4LF7C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 54
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf7C02
4DCVA 2VQFC 4B3SC 1USPA 3EERA 3J80D 1N33C 2ASBA 4DV2C 4LF9C 4KHPC 1VLAA 4DR6C 4MTNA 5BR8C 1WF3A 4NXMC 4JI1C 3OTOC 1NYEA 4LF6C 1HH2P 2DYJA 4DV5C 5LMUC 1ZB8A 3LUSA 1HR0C 5IWAC 2PN2A 3CJEA 1XMOC 4B3RC 4X64C 1N36C 4AQYC 1IBKC 1LQLA 4LF8C 4JI2C 1HNWC 4DUYC 1KKGA 3JAMD 5A2QD 4JI5C 2EGTA 1XNRC 4JI7C 4X62C 4XX2A 2E5LC 1N34C 1WH9A 4DV7C 3R9XA 2HHHC 3R9WA 4JV5C 4DR5C 4NXNC 4LFAC 1IBMC 4X66C 4B3MC 2VQEC 4DUZC 1HNXC 4DCSA 4DV6C 4GKKC 2F4VC 1J5EC 2D7VA 4DCTA 1I94C 3T1YC 1N32C 2UXCC 1PA4A 2UUCC 4JI4C 1ZB9A 4DR3C 4JI8C 2JMPA 3IEVA 2ATWA 4DV0C 4DR1C 4MH4A 1FJGC 4LFCC 4LF5C 2QL8A 5FLXD 4X65C 2UUAC 2UUBC 2PT7G 4DR7C 1ML8A 1XNQC 4DV3C 2XR1A 3IEUA 4JI3C 2E8CA 3T1HC 2OPLB 2UXBC 1HNZC 4BSZA 2KZFA 2BJOA 3J7AD 1K0RA 1L2FA 1JOSA 4DV4C 3J81D 2HJGA 5LMNC 4NOZA 2E8FA 2UU9C 1UKKA 4GKJC 2ZM6C 4B3TC 3AF6A 5IT9D 4K0KC 4JI6C 1EGAA 4DR4C 4DV1C 4DCUA 4DR2C 1XMQC 2UXDC 4YY3C 2OPLA 1QWIA 1USPB 1IBLC 4JYAC 2CY1A 4LF4C 2E7GA 2ONFA 2YCBA 4JI0C 1MKYA 2E8EA 3I07A 4LFBC 1N2FA 3GKUA 4OX9C 4YHHC 2CXCA 4LF7C 3AF5A
chains in the Genus database with same CATH superfamily
1RY2A 2P2FA 2VSQA 1N33C 4R0MA 4DV2C 4LF9C 4KHPC 5AE1A 4D57A 3L95X 3TQIA 1WF3A 1NYEA 4RMNA 1P4EA 3VNSA 3CJEA 1O93A 4FUQA 1XMOC 4B3RC 4PUIA 2MM9A 5BUSA 1N36C 4JI7C 5DV9A 2P2QA 1XRCA 4DG8A 2D1RA 3E7WA 4DV7C 3R9XA 2HHHC 5BSTA 1M6XA 4L4QA 4X66C 5T8TA 4ODJA 4B3MC 2VQEC 3GR0A 5ADZA 2JNVA 2F4VC 2ZTBA 3UX3A 1V26A 4R1LA 2Y4NA 3IEVA 2ATWA 3IPLA 1PU1A 1FJGC 4LF5C 1T5HX 3S82A 2QL8A 5BSMA 5FLXD 2E0GA 3CQ1A 3L8CA 2UUBC 5KEIA 2WP0C 1P4EC 1YGTA 4WS9A 1TH5A 3PROC 1PG4A 4TPSB 2ZZMA 3T1HC 4EATA 2OPLB 2P20A 4BSZA 3J7AD 2UU9C 4BBYA 4GKJC 4L2ZA 2ZM6C 3R44A 4K0KC 3SO4A 3DLPX 2DPLA 3NPDA 2OPLA 1IBLC 1V60A 1QM4A 2YWCA 2CY1A 3RG2A 4RLFA 4OYCA 4IR7A 1N2FA 3GKUA 2M5HA 3DAYA 4LF7C 3AF5A 4DCVA 5A1GA 3VNQA 3E7XA 4OXIA 1MXBA 4DG9A 4DR6C 4MTNA 5BR8C 4NXMC 1UWDA 2DYJA 5CZVA 1ZB8A 4PUHA 1HR0C 5IWAC 2PN2A 1O92A 4PHTA 2YWBA 5E7QA 2Y27A 4X64C 3A4IA 4AQYC 4JI2C 1KKGA 3TUFA 4JI5C 5BSWA 3A26A 2D28C 1NY8A 4X62C 1XHJA 1YJ7A 2QVYX 5BURA 3LNOA 4DR5C 4LFAC 1HNXC 4DCSA 1WCJA 1J5EC 4DCTA 1I94C 1N32C 3DHVA 5CZXA 3O2EA 4DR3C 1ULTA 4G1IA 2MCQA 4X65C 1O90A 3NYQA 2UUAC 4I9GA 4R1MA 2D1SA 3TR3A 2Z51A 2NCLA 3IEUA 2E8CA 4GXQA 5KYVA 3PBKA 2BJOA 5A19A 5T8SA 1L2FA 1RG9A 2HJGA 3N2QA 3NI2A 4B3TC 4RM2A 3UEBA 1MDBA 2V7BA 1GPMA 1XRBA 5GTDA 4DR4C 4DCUA 3H2TA 2UXDC 4RVNA 5BSRA 4BC7A 1USPB 3A9VA 1XRAA 4RVOA 2E7GA 4HPVA 4G36A 4JI0C 2E8EA 1VEHA 4OX9C 5IFIA 2VQFC 5K85A 3C5EA 4B3SC 1USPA 2OO4A 3EERA 4FUTA 3J80D 2ASBA 3LNVA 4PROC 1M6XC 2QVZX 4D4IA 4LF6C 3EQ6A 5LMUC 3B7WA 3LUSA 3CW9A 4ISBA 3GR1A 1AMUA 3G7SA 4ZJZA 1IBKC 4LF8C 3PESA 1O9TA 4U5YD 2YX1A 3TDEA 3UZ0A 3K6RA 4RLQA 1T5DX 5BUQA 4XX2A 3NYRA 1MDFA 5KYTA 1IBMC 2D27A 1BA3A 4G37A 2PROA 4DV6C 2P2JA 3T1YC 2UXCC 2UUCC 4JI4C 1ZB9A 4JI8C 4BC9A 4MH4A 4LFCC 5LCIA 3ETCA 2QW0X 3ETOA 3FCCA 2WD9A 2P2MA 4DR7C 1XNQC 4BCAA 3LAXA 2XR1A 4JI3C 4D4GA 2P02A 2UXBC 3LGXA 1HNZC 3CQ2A 1K0RA 1JOSA 4KTVA 2QVXX 3CQ3A 4LE5A 1UKKA 2OBVA 1IB8A 2D1TA 2KZ0A 5IT9D 4JI6C 3CW8X 3N54B 4DV1C 2CU6A 3FCEA 2D1QA 1QWIA 4GXRA 4WV3A 5JRHA 2ZZNA 2MMAB 3I07A 2DHMA 4YHHC 2CXCA 3FM7A 4PZPA 3GPCA 2Y4OA 1XDXA 4NDNA 1VLAA 4PUGA 4JI1C 3OTOC 1HH2P 4DV5C 4D56A 3A9UA 1P7LA 3RV2A 1LQLA 5BSUA 1HNWC 4DUYC 3JAMD 5A2QD 2EGTA 1XNRC 1MD9A 2KDNA 5A1IA 5H9UA 2AYAA 1N34C 2E5LC 4FTFA 1MXCA 1WH9A 3R9WA 4JV5C 1V25A 4NXNC 4I9FA 4DUZC 4IZ6A 4GKKC 2D7VA 2PG1E 1PA4A 3UOWA 3KXWA 2JMPA 4DV0C 4DR1C 2BH1X 3IMLA 1XS3A 1PG3A 1MXAA 2PT7G 5AE3A 1ML8A 5AE2A 4DV3C 1FLOA 3AY0A 4ZLPA 2KZFA 4DV4C 3J81D 5LMNC 4NOZA 2E8FA 3UX2A 5K8FA 1LCIA 1FUGA 3AF6A 1EGAA 2P2BA 4DR2C 1XMQC 4KTTA 4YY3C 4JYAC 2M5OA 4L7IA 5BSVA 3A25A 2VZEA 3VNRA 4LF4C 4GS5A 2ONFA 2YCBA 3I08A 1MKYA 4JM1A 4RM3A 4LFBC 4K0BA
chains in the Genus database with same CATH topology
1RY2A 2P2FA 2VSQA 1N33C 4R0MA 4DV2C 4LF9C 4KHPC 5AE1A 4D57A 3L95X 3TQIA 1WF3A 1NYEA 4RMNA 3VNSA 3CJEA 1O93A 4FUQA 1XMOC 4B3RC 5BUSA 1N36C 4JI7C 5DV9A 2P2QA 1XRCA 4DG8A 2D1RA 3E7WA 4DV7C 3R9XA 2HHHC 5BSTA 4L4QA 4X66C 5T8TA 4ODJA 4B3MC 2VQEC 3GR0A 5ADZA 2F4VC 1V26A 4R1LA 2Y4NA 3IEVA 2ATWA 3IPLA 1FJGC 4LF5C 1T5HX 3S82A 2QL8A 5BSMA 5FLXD 2E0GA 3L8CA 2UUBC 5KEIA 2WP0C 4WS9A 3PROC 1PG4A 4TPSB 3T1HC 4EATA 2OPLB 2P20A 4BSZA 3J7AD 2UU9C 4BBYA 4GKJC 4L2ZA 2ZM6C 3R44A 4K0KC 3SO4A 3DLPX 2DPLA 3NPDA 2OPLA 1IBLC 1QM4A 2YWCA 2CY1A 3RG2A 4RLFA 4OYCA 4IR7A 1N2FA 3GKUA 3DAYA 4LF7C 3AF5A 4DCVA 5A1GA 3VNQA 3E7XA 4OXIA 1MXBA 4DG9A 4DR6C 4MTNA 5BR8C 4NXMC 2DYJA 5CZVA 1ZB8A 1HR0C 5IWAC 2PN2A 1O92A 4PHTA 2YWBA 5E7QA 2Y27A 4X64C 3A4IA 4AQYC 4JI2C 1KKGA 3TUFA 4JI5C 5BSWA 2D28C 4X62C 1YJ7A 2QVYX 5BURA 4DR5C 4LFAC 1HNXC 4DCSA 1J5EC 4DCTA 1I94C 1N32C 3DHVA 5CZXA 4DR3C 1ULTA 4G1IA 4X65C 1O90A 3NYQA 2UUAC 4I9GA 4R1MA 2D1SA 3IEUA 2E8CA 4GXQA 5KYVA 3PBKA 2BJOA 5A19A 5T8SA 1L2FA 1RG9A 2HJGA 3N2QA 3NI2A 4B3TC 4RM2A 1MDBA 2V7BA 1GPMA 1XRBA 5GTDA 4DR4C 4DCUA 3H2TA 2UXDC 4RVNA 5BSRA 4BC7A 1USPB 3A9VA 1XRAA 4RVOA 2E7GA 4HPVA 4G36A 4JI0C 2E8EA 4OX9C 5IFIA 2VQFC 5K85A 3C5EA 4B3SC 1USPA 2OO4A 3EERA 4FUTA 3J80D 2ASBA 3LNVA 4PROC 2QVZX 4D4IA 4LF6C 3EQ6A 5LMUC 3B7WA 3LUSA 3CW9A 4ISBA 3GR1A 1AMUA 3G7SA 4ZJZA 1IBKC 4LF8C 3PESA 1O9TA 4U5YD 3TDEA 3UZ0A 4RLQA 1T5DX 5BUQA 4XX2A 3NYRA 1MDFA 5KYTA 1IBMC 2D27A 1BA3A 4G37A 2PROA 4DV6C 2P2JA 3T1YC 2UXCC 2UUCC 4JI4C 1ZB9A 4JI8C 4BC9A 4MH4A 4LFCC 3ETCA 2QW0X 3ETOA 3FCCA 2WD9A 2P2MA 4DR7C 1XNQC 4BCAA 3LAXA 2XR1A 4JI3C 4D4GA 2P02A 2UXBC 3LGXA 1HNZC 1K0RA 1JOSA 4KTVA 2QVXX 4LE5A 1UKKA 2OBVA 2D1TA 5IT9D 4JI6C 3CW8X 3N54B 4DV1C 3FCEA 2D1QA 1QWIA 4GXRA 4WV3A 5JRHA 3I07A 4YHHC 2CXCA 4PZPA 3GPCA 2Y4OA 4NDNA 1VLAA 4JI1C 3OTOC 1HH2P 4DV5C 4D56A 3A9UA 1P7LA 3RV2A 1LQLA 5BSUA 1HNWC 4DUYC 3JAMD 5A2QD 2EGTA 1XNRC 1MD9A 5A1IA 5H9UA 2AYAA 1N34C 2E5LC 4FTFA 1MXCA 1WH9A 3R9WA 4JV5C 1V25A 4NXNC 4I9FA 4DUZC 4IZ6A 4GKKC 2D7VA 1PA4A 3UOWA 3KXWA 2JMPA 4DV0C 4DR1C 2BH1X 3IMLA 1PG3A 1MXAA 2PT7G 5AE3A 1ML8A 5AE2A 4DV3C 4ZLPA 2KZFA 4DV4C 3J81D 5LMNC 4NOZA 2E8FA 1LCIA 1FUGA 5K8FA 3AF6A 1EGAA 2P2BA 4DR2C 1XMQC 4KTTA 4YY3C 4JYAC 4L7IA 5BSVA 2VZEA 3VNRA 4LF4C 4GS5A 2ONFA 2YCBA 3I08A 1MKYA 4JM1A 4RM3A 4LFBC 4K0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCV A;  2VQF C;  4B3S C;  1USP A;  3EER A;  3J80 D;  1N33 C;  2ASB A;  4DV2 C;  4LF9 C;  4KHP C;  1VLA A;  4DR6 C;  4MTN A;  5BR8 C;  1WF3 A;  4NXM C;  4JI1 C;  3OTO C;  1NYE A;  4LF6 C;  1HH2 P;  2DYJ A;  4DV5 C;  5LMU C;  1ZB8 A;  3LUS A;  1HR0 C;  5IWA C;  2PN2 A;  3CJE A;  1XMO C;  4B3R C;  4X64 C;  1N36 C;  4AQY C;  1IBK C;  1LQL A;  4LF8 C;  4JI2 C;  1HNW C;  4DUY C;  1KKG A;  3JAM D;  5A2Q D;  4JI5 C;  2EGT A;  1XNR C;  4JI7 C;  4X62 C;  4XX2 A;  2E5L C;  1N34 C;  1WH9 A;  4DV7 C;  3R9X A;  2HHH C;  3R9W A;  4JV5 C;  4DR5 C;  4NXN C;  4LFA C;  1IBM C;  4X66 C;  4B3M C;  2VQE C;  4DUZ C;  1HNX C;  4DCS A;  4DV6 C;  4GKK C;  2F4V C;  1J5E C;  2D7V A;  4DCT A;  1I94 C;  3T1Y C;  1N32 C;  2UXC C;  1PA4 A;  2UUC C;  4JI4 C;  1ZB9 A;  4DR3 C;  4JI8 C;  2JMP A;  3IEV A;  2ATW A;  4DV0 C;  4DR1 C;  4MH4 A;  1FJG C;  4LFC C;  4LF5 C;  2QL8 A;  5FLX D;  4X65 C;  2UUA C;  2UUB C;  2PT7 G;  4DR7 C;  1ML8 A;  1XNQ C;  4DV3 C;  2XR1 A;  3IEU A;  4JI3 C;  2E8C A;  3T1H C;  2OPL B;  2UXB C;  1HNZ C;  4BSZ A;  2KZF A;  2BJO A;  3J7A D;  1K0R A;  1L2F A;  1JOS A;  4DV4 C;  3J81 D;  2HJG A;  5LMN C;  4NOZ A;  2E8F A;  2UU9 C;  1UKK A;  4GKJ C;  2ZM6 C;  4B3T C;  3AF6 A;  5IT9 D;  4K0K C;  4JI6 C;  1EGA A;  4DR4 C;  4DV1 C;  4DCU A;  4DR2 C;  1XMQ C;  2UXD C;  4YY3 C;  2OPL A;  1QWI A;  1USP B;  1IBL C;  4JYA C;  2CY1 A;  4LF4 C;  2E7G A;  2ONF A;  2YCB A;  4JI0 C;  1MKY A;  2E8E A;  3I07 A;  4LFB C;  1N2F A;  3GKU A;  4OX9 C;  4YHH C;  2CXC A;  4LF7 C;  3AF5 A; 
#chains in the Genus database with same CATH topology
 1RY2 A;  2P2F A;  2VSQ A;  1N33 C;  4R0M A;  4DV2 C;  4LF9 C;  4KHP C;  5AE1 A;  4D57 A;  3L95 X;  3TQI A;  1WF3 A;  1NYE A;  4RMN A;  1P4E A;  3VNS A;  3CJE A;  1O93 A;  4FUQ A;  1XMO C;  4B3R C;  4PUI A;  2MM9 A;  5BUS A;  1N36 C;  4JI7 C;  5DV9 A;  2P2Q A;  1XRC A;  4DG8 A;  2D1R A;  3E7W A;  4DV7 C;  3R9X A;  2HHH C;  5BST A;  1M6X A;  4L4Q A;  4X66 C;  5T8T A;  4ODJ A;  4B3M C;  2VQE C;  3GR0 A;  5ADZ A;  2JNV A;  2F4V C;  2ZTB A;  3UX3 A;  1V26 A;  4R1L A;  2Y4N A;  3IEV A;  2ATW A;  3IPL A;  1PU1 A;  1FJG C;  4LF5 C;  1T5H X;  3S82 A;  2QL8 A;  5BSM A;  5FLX D;  2E0G A;  3CQ1 A;  3L8C A;  2UUB C;  5KEI A;  2WP0 C;  1P4E C;  1YGT A;  4WS9 A;  1TH5 A;  3PRO C;  1PG4 A;  4TPS B;  2ZZM A;  3T1H C;  4EAT A;  2OPL B;  2P20 A;  4BSZ A;  3J7A D;  2UU9 C;  4BBY A;  4GKJ C;  4L2Z A;  2ZM6 C;  3R44 A;  4K0K C;  3SO4 A;  3DLP X;  2DPL A;  3NPD A;  2OPL A;  1IBL C;  1V60 A;  1QM4 A;  2YWC A;  2CY1 A;  3RG2 A;  4RLF A;  4OYC A;  4IR7 A;  1N2F A;  3GKU A;  2M5H A;  3DAY A;  4LF7 C;  3AF5 A;  4DCV A;  5A1G A;  3VNQ A;  3E7X A;  4OXI A;  1MXB A;  4DG9 A;  4DR6 C;  4MTN A;  5BR8 C;  4NXM C;  1UWD A;  2DYJ A;  5CZV A;  1ZB8 A;  4PUH A;  1HR0 C;  5IWA C;  2PN2 A;  1O92 A;  4PHT A;  2YWB A;  5E7Q A;  2Y27 A;  4X64 C;  3A4I A;  4AQY C;  4JI2 C;  1KKG A;  3TUF A;  4JI5 C;  5BSW A;  3A26 A;  2D28 C;  1NY8 A;  4X62 C;  1XHJ A;  1YJ7 A;  2QVY X;  5BUR A;  3LNO A;  4DR5 C;  4LFA C;  1HNX C;  4DCS A;  1WCJ A;  1J5E C;  4DCT A;  1I94 C;  1N32 C;  3DHV A;  5CZX A;  3O2E A;  4DR3 C;  1ULT A;  4G1I A;  2MCQ A;  4X65 C;  1O90 A;  3NYQ A;  2UUA C;  4I9G A;  4R1M A;  2D1S A;  3TR3 A;  2Z51 A;  2NCL A;  3IEU A;  2E8C A;  4GXQ A;  5KYV A;  3PBK A;  2BJO A;  5A19 A;  5T8S A;  1L2F A;  1RG9 A;  2HJG A;  3N2Q A;  3NI2 A;  4B3T C;  4RM2 A;  3UEB A;  1MDB A;  2V7B A;  1GPM A;  1XRB A;  5GTD A;  4DR4 C;  4DCU A;  3H2T A;  2UXD C;  4RVN A;  5BSR A;  4BC7 A;  1USP B;  3A9V A;  1XRA A;  4RVO A;  2E7G A;  4HPV A;  4G36 A;  4JI0 C;  2E8E A;  1VEH A;  4OX9 C;  5IFI A;  2VQF C;  5K85 A;  3C5E A;  4B3S C;  1USP A;  2OO4 A;  3EER A;  4FUT A;  3J80 D;  2ASB A;  3LNV A;  4PRO C;  1M6X C;  2QVZ X;  4D4I A;  4LF6 C;  3EQ6 A;  5LMU C;  3B7W A;  3LUS A;  3CW9 A;  4ISB A;  3GR1 A;  1AMU A;  3G7S A;  4ZJZ A;  1IBK C;  4LF8 C;  3PES A;  1O9T A;  4U5Y D;  2YX1 A;  3TDE A;  3UZ0 A;  3K6R A;  4RLQ A;  1T5D X;  5BUQ A;  4XX2 A;  3NYR A;  1MDF A;  5KYT A;  1IBM C;  2D27 A;  1BA3 A;  4G37 A;  2PRO A;  4DV6 C;  2P2J A;  3T1Y C;  2UXC C;  2UUC C;  4JI4 C;  1ZB9 A;  4JI8 C;  4BC9 A;  4MH4 A;  4LFC C;  5LCI A;  3ETC A;  2QW0 X;  3ETO A;  3FCC A;  2WD9 A;  2P2M A;  4DR7 C;  1XNQ C;  4BCA A;  3LAX A;  2XR1 A;  4JI3 C;  4D4G A;  2P02 A;  2UXB C;  3LGX A;  1HNZ C;  3CQ2 A;  1K0R A;  1JOS A;  4KTV A;  2QVX X;  3CQ3 A;  4LE5 A;  1UKK A;  2OBV A;  1IB8 A;  2D1T A;  2KZ0 A;  5IT9 D;  4JI6 C;  3CW8 X;  3N54 B;  4DV1 C;  2CU6 A;  3FCE A;  2D1Q A;  1QWI A;  4GXR A;  4WV3 A;  5JRH A;  2ZZN A;  2MMA B;  3I07 A;  2DHM A;  4YHH C;  2CXC A;  3FM7 A;  4PZP A;  3GPC A;  2Y4O A;  1XDX A;  4NDN A;  1VLA A;  4PUG A;  4JI1 C;  3OTO C;  1HH2 P;  4DV5 C;  4D56 A;  3A9U A;  1P7L A;  3RV2 A;  1LQL A;  5BSU A;  1HNW C;  4DUY C;  3JAM D;  5A2Q D;  2EGT A;  1XNR C;  1MD9 A;  2KDN A;  5A1I A;  5H9U A;  2AYA A;  1N34 C;  2E5L C;  4FTF A;  1MXC A;  1WH9 A;  3R9W A;  4JV5 C;  1V25 A;  4NXN C;  4I9F A;  4DUZ C;  4IZ6 A;  4GKK C;  2D7V A;  2PG1 E;  1PA4 A;  3UOW A;  3KXW A;  2JMP A;  4DV0 C;  4DR1 C;  2BH1 X;  3IML A;  1XS3 A;  1PG3 A;  1MXA A;  2PT7 G;  5AE3 A;  1ML8 A;  5AE2 A;  4DV3 C;  1FLO A;  3AY0 A;  4ZLP A;  2KZF A;  4DV4 C;  3J81 D;  5LMN C;  4NOZ A;  2E8F A;  3UX2 A;  5K8F A;  1LCI A;  1FUG A;  3AF6 A;  1EGA A;  2P2B A;  4DR2 C;  1XMQ C;  4KTT A;  4YY3 C;  4JYA C;  2M5O A;  4L7I A;  5BSV A;  3A25 A;  2VZE A;  3VNR A;  4LF4 C;  4GS5 A;  2ONF A;  2YCB A;  3I08 A;  1MKY A;  4JM1 A;  4RM3 A;  4LFB C;  4K0B A; 
#chains in the Genus database with same CATH homology
 1RY2 A;  2P2F A;  2VSQ A;  1N33 C;  4R0M A;  4DV2 C;  4LF9 C;  4KHP C;  5AE1 A;  4D57 A;  3L95 X;  3TQI A;  1WF3 A;  1NYE A;  4RMN A;  3VNS A;  3CJE A;  1O93 A;  4FUQ A;  1XMO C;  4B3R C;  5BUS A;  1N36 C;  4JI7 C;  5DV9 A;  2P2Q A;  1XRC A;  4DG8 A;  2D1R A;  3E7W A;  4DV7 C;  3R9X A;  2HHH C;  5BST A;  4L4Q A;  4X66 C;  5T8T A;  4ODJ A;  4B3M C;  2VQE C;  3GR0 A;  5ADZ A;  2F4V C;  1V26 A;  4R1L A;  2Y4N A;  3IEV A;  2ATW A;  3IPL A;  1FJG C;  4LF5 C;  1T5H X;  3S82 A;  2QL8 A;  5BSM A;  5FLX D;  2E0G A;  3L8C A;  2UUB C;  5KEI A;  2WP0 C;  4WS9 A;  3PRO C;  1PG4 A;  4TPS B;  3T1H C;  4EAT A;  2OPL B;  2P20 A;  4BSZ A;  3J7A D;  2UU9 C;  4BBY A;  4GKJ C;  4L2Z A;  2ZM6 C;  3R44 A;  4K0K C;  3SO4 A;  3DLP X;  2DPL A;  3NPD A;  2OPL A;  1IBL C;  1QM4 A;  2YWC A;  2CY1 A;  3RG2 A;  4RLF A;  4OYC A;  4IR7 A;  1N2F A;  3GKU A;  3DAY A;  4LF7 C;  3AF5 A;  4DCV A;  5A1G A;  3VNQ A;  3E7X A;  4OXI A;  1MXB A;  4DG9 A;  4DR6 C;  4MTN A;  5BR8 C;  4NXM C;  2DYJ A;  5CZV A;  1ZB8 A;  1HR0 C;  5IWA C;  2PN2 A;  1O92 A;  4PHT A;  2YWB A;  5E7Q A;  2Y27 A;  4X64 C;  3A4I A;  4AQY C;  4JI2 C;  1KKG A;  3TUF A;  4JI5 C;  5BSW A;  2D28 C;  4X62 C;  1YJ7 A;  2QVY X;  5BUR A;  4DR5 C;  4LFA C;  1HNX C;  4DCS A;  1J5E C;  4DCT A;  1I94 C;  1N32 C;  3DHV A;  5CZX A;  4DR3 C;  1ULT A;  4G1I A;  4X65 C;  1O90 A;  3NYQ A;  2UUA C;  4I9G A;  4R1M A;  2D1S A;  3IEU A;  2E8C A;  4GXQ A;  5KYV A;  3PBK A;  2BJO A;  5A19 A;  5T8S A;  1L2F A;  1RG9 A;  2HJG A;  3N2Q A;  3NI2 A;  4B3T C;  4RM2 A;  1MDB A;  2V7B A;  1GPM A;  1XRB A;  5GTD A;  4DR4 C;  4DCU A;  3H2T A;  2UXD C;  4RVN A;  5BSR A;  4BC7 A;  1USP B;  3A9V A;  1XRA A;  4RVO A;  2E7G A;  4HPV A;  4G36 A;  4JI0 C;  2E8E A;  4OX9 C;  5IFI A;  2VQF C;  5K85 A;  3C5E A;  4B3S C;  1USP A;  2OO4 A;  3EER A;  4FUT A;  3J80 D;  2ASB A;  3LNV A;  4PRO C;  2QVZ X;  4D4I A;  4LF6 C;  3EQ6 A;  5LMU C;  3B7W A;  3LUS A;  3CW9 A;  4ISB A;  3GR1 A;  1AMU A;  3G7S A;  4ZJZ A;  1IBK C;  4LF8 C;  3PES A;  1O9T A;  4U5Y D;  3TDE A;  3UZ0 A;  4RLQ A;  1T5D X;  5BUQ A;  4XX2 A;  3NYR A;  1MDF A;  5KYT A;  1IBM C;  2D27 A;  1BA3 A;  4G37 A;  2PRO A;  4DV6 C;  2P2J A;  3T1Y C;  2UXC C;  2UUC C;  4JI4 C;  1ZB9 A;  4JI8 C;  4BC9 A;  4MH4 A;  4LFC C;  3ETC A;  2QW0 X;  3ETO A;  3FCC A;  2WD9 A;  2P2M A;  4DR7 C;  1XNQ C;  4BCA A;  3LAX A;  2XR1 A;  4JI3 C;  4D4G A;  2P02 A;  2UXB C;  3LGX A;  1HNZ C;  1K0R A;  1JOS A;  4KTV A;  2QVX X;  4LE5 A;  1UKK A;  2OBV A;  2D1T A;  5IT9 D;  4JI6 C;  3CW8 X;  3N54 B;  4DV1 C;  3FCE A;  2D1Q A;  1QWI A;  4GXR A;  4WV3 A;  5JRH A;  3I07 A;  4YHH C;  2CXC A;  4PZP A;  3GPC A;  2Y4O A;  4NDN A;  1VLA A;  4JI1 C;  3OTO C;  1HH2 P;  4DV5 C;  4D56 A;  3A9U A;  1P7L A;  3RV2 A;  1LQL A;  5BSU A;  1HNW C;  4DUY C;  3JAM D;  5A2Q D;  2EGT A;  1XNR C;  1MD9 A;  5A1I A;  5H9U A;  2AYA A;  1N34 C;  2E5L C;  4FTF A;  1MXC A;  1WH9 A;  3R9W A;  4JV5 C;  1V25 A;  4NXN C;  4I9F A;  4DUZ C;  4IZ6 A;  4GKK C;  2D7V A;  1PA4 A;  3UOW A;  3KXW A;  2JMP A;  4DV0 C;  4DR1 C;  2BH1 X;  3IML A;  1PG3 A;  1MXA A;  2PT7 G;  5AE3 A;  1ML8 A;  5AE2 A;  4DV3 C;  4ZLP A;  2KZF A;  4DV4 C;  3J81 D;  5LMN C;  4NOZ A;  2E8F A;  1LCI A;  1FUG A;  5K8F A;  3AF6 A;  1EGA A;  2P2B A;  4DR2 C;  1XMQ C;  4KTT A;  4YY3 C;  4JYA C;  4L7I A;  5BSV A;  2VZE A;  3VNR A;  4LF4 C;  4GS5 A;  2ONF A;  2YCB A;  3I08 A;  1MKY A;  4JM1 A;  4RM3 A;  4LFB C;  4K0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...