2UUCC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uucC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uucC02
4DR5C 2UUCC 2UXBC 1N34C 2OPLB 1LQLA 4B3MC 4DUYC 4NOZA 3EERA 2ATWA 4DUZC 2UXDC 4B3RC 1USPB 2BJOA 2E5LC 4X65C 4DR4C 2E8FA 4DR6C 4DCVA 4JI1C 1XNQC 1HH2P 4DCTA 2ASBA 1PA4A 2CY1A 4X66C 4BSZA 2VQFC 1MKYA 4B3TC 4X64C 2DYJA 5LMUC 1N36C 3IEVA 1JOSA 1HNXC 4OX9C 2UUAC 4XX2A 4DV6C 2EGTA 4DR2C 2OPLA 2E7GA 2E8CA 1QWIA 5IT9D 2PT7G 3J7AD 1USPA 2JMPA 1K0RA 4JI8C 4DR7C 2ONFA 4YHHC 5BR8C 5FLXD 4JI4C 3JAMD 1KKGA 3J80D 4LF5C 1WH9A 1ZB9A 4B3SC 4LF8C 4GKJC 1WF3A 4MH4A 3AF6A 1IBKC 2UUBC 4YY3C 2PN2A 4MTNA 4LF7C 4LFAC 1HNZC 4KHPC 4DV7C 1N2FA 1L2FA 4K0KC 4JI0C 1J5EC 4LF6C 1IBMC 2UXCC 1XMOC 4JI5C 1XNRC 2HJGA 1N32C 4DV4C 3J81D 1ML8A 1HR0C 2HHHC 1FJGC 2KZFA 4NXMC 4DV0C 4JI6C 3OTOC 4DCSA 2ZM6C 4DV5C 2D7VA 3T1HC 1XMQC 4JYAC 3R9WA 4AQYC 3AF5A 2UU9C 2E8EA 4JI7C 5A2QD 2VQEC 4LF4C 1VLAA 4LFCC 3LUSA 4DV3C 2F4VC 1HNWC 1IBLC 5IWAC 4NXNC 2CXCA 4LFBC 3CJEA 1N33C 4DR1C 5LMNC 4GKKC 4DCUA 2QL8A 3IEUA 3R9XA 3I07A 1I94C 4DV2C 4LF9C 1ZB8A 2XR1A 3T1YC 1NYEA 3GKUA 4JI3C 4JV5C 1EGAA 4X62C 4DV1C 2YCBA 4DR3C 1UKKA 4JI2C
chains in the Genus database with same CATH superfamily
5H9UA 2OPLB 1LQLA 2M5OA 3RV2A 4B3MC 3EERA 4NDNA 3FCEA 5K85A 4R0MA 1USPB 4ODJA 2QVXX 2E5LC 4X65C 3G7SA 3R44A 2NCLA 1MD9A 5BSWA 4DR6C 4DCVA 1YGTA 5LCIA 2ASBA 2D1RA 4OXIA 2BH1X 4BCAA 2PROA 4B3TC 2ZZNA 2QVZX 2DYJA 4KTVA 4PUGA 1JOSA 4GXQA 4GXRA 4XX2A 5AE1A 5BSVA 4DV6C 2OPLA 4U5YD 4IR7A 2E0GA 5IT9D 1USPA 3UOWA 4DR7C 2ONFA 2P20A 4YHHC 5BR8C 3ETCA 4FTFA 3J80D 4PUIA 4LF8C 1WF3A 3DHVA 4YY3C 2DHMA 4PROC 1L2FA 1MXCA 4K0KC 1M6XA 2WD9A 2VSQA 2UXCC 4DG8A 2KZ0A 4D57A 1N32C 1FUGA 1XDXA 5KEIA 5T8SA 1FLOA 1LCIA 2HHHC 2P2FA 4JI6C 4G36A 2VZEA 4DCSA 4RLQA 3VNSA 2OBVA 1XMQC 4BC7A 3R9WA 5CZXA 4AQYC 2DPLA 3DLPX 2D1SA 1XRBA 1RY2A 2E8EA 5BUSA 3H2TA 3B7WA 3L95X 5BSRA 3LUSA 4DV3C 3GR0A 5IWAC 1NY8A 5AE2A 4DCUA 1MXBA 3A26A 3TQIA 3IMLA 4D4GA 1O90A 2P02A 2PG1E 4JI3C 3GKUA 2Z51A 1TH5A 2P2QA 2Y27A 4PUHA 4DR3C 4OYCA 1UKKA 1MDBA 3NI2A 4DR5C 2UUCC 2WP0C 2UXBC 2AYAA 3FM7A 1P4EC 4L7IA 3AY0A 1PU1A 2E8FA 4L2ZA 1GPMA 3LGXA 4DCTA 4BSZA 3TUFA 5JRHA 4HPVA 5LMUC 4LE5A 1XRCA 5T8TA 1HNXC 2UUAC 3N54B 2P2JA 4DR2C 2E7GA 2PT7G 3J7AD 3TDEA 1BA3A 2OO4A 3LNVA 3E7WA 4JI4C 2QW0X 1KKGA 3TR3A 4LF5C 1XS3A 4B3SC 4GKJC 4MH4A 4RM2A 4LF7C 1HNZC 4KHPC 3O2EA 3PESA 1J5EC 2QVYX 2Y4OA 3LAXA 4WV3A 3DAYA 1XMOC 1XNRC 4DV4C 3PROC 1HR0C 2KZFA 2D7VA 3T1HC 4R1LA 5K8FA 3UX3A 3C5EA 2D1QA 1VEHA 3K6RA 4LFCC 4EATA 2CXCA 2KDNA 5BURA 3IEUA 3IPLA 3R9XA 1I94C 4LF9C 2XR1A 3T1YC 3VNQA 4FUQA 4X62C 2M5HA 4DV1C 1V26A 3A25A 5AE3A 1MXAA 1O9TA 5GTDA 4DG9A 3L8CA 3KXWA 3UZ0A 5BSUA 4BBYA 1XHJA 3A9UA 4GS5A 4JI1C 1XNQC 1HH2P 2D27A 4I9FA 3VNRA 1PA4A 2CY1A 3CW9A 4X66C 1MDFA 2ZTBA 4TPSB 4X64C 1N36C 3IEVA 5CZVA 3S82A 4OX9C 4D56A 3NYRA 1UWDA 2E8CA 3NYQA 3LNOA 4RM3A 1XRAA 3EQ6A 2JMPA 1K0RA 1V25A 4WS9A 2JNVA 3JAMD 1T5DX 3A4IA 1WH9A 1ZB9A 2UUBC 3AF6A 1YJ7A 4MTNA 4FUTA 1N2FA 3FCCA 4JI0C 5A1GA 4I9GA 4PHTA 5E7QA 1P7LA 3I08A 4KTTA 3J81D 4NXMC 4DV0C 1WCJA 3CQ3A 2ZM6C 5KYVA 1O93A 1PG4A 3PBKA 4JYAC 4RMNA 1T5HX 3ETOA 3AF5A 5KYTA 1P4EA 4L4QA 4ZJZA 2F4VC 1IBLC 4JM1A 1PG3A 4DR1C 1N33C 1M6XC 2QL8A 5DV9A 2MCQA 4D4IA 1RG9A 3I07A 4IZ6A 3N2QA 2V7BA 1IB8A 1EGAA 4JI2C 4JI5C 1QM4A 1N34C 4DUYC 4NOZA 2ATWA 4DUZC 2UXDC 2MMAB 4B3RC 2BJOA 1ULTA 4K0BA 4RVOA 2YX1A 4BC9A 4DR4C 5BSMA 1V60A 4RVNA 5A1IA 3GPCA 2D28C 5BSTA 5IFIA 4ISBA 2VQFC 1MKYA 3CQ1A 5BUQA 3CQ2A 3CW8X 2EGTA 2Y4NA 1QWIA 2P2MA 1O92A 4JI8C 5FLXD 3UEBA 2CU6A 1IBKC 2PN2A 4LFAC 4DV7C 4LF6C 4ZLPA 4RLFA 1IBMC 4G1IA 3UX2A 2HJGA 5A19A 1ML8A 1FJGC 3OTOC 4DV5C 3NPDA 3A9VA 4PZPA 1AMUA 2YWCA 2UU9C 4R1MA 2D1TA 2ZZMA 3E7XA 4JI7C 3RG2A 5A2QD 2VQEC 4LF4C 1VLAA 4G37A 1HNWC 2P2BA 4NXNC 4LFBC 3CJEA 4GKKC 5LMNC 2MM9A 3GR1A 5ADZA 4DV2C 4JV5C 1ZB8A 1NYEA 3SO4A 2YCBA 2YWBA
chains in the Genus database with same CATH topology
5H9UA 2OPLB 1LQLA 3RV2A 4B3MC 3EERA 4NDNA 3FCEA 5K85A 4R0MA 1USPB 4ODJA 2QVXX 2E5LC 4X65C 3G7SA 3R44A 1MD9A 5BSWA 4DR6C 4DCVA 2ASBA 2D1RA 4OXIA 2BH1X 4BCAA 2PROA 4B3TC 2QVZX 2DYJA 4KTVA 1JOSA 4GXQA 4GXRA 4XX2A 5AE1A 5BSVA 4DV6C 2OPLA 4U5YD 4IR7A 2E0GA 5IT9D 1USPA 3UOWA 4DR7C 2ONFA 2P20A 4YHHC 5BR8C 3ETCA 4FTFA 3J80D 4LF8C 1WF3A 3DHVA 4YY3C 4PROC 1L2FA 1MXCA 4K0KC 2WD9A 2VSQA 2UXCC 4DG8A 4D57A 1N32C 1FUGA 5KEIA 5T8SA 1LCIA 2HHHC 2P2FA 4JI6C 4G36A 2VZEA 4DCSA 4RLQA 3VNSA 2OBVA 1XMQC 4BC7A 3R9WA 5CZXA 4AQYC 2DPLA 3DLPX 2D1SA 1XRBA 1RY2A 2E8EA 5BUSA 3H2TA 3B7WA 3L95X 5BSRA 3LUSA 4DV3C 3GR0A 5IWAC 5AE2A 4DCUA 1MXBA 3TQIA 3IMLA 4D4GA 1O90A 2P02A 4JI3C 3GKUA 2P2QA 2Y27A 4DR3C 4OYCA 1UKKA 1MDBA 3NI2A 4DR5C 2UUCC 2WP0C 2UXBC 2AYAA 4L7IA 4L2ZA 2E8FA 1GPMA 3LGXA 4DCTA 4BSZA 3TUFA 5JRHA 4HPVA 5LMUC 4LE5A 1XRCA 5T8TA 1HNXC 2UUAC 3N54B 2P2JA 4DR2C 2E7GA 2PT7G 3J7AD 3TDEA 1BA3A 2OO4A 3LNVA 3E7WA 4JI4C 2QW0X 1KKGA 4LF5C 4B3SC 4GKJC 4MH4A 4RM2A 4LF7C 1HNZC 4KHPC 3PESA 1J5EC 2QVYX 2Y4OA 3LAXA 4WV3A 3DAYA 1XMOC 1XNRC 4DV4C 3PROC 1HR0C 2KZFA 2D7VA 3T1HC 4R1LA 5K8FA 3C5EA 2D1QA 4LFCC 4EATA 2CXCA 5BURA 3IEUA 3IPLA 3R9XA 1I94C 4LF9C 2XR1A 3T1YC 3VNQA 4FUQA 4X62C 4DV1C 1V26A 5AE3A 1MXAA 1O9TA 5GTDA 4DG9A 3L8CA 3KXWA 3UZ0A 5BSUA 4BBYA 3A9UA 4GS5A 4JI1C 1XNQC 1HH2P 2D27A 4I9FA 3VNRA 1PA4A 2CY1A 3CW9A 4X66C 1MDFA 4TPSB 4X64C 1N36C 3IEVA 5CZVA 3S82A 4OX9C 4D56A 3NYRA 2E8CA 3NYQA 4RM3A 1XRAA 3EQ6A 2JMPA 1K0RA 1V25A 4WS9A 3JAMD 1T5DX 3A4IA 1WH9A 1ZB9A 2UUBC 3AF6A 1YJ7A 4MTNA 4FUTA 1N2FA 3FCCA 4JI0C 5A1GA 4I9GA 4PHTA 5E7QA 1P7LA 3I08A 4KTTA 3J81D 4NXMC 4DV0C 2ZM6C 5KYVA 1O93A 1PG4A 3PBKA 4JYAC 4RMNA 1T5HX 3ETOA 3AF5A 5KYTA 4L4QA 4ZJZA 2F4VC 1IBLC 4JM1A 1PG3A 4DR1C 1N33C 2QL8A 5DV9A 4D4IA 1RG9A 3I07A 4IZ6A 3N2QA 2V7BA 1EGAA 4JI2C 4JI5C 1QM4A 1N34C 4DUYC 4NOZA 2ATWA 4DUZC 2UXDC 4B3RC 2BJOA 1ULTA 4K0BA 4RVOA 4BC9A 4DR4C 5BSMA 4RVNA 5A1IA 3GPCA 2D28C 5BSTA 5IFIA 4ISBA 2VQFC 1MKYA 5BUQA 3CW8X 2EGTA 2Y4NA 1QWIA 2P2MA 1O92A 4JI8C 5FLXD 1IBKC 2PN2A 4LFAC 4DV7C 4LF6C 4ZLPA 4RLFA 1IBMC 4G1IA 2HJGA 5A19A 1ML8A 1FJGC 3OTOC 4DV5C 3NPDA 3A9VA 4PZPA 1AMUA 2YWCA 2UU9C 4R1MA 2D1TA 3E7XA 4JI7C 3RG2A 5A2QD 2VQEC 4LF4C 1VLAA 4G37A 1HNWC 2P2BA 4NXNC 4LFBC 3CJEA 4GKKC 5LMNC 3GR1A 5ADZA 4DV2C 4JV5C 1ZB8A 1NYEA 3SO4A 2YCBA 2YWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 C;  2UUC C;  2UXB C;  1N34 C;  2OPL B;  1LQL A;  4B3M C;  4DUY C;  4NOZ A;  3EER A;  2ATW A;  4DUZ C;  2UXD C;  4B3R C;  1USP B;  2BJO A;  2E5L C;  4X65 C;  4DR4 C;  2E8F A;  4DR6 C;  4DCV A;  4JI1 C;  1XNQ C;  1HH2 P;  4DCT A;  2ASB A;  1PA4 A;  2CY1 A;  4X66 C;  4BSZ A;  2VQF C;  1MKY A;  4B3T C;  4X64 C;  2DYJ A;  5LMU C;  1N36 C;  3IEV A;  1JOS A;  1HNX C;  4OX9 C;  2UUA C;  4XX2 A;  4DV6 C;  2EGT A;  4DR2 C;  2OPL A;  2E7G A;  2E8C A;  1QWI A;  5IT9 D;  2PT7 G;  3J7A D;  1USP A;  2JMP A;  1K0R A;  4JI8 C;  4DR7 C;  2ONF A;  4YHH C;  5BR8 C;  5FLX D;  4JI4 C;  3JAM D;  1KKG A;  3J80 D;  4LF5 C;  1WH9 A;  1ZB9 A;  4B3S C;  4LF8 C;  4GKJ C;  1WF3 A;  4MH4 A;  3AF6 A;  1IBK C;  2UUB C;  4YY3 C;  2PN2 A;  4MTN A;  4LF7 C;  4LFA C;  1HNZ C;  4KHP C;  4DV7 C;  1N2F A;  1L2F A;  4K0K C;  4JI0 C;  1J5E C;  4LF6 C;  1IBM C;  2UXC C;  1XMO C;  4JI5 C;  1XNR C;  2HJG A;  1N32 C;  4DV4 C;  3J81 D;  1ML8 A;  1HR0 C;  2HHH C;  1FJG C;  2KZF A;  4NXM C;  4DV0 C;  4JI6 C;  3OTO C;  4DCS A;  2ZM6 C;  4DV5 C;  2D7V A;  3T1H C;  1XMQ C;  4JYA C;  3R9W A;  4AQY C;  3AF5 A;  2UU9 C;  2E8E A;  4JI7 C;  5A2Q D;  2VQE C;  4LF4 C;  1VLA A;  4LFC C;  3LUS A;  4DV3 C;  2F4V C;  1HNW C;  1IBL C;  5IWA C;  4NXN C;  2CXC A;  4LFB C;  3CJE A;  1N33 C;  4DR1 C;  5LMN C;  4GKK C;  4DCU A;  2QL8 A;  3IEU A;  3R9X A;  3I07 A;  1I94 C;  4DV2 C;  4LF9 C;  1ZB8 A;  2XR1 A;  3T1Y C;  1NYE A;  3GKU A;  4JI3 C;  4JV5 C;  1EGA A;  4X62 C;  4DV1 C;  2YCB A;  4DR3 C;  1UKK A;  4JI2 C; 
#chains in the Genus database with same CATH topology
 5H9U A;  2OPL B;  1LQL A;  2M5O A;  3RV2 A;  4B3M C;  3EER A;  4NDN A;  3FCE A;  5K85 A;  4R0M A;  1USP B;  4ODJ A;  2QVX X;  2E5L C;  4X65 C;  3G7S A;  3R44 A;  2NCL A;  1MD9 A;  5BSW A;  4DR6 C;  4DCV A;  1YGT A;  5LCI A;  2ASB A;  2D1R A;  4OXI A;  2BH1 X;  4BCA A;  2PRO A;  4B3T C;  2ZZN A;  2QVZ X;  2DYJ A;  4KTV A;  4PUG A;  1JOS A;  4GXQ A;  4GXR A;  4XX2 A;  5AE1 A;  5BSV A;  4DV6 C;  2OPL A;  4U5Y D;  4IR7 A;  2E0G A;  5IT9 D;  1USP A;  3UOW A;  4DR7 C;  2ONF A;  2P20 A;  4YHH C;  5BR8 C;  3ETC A;  4FTF A;  3J80 D;  4PUI A;  4LF8 C;  1WF3 A;  3DHV A;  4YY3 C;  2DHM A;  4PRO C;  1L2F A;  1MXC A;  4K0K C;  1M6X A;  2WD9 A;  2VSQ A;  2UXC C;  4DG8 A;  2KZ0 A;  4D57 A;  1N32 C;  1FUG A;  1XDX A;  5KEI A;  5T8S A;  1FLO A;  1LCI A;  2HHH C;  2P2F A;  4JI6 C;  4G36 A;  2VZE A;  4DCS A;  4RLQ A;  3VNS A;  2OBV A;  1XMQ C;  4BC7 A;  3R9W A;  5CZX A;  4AQY C;  2DPL A;  3DLP X;  2D1S A;  1XRB A;  1RY2 A;  2E8E A;  5BUS A;  3H2T A;  3B7W A;  3L95 X;  5BSR A;  3LUS A;  4DV3 C;  3GR0 A;  5IWA C;  1NY8 A;  5AE2 A;  4DCU A;  1MXB A;  3A26 A;  3TQI A;  3IML A;  4D4G A;  1O90 A;  2P02 A;  2PG1 E;  4JI3 C;  3GKU A;  2Z51 A;  1TH5 A;  2P2Q A;  2Y27 A;  4PUH A;  4DR3 C;  4OYC A;  1UKK A;  1MDB A;  3NI2 A;  4DR5 C;  2UUC C;  2WP0 C;  2UXB C;  2AYA A;  3FM7 A;  1P4E C;  4L7I A;  3AY0 A;  1PU1 A;  2E8F A;  4L2Z A;  1GPM A;  3LGX A;  4DCT A;  4BSZ A;  3TUF A;  5JRH A;  4HPV A;  5LMU C;  4LE5 A;  1XRC A;  5T8T A;  1HNX C;  2UUA C;  3N54 B;  2P2J A;  4DR2 C;  2E7G A;  2PT7 G;  3J7A D;  3TDE A;  1BA3 A;  2OO4 A;  3LNV A;  3E7W A;  4JI4 C;  2QW0 X;  1KKG A;  3TR3 A;  4LF5 C;  1XS3 A;  4B3S C;  4GKJ C;  4MH4 A;  4RM2 A;  4LF7 C;  1HNZ C;  4KHP C;  3O2E A;  3PES A;  1J5E C;  2QVY X;  2Y4O A;  3LAX A;  4WV3 A;  3DAY A;  1XMO C;  1XNR C;  4DV4 C;  3PRO C;  1HR0 C;  2KZF A;  2D7V A;  3T1H C;  4R1L A;  5K8F A;  3UX3 A;  3C5E A;  2D1Q A;  1VEH A;  3K6R A;  4LFC C;  4EAT A;  2CXC A;  2KDN A;  5BUR A;  3IEU A;  3IPL A;  3R9X A;  1I94 C;  4LF9 C;  2XR1 A;  3T1Y C;  3VNQ A;  4FUQ A;  4X62 C;  2M5H A;  4DV1 C;  1V26 A;  3A25 A;  5AE3 A;  1MXA A;  1O9T A;  5GTD A;  4DG9 A;  3L8C A;  3KXW A;  3UZ0 A;  5BSU A;  4BBY A;  1XHJ A;  3A9U A;  4GS5 A;  4JI1 C;  1XNQ C;  1HH2 P;  2D27 A;  4I9F A;  3VNR A;  1PA4 A;  2CY1 A;  3CW9 A;  4X66 C;  1MDF A;  2ZTB A;  4TPS B;  4X64 C;  1N36 C;  3IEV A;  5CZV A;  3S82 A;  4OX9 C;  4D56 A;  3NYR A;  1UWD A;  2E8C A;  3NYQ A;  3LNO A;  4RM3 A;  1XRA A;  3EQ6 A;  2JMP A;  1K0R A;  1V25 A;  4WS9 A;  2JNV A;  3JAM D;  1T5D X;  3A4I A;  1WH9 A;  1ZB9 A;  2UUB C;  3AF6 A;  1YJ7 A;  4MTN A;  4FUT A;  1N2F A;  3FCC A;  4JI0 C;  5A1G A;  4I9G A;  4PHT A;  5E7Q A;  1P7L A;  3I08 A;  4KTT A;  3J81 D;  4NXM C;  4DV0 C;  1WCJ A;  3CQ3 A;  2ZM6 C;  5KYV A;  1O93 A;  1PG4 A;  3PBK A;  4JYA C;  4RMN A;  1T5H X;  3ETO A;  3AF5 A;  5KYT A;  1P4E A;  4L4Q A;  4ZJZ A;  2F4V C;  1IBL C;  4JM1 A;  1PG3 A;  4DR1 C;  1N33 C;  1M6X C;  2QL8 A;  5DV9 A;  2MCQ A;  4D4I A;  1RG9 A;  3I07 A;  4IZ6 A;  3N2Q A;  2V7B A;  1IB8 A;  1EGA A;  4JI2 C;  4JI5 C;  1QM4 A;  1N34 C;  4DUY C;  4NOZ A;  2ATW A;  4DUZ C;  2UXD C;  2MMA B;  4B3R C;  2BJO A;  1ULT A;  4K0B A;  4RVO A;  2YX1 A;  4BC9 A;  4DR4 C;  5BSM A;  1V60 A;  4RVN A;  5A1I A;  3GPC A;  2D28 C;  5BST A;  5IFI A;  4ISB A;  2VQF C;  1MKY A;  3CQ1 A;  5BUQ A;  3CQ2 A;  3CW8 X;  2EGT A;  2Y4N A;  1QWI A;  2P2M A;  1O92 A;  4JI8 C;  5FLX D;  3UEB A;  2CU6 A;  1IBK C;  2PN2 A;  4LFA C;  4DV7 C;  4LF6 C;  4ZLP A;  4RLF A;  1IBM C;  4G1I A;  3UX2 A;  2HJG A;  5A19 A;  1ML8 A;  1FJG C;  3OTO C;  4DV5 C;  3NPD A;  3A9V A;  4PZP A;  1AMU A;  2YWC A;  2UU9 C;  4R1M A;  2D1T A;  2ZZM A;  3E7X A;  4JI7 C;  3RG2 A;  5A2Q D;  2VQE C;  4LF4 C;  1VLA A;  4G37 A;  1HNW C;  2P2B A;  4NXN C;  4LFB C;  3CJE A;  4GKK C;  5LMN C;  2MM9 A;  3GR1 A;  5ADZ A;  4DV2 C;  4JV5 C;  1ZB8 A;  1NYE A;  3SO4 A;  2YCB A;  2YWB A; 
#chains in the Genus database with same CATH homology
 5H9U A;  2OPL B;  1LQL A;  3RV2 A;  4B3M C;  3EER A;  4NDN A;  3FCE A;  5K85 A;  4R0M A;  1USP B;  4ODJ A;  2QVX X;  2E5L C;  4X65 C;  3G7S A;  3R44 A;  1MD9 A;  5BSW A;  4DR6 C;  4DCV A;  2ASB A;  2D1R A;  4OXI A;  2BH1 X;  4BCA A;  2PRO A;  4B3T C;  2QVZ X;  2DYJ A;  4KTV A;  1JOS A;  4GXQ A;  4GXR A;  4XX2 A;  5AE1 A;  5BSV A;  4DV6 C;  2OPL A;  4U5Y D;  4IR7 A;  2E0G A;  5IT9 D;  1USP A;  3UOW A;  4DR7 C;  2ONF A;  2P20 A;  4YHH C;  5BR8 C;  3ETC A;  4FTF A;  3J80 D;  4LF8 C;  1WF3 A;  3DHV A;  4YY3 C;  4PRO C;  1L2F A;  1MXC A;  4K0K C;  2WD9 A;  2VSQ A;  2UXC C;  4DG8 A;  4D57 A;  1N32 C;  1FUG A;  5KEI A;  5T8S A;  1LCI A;  2HHH C;  2P2F A;  4JI6 C;  4G36 A;  2VZE A;  4DCS A;  4RLQ A;  3VNS A;  2OBV A;  1XMQ C;  4BC7 A;  3R9W A;  5CZX A;  4AQY C;  2DPL A;  3DLP X;  2D1S A;  1XRB A;  1RY2 A;  2E8E A;  5BUS A;  3H2T A;  3B7W A;  3L95 X;  5BSR A;  3LUS A;  4DV3 C;  3GR0 A;  5IWA C;  5AE2 A;  4DCU A;  1MXB A;  3TQI A;  3IML A;  4D4G A;  1O90 A;  2P02 A;  4JI3 C;  3GKU A;  2P2Q A;  2Y27 A;  4DR3 C;  4OYC A;  1UKK A;  1MDB A;  3NI2 A;  4DR5 C;  2UUC C;  2WP0 C;  2UXB C;  2AYA A;  4L7I A;  4L2Z A;  2E8F A;  1GPM A;  3LGX A;  4DCT A;  4BSZ A;  3TUF A;  5JRH A;  4HPV A;  5LMU C;  4LE5 A;  1XRC A;  5T8T A;  1HNX C;  2UUA C;  3N54 B;  2P2J A;  4DR2 C;  2E7G A;  2PT7 G;  3J7A D;  3TDE A;  1BA3 A;  2OO4 A;  3LNV A;  3E7W A;  4JI4 C;  2QW0 X;  1KKG A;  4LF5 C;  4B3S C;  4GKJ C;  4MH4 A;  4RM2 A;  4LF7 C;  1HNZ C;  4KHP C;  3PES A;  1J5E C;  2QVY X;  2Y4O A;  3LAX A;  4WV3 A;  3DAY A;  1XMO C;  1XNR C;  4DV4 C;  3PRO C;  1HR0 C;  2KZF A;  2D7V A;  3T1H C;  4R1L A;  5K8F A;  3C5E A;  2D1Q A;  4LFC C;  4EAT A;  2CXC A;  5BUR A;  3IEU A;  3IPL A;  3R9X A;  1I94 C;  4LF9 C;  2XR1 A;  3T1Y C;  3VNQ A;  4FUQ A;  4X62 C;  4DV1 C;  1V26 A;  5AE3 A;  1MXA A;  1O9T A;  5GTD A;  4DG9 A;  3L8C A;  3KXW A;  3UZ0 A;  5BSU A;  4BBY A;  3A9U A;  4GS5 A;  4JI1 C;  1XNQ C;  1HH2 P;  2D27 A;  4I9F A;  3VNR A;  1PA4 A;  2CY1 A;  3CW9 A;  4X66 C;  1MDF A;  4TPS B;  4X64 C;  1N36 C;  3IEV A;  5CZV A;  3S82 A;  4OX9 C;  4D56 A;  3NYR A;  2E8C A;  3NYQ A;  4RM3 A;  1XRA A;  3EQ6 A;  2JMP A;  1K0R A;  1V25 A;  4WS9 A;  3JAM D;  1T5D X;  3A4I A;  1WH9 A;  1ZB9 A;  2UUB C;  3AF6 A;  1YJ7 A;  4MTN A;  4FUT A;  1N2F A;  3FCC A;  4JI0 C;  5A1G A;  4I9G A;  4PHT A;  5E7Q A;  1P7L A;  3I08 A;  4KTT A;  3J81 D;  4NXM C;  4DV0 C;  2ZM6 C;  5KYV A;  1O93 A;  1PG4 A;  3PBK A;  4JYA C;  4RMN A;  1T5H X;  3ETO A;  3AF5 A;  5KYT A;  4L4Q A;  4ZJZ A;  2F4V C;  1IBL C;  4JM1 A;  1PG3 A;  4DR1 C;  1N33 C;  2QL8 A;  5DV9 A;  4D4I A;  1RG9 A;  3I07 A;  4IZ6 A;  3N2Q A;  2V7B A;  1EGA A;  4JI2 C;  4JI5 C;  1QM4 A;  1N34 C;  4DUY C;  4NOZ A;  2ATW A;  4DUZ C;  2UXD C;  4B3R C;  2BJO A;  1ULT A;  4K0B A;  4RVO A;  4BC9 A;  4DR4 C;  5BSM A;  4RVN A;  5A1I A;  3GPC A;  2D28 C;  5BST A;  5IFI A;  4ISB A;  2VQF C;  1MKY A;  5BUQ A;  3CW8 X;  2EGT A;  2Y4N A;  1QWI A;  2P2M A;  1O92 A;  4JI8 C;  5FLX D;  1IBK C;  2PN2 A;  4LFA C;  4DV7 C;  4LF6 C;  4ZLP A;  4RLF A;  1IBM C;  4G1I A;  2HJG A;  5A19 A;  1ML8 A;  1FJG C;  3OTO C;  4DV5 C;  3NPD A;  3A9V A;  4PZP A;  1AMU A;  2YWC A;  2UU9 C;  4R1M A;  2D1T A;  3E7X A;  4JI7 C;  3RG2 A;  5A2Q D;  2VQE C;  4LF4 C;  1VLA A;  4G37 A;  1HNW C;  2P2B A;  4NXN C;  4LFB C;  3CJE A;  4GKK C;  5LMN C;  3GR1 A;  5ADZ A;  4DV2 C;  4JV5 C;  1ZB8 A;  1NYE A;  3SO4 A;  2YCB A;  2YWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...