4LF7C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 54
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf7C02
1L2FA 4DR5C 1HR0C 1IBMC 1JOSA 4JV5C 2YCBA 4JYAC 2UUCC 2D7VA 3T1YC 4LFAC 3J7AD 4DCVA 3LUSA 4AQYC 1USPB 5IT9D 1N33C 4B3MC 4JI0C 1WH9A 4JI6C 1LQLA 1PA4A 2CY1A 4X62C 1ML8A 1VLAA 4JI1C 5IWAC 4LF9C 4LF8C 4X66C 2XR1A 1HNWC 1K0RA 1MKYA 3EERA 4LF6C 4DUYC 2VQEC 4DV1C 2BJOA 4DV0C 1N32C 3CJEA 3R9WA 4B3SC 2E7GA 4DCUA 4DV2C 4XX2A 4DV7C 2UUBC 4JI7C 1USPA 5LMUC 3AF5A 2EGTA 5FLXD 4DR4C 4DR2C 2UU9C 1XNRC 1J5EC 2OPLB 4DR7C 1QWIA 5A2QD 2E5LC 4JI8C 4DV5C 4DR3C 4DR6C 4YY3C 4LFCC 1FJGC 3R9XA 2E8EA 3IEVA 1XMOC 4GKJC 1XMQC 4LFBC 1N2FA 4K0KC 1EGAA 3J81D 3T1HC 1ZB9A 4NXNC 2E8CA 2VQFC 3IEUA 4GKKC 4YHHC 4DV4C 2ONFA 4JI3C 4DCTA 4BSZA 2JMPA 4NOZA 4LF7C 1HH2P 2E8FA 1N36C 4JI2C 1WF3A 4DCSA 1UKKA 4OX9C 4DV3C 4MH4A 3J80D 2PT7G 4JI5C 4MTNA 4X64C 4DV6C 4B3RC 1XNQC 2PN2A 2F4VC 1KKGA 2QL8A 4B3TC 1I94C 4KHPC 5LMNC 3JAMD 2UUAC 3AF6A 2UXBC 3OTOC 2ZM6C 5BR8C 1N34C 1IBKC 4LF5C 4LF4C 1ZB8A 2UXCC 2UXDC 1HNXC 2ASBA 4X65C 1IBLC 4JI4C 1NYEA 3GKUA 4DR1C 2ATWA 4DUZC 2HHHC 1HNZC 2CXCA 2KZFA 3I07A 2HJGA 2OPLA 4NXMC 2DYJA
chains in the Genus database with same CATH superfamily
4PZPA 3LGXA 1JOSA 4JV5C 1O92A 2D27A 5KYTA 3TUFA 2PG1E 4D4GA 1RG9A 4D57A 1XRAA 1N33C 4JI0C 3VNSA 4JI6C 4FTFA 3TQIA 2CY1A 1RY2A 3G7SA 4X62C 4EATA 2QW0X 3UEBA 4X66C 4D56A 4WV3A 1K0RA 1MKYA 3A25A 4LE5A 4LF6C 2OBVA 2VQEC 3A9UA 1FLOA 4ZLPA 4ISBA 3GPCA 4DV7C 1MXBA 2WP0C 2EGTA 4DR4C 3H2TA 2P20A 2E5LC 4DV5C 4JM1A 2DPLA 4WS9A 5AE2A 4YY3C 1PU1A 1FJGC 1PG4A 2E8EA 4GKJC 3B7WA 1XMQC 4I9FA 4LFBC 4GS5A 4K0KC 1EGAA 3CQ1A 2D1TA 4NXNC 1YJ7A 5GTDA 2E8CA 3RG2A 3IEUA 4RM2A 3GR1A 3UOWA 4DV4C 5BSUA 5K85A 4BSZA 3LAXA 5BUQA 2E8FA 3UZ0A 3IPLA 2D1RA 3NI2A 4MH4A 2PT7G 4JI5C 4DV6C 2OO4A 1XNQC 3FM7A 4G1IA 4KTVA 2P2BA 3JAMD 5LMNC 5KEIA 4LF5C 1N34C 4LF4C 5T8SA 4G37A 4X65C 1M6XC 4JI4C 3S82A 3GKUA 4L7IA 1MXCA 3N54B 2ATWA 4IZ6A 4NXMC 1L2FA 3L8CA 3K6RA 3CW9A 5IFIA 2UUCC 4OXIA 4D4IA 4LFAC 2QVYX 1O90A 5T8TA 1LQLA 4I9GA 5JRHA 4JI1C 4LF8C 2YWBA 2KDNA 2V7BA 4OYCA 4G36A 5BSTA 1N32C 3RV2A 4BCAA 1XRBA 2E7GA 3PESA 3A26A 3VNRA 5LMUC 3VNQA 3E7WA 5FLXD 2QVXX 2BH1X 2OPLB 4BBYA 1QWIA 1O93A 4DR3C 4DR6C 1GPMA 4ODJA 4GXRA 2MCQA 3R9XA 1XMOC 5BSVA 2PROA 5A1IA 1WCJA 4R0MA 1ZB9A 3A9VA 2VQFC 1MDFA 2D28C 4GKKC 3LNOA 2JMPA 2NCLA 2MMAB 4JI2C 3TDEA 3IMLA 1UKKA 5BSWA 3J80D 1ULTA 3UX2A 2PN2A 1KKGA 4GXQA 2QL8A 3DAYA 4KHPC 2AYAA 2ZZMA 2VSQA 1NY8A 3GR0A 3AF6A 3AY0A 3PROC 3OTOC 2UXCC 1IBKC 1ZB8A 4TPSB 1MD9A 3DLPX 4PROC 5BUSA 4BC7A 5LCIA 1IBLC 3PBKA 3NYRA 3CW8X 2M5OA 2CXCA 1V26A 3I07A 2HJGA 4PHTA 3O2EA 2CU6A 1HR0C 2WD9A 2YCBA 2D7VA 3T1YC 5IT9D 4B3MC 1PA4A 1FUGA 1ML8A 1VLAA 4R1LA 5IWAC 4LF9C 1YGTA 1UWDA 1M6XA 1T5DX 2D1QA 2YWCA 4DV0C 5DV9A 1VEHA 3R9WA 4B3SC 3FCEA 4DV2C 1IB8A 1PG3A 4DG9A 1P4EC 4JI7C 4K0BA 5E7QA 4DR2C 4FUTA 2UU9C 3L95X 5BURA 1BA3A 1XNRC 3CQ2A 1MDBA 4U5YD 2KZ0A 5A2QD 4JI8C 2Y4OA 2MM9A 2P02A 5AE3A 4FUQA 4RLQA 1AMUA 5K8FA 4RMNA 4PUHA 2DHMA 3TR3A 2Z51A 2ONFA 4DCTA 3LNVA 1QM4A 2ZZNA 4LF7C 1HH2P 1N36C 1WF3A 3NYQA 4NDNA 2Y27A 4KTTA 4L2ZA 4PUIA 2M5HA 2QVZX 3E7XA 2VZEA 4MTNA 3UX3A 2D1SA 4B3TC 1I94C 1XDXA 5ADZA 3FCCA 2UXBC 1HNXC 4DG8A 2P2FA 3C5EA 1P7LA 5AE1A 2JNVA 1V60A 1XHJA 4DR5C 1IBMC 3R44A 3EQ6A 4JYAC 4RVOA 2E0GA 3ETCA 3J7AD 4DCVA 3LUSA 4AQYC 1USPB 4IR7A 1WH9A 1TH5A 2XR1A 2P2QA 1HNWC 3EERA 4DUYC 4DV1C 2BJOA 3ETOA 1XS3A 5CZVA 3CJEA 3A4IA 1MXAA 4DCUA 3I08A 4RLFA 4XX2A 2ZTBA 1O9TA 2UUBC 1USPA 1V25A 3AF5A 5BSRA 1J5EC 3CQ3A 4DR7C 1LCIA 4RVNA 4LFCC 3IEVA 1XRCA 1N2FA 5A19A 3J81D 3T1HC 4BC9A 4L4QA 4YHHC 4JI3C 2P2JA 3NPDA 3DHVA 4HPVA 4NOZA 1P4EA 4R1MA 5CZXA 4DCSA 4OX9C 4DV3C 2Y4NA 4X64C 1T5HX 4B3RC 3N2QA 2F4VC 5KYVA 3SO4A 2UUAC 2UXDC 2ZM6C 5BR8C 2P2MA 2ASBA 4ZJZA 1NYEA 4PUGA 4RM3A 3KXWA 4DR1C 5A1GA 4DUZC 2HHHC 1HNZC 2KZFA 2YX1A 2OPLA 5H9UA 5BSMA 2DYJA
chains in the Genus database with same CATH topology
4PZPA 3LGXA 1JOSA 4JV5C 1O92A 2D27A 5KYTA 3TUFA 4D4GA 1RG9A 4D57A 1XRAA 1N33C 4JI0C 3VNSA 4JI6C 4FTFA 3TQIA 2CY1A 1RY2A 3G7SA 4X62C 4EATA 2QW0X 4X66C 4D56A 4WV3A 1K0RA 1MKYA 4LE5A 4LF6C 2OBVA 2VQEC 3A9UA 4ZLPA 4ISBA 3GPCA 4DV7C 1MXBA 2WP0C 2EGTA 4DR4C 3H2TA 2P20A 2E5LC 4DV5C 4JM1A 2DPLA 4WS9A 5AE2A 4YY3C 1FJGC 1PG4A 2E8EA 4GKJC 3B7WA 1XMQC 4I9FA 4LFBC 4GS5A 4K0KC 1EGAA 2D1TA 4NXNC 1YJ7A 5GTDA 2E8CA 3RG2A 3IEUA 4RM2A 3GR1A 3UOWA 4DV4C 5BSUA 5K85A 4BSZA 3LAXA 5BUQA 2E8FA 3UZ0A 3IPLA 2D1RA 3NI2A 4MH4A 2PT7G 4JI5C 4DV6C 2OO4A 1XNQC 4G1IA 4KTVA 2P2BA 3JAMD 5LMNC 5KEIA 4LF5C 1N34C 4LF4C 5T8SA 4G37A 4X65C 4JI4C 3S82A 3GKUA 4L7IA 1MXCA 3N54B 2ATWA 4IZ6A 4NXMC 1L2FA 3L8CA 3CW9A 5IFIA 2UUCC 4OXIA 4D4IA 4LFAC 2QVYX 1O90A 5T8TA 1LQLA 4I9GA 5JRHA 4JI1C 4LF8C 2YWBA 2V7BA 4OYCA 4G36A 5BSTA 1N32C 3RV2A 4BCAA 1XRBA 2E7GA 3PESA 3VNRA 5LMUC 3VNQA 3E7WA 5FLXD 2QVXX 2BH1X 2OPLB 4BBYA 1QWIA 1O93A 4DR3C 4DR6C 1GPMA 4ODJA 4GXRA 3R9XA 1XMOC 5BSVA 2PROA 5A1IA 4R0MA 1ZB9A 3A9VA 2VQFC 1MDFA 2D28C 4GKKC 2JMPA 4JI2C 3TDEA 3IMLA 1UKKA 5BSWA 3J80D 1ULTA 2PN2A 1KKGA 4GXQA 2QL8A 3DAYA 4KHPC 2AYAA 2VSQA 3GR0A 3AF6A 3PROC 3OTOC 2UXCC 1IBKC 1ZB8A 4TPSB 1MD9A 3DLPX 4PROC 5BUSA 4BC7A 1IBLC 3PBKA 3NYRA 3CW8X 2CXCA 1V26A 3I07A 2HJGA 4PHTA 1HR0C 2WD9A 2YCBA 2D7VA 3T1YC 5IT9D 4B3MC 1PA4A 1FUGA 1ML8A 1VLAA 4R1LA 5IWAC 4LF9C 1T5DX 2D1QA 2YWCA 4DV0C 5DV9A 3R9WA 4B3SC 3FCEA 4DG9A 1PG3A 4DV2C 4JI7C 4K0BA 5E7QA 4DR2C 4FUTA 2UU9C 3L95X 5BURA 1BA3A 1XNRC 1MDBA 4U5YD 5A2QD 4JI8C 2Y4OA 2P02A 5AE3A 4FUQA 4RLQA 1AMUA 5K8FA 4RMNA 2ONFA 4DCTA 3LNVA 1QM4A 4LF7C 1HH2P 1N36C 1WF3A 3NYQA 4NDNA 2Y27A 4KTTA 4L2ZA 2QVZX 3E7XA 2VZEA 4MTNA 2D1SA 4B3TC 1I94C 5ADZA 3FCCA 2UXBC 1HNXC 4DG8A 2P2FA 3C5EA 1P7LA 5AE1A 4DR5C 1IBMC 3R44A 3EQ6A 4JYAC 4RVOA 2E0GA 3ETCA 3J7AD 4DCVA 3LUSA 4AQYC 1USPB 4IR7A 1WH9A 2XR1A 2P2QA 1HNWC 3EERA 4DUYC 4DV1C 2BJOA 3ETOA 5CZVA 3CJEA 3A4IA 1MXAA 4DCUA 3I08A 4RLFA 4XX2A 1O9TA 2UUBC 1USPA 1V25A 3AF5A 5BSRA 1J5EC 4DR7C 1LCIA 4RVNA 4LFCC 3IEVA 1XRCA 1N2FA 5A19A 3J81D 3T1HC 4BC9A 4L4QA 4YHHC 4JI3C 2P2JA 3NPDA 3DHVA 4HPVA 4NOZA 4R1MA 5CZXA 4DCSA 4OX9C 4DV3C 2Y4NA 4X64C 1T5HX 4B3RC 3N2QA 2F4VC 5KYVA 3SO4A 2UUAC 2UXDC 2ZM6C 5BR8C 2P2MA 2ASBA 4ZJZA 1NYEA 4RM3A 3KXWA 4DR1C 5A1GA 4DUZC 2HHHC 1HNZC 2KZFA 2OPLA 5H9UA 5BSMA 2DYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2F A;  4DR5 C;  1HR0 C;  1IBM C;  1JOS A;  4JV5 C;  2YCB A;  4JYA C;  2UUC C;  2D7V A;  3T1Y C;  4LFA C;  3J7A D;  4DCV A;  3LUS A;  4AQY C;  1USP B;  5IT9 D;  1N33 C;  4B3M C;  4JI0 C;  1WH9 A;  4JI6 C;  1LQL A;  1PA4 A;  2CY1 A;  4X62 C;  1ML8 A;  1VLA A;  4JI1 C;  5IWA C;  4LF9 C;  4LF8 C;  4X66 C;  2XR1 A;  1HNW C;  1K0R A;  1MKY A;  3EER A;  4LF6 C;  4DUY C;  2VQE C;  4DV1 C;  2BJO A;  4DV0 C;  1N32 C;  3CJE A;  3R9W A;  4B3S C;  2E7G A;  4DCU A;  4DV2 C;  4XX2 A;  4DV7 C;  2UUB C;  4JI7 C;  1USP A;  5LMU C;  3AF5 A;  2EGT A;  5FLX D;  4DR4 C;  4DR2 C;  2UU9 C;  1XNR C;  1J5E C;  2OPL B;  4DR7 C;  1QWI A;  5A2Q D;  2E5L C;  4JI8 C;  4DV5 C;  4DR3 C;  4DR6 C;  4YY3 C;  4LFC C;  1FJG C;  3R9X A;  2E8E A;  3IEV A;  1XMO C;  4GKJ C;  1XMQ C;  4LFB C;  1N2F A;  4K0K C;  1EGA A;  3J81 D;  3T1H C;  1ZB9 A;  4NXN C;  2E8C A;  2VQF C;  3IEU A;  4GKK C;  4YHH C;  4DV4 C;  2ONF A;  4JI3 C;  4DCT A;  4BSZ A;  2JMP A;  4NOZ A;  4LF7 C;  1HH2 P;  2E8F A;  1N36 C;  4JI2 C;  1WF3 A;  4DCS A;  1UKK A;  4OX9 C;  4DV3 C;  4MH4 A;  3J80 D;  2PT7 G;  4JI5 C;  4MTN A;  4X64 C;  4DV6 C;  4B3R C;  1XNQ C;  2PN2 A;  2F4V C;  1KKG A;  2QL8 A;  4B3T C;  1I94 C;  4KHP C;  5LMN C;  3JAM D;  2UUA C;  3AF6 A;  2UXB C;  3OTO C;  2ZM6 C;  5BR8 C;  1N34 C;  1IBK C;  4LF5 C;  4LF4 C;  1ZB8 A;  2UXC C;  2UXD C;  1HNX C;  2ASB A;  4X65 C;  1IBL C;  4JI4 C;  1NYE A;  3GKU A;  4DR1 C;  2ATW A;  4DUZ C;  2HHH C;  1HNZ C;  2CXC A;  2KZF A;  3I07 A;  2HJG A;  2OPL A;  4NXM C;  2DYJ A; 
#chains in the Genus database with same CATH topology
 4PZP A;  3LGX A;  1JOS A;  4JV5 C;  1O92 A;  2D27 A;  5KYT A;  3TUF A;  2PG1 E;  4D4G A;  1RG9 A;  4D57 A;  1XRA A;  1N33 C;  4JI0 C;  3VNS A;  4JI6 C;  4FTF A;  3TQI A;  2CY1 A;  1RY2 A;  3G7S A;  4X62 C;  4EAT A;  2QW0 X;  3UEB A;  4X66 C;  4D56 A;  4WV3 A;  1K0R A;  1MKY A;  3A25 A;  4LE5 A;  4LF6 C;  2OBV A;  2VQE C;  3A9U A;  1FLO A;  4ZLP A;  4ISB A;  3GPC A;  4DV7 C;  1MXB A;  2WP0 C;  2EGT A;  4DR4 C;  3H2T A;  2P20 A;  2E5L C;  4DV5 C;  4JM1 A;  2DPL A;  4WS9 A;  5AE2 A;  4YY3 C;  1PU1 A;  1FJG C;  1PG4 A;  2E8E A;  4GKJ C;  3B7W A;  1XMQ C;  4I9F A;  4LFB C;  4GS5 A;  4K0K C;  1EGA A;  3CQ1 A;  2D1T A;  4NXN C;  1YJ7 A;  5GTD A;  2E8C A;  3RG2 A;  3IEU A;  4RM2 A;  3GR1 A;  3UOW A;  4DV4 C;  5BSU A;  5K85 A;  4BSZ A;  3LAX A;  5BUQ A;  2E8F A;  3UZ0 A;  3IPL A;  2D1R A;  3NI2 A;  4MH4 A;  2PT7 G;  4JI5 C;  4DV6 C;  2OO4 A;  1XNQ C;  3FM7 A;  4G1I A;  4KTV A;  2P2B A;  3JAM D;  5LMN C;  5KEI A;  4LF5 C;  1N34 C;  4LF4 C;  5T8S A;  4G37 A;  4X65 C;  1M6X C;  4JI4 C;  3S82 A;  3GKU A;  4L7I A;  1MXC A;  3N54 B;  2ATW A;  4IZ6 A;  4NXM C;  1L2F A;  3L8C A;  3K6R A;  3CW9 A;  5IFI A;  2UUC C;  4OXI A;  4D4I A;  4LFA C;  2QVY X;  1O90 A;  5T8T A;  1LQL A;  4I9G A;  5JRH A;  4JI1 C;  4LF8 C;  2YWB A;  2KDN A;  2V7B A;  4OYC A;  4G36 A;  5BST A;  1N32 C;  3RV2 A;  4BCA A;  1XRB A;  2E7G A;  3PES A;  3A26 A;  3VNR A;  5LMU C;  3VNQ A;  3E7W A;  5FLX D;  2QVX X;  2BH1 X;  2OPL B;  4BBY A;  1QWI A;  1O93 A;  4DR3 C;  4DR6 C;  1GPM A;  4ODJ A;  4GXR A;  2MCQ A;  3R9X A;  1XMO C;  5BSV A;  2PRO A;  5A1I A;  1WCJ A;  4R0M A;  1ZB9 A;  3A9V A;  2VQF C;  1MDF A;  2D28 C;  4GKK C;  3LNO A;  2JMP A;  2NCL A;  2MMA B;  4JI2 C;  3TDE A;  3IML A;  1UKK A;  5BSW A;  3J80 D;  1ULT A;  3UX2 A;  2PN2 A;  1KKG A;  4GXQ A;  2QL8 A;  3DAY A;  4KHP C;  2AYA A;  2ZZM A;  2VSQ A;  1NY8 A;  3GR0 A;  3AF6 A;  3AY0 A;  3PRO C;  3OTO C;  2UXC C;  1IBK C;  1ZB8 A;  4TPS B;  1MD9 A;  3DLP X;  4PRO C;  5BUS A;  4BC7 A;  5LCI A;  1IBL C;  3PBK A;  3NYR A;  3CW8 X;  2M5O A;  2CXC A;  1V26 A;  3I07 A;  2HJG A;  4PHT A;  3O2E A;  2CU6 A;  1HR0 C;  2WD9 A;  2YCB A;  2D7V A;  3T1Y C;  5IT9 D;  4B3M C;  1PA4 A;  1FUG A;  1ML8 A;  1VLA A;  4R1L A;  5IWA C;  4LF9 C;  1YGT A;  1UWD A;  1M6X A;  1T5D X;  2D1Q A;  2YWC A;  4DV0 C;  5DV9 A;  1VEH A;  3R9W A;  4B3S C;  3FCE A;  4DV2 C;  1IB8 A;  1PG3 A;  4DG9 A;  1P4E C;  4JI7 C;  4K0B A;  5E7Q A;  4DR2 C;  4FUT A;  2UU9 C;  3L95 X;  5BUR A;  1BA3 A;  1XNR C;  3CQ2 A;  1MDB A;  4U5Y D;  2KZ0 A;  5A2Q D;  4JI8 C;  2Y4O A;  2MM9 A;  2P02 A;  5AE3 A;  4FUQ A;  4RLQ A;  1AMU A;  5K8F A;  4RMN A;  4PUH A;  2DHM A;  3TR3 A;  2Z51 A;  2ONF A;  4DCT A;  3LNV A;  1QM4 A;  2ZZN A;  4LF7 C;  1HH2 P;  1N36 C;  1WF3 A;  3NYQ A;  4NDN A;  2Y27 A;  4KTT A;  4L2Z A;  4PUI A;  2M5H A;  2QVZ X;  3E7X A;  2VZE A;  4MTN A;  3UX3 A;  2D1S A;  4B3T C;  1I94 C;  1XDX A;  5ADZ A;  3FCC A;  2UXB C;  1HNX C;  4DG8 A;  2P2F A;  3C5E A;  1P7L A;  5AE1 A;  2JNV A;  1V60 A;  1XHJ A;  4DR5 C;  1IBM C;  3R44 A;  3EQ6 A;  4JYA C;  4RVO A;  2E0G A;  3ETC A;  3J7A D;  4DCV A;  3LUS A;  4AQY C;  1USP B;  4IR7 A;  1WH9 A;  1TH5 A;  2XR1 A;  2P2Q A;  1HNW C;  3EER A;  4DUY C;  4DV1 C;  2BJO A;  3ETO A;  1XS3 A;  5CZV A;  3CJE A;  3A4I A;  1MXA A;  4DCU A;  3I08 A;  4RLF A;  4XX2 A;  2ZTB A;  1O9T A;  2UUB C;  1USP A;  1V25 A;  3AF5 A;  5BSR A;  1J5E C;  3CQ3 A;  4DR7 C;  1LCI A;  4RVN A;  4LFC C;  3IEV A;  1XRC A;  1N2F A;  5A19 A;  3J81 D;  3T1H C;  4BC9 A;  4L4Q A;  4YHH C;  4JI3 C;  2P2J A;  3NPD A;  3DHV A;  4HPV A;  4NOZ A;  1P4E A;  4R1M A;  5CZX A;  4DCS A;  4OX9 C;  4DV3 C;  2Y4N A;  4X64 C;  1T5H X;  4B3R C;  3N2Q A;  2F4V C;  5KYV A;  3SO4 A;  2UUA C;  2UXD C;  2ZM6 C;  5BR8 C;  2P2M A;  2ASB A;  4ZJZ A;  1NYE A;  4PUG A;  4RM3 A;  3KXW A;  4DR1 C;  5A1G A;  4DUZ C;  2HHH C;  1HNZ C;  2KZF A;  2YX1 A;  2OPL A;  5H9U A;  5BSM A;  2DYJ A; 
#chains in the Genus database with same CATH homology
 4PZP A;  3LGX A;  1JOS A;  4JV5 C;  1O92 A;  2D27 A;  5KYT A;  3TUF A;  4D4G A;  1RG9 A;  4D57 A;  1XRA A;  1N33 C;  4JI0 C;  3VNS A;  4JI6 C;  4FTF A;  3TQI A;  2CY1 A;  1RY2 A;  3G7S A;  4X62 C;  4EAT A;  2QW0 X;  4X66 C;  4D56 A;  4WV3 A;  1K0R A;  1MKY A;  4LE5 A;  4LF6 C;  2OBV A;  2VQE C;  3A9U A;  4ZLP A;  4ISB A;  3GPC A;  4DV7 C;  1MXB A;  2WP0 C;  2EGT A;  4DR4 C;  3H2T A;  2P20 A;  2E5L C;  4DV5 C;  4JM1 A;  2DPL A;  4WS9 A;  5AE2 A;  4YY3 C;  1FJG C;  1PG4 A;  2E8E A;  4GKJ C;  3B7W A;  1XMQ C;  4I9F A;  4LFB C;  4GS5 A;  4K0K C;  1EGA A;  2D1T A;  4NXN C;  1YJ7 A;  5GTD A;  2E8C A;  3RG2 A;  3IEU A;  4RM2 A;  3GR1 A;  3UOW A;  4DV4 C;  5BSU A;  5K85 A;  4BSZ A;  3LAX A;  5BUQ A;  2E8F A;  3UZ0 A;  3IPL A;  2D1R A;  3NI2 A;  4MH4 A;  2PT7 G;  4JI5 C;  4DV6 C;  2OO4 A;  1XNQ C;  4G1I A;  4KTV A;  2P2B A;  3JAM D;  5LMN C;  5KEI A;  4LF5 C;  1N34 C;  4LF4 C;  5T8S A;  4G37 A;  4X65 C;  4JI4 C;  3S82 A;  3GKU A;  4L7I A;  1MXC A;  3N54 B;  2ATW A;  4IZ6 A;  4NXM C;  1L2F A;  3L8C A;  3CW9 A;  5IFI A;  2UUC C;  4OXI A;  4D4I A;  4LFA C;  2QVY X;  1O90 A;  5T8T A;  1LQL A;  4I9G A;  5JRH A;  4JI1 C;  4LF8 C;  2YWB A;  2V7B A;  4OYC A;  4G36 A;  5BST A;  1N32 C;  3RV2 A;  4BCA A;  1XRB A;  2E7G A;  3PES A;  3VNR A;  5LMU C;  3VNQ A;  3E7W A;  5FLX D;  2QVX X;  2BH1 X;  2OPL B;  4BBY A;  1QWI A;  1O93 A;  4DR3 C;  4DR6 C;  1GPM A;  4ODJ A;  4GXR A;  3R9X A;  1XMO C;  5BSV A;  2PRO A;  5A1I A;  4R0M A;  1ZB9 A;  3A9V A;  2VQF C;  1MDF A;  2D28 C;  4GKK C;  2JMP A;  4JI2 C;  3TDE A;  3IML A;  1UKK A;  5BSW A;  3J80 D;  1ULT A;  2PN2 A;  1KKG A;  4GXQ A;  2QL8 A;  3DAY A;  4KHP C;  2AYA A;  2VSQ A;  3GR0 A;  3AF6 A;  3PRO C;  3OTO C;  2UXC C;  1IBK C;  1ZB8 A;  4TPS B;  1MD9 A;  3DLP X;  4PRO C;  5BUS A;  4BC7 A;  1IBL C;  3PBK A;  3NYR A;  3CW8 X;  2CXC A;  1V26 A;  3I07 A;  2HJG A;  4PHT A;  1HR0 C;  2WD9 A;  2YCB A;  2D7V A;  3T1Y C;  5IT9 D;  4B3M C;  1PA4 A;  1FUG A;  1ML8 A;  1VLA A;  4R1L A;  5IWA C;  4LF9 C;  1T5D X;  2D1Q A;  2YWC A;  4DV0 C;  5DV9 A;  3R9W A;  4B3S C;  3FCE A;  4DG9 A;  1PG3 A;  4DV2 C;  4JI7 C;  4K0B A;  5E7Q A;  4DR2 C;  4FUT A;  2UU9 C;  3L95 X;  5BUR A;  1BA3 A;  1XNR C;  1MDB A;  4U5Y D;  5A2Q D;  4JI8 C;  2Y4O A;  2P02 A;  5AE3 A;  4FUQ A;  4RLQ A;  1AMU A;  5K8F A;  4RMN A;  2ONF A;  4DCT A;  3LNV A;  1QM4 A;  4LF7 C;  1HH2 P;  1N36 C;  1WF3 A;  3NYQ A;  4NDN A;  2Y27 A;  4KTT A;  4L2Z A;  2QVZ X;  3E7X A;  2VZE A;  4MTN A;  2D1S A;  4B3T C;  1I94 C;  5ADZ A;  3FCC A;  2UXB C;  1HNX C;  4DG8 A;  2P2F A;  3C5E A;  1P7L A;  5AE1 A;  4DR5 C;  1IBM C;  3R44 A;  3EQ6 A;  4JYA C;  4RVO A;  2E0G A;  3ETC A;  3J7A D;  4DCV A;  3LUS A;  4AQY C;  1USP B;  4IR7 A;  1WH9 A;  2XR1 A;  2P2Q A;  1HNW C;  3EER A;  4DUY C;  4DV1 C;  2BJO A;  3ETO A;  5CZV A;  3CJE A;  3A4I A;  1MXA A;  4DCU A;  3I08 A;  4RLF A;  4XX2 A;  1O9T A;  2UUB C;  1USP A;  1V25 A;  3AF5 A;  5BSR A;  1J5E C;  4DR7 C;  1LCI A;  4RVN A;  4LFC C;  3IEV A;  1XRC A;  1N2F A;  5A19 A;  3J81 D;  3T1H C;  4BC9 A;  4L4Q A;  4YHH C;  4JI3 C;  2P2J A;  3NPD A;  3DHV A;  4HPV A;  4NOZ A;  4R1M A;  5CZX A;  4DCS A;  4OX9 C;  4DV3 C;  2Y4N A;  4X64 C;  1T5H X;  4B3R C;  3N2Q A;  2F4V C;  5KYV A;  3SO4 A;  2UUA C;  2UXD C;  2ZM6 C;  5BR8 C;  2P2M A;  2ASB A;  4ZJZ A;  1NYE A;  4RM3 A;  3KXW A;  4DR1 C;  5A1G A;  4DUZ C;  2HHH C;  1HNZ C;  2KZF A;  2OPL A;  5H9U A;  5BSM A;  2DYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...