2UUCC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uucC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uucC02
2UUAC 3I07A 1HH2P 2OPLA 4DR7C 3J81D 1LQLA 3CJEA 1QWIA 1KKGA 2E8CA 2HHHC 1WH9A 3IEUA 1HNWC 2E8EA 4YHHC 3AF5A 4LFCC 2E7GA 1MKYA 1WF3A 3T1YC 4LF5C 2D7VA 1N32C 1N34C 4DCSA 1K0RA 4LF4C 1FJGC 4OX9C 2UUCC 4JI6C 1ZB9A 4DV2C 4DV6C 4X64C 3JAMD 2PN2A 2UUBC 4DV4C 2OPLB 1VLAA 4JI2C 2KZFA 2UU9C 3GKUA 4DR2C 4AQYC 4DCTA 4NXNC 2PT7G 4NOZA 2ZM6C 3R9XA 2UXDC 4X65C 1NYEA 1XMOC 4DCUA 1UKKA 4NXMC 4MH4A 1HNXC 5LMNC 2CY1A 4XX2A 3EERA 4X62C 4LF6C 4DUZC 2BJOA 5A2QD 2F4VC 1XNQC 4DR6C 1IBKC 1PA4A 1IBMC 4KHPC 4LF8C 5BR8C 1N36C 1N2FA 4JV5C 1HR0C 4B3MC 4JI1C 1ZB8A 2JMPA 5IWAC 1XNRC 4B3TC 1USPB 5LMUC 3LUSA 1IBLC 4DV1C 1I94C 4DR5C 3R9WA 4GKJC 2UXCC 4LF9C 2EGTA 2QL8A 1JOSA 3J80D 4JI8C 4DR4C 2E5LC 2HJGA 3OTOC 4DR3C 5FLXD 4DV0C 2UXBC 4DR1C 2CXCA 1EGAA 4MTNA 4LF7C 4DCVA 2XR1A 1HNZC 4X66C 5IT9D 4JI5C 1XMQC 3J7AD 2VQEC 2ONFA 3AF6A 1USPA 4BSZA 1L2FA 2YCBA 4DV7C 4B3SC 4K0KC 4JI0C 4DUYC 4DV5C 1N33C 3T1HC 4JI7C 2ASBA 4JI4C 2VQFC 4JYAC 1J5EC 3IEVA 4LFAC 4JI3C 2ATWA 2E8FA 4DV3C 1ML8A 2DYJA 4LFBC 4YY3C 4B3RC 4GKKC
chains in the Genus database with same CATH superfamily
2UUAC 5LCIA 3TR3A 3UZ0A 5BSRA 2ZZMA 2P2MA 3C5EA 3IEUA 2QVYX 4RLFA 1LCIA 5A1GA 1O9TA 3E7WA 2D7VA 2D1QA 4IR7A 1N32C 1N34C 4R1MA 5BSTA 4DCSA 1MDFA 3CW9A 4LE5A 4OX9C 2UUCC 1M6XC 2BH1X 4DV2C 3JAMD 1TH5A 3KXWA 1VLAA 2KZ0A 1FUGA 2KZFA 1P4EA 4DR2C 2MCQA 2ZM6C 5BUQA 1YJ7A 2AYAA 1UKKA 4PHTA 4DG8A 4X62C 1PA4A 1T5DX 3NYRA 4OXIA 1IBMC 4LF8C 5BR8C 1BA3A 5A19A 1XNRC 4PZPA 1USPB 4RM3A 3LUSA 5KYTA 4DV1C 2QVZX 3EQ6A 1PG4A 1O90A 4NDNA 1JOSA 2HJGA 3A4IA 4BBYA 2UXBC 2MM9A 4BC7A 1YGTA 3A9UA 2Y4NA 3IMLA 4G36A 4D4IA 2XR1A 5IT9D 2WP0C 3J7AD 1RG9A 1USPA 3CQ3A 4DV7C 2M5HA 5IFIA 4K0KC 3L95X 3SO4A 1XHJA 1J5EC 4JI3C 2P2BA 4KTVA 4BCAA 4GKJC 1O93A 2OPLA 3NYQA 3TQIA 1LQLA 2Y27A 3LAXA 2MMAB 2DHMA 3AF5A 4L2ZA 1MDBA 1XRAA 4PUHA 5DV9A 3T1YC 1MXCA 4G1IA 3PROC 4DV6C 2PN2A 5BUSA 2UUBC 4DV4C 4WS9A 1T5HX 4ISBA 4AQYC 2PT7G 4K0BA 3LGXA 4I9FA 5KYVA 2UXDC 4WV3A 1NYEA 5ADZA 3TDEA 1XMOC 4G37A 5LMNC 2CY1A 4XX2A 3EERA 4LF6C 1MD9A 4DR6C 1XRCA 3PESA 3UOWA 4ODJA 5T8TA 1N2FA 4PUIA 2V7BA 3CQ1A 1MXAA 1I94C 2YWBA 2QL8A 3J80D 4JM1A 3GPCA 5KEIA 4HPVA 1XRBA 2CXCA 2P2FA 4DCVA 2D27A 2VZEA 4IZ6A 1HNZC 4JI5C 3LNVA 2VQEC 3GR0A 4GS5A 1L2FA 2OO4A 4B3SC 2M5OA 4ZJZA 3S82A 4DV5C 5GTDA 3T1HC 2D1TA 4JI4C 4D57A 2Y4OA 3RV2A 3IEVA 4RLQA 3TUFA 1V26A 1ML8A 2DYJA 4LFBC 3GR1A 4B3RC 2P02A 3J81D 3CJEA 2PROA 1KKGA 3B7WA 2E8CA 1WH9A 2E0GA 5H9UA 5AE1A 4YHHC 2E7GA 1WF3A 1RY2A 5BSVA 4BC9A 4R0MA 1XS3A 4LF4C 4GXQA 4FUQA 1FJGC 1ZB9A 3NI2A 5BSMA 3IPLA 3UX2A 5JRHA 1M6XA 2UU9C 3GKUA 4RVOA 2D1SA 2DPLA 4NXNC 3R9XA 4X65C 5E7QA 1UWDA 2D1RA 3PBKA 4MH4A 4NXMC 1HNXC 3O2EA 4EATA 3VNSA 1XNQC 4RMNA 2JNVA 2NCLA 3R44A 1N36C 4DG9A 4JV5C 4B3MC 4JI1C 1ZB8A 2JMPA 3FCEA 3A26A 4B3TC 1GPMA 2P2JA 1IBLC 4TPSB 3CW8X 3AY0A 3RG2A 5BSWA 5T8SA 4LF9C 5BURA 2EGTA 5K85A 4JI8C 3UEBA 2E5LC 1VEHA 2YWCA 3A25A 4DR1C 1P4EC 1V60A 3DHVA 4LF7C 4L4QA 1V25A 4FUTA 5AE2A 2ONFA 3VNRA 3ETOA 3AF6A 2VSQA 2QVXX 4I9GA 1ULTA 4DUYC 4PUGA 1N33C 3I08A 4LFAC 3DAYA 4YY3C 5BSUA 3I07A 1HH2P 4DR7C 1IB8A 1FLOA 1QWIA 4D56A 1AMUA 3CQ2A 2HHHC 4KTTA 1HNWC 2E8EA 3LNOA 4LFCC 1MKYA 3VNQA 4LF5C 5CZXA 1K0RA 3G7SA 4JI6C 2D28C 4R1LA 4X64C 5CZVA 4L7IA 4RM2A 2OPLB 3H2TA 1O92A 5AE3A 4JI2C 3N2QA 4DCTA 4NOZA 3K6RA 2PG1E 3NPDA 3E7XA 1PG3A 4DCUA 1NY8A 3A9VA 2OBVA 4DUZC 1PU1A 2BJOA 2YX1A 3L8CA 5A2QD 3FM7A 2F4VC 4D4GA 1IBKC 4RVNA 4KHPC 3FCCA 4OYCA 1HR0C 5IWAC 4GKKC 4U5YD 4FTFA 5LMUC 4DR5C 1WCJA 3R9WA 2UXCC 3N54B 3ETCA 4DR4C 3OTOC 4DR3C 4PROC 5FLXD 4DV0C 4GXRA 2CU6A 1EGAA 3DLPX 4ZLPA 4MTNA 3UX3A 2P20A 4X66C 1XMQC 1P7LA 2P2QA 4BSZA 5K8FA 2YCBA 4JI0C 2WD9A 4JI7C 1XDXA 5A1IA 2ASBA 2VQFC 2Z51A 4JYAC 2ZTBA 2KDNA 2ATWA 2E8FA 4DV3C 1QM4A 2ZZNA 2QW0X 1MXBA
chains in the Genus database with same CATH topology
2UUAC 3UZ0A 5BSRA 2P2MA 3C5EA 3IEUA 2QVYX 4RLFA 1LCIA 5A1GA 1O9TA 3E7WA 2D7VA 2D1QA 4IR7A 1N32C 1N34C 4R1MA 5BSTA 4DCSA 1MDFA 3CW9A 4LE5A 4OX9C 2UUCC 2BH1X 4DV2C 3JAMD 3KXWA 1VLAA 1FUGA 2KZFA 4DR2C 2ZM6C 5BUQA 1YJ7A 2AYAA 1UKKA 4PHTA 4DG8A 4X62C 1PA4A 1T5DX 3NYRA 4OXIA 1IBMC 4LF8C 5BR8C 1BA3A 5A19A 1XNRC 4PZPA 1USPB 4RM3A 3LUSA 5KYTA 4DV1C 2QVZX 3EQ6A 1PG4A 1O90A 4NDNA 1JOSA 2HJGA 3A4IA 4BBYA 2UXBC 4BC7A 3A9UA 2Y4NA 3IMLA 4G36A 4D4IA 2XR1A 5IT9D 2WP0C 3J7AD 1RG9A 1USPA 4DV7C 5IFIA 4K0KC 3L95X 3SO4A 1J5EC 4JI3C 2P2BA 4KTVA 4BCAA 4GKJC 1O93A 2OPLA 3NYQA 3TQIA 1LQLA 2Y27A 3LAXA 3AF5A 4L2ZA 1MDBA 1XRAA 5DV9A 3T1YC 1MXCA 4G1IA 3PROC 4DV6C 2PN2A 5BUSA 2UUBC 4DV4C 4WS9A 1T5HX 4ISBA 4AQYC 2PT7G 4K0BA 3LGXA 4I9FA 5KYVA 2UXDC 4WV3A 1NYEA 3TDEA 5ADZA 1XMOC 4G37A 5LMNC 2CY1A 4XX2A 3EERA 4LF6C 1MD9A 4DR6C 1XRCA 3PESA 3UOWA 4ODJA 5T8TA 1N2FA 2V7BA 1MXAA 1I94C 2YWBA 2QL8A 3J80D 4JM1A 3GPCA 5KEIA 4HPVA 1XRBA 2CXCA 2P2FA 4DCVA 2D27A 2VZEA 4IZ6A 4JI5C 1HNZC 3LNVA 2VQEC 3GR0A 4GS5A 1L2FA 2OO4A 4B3SC 4ZJZA 3S82A 4DV5C 5GTDA 3T1HC 2D1TA 4JI4C 4D57A 2Y4OA 3RV2A 3IEVA 4RLQA 3TUFA 1V26A 1ML8A 2DYJA 4LFBC 3GR1A 4B3RC 2P02A 3J81D 3CJEA 2PROA 1KKGA 3B7WA 2E8CA 1WH9A 2E0GA 5H9UA 5AE1A 4YHHC 2E7GA 1WF3A 1RY2A 5BSVA 4BC9A 4R0MA 4LF4C 4GXQA 4FUQA 1FJGC 1ZB9A 3NI2A 5BSMA 3IPLA 5JRHA 2UU9C 3GKUA 4RVOA 2D1SA 2DPLA 4NXNC 3R9XA 4X65C 5E7QA 2D1RA 3PBKA 4MH4A 4NXMC 1HNXC 4EATA 3VNSA 1XNQC 4RMNA 3R44A 1N36C 4DG9A 4JV5C 4B3MC 4JI1C 1ZB8A 2JMPA 3FCEA 4B3TC 1GPMA 2P2JA 1IBLC 4TPSB 3CW8X 3RG2A 5BSWA 5T8SA 4LF9C 5BURA 2EGTA 5K85A 4JI8C 2E5LC 2YWCA 4DR1C 3DHVA 4LF7C 4L4QA 1V25A 4FUTA 5AE2A 2ONFA 3VNRA 3ETOA 3AF6A 2VSQA 2QVXX 4I9GA 1ULTA 4DUYC 1N33C 3I08A 4LFAC 3DAYA 4YY3C 5BSUA 3I07A 1HH2P 4DR7C 1QWIA 4D56A 1AMUA 2HHHC 4KTTA 1HNWC 2E8EA 4LFCC 1MKYA 3VNQA 4LF5C 5CZXA 1K0RA 3G7SA 4JI6C 2D28C 4R1LA 4X64C 5CZVA 4L7IA 4RM2A 2OPLB 3H2TA 1O92A 5AE3A 4JI2C 3N2QA 4DCTA 4NOZA 3NPDA 3E7XA 1PG3A 4DCUA 3A9VA 2OBVA 4DUZC 2BJOA 3L8CA 5A2QD 2F4VC 4D4GA 1IBKC 4RVNA 4KHPC 3FCCA 4OYCA 1HR0C 5IWAC 4GKKC 4U5YD 4FTFA 5LMUC 4DR5C 3R9WA 2UXCC 3N54B 3ETCA 4DR4C 3OTOC 4DR3C 4PROC 5FLXD 4DV0C 4GXRA 3DLPX 1EGAA 4ZLPA 4MTNA 2P20A 4X66C 1XMQC 1P7LA 2P2QA 4BSZA 5K8FA 2YCBA 4JI0C 2WD9A 4JI7C 5A1IA 2ASBA 2VQFC 4JYAC 2ATWA 2E8FA 4DV3C 1QM4A 2QW0X 1MXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA C;  3I07 A;  1HH2 P;  2OPL A;  4DR7 C;  3J81 D;  1LQL A;  3CJE A;  1QWI A;  1KKG A;  2E8C A;  2HHH C;  1WH9 A;  3IEU A;  1HNW C;  2E8E A;  4YHH C;  3AF5 A;  4LFC C;  2E7G A;  1MKY A;  1WF3 A;  3T1Y C;  4LF5 C;  2D7V A;  1N32 C;  1N34 C;  4DCS A;  1K0R A;  4LF4 C;  1FJG C;  4OX9 C;  2UUC C;  4JI6 C;  1ZB9 A;  4DV2 C;  4DV6 C;  4X64 C;  3JAM D;  2PN2 A;  2UUB C;  4DV4 C;  2OPL B;  1VLA A;  4JI2 C;  2KZF A;  2UU9 C;  3GKU A;  4DR2 C;  4AQY C;  4DCT A;  4NXN C;  2PT7 G;  4NOZ A;  2ZM6 C;  3R9X A;  2UXD C;  4X65 C;  1NYE A;  1XMO C;  4DCU A;  1UKK A;  4NXM C;  4MH4 A;  1HNX C;  5LMN C;  2CY1 A;  4XX2 A;  3EER A;  4X62 C;  4LF6 C;  4DUZ C;  2BJO A;  5A2Q D;  2F4V C;  1XNQ C;  4DR6 C;  1IBK C;  1PA4 A;  1IBM C;  4KHP C;  4LF8 C;  5BR8 C;  1N36 C;  1N2F A;  4JV5 C;  1HR0 C;  4B3M C;  4JI1 C;  1ZB8 A;  2JMP A;  5IWA C;  1XNR C;  4B3T C;  1USP B;  5LMU C;  3LUS A;  1IBL C;  4DV1 C;  1I94 C;  4DR5 C;  3R9W A;  4GKJ C;  2UXC C;  4LF9 C;  2EGT A;  2QL8 A;  1JOS A;  3J80 D;  4JI8 C;  4DR4 C;  2E5L C;  2HJG A;  3OTO C;  4DR3 C;  5FLX D;  4DV0 C;  2UXB C;  4DR1 C;  2CXC A;  1EGA A;  4MTN A;  4LF7 C;  4DCV A;  2XR1 A;  1HNZ C;  4X66 C;  5IT9 D;  4JI5 C;  1XMQ C;  3J7A D;  2VQE C;  2ONF A;  3AF6 A;  1USP A;  4BSZ A;  1L2F A;  2YCB A;  4DV7 C;  4B3S C;  4K0K C;  4JI0 C;  4DUY C;  4DV5 C;  1N33 C;  3T1H C;  4JI7 C;  2ASB A;  4JI4 C;  2VQF C;  4JYA C;  1J5E C;  3IEV A;  4LFA C;  4JI3 C;  2ATW A;  2E8F A;  4DV3 C;  1ML8 A;  2DYJ A;  4LFB C;  4YY3 C;  4B3R C;  4GKK C; 
#chains in the Genus database with same CATH topology
 2UUA C;  5LCI A;  3TR3 A;  3UZ0 A;  5BSR A;  2ZZM A;  2P2M A;  3C5E A;  3IEU A;  2QVY X;  4RLF A;  1LCI A;  5A1G A;  1O9T A;  3E7W A;  2D7V A;  2D1Q A;  4IR7 A;  1N32 C;  1N34 C;  4R1M A;  5BST A;  4DCS A;  1MDF A;  3CW9 A;  4LE5 A;  4OX9 C;  2UUC C;  1M6X C;  2BH1 X;  4DV2 C;  3JAM D;  1TH5 A;  3KXW A;  1VLA A;  2KZ0 A;  1FUG A;  2KZF A;  1P4E A;  4DR2 C;  2MCQ A;  2ZM6 C;  5BUQ A;  1YJ7 A;  2AYA A;  1UKK A;  4PHT A;  4DG8 A;  4X62 C;  1PA4 A;  1T5D X;  3NYR A;  4OXI A;  1IBM C;  4LF8 C;  5BR8 C;  1BA3 A;  5A19 A;  1XNR C;  4PZP A;  1USP B;  4RM3 A;  3LUS A;  5KYT A;  4DV1 C;  2QVZ X;  3EQ6 A;  1PG4 A;  1O90 A;  4NDN A;  1JOS A;  2HJG A;  3A4I A;  4BBY A;  2UXB C;  2MM9 A;  4BC7 A;  1YGT A;  3A9U A;  2Y4N A;  3IML A;  4G36 A;  4D4I A;  2XR1 A;  5IT9 D;  2WP0 C;  3J7A D;  1RG9 A;  1USP A;  3CQ3 A;  4DV7 C;  2M5H A;  5IFI A;  4K0K C;  3L95 X;  3SO4 A;  1XHJ A;  1J5E C;  4JI3 C;  2P2B A;  4KTV A;  4BCA A;  4GKJ C;  1O93 A;  2OPL A;  3NYQ A;  3TQI A;  1LQL A;  2Y27 A;  3LAX A;  2MMA B;  2DHM A;  3AF5 A;  4L2Z A;  1MDB A;  1XRA A;  4PUH A;  5DV9 A;  3T1Y C;  1MXC A;  4G1I A;  3PRO C;  4DV6 C;  2PN2 A;  5BUS A;  2UUB C;  4DV4 C;  4WS9 A;  1T5H X;  4ISB A;  4AQY C;  2PT7 G;  4K0B A;  3LGX A;  4I9F A;  5KYV A;  2UXD C;  4WV3 A;  1NYE A;  5ADZ A;  3TDE A;  1XMO C;  4G37 A;  5LMN C;  2CY1 A;  4XX2 A;  3EER A;  4LF6 C;  1MD9 A;  4DR6 C;  1XRC A;  3PES A;  3UOW A;  4ODJ A;  5T8T A;  1N2F A;  4PUI A;  2V7B A;  3CQ1 A;  1MXA A;  1I94 C;  2YWB A;  2QL8 A;  3J80 D;  4JM1 A;  3GPC A;  5KEI A;  4HPV A;  1XRB A;  2CXC A;  2P2F A;  4DCV A;  2D27 A;  2VZE A;  4IZ6 A;  1HNZ C;  4JI5 C;  3LNV A;  2VQE C;  3GR0 A;  4GS5 A;  1L2F A;  2OO4 A;  4B3S C;  2M5O A;  4ZJZ A;  3S82 A;  4DV5 C;  5GTD A;  3T1H C;  2D1T A;  4JI4 C;  4D57 A;  2Y4O A;  3RV2 A;  3IEV A;  4RLQ A;  3TUF A;  1V26 A;  1ML8 A;  2DYJ A;  4LFB C;  3GR1 A;  4B3R C;  2P02 A;  3J81 D;  3CJE A;  2PRO A;  1KKG A;  3B7W A;  2E8C A;  1WH9 A;  2E0G A;  5H9U A;  5AE1 A;  4YHH C;  2E7G A;  1WF3 A;  1RY2 A;  5BSV A;  4BC9 A;  4R0M A;  1XS3 A;  4LF4 C;  4GXQ A;  4FUQ A;  1FJG C;  1ZB9 A;  3NI2 A;  5BSM A;  3IPL A;  3UX2 A;  5JRH A;  1M6X A;  2UU9 C;  3GKU A;  4RVO A;  2D1S A;  2DPL A;  4NXN C;  3R9X A;  4X65 C;  5E7Q A;  1UWD A;  2D1R A;  3PBK A;  4MH4 A;  4NXM C;  1HNX C;  3O2E A;  4EAT A;  3VNS A;  1XNQ C;  4RMN A;  2JNV A;  2NCL A;  3R44 A;  1N36 C;  4DG9 A;  4JV5 C;  4B3M C;  4JI1 C;  1ZB8 A;  2JMP A;  3FCE A;  3A26 A;  4B3T C;  1GPM A;  2P2J A;  1IBL C;  4TPS B;  3CW8 X;  3AY0 A;  3RG2 A;  5BSW A;  5T8S A;  4LF9 C;  5BUR A;  2EGT A;  5K85 A;  4JI8 C;  3UEB A;  2E5L C;  1VEH A;  2YWC A;  3A25 A;  4DR1 C;  1P4E C;  1V60 A;  3DHV A;  4LF7 C;  4L4Q A;  1V25 A;  4FUT A;  5AE2 A;  2ONF A;  3VNR A;  3ETO A;  3AF6 A;  2VSQ A;  2QVX X;  4I9G A;  1ULT A;  4DUY C;  4PUG A;  1N33 C;  3I08 A;  4LFA C;  3DAY A;  4YY3 C;  5BSU A;  3I07 A;  1HH2 P;  4DR7 C;  1IB8 A;  1FLO A;  1QWI A;  4D56 A;  1AMU A;  3CQ2 A;  2HHH C;  4KTT A;  1HNW C;  2E8E A;  3LNO A;  4LFC C;  1MKY A;  3VNQ A;  4LF5 C;  5CZX A;  1K0R A;  3G7S A;  4JI6 C;  2D28 C;  4R1L A;  4X64 C;  5CZV A;  4L7I A;  4RM2 A;  2OPL B;  3H2T A;  1O92 A;  5AE3 A;  4JI2 C;  3N2Q A;  4DCT A;  4NOZ A;  3K6R A;  2PG1 E;  3NPD A;  3E7X A;  1PG3 A;  4DCU A;  1NY8 A;  3A9V A;  2OBV A;  4DUZ C;  1PU1 A;  2BJO A;  2YX1 A;  3L8C A;  5A2Q D;  3FM7 A;  2F4V C;  4D4G A;  1IBK C;  4RVN A;  4KHP C;  3FCC A;  4OYC A;  1HR0 C;  5IWA C;  4GKK C;  4U5Y D;  4FTF A;  5LMU C;  4DR5 C;  1WCJ A;  3R9W A;  2UXC C;  3N54 B;  3ETC A;  4DR4 C;  3OTO C;  4DR3 C;  4PRO C;  5FLX D;  4DV0 C;  4GXR A;  2CU6 A;  1EGA A;  3DLP X;  4ZLP A;  4MTN A;  3UX3 A;  2P20 A;  4X66 C;  1XMQ C;  1P7L A;  2P2Q A;  4BSZ A;  5K8F A;  2YCB A;  4JI0 C;  2WD9 A;  4JI7 C;  1XDX A;  5A1I A;  2ASB A;  2VQF C;  2Z51 A;  4JYA C;  2ZTB A;  2KDN A;  2ATW A;  2E8F A;  4DV3 C;  1QM4 A;  2ZZN A;  2QW0 X;  1MXB A; 
#chains in the Genus database with same CATH homology
 2UUA C;  3UZ0 A;  5BSR A;  2P2M A;  3C5E A;  3IEU A;  2QVY X;  4RLF A;  1LCI A;  5A1G A;  1O9T A;  3E7W A;  2D7V A;  2D1Q A;  4IR7 A;  1N32 C;  1N34 C;  4R1M A;  5BST A;  4DCS A;  1MDF A;  3CW9 A;  4LE5 A;  4OX9 C;  2UUC C;  2BH1 X;  4DV2 C;  3JAM D;  3KXW A;  1VLA A;  1FUG A;  2KZF A;  4DR2 C;  2ZM6 C;  5BUQ A;  1YJ7 A;  2AYA A;  1UKK A;  4PHT A;  4DG8 A;  4X62 C;  1PA4 A;  1T5D X;  3NYR A;  4OXI A;  1IBM C;  4LF8 C;  5BR8 C;  1BA3 A;  5A19 A;  1XNR C;  4PZP A;  1USP B;  4RM3 A;  3LUS A;  5KYT A;  4DV1 C;  2QVZ X;  3EQ6 A;  1PG4 A;  1O90 A;  4NDN A;  1JOS A;  2HJG A;  3A4I A;  4BBY A;  2UXB C;  4BC7 A;  3A9U A;  2Y4N A;  3IML A;  4G36 A;  4D4I A;  2XR1 A;  5IT9 D;  2WP0 C;  3J7A D;  1RG9 A;  1USP A;  4DV7 C;  5IFI A;  4K0K C;  3L95 X;  3SO4 A;  1J5E C;  4JI3 C;  2P2B A;  4KTV A;  4BCA A;  4GKJ C;  1O93 A;  2OPL A;  3NYQ A;  3TQI A;  1LQL A;  2Y27 A;  3LAX A;  3AF5 A;  4L2Z A;  1MDB A;  1XRA A;  5DV9 A;  3T1Y C;  1MXC A;  4G1I A;  3PRO C;  4DV6 C;  2PN2 A;  5BUS A;  2UUB C;  4DV4 C;  4WS9 A;  1T5H X;  4ISB A;  4AQY C;  2PT7 G;  4K0B A;  3LGX A;  4I9F A;  5KYV A;  2UXD C;  4WV3 A;  1NYE A;  3TDE A;  5ADZ A;  1XMO C;  4G37 A;  5LMN C;  2CY1 A;  4XX2 A;  3EER A;  4LF6 C;  1MD9 A;  4DR6 C;  1XRC A;  3PES A;  3UOW A;  4ODJ A;  5T8T A;  1N2F A;  2V7B A;  1MXA A;  1I94 C;  2YWB A;  2QL8 A;  3J80 D;  4JM1 A;  3GPC A;  5KEI A;  4HPV A;  1XRB A;  2CXC A;  2P2F A;  4DCV A;  2D27 A;  2VZE A;  4IZ6 A;  4JI5 C;  1HNZ C;  3LNV A;  2VQE C;  3GR0 A;  4GS5 A;  1L2F A;  2OO4 A;  4B3S C;  4ZJZ A;  3S82 A;  4DV5 C;  5GTD A;  3T1H C;  2D1T A;  4JI4 C;  4D57 A;  2Y4O A;  3RV2 A;  3IEV A;  4RLQ A;  3TUF A;  1V26 A;  1ML8 A;  2DYJ A;  4LFB C;  3GR1 A;  4B3R C;  2P02 A;  3J81 D;  3CJE A;  2PRO A;  1KKG A;  3B7W A;  2E8C A;  1WH9 A;  2E0G A;  5H9U A;  5AE1 A;  4YHH C;  2E7G A;  1WF3 A;  1RY2 A;  5BSV A;  4BC9 A;  4R0M A;  4LF4 C;  4GXQ A;  4FUQ A;  1FJG C;  1ZB9 A;  3NI2 A;  5BSM A;  3IPL A;  5JRH A;  2UU9 C;  3GKU A;  4RVO A;  2D1S A;  2DPL A;  4NXN C;  3R9X A;  4X65 C;  5E7Q A;  2D1R A;  3PBK A;  4MH4 A;  4NXM C;  1HNX C;  4EAT A;  3VNS A;  1XNQ C;  4RMN A;  3R44 A;  1N36 C;  4DG9 A;  4JV5 C;  4B3M C;  4JI1 C;  1ZB8 A;  2JMP A;  3FCE A;  4B3T C;  1GPM A;  2P2J A;  1IBL C;  4TPS B;  3CW8 X;  3RG2 A;  5BSW A;  5T8S A;  4LF9 C;  5BUR A;  2EGT A;  5K85 A;  4JI8 C;  2E5L C;  2YWC A;  4DR1 C;  3DHV A;  4LF7 C;  4L4Q A;  1V25 A;  4FUT A;  5AE2 A;  2ONF A;  3VNR A;  3ETO A;  3AF6 A;  2VSQ A;  2QVX X;  4I9G A;  1ULT A;  4DUY C;  1N33 C;  3I08 A;  4LFA C;  3DAY A;  4YY3 C;  5BSU A;  3I07 A;  1HH2 P;  4DR7 C;  1QWI A;  4D56 A;  1AMU A;  2HHH C;  4KTT A;  1HNW C;  2E8E A;  4LFC C;  1MKY A;  3VNQ A;  4LF5 C;  5CZX A;  1K0R A;  3G7S A;  4JI6 C;  2D28 C;  4R1L A;  4X64 C;  5CZV A;  4L7I A;  4RM2 A;  2OPL B;  3H2T A;  1O92 A;  5AE3 A;  4JI2 C;  3N2Q A;  4DCT A;  4NOZ A;  3NPD A;  3E7X A;  1PG3 A;  4DCU A;  3A9V A;  2OBV A;  4DUZ C;  2BJO A;  3L8C A;  5A2Q D;  2F4V C;  4D4G A;  1IBK C;  4RVN A;  4KHP C;  3FCC A;  4OYC A;  1HR0 C;  5IWA C;  4GKK C;  4U5Y D;  4FTF A;  5LMU C;  4DR5 C;  3R9W A;  2UXC C;  3N54 B;  3ETC A;  4DR4 C;  3OTO C;  4DR3 C;  4PRO C;  5FLX D;  4DV0 C;  4GXR A;  3DLP X;  1EGA A;  4ZLP A;  4MTN A;  2P20 A;  4X66 C;  1XMQ C;  1P7L A;  2P2Q A;  4BSZ A;  5K8F A;  2YCB A;  4JI0 C;  2WD9 A;  4JI7 C;  5A1I A;  2ASB A;  2VQF C;  4JYA C;  2ATW A;  2E8F A;  4DV3 C;  1QM4 A;  2QW0 X;  1MXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...