4LF7C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 54
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf7C02
4X62C 4OX9C 4LFCC 3OTOC 2DYJA 1WH9A 1MKYA 2YCBA 4B3TC 5IWAC 4DCSA 4LFBC 2QL8A 1ZB8A 3GKUA 1ML8A 4JYAC 4DUZC 4DR5C 1IBKC 2XR1A 1N36C 2OPLB 1HNZC 4X64C 1XNRC 1WF3A 4LF9C 2E8EA 4GKKC 1HH2P 2BJOA 3CJEA 4LF7C 3J80D 3R9WA 1NYEA 1QWIA 4AQYC 4MH4A 2E7GA 2F4VC 2VQEC 2UXDC 4DV7C 1I94C 4JI0C 2VQFC 2HHHC 1XNQC 5LMUC 2UUCC 1PA4A 3I07A 2E8CA 4JI6C 3IEVA 4YY3C 3IEUA 4DV2C 4JI3C 2UUBC 2EGTA 4DR3C 2E8FA 4LF8C 3J81D 3T1YC 1N2FA 2PT7G 3EERA 1LQLA 5A2QD 4LF4C 4NXMC 4LFAC 4XX2A 2KZFA 1L2FA 4DCUA 3T1HC 2D7VA 2UUAC 1N32C 1FJGC 4GKJC 4JI7C 1USPB 2OPLA 2JMPA 4LF5C 4DCTA 4NXNC 4DV4C 4B3RC 4JI4C 4X66C 1USPA 4DV1C 2HJGA 1N34C 4JV5C 4DR4C 4DV0C 1EGAA 4DCVA 4JI8C 4JI1C 1VLAA 2CY1A 3AF5A 1ZB9A 2ASBA 2UU9C 1N33C 4DR6C 2UXBC 4B3MC 4NOZA 1IBLC 3AF6A 2E5LC 1HNWC 4DR7C 1HNXC 4K0KC 1IBMC 2CXCA 4DV6C 4DR1C 4KHPC 3J7AD 2PN2A 1HR0C 4DV3C 4BSZA 4JI2C 5FLXD 5LMNC 2ZM6C 3JAMD 3LUSA 4DR2C 4DV5C 1UKKA 4LF6C 3R9XA 1XMQC 1KKGA 1K0RA 4B3SC 5BR8C 2UXCC 1XMOC 4MTNA 1JOSA 4YHHC 2ATWA 2ONFA 1J5EC 4JI5C 4X65C 4DUYC 5IT9D
chains in the Genus database with same CATH superfamily
5AE1A 4X62C 5IWAC 3CW8X 5BSUA 3IMLA 1ZB8A 4GS5A 4DR5C 4ZJZA 5AE2A 4D4IA 2XR1A 4FUTA 1V60A 3NYRA 2NCLA 3J80D 3VNSA 3L95X 3A9VA 3GPCA 4BBYA 4PUGA 4PUHA 5K8FA 3GR0A 5LMUC 4JI6C 2E8CA 3IEUA 3PESA 3NPDA 4JI3C 2UUBC 2EGTA 2P2JA 1N2FA 4NXMC 3I08A 4LFAC 1FJGC 3CQ1A 4GKJC 1USPB 2OPLA 2JMPA 1MD9A 4TPSB 1WCJA 4K0BA 2MM9A 4DCVA 3DAYA 4RMNA 4JI8C 4JI1C 2CY1A 1XRAA 2D1RA 2KDNA 4DR6C 1YGTA 3TR3A 5A1IA 4B3MC 2PG1E 3AF6A 1UWDA 5T8TA 2QVZX 1IBMC 2Y27A 5AE3A 2CXCA 2ZTBA 3FCEA 4G36A 4I9FA 3H2TA 4WS9A 1RY2A 2BH1X 5KEIA 3UOWA 2WP0C 4L7IA 1XMOC 3G7SA 2OO4A 4OX9C 1FUGA 3OTOC 4IZ6A 2DYJA 1NY8A 4B3TC 2P2QA 3GKUA 3LNOA 1ML8A 1O90A 3E7WA 1V25A 4JYAC 1IBKC 2D1TA 1N36C 5A19A 2OPLB 1XDXA 1XNRC 1QM4A 1MDBA 1O93A 1RG9A 3DHVA 5BSRA 3R9WA 4AQYC 2E7GA 2VQEC 2UXDC 1XS3A 2KZ0A 1P4EC 1XHJA 4DV2C 2D1QA 4LF8C 1T5DX 2D27A 1T5HX 2Y4NA 4HPVA 3ETOA 4XX2A 1L2FA 4DCUA 1MXBA 4LE5A 2P02A 2WD9A 1MXAA 2AYAA 5BSMA 4NXNC 4JI4C 2HJGA 4ODJA 2QVXX 1N34C 2MMAB 2M5OA 4DR4C 2DHMA 5E7QA 1PU1A 3AF5A 4GXRA 1N33C 3NYQA 3CQ3A 3TUFA 3C5EA 2VZEA 2VSQA 1HNWC 5CZVA 1PG4A 4DR7C 1HNXC 4K0KC 5BSWA 5BUQA 3K6RA 4ISBA 3J7AD 2PN2A 5H9UA 3JAMD 3LUSA 4DR2C 4DV5C 1FLOA 3R44A 2ZZNA 4LF6C 3R9XA 4PHTA 4B3SC 5BR8C 4G37A 4MTNA 2P2FA 2ZZMA 4X65C 3A4IA 4DUYC 4KTTA 4LFBC 1YJ7A 2QL8A 2YWBA 4BC9A 5JRHA 3NI2A 4DG9A 3ETCA 4NDNA 4D4GA 1HNZC 4X64C 1TH5A 1WF3A 4LF9C 3UX2A 4GKKC 4U5YD 2BJOA 4LF7C 3CJEA 3LNVA 3GR1A 1QWIA 5A1GA 3N54B 4D57A 2CU6A 4DV7C 4JI0C 2VQFC 5T8SA 4R0MA 1XRBA 3UZ0A 2UUCC 1PA4A 1VEHA 3I07A 4OYCA 1LCIA 4KTVA 2OBVA 5LCIA 3J81D 3T1YC 2PT7G 3EERA 1LQLA 3DLPX 2Y4OA 3T1HC 2UUAC 4EATA 3UX3A 1O9TA 5CZXA 1V26A 4JI7C 5IFIA 5BUSA 3PROC 4B3RC 4X66C 1USPA 2M5HA 3E7XA 3FM7A 1EGAA 4WV3A 2V7BA 1M6XC 5KYTA 1P4EA 2ASBA 1O92A 4L4QA 3TQIA 3KXWA 3IPLA 2UXBC 1M6XA 5BSVA 4NOZA 1IBLC 4GXQA 2E5LC 3EQ6A 3VNRA 4R1MA 4BCAA 1AMUA 4DV6C 4KHPC 5KYVA 4PUIA 3A26A 4IR7A 4DV3C 4BSZA 1HR0C 4JI2C 3SO4A 5FLXD 3VNQA 4ZLPA 5LMNC 2ZM6C 3B7WA 1XRCA 2QVYX 1XMQC 2D28C 4R1LA 3O2EA 2UXCC 4YHHC 2ATWA 2ONFA 3RV2A 1BA3A 4JI5C 5DV9A 1I94C 5IT9D 4LFCC 4JM1A 2Z51A 1ULTA 1WH9A 3FCCA 1MKYA 2YCBA 4DCSA 5GTDA 4RLQA 4RVNA 3AY0A 4RM3A 4DUZC 4D56A 2QW0X 4FTFA 1MDFA 2E8EA 3TDEA 1HH2P 3A25A 1NYEA 4MH4A 4PROC 4BC7A 2P20A 4I9GA 2F4VC 5BSTA 2YX1A 1MXCA 2HHHC 1GPMA 1XNQC 2P2MA 3IEVA 4YY3C 4DG8A 4DR3C 3LAXA 2E8FA 4RVOA 3PBKA 3RG2A 5A2QD 4LF4C 4OXIA 4G1IA 1P7LA 2E0GA 2KZFA 2YWCA 2D7VA 2PROA 1N32C 3S82A 2D1SA 4LF5C 4DCTA 4DV4C 2DPLA 3L8CA 4DV1C 4JV5C 4DV0C 1IB8A 5BURA 2JNVA 1VLAA 1ZB9A 4FUQA 2UU9C 3UEBA 3LGXA 4PZPA 1PG3A 4L2ZA 4RLFA 5ADZA 2MCQA 4DR1C 3CW9A 4RM2A 3A9UA 5K85A 1UKKA 2P2BA 1KKGA 1K0RA 3CQ2A 1JOSA 1J5EC 3N2QA
chains in the Genus database with same CATH topology
5AE1A 4X62C 5IWAC 3CW8X 5BSUA 3IMLA 1ZB8A 4GS5A 4DR5C 4ZJZA 5AE2A 4D4IA 2XR1A 4FUTA 3NYRA 3J80D 3VNSA 3L95X 3A9VA 3GPCA 4BBYA 5K8FA 3GR0A 5LMUC 4JI6C 2E8CA 3IEUA 3PESA 3NPDA 4JI3C 2UUBC 2EGTA 2P2JA 1N2FA 4NXMC 3I08A 4LFAC 1FJGC 4GKJC 1USPB 2OPLA 2JMPA 1MD9A 4TPSB 4K0BA 4DCVA 3DAYA 4RMNA 4JI8C 4JI1C 2CY1A 1XRAA 2D1RA 4DR6C 5A1IA 4B3MC 3AF6A 5T8TA 2QVZX 1IBMC 2Y27A 5AE3A 2CXCA 3FCEA 4G36A 4I9FA 3H2TA 4WS9A 1RY2A 2BH1X 5KEIA 3UOWA 2WP0C 4L7IA 1XMOC 3G7SA 2OO4A 4OX9C 1FUGA 3OTOC 4IZ6A 2DYJA 4B3TC 2P2QA 3GKUA 1ML8A 1O90A 3E7WA 1V25A 4JYAC 1IBKC 2D1TA 1N36C 5A19A 2OPLB 1XNRC 1QM4A 1MDBA 1O93A 1RG9A 3DHVA 5BSRA 3R9WA 4AQYC 2E7GA 2VQEC 2UXDC 4DV2C 2D1QA 4LF8C 1T5DX 2D27A 1T5HX 2Y4NA 4HPVA 3ETOA 4XX2A 1L2FA 4DCUA 1MXBA 4LE5A 2P02A 2WD9A 1MXAA 2AYAA 5BSMA 4NXNC 4JI4C 2HJGA 4ODJA 2QVXX 1N34C 4DR4C 5E7QA 3AF5A 4GXRA 1N33C 3NYQA 3TUFA 3C5EA 2VZEA 2VSQA 1HNWC 5CZVA 1PG4A 4DR7C 1HNXC 4K0KC 5BSWA 5BUQA 4ISBA 3J7AD 2PN2A 5H9UA 3JAMD 3LUSA 4DR2C 4DV5C 3R44A 4LF6C 3R9XA 4PHTA 4B3SC 5BR8C 4G37A 4MTNA 2P2FA 4X65C 3A4IA 4DUYC 4KTTA 4LFBC 1YJ7A 2QL8A 2YWBA 4BC9A 5JRHA 3NI2A 4DG9A 3ETCA 4NDNA 4D4GA 1HNZC 4X64C 1WF3A 4LF9C 4GKKC 4U5YD 2BJOA 4LF7C 3CJEA 3LNVA 3GR1A 1QWIA 5A1GA 3N54B 4D57A 4DV7C 4JI0C 2VQFC 5T8SA 4R0MA 1XRBA 3UZ0A 2UUCC 1PA4A 3I07A 4OYCA 1LCIA 4KTVA 2OBVA 3J81D 3T1YC 2PT7G 3EERA 1LQLA 3DLPX 2Y4OA 3T1HC 2UUAC 4EATA 1O9TA 5CZXA 1V26A 4JI7C 5IFIA 5BUSA 3PROC 4B3RC 4X66C 1USPA 3E7XA 1EGAA 4WV3A 2V7BA 5KYTA 2ASBA 1O92A 4L4QA 3TQIA 3KXWA 3IPLA 2UXBC 5BSVA 4NOZA 1IBLC 4GXQA 2E5LC 3EQ6A 3VNRA 4R1MA 4BCAA 1AMUA 4DV6C 4KHPC 5KYVA 4IR7A 4DV3C 4BSZA 1HR0C 4JI2C 3SO4A 5FLXD 3VNQA 4ZLPA 5LMNC 2ZM6C 3B7WA 1XRCA 2QVYX 1XMQC 2D28C 4R1LA 2UXCC 4YHHC 2ATWA 2ONFA 3RV2A 1BA3A 4JI5C 5DV9A 1I94C 5IT9D 4LFCC 4JM1A 1ULTA 1WH9A 3FCCA 1MKYA 2YCBA 4DCSA 5GTDA 4RLQA 4RVNA 4RM3A 4DUZC 4D56A 2QW0X 4FTFA 1MDFA 2E8EA 3TDEA 1HH2P 1NYEA 4MH4A 4PROC 4BC7A 2P20A 4I9GA 2F4VC 5BSTA 1MXCA 2HHHC 1GPMA 1XNQC 2P2MA 3IEVA 4YY3C 4DG8A 4DR3C 3LAXA 2E8FA 4RVOA 3PBKA 3RG2A 5A2QD 4LF4C 4OXIA 4G1IA 1P7LA 2E0GA 2KZFA 2YWCA 2D7VA 2PROA 1N32C 3S82A 2D1SA 4LF5C 4DCTA 4DV4C 2DPLA 3L8CA 4DV1C 4JV5C 4DV0C 5BURA 1VLAA 1ZB9A 4FUQA 2UU9C 3LGXA 4PZPA 1PG3A 4L2ZA 4RLFA 5ADZA 4DR1C 3CW9A 4RM2A 3A9UA 5K85A 1UKKA 2P2BA 1KKGA 1K0RA 1JOSA 1J5EC 3N2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 C;  4OX9 C;  4LFC C;  3OTO C;  2DYJ A;  1WH9 A;  1MKY A;  2YCB A;  4B3T C;  5IWA C;  4DCS A;  4LFB C;  2QL8 A;  1ZB8 A;  3GKU A;  1ML8 A;  4JYA C;  4DUZ C;  4DR5 C;  1IBK C;  2XR1 A;  1N36 C;  2OPL B;  1HNZ C;  4X64 C;  1XNR C;  1WF3 A;  4LF9 C;  2E8E A;  4GKK C;  1HH2 P;  2BJO A;  3CJE A;  4LF7 C;  3J80 D;  3R9W A;  1NYE A;  1QWI A;  4AQY C;  4MH4 A;  2E7G A;  2F4V C;  2VQE C;  2UXD C;  4DV7 C;  1I94 C;  4JI0 C;  2VQF C;  2HHH C;  1XNQ C;  5LMU C;  2UUC C;  1PA4 A;  3I07 A;  2E8C A;  4JI6 C;  3IEV A;  4YY3 C;  3IEU A;  4DV2 C;  4JI3 C;  2UUB C;  2EGT A;  4DR3 C;  2E8F A;  4LF8 C;  3J81 D;  3T1Y C;  1N2F A;  2PT7 G;  3EER A;  1LQL A;  5A2Q D;  4LF4 C;  4NXM C;  4LFA C;  4XX2 A;  2KZF A;  1L2F A;  4DCU A;  3T1H C;  2D7V A;  2UUA C;  1N32 C;  1FJG C;  4GKJ C;  4JI7 C;  1USP B;  2OPL A;  2JMP A;  4LF5 C;  4DCT A;  4NXN C;  4DV4 C;  4B3R C;  4JI4 C;  4X66 C;  1USP A;  4DV1 C;  2HJG A;  1N34 C;  4JV5 C;  4DR4 C;  4DV0 C;  1EGA A;  4DCV A;  4JI8 C;  4JI1 C;  1VLA A;  2CY1 A;  3AF5 A;  1ZB9 A;  2ASB A;  2UU9 C;  1N33 C;  4DR6 C;  2UXB C;  4B3M C;  4NOZ A;  1IBL C;  3AF6 A;  2E5L C;  1HNW C;  4DR7 C;  1HNX C;  4K0K C;  1IBM C;  2CXC A;  4DV6 C;  4DR1 C;  4KHP C;  3J7A D;  2PN2 A;  1HR0 C;  4DV3 C;  4BSZ A;  4JI2 C;  5FLX D;  5LMN C;  2ZM6 C;  3JAM D;  3LUS A;  4DR2 C;  4DV5 C;  1UKK A;  4LF6 C;  3R9X A;  1XMQ C;  1KKG A;  1K0R A;  4B3S C;  5BR8 C;  2UXC C;  1XMO C;  4MTN A;  1JOS A;  4YHH C;  2ATW A;  2ONF A;  1J5E C;  4JI5 C;  4X65 C;  4DUY C;  5IT9 D; 
#chains in the Genus database with same CATH topology
 5AE1 A;  4X62 C;  5IWA C;  3CW8 X;  5BSU A;  3IML A;  1ZB8 A;  4GS5 A;  4DR5 C;  4ZJZ A;  5AE2 A;  4D4I A;  2XR1 A;  4FUT A;  1V60 A;  3NYR A;  2NCL A;  3J80 D;  3VNS A;  3L95 X;  3A9V A;  3GPC A;  4BBY A;  4PUG A;  4PUH A;  5K8F A;  3GR0 A;  5LMU C;  4JI6 C;  2E8C A;  3IEU A;  3PES A;  3NPD A;  4JI3 C;  2UUB C;  2EGT A;  2P2J A;  1N2F A;  4NXM C;  3I08 A;  4LFA C;  1FJG C;  3CQ1 A;  4GKJ C;  1USP B;  2OPL A;  2JMP A;  1MD9 A;  4TPS B;  1WCJ A;  4K0B A;  2MM9 A;  4DCV A;  3DAY A;  4RMN A;  4JI8 C;  4JI1 C;  2CY1 A;  1XRA A;  2D1R A;  2KDN A;  4DR6 C;  1YGT A;  3TR3 A;  5A1I A;  4B3M C;  2PG1 E;  3AF6 A;  1UWD A;  5T8T A;  2QVZ X;  1IBM C;  2Y27 A;  5AE3 A;  2CXC A;  2ZTB A;  3FCE A;  4G36 A;  4I9F A;  3H2T A;  4WS9 A;  1RY2 A;  2BH1 X;  5KEI A;  3UOW A;  2WP0 C;  4L7I A;  1XMO C;  3G7S A;  2OO4 A;  4OX9 C;  1FUG A;  3OTO C;  4IZ6 A;  2DYJ A;  1NY8 A;  4B3T C;  2P2Q A;  3GKU A;  3LNO A;  1ML8 A;  1O90 A;  3E7W A;  1V25 A;  4JYA C;  1IBK C;  2D1T A;  1N36 C;  5A19 A;  2OPL B;  1XDX A;  1XNR C;  1QM4 A;  1MDB A;  1O93 A;  1RG9 A;  3DHV A;  5BSR A;  3R9W A;  4AQY C;  2E7G A;  2VQE C;  2UXD C;  1XS3 A;  2KZ0 A;  1P4E C;  1XHJ A;  4DV2 C;  2D1Q A;  4LF8 C;  1T5D X;  2D27 A;  1T5H X;  2Y4N A;  4HPV A;  3ETO A;  4XX2 A;  1L2F A;  4DCU A;  1MXB A;  4LE5 A;  2P02 A;  2WD9 A;  1MXA A;  2AYA A;  5BSM A;  4NXN C;  4JI4 C;  2HJG A;  4ODJ A;  2QVX X;  1N34 C;  2MMA B;  2M5O A;  4DR4 C;  2DHM A;  5E7Q A;  1PU1 A;  3AF5 A;  4GXR A;  1N33 C;  3NYQ A;  3CQ3 A;  3TUF A;  3C5E A;  2VZE A;  2VSQ A;  1HNW C;  5CZV A;  1PG4 A;  4DR7 C;  1HNX C;  4K0K C;  5BSW A;  5BUQ A;  3K6R A;  4ISB A;  3J7A D;  2PN2 A;  5H9U A;  3JAM D;  3LUS A;  4DR2 C;  4DV5 C;  1FLO A;  3R44 A;  2ZZN A;  4LF6 C;  3R9X A;  4PHT A;  4B3S C;  5BR8 C;  4G37 A;  4MTN A;  2P2F A;  2ZZM A;  4X65 C;  3A4I A;  4DUY C;  4KTT A;  4LFB C;  1YJ7 A;  2QL8 A;  2YWB A;  4BC9 A;  5JRH A;  3NI2 A;  4DG9 A;  3ETC A;  4NDN A;  4D4G A;  1HNZ C;  4X64 C;  1TH5 A;  1WF3 A;  4LF9 C;  3UX2 A;  4GKK C;  4U5Y D;  2BJO A;  4LF7 C;  3CJE A;  3LNV A;  3GR1 A;  1QWI A;  5A1G A;  3N54 B;  4D57 A;  2CU6 A;  4DV7 C;  4JI0 C;  2VQF C;  5T8S A;  4R0M A;  1XRB A;  3UZ0 A;  2UUC C;  1PA4 A;  1VEH A;  3I07 A;  4OYC A;  1LCI A;  4KTV A;  2OBV A;  5LCI A;  3J81 D;  3T1Y C;  2PT7 G;  3EER A;  1LQL A;  3DLP X;  2Y4O A;  3T1H C;  2UUA C;  4EAT A;  3UX3 A;  1O9T A;  5CZX A;  1V26 A;  4JI7 C;  5IFI A;  5BUS A;  3PRO C;  4B3R C;  4X66 C;  1USP A;  2M5H A;  3E7X A;  3FM7 A;  1EGA A;  4WV3 A;  2V7B A;  1M6X C;  5KYT A;  1P4E A;  2ASB A;  1O92 A;  4L4Q A;  3TQI A;  3KXW A;  3IPL A;  2UXB C;  1M6X A;  5BSV A;  4NOZ A;  1IBL C;  4GXQ A;  2E5L C;  3EQ6 A;  3VNR A;  4R1M A;  4BCA A;  1AMU A;  4DV6 C;  4KHP C;  5KYV A;  4PUI A;  3A26 A;  4IR7 A;  4DV3 C;  4BSZ A;  1HR0 C;  4JI2 C;  3SO4 A;  5FLX D;  3VNQ A;  4ZLP A;  5LMN C;  2ZM6 C;  3B7W A;  1XRC A;  2QVY X;  1XMQ C;  2D28 C;  4R1L A;  3O2E A;  2UXC C;  4YHH C;  2ATW A;  2ONF A;  3RV2 A;  1BA3 A;  4JI5 C;  5DV9 A;  1I94 C;  5IT9 D;  4LFC C;  4JM1 A;  2Z51 A;  1ULT A;  1WH9 A;  3FCC A;  1MKY A;  2YCB A;  4DCS A;  5GTD A;  4RLQ A;  4RVN A;  3AY0 A;  4RM3 A;  4DUZ C;  4D56 A;  2QW0 X;  4FTF A;  1MDF A;  2E8E A;  3TDE A;  1HH2 P;  3A25 A;  1NYE A;  4MH4 A;  4PRO C;  4BC7 A;  2P20 A;  4I9G A;  2F4V C;  5BST A;  2YX1 A;  1MXC A;  2HHH C;  1GPM A;  1XNQ C;  2P2M A;  3IEV A;  4YY3 C;  4DG8 A;  4DR3 C;  3LAX A;  2E8F A;  4RVO A;  3PBK A;  3RG2 A;  5A2Q D;  4LF4 C;  4OXI A;  4G1I A;  1P7L A;  2E0G A;  2KZF A;  2YWC A;  2D7V A;  2PRO A;  1N32 C;  3S82 A;  2D1S A;  4LF5 C;  4DCT A;  4DV4 C;  2DPL A;  3L8C A;  4DV1 C;  4JV5 C;  4DV0 C;  1IB8 A;  5BUR A;  2JNV A;  1VLA A;  1ZB9 A;  4FUQ A;  2UU9 C;  3UEB A;  3LGX A;  4PZP A;  1PG3 A;  4L2Z A;  4RLF A;  5ADZ A;  2MCQ A;  4DR1 C;  3CW9 A;  4RM2 A;  3A9U A;  5K85 A;  1UKK A;  2P2B A;  1KKG A;  1K0R A;  3CQ2 A;  1JOS A;  1J5E C;  3N2Q A; 
#chains in the Genus database with same CATH homology
 5AE1 A;  4X62 C;  5IWA C;  3CW8 X;  5BSU A;  3IML A;  1ZB8 A;  4GS5 A;  4DR5 C;  4ZJZ A;  5AE2 A;  4D4I A;  2XR1 A;  4FUT A;  3NYR A;  3J80 D;  3VNS A;  3L95 X;  3A9V A;  3GPC A;  4BBY A;  5K8F A;  3GR0 A;  5LMU C;  4JI6 C;  2E8C A;  3IEU A;  3PES A;  3NPD A;  4JI3 C;  2UUB C;  2EGT A;  2P2J A;  1N2F A;  4NXM C;  3I08 A;  4LFA C;  1FJG C;  4GKJ C;  1USP B;  2OPL A;  2JMP A;  1MD9 A;  4TPS B;  4K0B A;  4DCV A;  3DAY A;  4RMN A;  4JI8 C;  4JI1 C;  2CY1 A;  1XRA A;  2D1R A;  4DR6 C;  5A1I A;  4B3M C;  3AF6 A;  5T8T A;  2QVZ X;  1IBM C;  2Y27 A;  5AE3 A;  2CXC A;  3FCE A;  4G36 A;  4I9F A;  3H2T A;  4WS9 A;  1RY2 A;  2BH1 X;  5KEI A;  3UOW A;  2WP0 C;  4L7I A;  1XMO C;  3G7S A;  2OO4 A;  4OX9 C;  1FUG A;  3OTO C;  4IZ6 A;  2DYJ A;  4B3T C;  2P2Q A;  3GKU A;  1ML8 A;  1O90 A;  3E7W A;  1V25 A;  4JYA C;  1IBK C;  2D1T A;  1N36 C;  5A19 A;  2OPL B;  1XNR C;  1QM4 A;  1MDB A;  1O93 A;  1RG9 A;  3DHV A;  5BSR A;  3R9W A;  4AQY C;  2E7G A;  2VQE C;  2UXD C;  4DV2 C;  2D1Q A;  4LF8 C;  1T5D X;  2D27 A;  1T5H X;  2Y4N A;  4HPV A;  3ETO A;  4XX2 A;  1L2F A;  4DCU A;  1MXB A;  4LE5 A;  2P02 A;  2WD9 A;  1MXA A;  2AYA A;  5BSM A;  4NXN C;  4JI4 C;  2HJG A;  4ODJ A;  2QVX X;  1N34 C;  4DR4 C;  5E7Q A;  3AF5 A;  4GXR A;  1N33 C;  3NYQ A;  3TUF A;  3C5E A;  2VZE A;  2VSQ A;  1HNW C;  5CZV A;  1PG4 A;  4DR7 C;  1HNX C;  4K0K C;  5BSW A;  5BUQ A;  4ISB A;  3J7A D;  2PN2 A;  5H9U A;  3JAM D;  3LUS A;  4DR2 C;  4DV5 C;  3R44 A;  4LF6 C;  3R9X A;  4PHT A;  4B3S C;  5BR8 C;  4G37 A;  4MTN A;  2P2F A;  4X65 C;  3A4I A;  4DUY C;  4KTT A;  4LFB C;  1YJ7 A;  2QL8 A;  2YWB A;  4BC9 A;  5JRH A;  3NI2 A;  4DG9 A;  3ETC A;  4NDN A;  4D4G A;  1HNZ C;  4X64 C;  1WF3 A;  4LF9 C;  4GKK C;  4U5Y D;  2BJO A;  4LF7 C;  3CJE A;  3LNV A;  3GR1 A;  1QWI A;  5A1G A;  3N54 B;  4D57 A;  4DV7 C;  4JI0 C;  2VQF C;  5T8S A;  4R0M A;  1XRB A;  3UZ0 A;  2UUC C;  1PA4 A;  3I07 A;  4OYC A;  1LCI A;  4KTV A;  2OBV A;  3J81 D;  3T1Y C;  2PT7 G;  3EER A;  1LQL A;  3DLP X;  2Y4O A;  3T1H C;  2UUA C;  4EAT A;  1O9T A;  5CZX A;  1V26 A;  4JI7 C;  5IFI A;  5BUS A;  3PRO C;  4B3R C;  4X66 C;  1USP A;  3E7X A;  1EGA A;  4WV3 A;  2V7B A;  5KYT A;  2ASB A;  1O92 A;  4L4Q A;  3TQI A;  3KXW A;  3IPL A;  2UXB C;  5BSV A;  4NOZ A;  1IBL C;  4GXQ A;  2E5L C;  3EQ6 A;  3VNR A;  4R1M A;  4BCA A;  1AMU A;  4DV6 C;  4KHP C;  5KYV A;  4IR7 A;  4DV3 C;  4BSZ A;  1HR0 C;  4JI2 C;  3SO4 A;  5FLX D;  3VNQ A;  4ZLP A;  5LMN C;  2ZM6 C;  3B7W A;  1XRC A;  2QVY X;  1XMQ C;  2D28 C;  4R1L A;  2UXC C;  4YHH C;  2ATW A;  2ONF A;  3RV2 A;  1BA3 A;  4JI5 C;  5DV9 A;  1I94 C;  5IT9 D;  4LFC C;  4JM1 A;  1ULT A;  1WH9 A;  3FCC A;  1MKY A;  2YCB A;  4DCS A;  5GTD A;  4RLQ A;  4RVN A;  4RM3 A;  4DUZ C;  4D56 A;  2QW0 X;  4FTF A;  1MDF A;  2E8E A;  3TDE A;  1HH2 P;  1NYE A;  4MH4 A;  4PRO C;  4BC7 A;  2P20 A;  4I9G A;  2F4V C;  5BST A;  1MXC A;  2HHH C;  1GPM A;  1XNQ C;  2P2M A;  3IEV A;  4YY3 C;  4DG8 A;  4DR3 C;  3LAX A;  2E8F A;  4RVO A;  3PBK A;  3RG2 A;  5A2Q D;  4LF4 C;  4OXI A;  4G1I A;  1P7L A;  2E0G A;  2KZF A;  2YWC A;  2D7V A;  2PRO A;  1N32 C;  3S82 A;  2D1S A;  4LF5 C;  4DCT A;  4DV4 C;  2DPL A;  3L8C A;  4DV1 C;  4JV5 C;  4DV0 C;  5BUR A;  1VLA A;  1ZB9 A;  4FUQ A;  2UU9 C;  3LGX A;  4PZP A;  1PG3 A;  4L2Z A;  4RLF A;  5ADZ A;  4DR1 C;  3CW9 A;  4RM2 A;  3A9U A;  5K85 A;  1UKK A;  2P2B A;  1KKG A;  1K0R A;  1JOS A;  1J5E C;  3N2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...