 D;  4B3M C;  1UKK A;  2EGT A;  2VQF C;  1N33 C;  1KKG A;  1NYE A;  1HH2 P;  5IT9 D;  2ATW A;  2QL8 A;  2KZF A;  2DYJ A;  5BR8 C;  4LFB C;  4YY3 C;  1XMO C;  4JI4 C;  2E8F A;  4DR4 C;  1USP B;  4JI2 C;  4JV5 C;  1N34 C;  4DR6 C;  1QWI A;  1N2F A;  1WF3 A;  4GKJ C;  1I94 C;  2E5L C;  3R9X A;  2UUC C;  4DR2 C;  5A2Q D;  4XX2 A;  2OPL A;  2E8C A;  4DV7 C;  1IBM C;  4YHH C;  4DR1 C;  4JYA C;  2HJG A;  1J5E C;  3LUS A;  4BSZ A;  2HHH C;  4X65 C;  4JI7 C;  3T1H C;  4NXM C;  4X62 C; 
#chains in the Genus database with same CATH topology
 3PRO C;  3NYR A;  1XNR C;  3IEV A;  1XRC A;  4HPV A;  4JI5 C;  4KTT A;  4LFC C;  4IZ6 A;  3CW8 X;  4I9G A;  4NOZ A;  4JI3 C;  1O9T A;  5T8T A;  1YJ7 A;  5FLX D;  1IBL C;  3JAM D;  3H2T A;  4RM3 A;  2OPL B;  4LF6 C;  1XMQ C;  4BCA A;  3T1Y C;  4JI0 C;  5H9U A;  4GKK C;  4TPS B;  3IEU A;  3DLP X;  2Y4N A;  5IWA C;  4ODJ A;  3N2Q A;  4EAT A;  4OX9 C;  1XS3 A;  4JM1 A;  2CXC A;  5A1G A;  2ZZN A;  1ULT A;  2UXC C;  5BSR A;  1XRA A;  4RLF A;  4LF4 C;  4ZJZ A;  3AF6 A;  3UX2 A;  4D57 A;  4DV3 C;  2JMP A;  5BSU A;  1P4E C;  1VLA A;  2UXB C;  3J7A D;  3TDE A;  1IB8 A;  2QVZ X;  4DV1 C;  1USP A;  4FUQ A;  3E7X A;  1KKG A;  3A26 A;  5IT9 D;  4GXQ A;  3G7S A;  1PG3 A;  4JV5 C;  4JI2 C;  1N34 C;  4DR6 C;  1N2F A;  1I94 C;  1RG9 A;  5A2Q D;  4YHH C;  4OXI A;  1J5E C;  3LUS A;  3N54 B;  1P7L A;  2HHH C;  2PRO A;  1MDB A;  2BH1 X;  1V60 A;  2ONF A;  5ADZ A;  2PT7 G;  3AF5 A;  3I07 A;  3UZ0 A;  4RVO A;  4DCT A;  1LQL A;  4JI6 C;  1N32 C;  3R44 A;  4RLQ A;  4B3R C;  2VQE C;  3CW9 A;  1TH5 A;  4MTN A;  4DCS A;  1EGA A;  4PUG A;  1M6X A;  3ETO A;  2MM9 A;  4LF9 C;  2F4V C;  2Y4O A;  1FJG C;  2UU9 C;  1MDF A;  3C5E A;  3L95 X;  1VEH A;  4DG8 A;  4LF7 C;  5BSV A;  4G37 A;  4B3T C;  1O90 A;  4R1M A;  1IBK C;  4LF5 C;  4DR3 C;  4BC9 A;  4JI1 C;  2P02 A;  2YWC A;  5KEI A;  4R1L A;  5LCI A;  2D7V A;  2ZTB A;  5T8S A;  4ISB A;  2QVX X;  1MD9 A;  2D1R A;  1JOS A;  5A1I A;  3TR3 A;  4DV5 C;  4I9F A;  4X66 C;  2P20 A;  3A9V A;  2P2Q A;  2PG1 E;  1N33 C;  1T5D X;  1V26 A;  4DG9 A;  1NYE A;  5BUS A;  2QL8 A;  2DYJ A;  2AYA A;  2OO4 A;  3UEB A;  5BR8 C;  1QM4 A;  5K85 A;  1T5H X;  1XHJ A;  2WD9 A;  2NCL A;  2Z51 A;  4DR4 C;  1O92 A;  1QWI A;  1WF3 A;  3FM7 A;  2ZZM A;  5K8F A;  2E5L C;  2D1T A;  1RY2 A;  2KDN A;  4DV7 C;  1WCJ A;  1LCI A;  1MXA A;  4BSZ A;  4WV3 A;  2D28 C;  3T1H C;  1V25 A;  1FLO A;  3GKU A;  4OYC A;  1PG4 A;  2UUA C;  3E7W A;  2OBV A;  1BA3 A;  1HNX C;  2P2B A;  3NI2 A;  2CY1 A;  2E7G A;  2YX1 A;  1M6X C;  4AQY C;  2VSQ A;  1N36 C;  2UXD C;  4GS5 A;  5DV9 A;  1XNQ C;  3CQ1 A;  2PN2 A;  3K6R A;  2Y27 A;  2E8E A;  4PUH A;  2QW0 X;  5BST A;  2ASB A;  4LF8 C;  1K0R A;  3DHV A;  5LMN C;  4GXR A;  2YCB A;  1YGT A;  4NXN C;  2P2M A;  4LFA C;  3TQI A;  5LMU C;  3EQ6 A;  4DUY C;  4U5Y D;  2DPL A;  2MMA B;  4L7I A;  5CZX A;  2D1S A;  3NPD A;  5GTD A;  3VNR A;  5AE3 A;  1MXB A;  2BJO A;  4DUZ C;  1HNW C;  3R9W A;  2KZ0 A;  2JNV A;  5IFI A;  4G1I A;  1MKY A;  3GR1 A;  5AE2 A;  4L4Q A;  3RG2 A;  2E0G A;  2VZE A;  4B3S C;  3J81 D;  4B3M C;  1UKK A;  2VQF C;  3NYQ A;  2D27 A;  1HH2 P;  2ATW A;  2KZF A;  3UOW A;  3B7W A;  1XMO C;  2E8F A;  3LGX A;  5BUQ A;  3LNV A;  4GKJ C;  4BC7 A;  3GPC A;  4G36 A;  3ETC A;  4L2Z A;  4LE5 A;  4PZP A;  4DR2 C;  2P2F A;  4XX2 A;  2WP0 C;  3LNO A;  1IBM C;  4JYA C;  2HJG A;  3IPL A;  2M5O A;  3A25 A;  3L8C A;  4X62 C;  1XRB A;  4KHP C;  4DR7 C;  3S82 A;  3EER A;  4DR5 C;  4DV4 C;  4DV6 C;  2DHM A;  1AMU A;  3SO4 A;  4RVN A;  2ZM6 C;  3GR0 A;  3IML A;  1GPM A;  4D56 A;  4NDN A;  4PHT A;  3FCE A;  4JI8 C;  3OTO C;  2CU6 A;  1ZB9 A;  4DCV A;  1L2F A;  4FUT A;  4RM2 A;  3CQ2 A;  3RV2 A;  1PU1 A;  4K0K C;  2YWB A;  4DV0 C;  4DV2 C;  1UWD A;  4KTV A;  5A19 A;  3VNS A;  4X64 C;  2M5H A;  1MXC A;  5BUR A;  2P2J A;  4D4I A;  1ML8 A;  4DCU A;  1WH9 A;  4R0M A;  2V7B A;  2XR1 A;  3UX3 A;  2QVY X;  1HNZ C;  5JRH A;  4MH4 A;  1HR0 C;  4WS9 A;  2MCQ A;  4IR7 A;  5CZV A;  5KYT A;  4ZLP A;  1FUG A;  3I08 A;  3CJE A;  1ZB8 A;  3DAY A;  3PBK A;  3PES A;  3FCC A;  1PA4 A;  4RMN A;  5BSW A;  3J80 D;  1P4E A;  3A9U A;  4K0B A;  2EGT A;  1XDX A;  4PUI A;  3O2E A;  2D1Q A;  4LFB C;  4YY3 C;  5KYV A;  4JI4 C;  1USP B;  4D4G A;  3A4I A;  1NY8 A;  4PRO C;  3R9X A;  5AE1 A;  3CQ3 A;  3VNQ A;  3TUF A;  2UUC C;  4FTF A;  2OPL A;  3KXW A;  2E8C A;  5E7Q A;  4DR1 C;  3LAX A;  3AY0 A;  4X65 C;  4JI7 C;  4NXM C;  5BSM A;  1O93 A;  4BBY A;  2UUB C; 
#chains in the Genus database with same CATH homology
 3PRO C;  3NYR A;  1XNR C;  3IEV A;  1XRC A;  4HPV A;  4JI5 C;  4KTT A;  4LFC C;  4IZ6 A;  3CW8 X;  4I9G A;  4NOZ A;  4JI3 C;  1O9T A;  5T8T A;  1YJ7 A;  5FLX D;  1IBL C;  3JAM D;  3H2T A;  4RM3 A;  2OPL B;  4LF6 C;  1XMQ C;  4BCA A;  3T1Y C;  4JI0 C;  5H9U A;  4GKK C;  4TPS B;  3IEU A;  3DLP X;  2Y4N A;  5IWA C;  4ODJ A;  3N2Q A;  4EAT A;  4OX9 C;  4JM1 A;  2CXC A;  5A1G A;  2UXC C;  1ULT A;  5BSR A;  1XRA A;  4RLF A;  4LF4 C;  4ZJZ A;  3AF6 A;  4D57 A;  4DV3 C;  2JMP A;  5BSU A;  1VLA A;  2UXB C;  3J7A D;  3TDE A;  2QVZ X;  4DV1 C;  1USP A;  4FUQ A;  3E7X A;  1KKG A;  5IT9 D;  4GXQ A;  3G7S A;  1PG3 A;  4JV5 C;  4JI2 C;  1N34 C;  4DR6 C;  1N2F A;  1I94 C;  1RG9 A;  5A2Q D;  4YHH C;  4OXI A;  1J5E C;  3LUS A;  3N54 B;  1P7L A;  2HHH C;  2PRO A;  1MDB A;  2BH1 X;  2ONF A;  5ADZ A;  2PT7 G;  3AF5 A;  3I07 A;  3UZ0 A;  4RVO A;  4DCT A;  1LQL A;  4JI6 C;  1N32 C;  3R44 A;  4RLQ A;  4B3R C;  2VQE C;  3CW9 A;  4MTN A;  4DCS A;  1EGA A;  3ETO A;  4LF9 C;  2F4V C;  2Y4O A;  1FJG C;  2UU9 C;  1MDF A;  3C5E A;  3L95 X;  4DG8 A;  4LF7 C;  5BSV A;  4G37 A;  4B3T C;  1O90 A;  4R1M A;  1IBK C;  4LF5 C;  4DR3 C;  4BC9 A;  4JI1 C;  2P02 A;  2YWC A;  5KEI A;  4R1L A;  2D7V A;  5T8S A;  4ISB A;  2QVX X;  1MD9 A;  2D1R A;  1JOS A;  5A1I A;  4DV5 C;  4I9F A;  4X66 C;  2P20 A;  3A9V A;  2P2Q A;  1N33 C;  1T5D X;  1V26 A;  4DG9 A;  1NYE A;  5BUS A;  2QL8 A;  2DYJ A;  2AYA A;  2OO4 A;  5BR8 C;  1QM4 A;  5K85 A;  1T5H X;  2WD9 A;  4DR4 C;  1O92 A;  1QWI A;  1WF3 A;  5K8F A;  2E5L C;  2D1T A;  1RY2 A;  4DV7 C;  1LCI A;  1MXA A;  4BSZ A;  4WV3 A;  2D28 C;  3T1H C;  1V25 A;  3GKU A;  4OYC A;  1PG4 A;  2UUA C;  3E7W A;  2OBV A;  1BA3 A;  1HNX C;  2P2B A;  3NI2 A;  2CY1 A;  2E7G A;  4AQY C;  2VSQ A;  1N36 C;  2UXD C;  4GS5 A;  5DV9 A;  1XNQ C;  2PN2 A;  2Y27 A;  2E8E A;  2QW0 X;  5BST A;  2ASB A;  4LF8 C;  1K0R A;  3DHV A;  5LMN C;  4GXR A;  2YCB A;  4NXN C;  2P2M A;  4LFA C;  3TQI A;  5LMU C;  3EQ6 A;  4DUY C;  4U5Y D;  2DPL A;  4L7I A;  5CZX A;  2D1S A;  3NPD A;  5GTD A;  3VNR A;  5AE3 A;  1MXB A;  2BJO A;  4DUZ C;  1HNW C;  3R9W A;  5IFI A;  4G1I A;  1MKY A;  3GR1 A;  5AE2 A;  4L4Q A;  3RG2 A;  2E0G A;  2VZE A;  4B3S C;  3J81 D;  4B3M C;  1UKK A;  2VQF C;  3NYQ A;  2D27 A;  1HH2 P;  2ATW A;  2KZF A;  3UOW A;  3B7W A;  1XMO C;  2E8F A;  3LGX A;  5BUQ A;  3LNV A;  4GKJ C;  4BC7 A;  3GPC A;  4G36 A;  3ETC A;  4L2Z A;  4LE5 A;  4PZP A;  4DR2 C;  2P2F A;  4XX2 A;  2WP0 C;  1IBM C;  4JYA C;  2HJG A;  3IPL A;  3L8C A;  4X62 C;  1XRB A;  4KHP C;  4DR7 C;  3S82 A;  3EER A;  4DR5 C;  4DV4 C;  4DV6 C;  1AMU A;  3SO4 A;  4RVN A;  2ZM6 C;  3GR0 A;  3IML A;  1GPM A;  4D56 A;  4NDN A;  4PHT A;  3FCE A;  4JI8 C;  3OTO C;  1ZB9 A;  4DCV A;  1L2F A;  4FUT A;  4RM2 A;  3RV2 A;  4K0K C;  2YWB A;  4DV0 C;  4DV2 C;  4KTV A;  5A19 A;  3VNS A;  4X64 C;  1MXC A;  5BUR A;  2P2J A;  4D4I A;  1ML8 A;  4DCU A;  1WH9 A;  4R0M A;  2V7B A;  2XR1 A;  2QVY X;  1HNZ C;  5JRH A;  4MH4 A;  1HR0 C;  4WS9 A;  4IR7 A;  5CZV A;  5KYT A;  4ZLP A;  1FUG A;  3I08 A;  3CJE A;  1ZB8 A;  3DAY A;  3PBK A;  3PES A;  3FCC A;  1PA4 A;  4RMN A;  5BSW A;  3J80 D;  3A9U A;  4K0B A;  2EGT A;  2D1Q A;  4LFB C;  4YY3 C;  5KYV A;  4JI4 C;  1USP B;  4D4G A;  3A4I A;  4PRO C;  3R9X A;  5AE1 A;  3VNQ A;  3TUF A;  2UUC C;  4FTF A;  2OPL A;  3KXW A;  2E8C A;  5E7Q A;  4DR1 C;  3LAX A;  4X65 C;  4JI7 C;  4NXM C;  5BSM A;  1O93 A;  4BBY A;  2UUB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...