1XMQC

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xmqC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xmqC02
5BR8C 4B3TC 4JI5C 4GKJC 2KZFA 2UUCC 4B3MC 4YHHC 4DUYC 1IBMC 2E8EA 4LF5C 1XNQC 4X64C 2ONFA 1N34C 3R9XA 4DV4C 4LFCC 1USPA 5IT9D 4DCVA 1HR0C 1N2FA 2YCBA 1LQLA 1ZB9A 4NXMC 2D7VA 2CXCA 1KKGA 2VQFC 3AF5A 5A2QD 4B3SC 4DV2C 1WH9A 3AF6A 2UU9C 4LF6C 2JMPA 2HHHC 1QWIA 1WF3A 5LMUC 4BSZA 3T1HC 4JI2C 4DV1C 1K0RA 2PT7G 2EGTA 4YY3C 1L2FA 4DR5C 4DV0C 4DR6C 4AQYC 3EERA 1UKKA 1HH2P 4DCTA 2UUAC 2E5LC 4GKKC 1ZB8A 4DCUA 2OPLB 3CJEA 5LMNC 2QL8A 4KHPC 2UXBC 4LFBC 4LF4C 2ATWA 4DUZC 3R9WA 4JV5C 1FJGC 4DV6C 2VQEC 4JI6C 3GKUA 4JI3C 1MKYA 3T1YC 1XMOC 2UUBC 4JI7C 1NYEA 4K0KC 1USPB 4JYAC 4LF9C 3J80D 1I94C 2UXDC 2XR1A 1ML8A 4DV5C 4LF8C 1VLAA 4LF7C 1HNWC 1PA4A 3IEUA 4MTNA 2HJGA 1IBKC 3JAMD 1HNZC 4LFAC 4X66C 2ASBA 2E7GA 4DV7C 4NOZA 4NXNC 1N33C 2ZM6C 2E8CA 4XX2A 4X65C 4OX9C 4MH4A 4DR7C 2PN2A 1N36C 1J5EC 1XNRC 1N32C 3LUSA 1JOSA 1HNXC 2CY1A 2E8FA 4JI0C 4JI1C 2F4VC 5FLXD 3OTOC 2UXCC 4X62C 4DR4C 1IBLC 2BJOA 4JI8C 4B3RC 1XMQC 4DR2C 1EGAA 4JI4C 4DCSA 4DR3C 5IWAC 3I07A 2DYJA 3IEVA 3J7AD 3J81D 4DV3C 2OPLA 4DR1C
chains in the Genus database with same CATH superfamily
3R44A 4KTVA 4RM2A 1BA3A 4GKJC 2KZFA 5A19A 1ULTA 4HPVA 4B3MC 1M6XC 4YHHC 2MMAB 4RM3A 2JNVA 2P02A 4X64C 3TDEA 5KYVA 2OO4A 4RLQA 4IZ6A 4LFCC 5BSVA 1N2FA 2VSQA 1KKGA 3C5EA 1P4EA 3A9UA 1P7LA 4WV3A 5LMUC 4BSZA 4DV1C 4TPSB 3CQ2A 2D1QA 3S82A 2BH1X 3A4IA 4D4IA 4GKKC 1QM4A 5BUQA 3G7SA 2OPLB 2QW0X 4FUTA 1RY2A 2QL8A 1XHJA 4LE5A 2E0GA 3R9WA 4DV6C 2VQEC 3GKUA 3VNRA 4EATA 3NYQA 1XMOC 2P2BA 2UUBC 1USPB 2YX1A 4OYCA 3J80D 1I94C 1MXAA 4DV5C 2PROA 4LF7C 1HNWC 1VLAA 3TQIA 4LFAC 2D1SA 4OX9C 4MH4A 4DR7C 1N32C 2E8FA 5FLXD 2QVXX 4DR4C 2P20A 3AY0A 2CU6A 1XMQC 2KZ0A 4DCSA 4DR3C 5IWAC 3I07A 2DYJA 4L4QA 1O90A 4IR7A 2Y27A 5DV9A 1XRCA 2PG1E 5BR8C 4JI5C 1GPMA 3UOWA 2UUCC 3IPLA 3K6RA 4DUYC 1XNQC 4G1IA 3NI2A 2ONFA 4DG9A 5E7QA 1N34C 3R9XA 1MDFA 3NPDA 5IT9D 5BSRA 1T5DX 2YCBA 1LQLA 2Y4NA 2VQFC 2Z51A 4DV2C 1WH9A 2D1TA 4L7IA 5LCIA 3T1HC 3UZ0A 1V25A 2OBVA 4PROC 4YY3C 3TUFA 2KDNA 3LGXA 4AQYC 1UKKA 1HH2P 2UUAC 2D28C 2M5OA 4RMNA 2UXBC 5BSMA 4D57A 3FM7A 4G36A 4DUZC 3VNSA 4JV5C 1TH5A 1FJGC 3CQ3A 4D56A 4PZPA 5T8TA 4JI3C 3PROC 4D4GA 4GXQA 3RV2A 1NYEA 1LCIA 2UXDC 4LF8C 1ML8A 5BSUA 4R0MA 2P2QA 3CW9A 4ISBA 5BSTA 5T8SA 4BBYA 5JRHA 3JAMD 4X66C 4L2ZA 1PG4A 2V7BA 2E7GA 1V60A 4DV7C 2P2MA 1N33C 1XDXA 2AYAA 4PHTA 4XX2A 1XS3A 4U5YD 4X65C 2YWBA 3LUSA 5KYTA 1HNXC 2F4VC 3KXWA 4X62C 4DG8A 1IBLC 2BJOA 4B3RC 2QVZX 4JM1A 1FUGA 3H2TA 2MM9A 1MXCA 4KTTA 5IFIA 3A9VA 2OPLA 2NCLA 2DHMA 1V26A 2ZZMA 1VEHA 3UX3A 5AE1A 5BSWA 4RLFA 4RVOA 3UX2A 1IBMC 2E8EA 4LF5C 4BC7A 1PU1A 1MXBA 1USPA 2VZEA 4NDNA 1ZB9A 4NXMC 2CXCA 3RG2A 3AF5A 5A2QD 3VNQA 4LF6C 2UU9C 3AF6A 1WF3A 3DLPX 1K0RA 2PT7G 3L8CA 3LNOA 2EGTA 4DR5C 4FTFA 1L2FA 1T5HX 3EERA 4DCTA 3FCCA 2E5LC 4R1MA 3A26A 1ZB8A 5CZVA 4DCUA 4ZLPA 3CJEA 4KHPC 3DAYA 3GR1A 1UWDA 2ATWA 3N54B 5ADZA 3N2QA 2ZTBA 4GXRA 4BCAA 5GTDA 1MKYA 5KEIA 1PG3A 4K0KC 1XRAA 1MD9A 3ETOA 1PA4A 2HJGA 1AMUA 2ASBA 2D1RA 2D27A 1NY8A 2YWCA 1N36C 1J5EC 4JI0C 3LAXA 1O9TA 3L95X 4I9FA 4WS9A 3GR0A 4JI8C 4DR2C 3NYRA 1EGAA 1RG9A 4JI4C 3J7AD 2ZZNA 4DV3C 4DR1C 4B3TC 3B7WA 2MCQA 3PBKA 4RVNA 1P4EC 1XRBA 5H9UA 4G37A 1YGTA 1O93A 4OXIA 3SO4A 4DV4C 3UEBA 3PESA 4GS5A 4DCVA 1HR0C 3E7XA 2DPLA 1O92A 1M6XA 2D7VA 5A1IA 4PUGA 5AE2A 3CW8X 5K85A 4B3SC 3DHVA 2HHHC 1QWIA 4JI2C 4ODJA 5K8FA 4R1LA 4DV0C 4DR6C 3TR3A 2P2FA 4FUQA 2Y4OA 5BUSA 5LMNC 2QVYX 4ZJZA 4LFBC 5A1GA 5AE3A 4LF4C 4PUHA 1WCJA 3O2EA 5CZXA 4JI6C 2WD9A 3T1YC 5BURA 4JI7C 3A25A 4JYAC 4LF9C 3CQ1A 3LNVA 2XR1A 3ETCA 3IMLA 3IEUA 1FLOA 4MTNA 1IBKC 1HNZC 4NXNC 4NOZA 4I9GA 2ZM6C 2E8CA 3I08A 2M5HA 2PN2A 1XNRC 1JOSA 2CY1A 3FCEA 4JI1C 1MDBA 4K0BA 3OTOC 2UXCC 2P2JA 3GPCA 1YJ7A 4BC9A 2WP0C 4PUIA 3IEVA 3E7WA 3J81D 2JMPA 3EQ6A 1IB8A
chains in the Genus database with same CATH topology
3R44A 4KTVA 4RM2A 1BA3A 4GKJC 2KZFA 5A19A 1ULTA 4HPVA 4B3MC 4YHHC 4RM3A 2P02A 4X64C 3TDEA 5KYVA 2OO4A 4RLQA 4IZ6A 4LFCC 5BSVA 1N2FA 2VSQA 1KKGA 3C5EA 3A9UA 1P7LA 4WV3A 5LMUC 4BSZA 4DV1C 4TPSB 2D1QA 3S82A 2BH1X 3A4IA 4D4IA 4GKKC 1QM4A 5BUQA 3G7SA 2OPLB 2QW0X 4FUTA 1RY2A 2QL8A 4LE5A 2E0GA 3R9WA 4DV6C 2VQEC 3GKUA 3VNRA 4EATA 3NYQA 1XMOC 2P2BA 2UUBC 1USPB 4OYCA 3J80D 1I94C 1MXAA 4DV5C 2PROA 4LF7C 1HNWC 1VLAA 3TQIA 4LFAC 2D1SA 4OX9C 4MH4A 4DR7C 1N32C 2E8FA 5FLXD 2QVXX 4DR4C 2P20A 1XMQC 4DCSA 4DR3C 5IWAC 3I07A 2DYJA 4L4QA 1O90A 4IR7A 2Y27A 5DV9A 1XRCA 5BR8C 4JI5C 1GPMA 3UOWA 2UUCC 3IPLA 4DUYC 1XNQC 4G1IA 3NI2A 2ONFA 4DG9A 1N34C 5E7QA 3R9XA 1MDFA 3NPDA 5IT9D 5BSRA 1T5DX 2YCBA 1LQLA 2Y4NA 2VQFC 4DV2C 1WH9A 2D1TA 4L7IA 3T1HC 3UZ0A 1V25A 2OBVA 4PROC 4YY3C 3TUFA 3LGXA 4AQYC 1UKKA 1HH2P 2UUAC 2D28C 4RMNA 2UXBC 5BSMA 4D57A 4G36A 4DUZC 3VNSA 4JV5C 1FJGC 4D56A 4PZPA 5T8TA 4JI3C 3PROC 4D4GA 4GXQA 3RV2A 1NYEA 1LCIA 2UXDC 4LF8C 1ML8A 5BSUA 4R0MA 2P2QA 3CW9A 4ISBA 5BSTA 5T8SA 4BBYA 5JRHA 3JAMD 4X66C 4L2ZA 1PG4A 2V7BA 2E7GA 4DV7C 2P2MA 1N33C 2AYAA 4PHTA 4XX2A 4X65C 4U5YD 2YWBA 3LUSA 5KYTA 1HNXC 2F4VC 3KXWA 4X62C 4DG8A 1IBLC 2BJOA 4B3RC 2QVZX 4JM1A 1FUGA 3H2TA 1MXCA 4KTTA 5IFIA 3A9VA 2OPLA 1V26A 5AE1A 5BSWA 4RLFA 4RVOA 1IBMC 2E8EA 4LF5C 4BC7A 1MXBA 1USPA 2VZEA 4NDNA 1ZB9A 4NXMC 2CXCA 3RG2A 3AF5A 5A2QD 3VNQA 4LF6C 2UU9C 3AF6A 1WF3A 3DLPX 1K0RA 2PT7G 3L8CA 2EGTA 4DR5C 4FTFA 1L2FA 1T5HX 3EERA 4DCTA 3FCCA 2E5LC 4R1MA 1ZB8A 5CZVA 4DCUA 4ZLPA 3CJEA 4KHPC 3DAYA 3GR1A 2ATWA 3N54B 5ADZA 3N2QA 4GXRA 4BCAA 5GTDA 1MKYA 5KEIA 1PG3A 4K0KC 1XRAA 1MD9A 3ETOA 1PA4A 2HJGA 1AMUA 2ASBA 2D1RA 2D27A 2YWCA 1N36C 1J5EC 4JI0C 3LAXA 1O9TA 3L95X 4I9FA 4WS9A 3GR0A 4JI8C 4DR2C 3NYRA 1EGAA 1RG9A 4JI4C 3J7AD 4DV3C 4DR1C 4B3TC 3B7WA 3PBKA 4RVNA 1XRBA 5H9UA 4G37A 1O93A 4OXIA 3SO4A 4DV4C 3PESA 4GS5A 4DCVA 1HR0C 3E7XA 2DPLA 1O92A 2D7VA 5A1IA 5AE2A 3CW8X 5K85A 4B3SC 3DHVA 2HHHC 1QWIA 4JI2C 4ODJA 5K8FA 4R1LA 4DV0C 4DR6C 2P2FA 4FUQA 2Y4OA 5BUSA 5LMNC 2QVYX 4ZJZA 4LFBC 5A1GA 5AE3A 4LF4C 5CZXA 4JI6C 2WD9A 3T1YC 5BURA 4JI7C 4JYAC 4LF9C 3LNVA 2XR1A 3ETCA 3IMLA 3IEUA 4MTNA 1IBKC 1HNZC 4NXNC 4NOZA 4I9GA 2ZM6C 2E8CA 3I08A 2PN2A 1XNRC 1JOSA 2CY1A 3FCEA 4JI1C 1MDBA 4K0BA 3OTOC 2UXCC 2P2JA 3GPCA 1YJ7A 4BC9A 2WP0C 3IEVA 3E7WA 3J81D 2JMPA 3EQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 C;  4B3T C;  4JI5 C;  4GKJ C;  2KZF A;  2UUC C;  4B3M C;  4YHH C;  4DUY C;  1IBM C;  2E8E A;  4LF5 C;  1XNQ C;  4X64 C;  2ONF A;  1N34 C;  3R9X A;  4DV4 C;  4LFC C;  1USP A;  5IT9 D;  4DCV A;  1HR0 C;  1N2F A;  2YCB A;  1LQL A;  1ZB9 A;  4NXM C;  2D7V A;  2CXC A;  1KKG A;  2VQF C;  3AF5 A;  5A2Q D;  4B3S C;  4DV2 C;  1WH9 A;  3AF6 A;  2UU9 C;  4LF6 C;  2JMP A;  2HHH C;  1QWI A;  1WF3 A;  5LMU C;  4BSZ A;  3T1H C;  4JI2 C;  4DV1 C;  1K0R A;  2PT7 G;  2EGT A;  4YY3 C;  1L2F A;  4DR5 C;  4DV0 C;  4DR6 C;  4AQY C;  3EER A;  1UKK A;  1HH2 P;  4DCT A;  2UUA C;  2E5L C;  4GKK C;  1ZB8 A;  4DCU A;  2OPL B;  3CJE A;  5LMN C;  2QL8 A;  4KHP C;  2UXB C;  4LFB C;  4LF4 C;  2ATW A;  4DUZ C;  3R9W A;  4JV5 C;  1FJG C;  4DV6 C;  2VQE C;  4JI6 C;  3GKU A;  4JI3 C;  1MKY A;  3T1Y C;  1XMO C;  2UUB C;  4JI7 C;  1NYE A;  4K0K C;  1USP B;  4JYA C;  4LF9 C;  3J80 D;  1I94 C;  2UXD C;  2XR1 A;  1ML8 A;  4DV5 C;  4LF8 C;  1VLA A;  4LF7 C;  1HNW C;  1PA4 A;  3IEU A;  4MTN A;  2HJG A;  1IBK C;  3JAM D;  1HNZ C;  4LFA C;  4X66 C;  2ASB A;  2E7G A;  4DV7 C;  4NOZ A;  4NXN C;  1N33 C;  2ZM6 C;  2E8C A;  4XX2 A;  4X65 C;  4OX9 C;  4MH4 A;  4DR7 C;  2PN2 A;  1N36 C;  1J5E C;  1XNR C;  1N32 C;  3LUS A;  1JOS A;  1HNX C;  2CY1 A;  2E8F A;  4JI0 C;  4JI1 C;  2F4V C;  5FLX D;  3OTO C;  2UXC C;  4X62 C;  4DR4 C;  1IBL C;  2BJO A;  4JI8 C;  4B3R C;  1XMQ C;  4DR2 C;  1EGA A;  4JI4 C;  4DCS A;  4DR3 C;  5IWA C;  3I07 A;  2DYJ A;  3IEV A;  3J7A D;  3J81 D;  4DV3 C;  2OPL A;  4DR1 C; 
#chains in the Genus database with same CATH topology
 3R44 A;  4KTV A;  4RM2 A;  1BA3 A;  4GKJ C;  2KZF A;  5A19 A;  1ULT A;  4HPV A;  4B3M C;  1M6X C;  4YHH C;  2MMA B;  4RM3 A;  2JNV A;  2P02 A;  4X64 C;  3TDE A;  5KYV A;  2OO4 A;  4RLQ A;  4IZ6 A;  4LFC C;  5BSV A;  1N2F A;  2VSQ A;  1KKG A;  3C5E A;  1P4E A;  3A9U A;  1P7L A;  4WV3 A;  5LMU C;  4BSZ A;  4DV1 C;  4TPS B;  3CQ2 A;  2D1Q A;  3S82 A;  2BH1 X;  3A4I A;  4D4I A;  4GKK C;  1QM4 A;  5BUQ A;  3G7S A;  2OPL B;  2QW0 X;  4FUT A;  1RY2 A;  2QL8 A;  1XHJ A;  4LE5 A;  2E0G A;  3R9W A;  4DV6 C;  2VQE C;  3GKU A;  3VNR A;  4EAT A;  3NYQ A;  1XMO C;  2P2B A;  2UUB C;  1USP B;  2YX1 A;  4OYC A;  3J80 D;  1I94 C;  1MXA A;  4DV5 C;  2PRO A;  4LF7 C;  1HNW C;  1VLA A;  3TQI A;  4LFA C;  2D1S A;  4OX9 C;  4MH4 A;  4DR7 C;  1N32 C;  2E8F A;  5FLX D;  2QVX X;  4DR4 C;  2P20 A;  3AY0 A;  2CU6 A;  1XMQ C;  2KZ0 A;  4DCS A;  4DR3 C;  5IWA C;  3I07 A;  2DYJ A;  4L4Q A;  1O90 A;  4IR7 A;  2Y27 A;  5DV9 A;  1XRC A;  2PG1 E;  5BR8 C;  4JI5 C;  1GPM A;  3UOW A;  2UUC C;  3IPL A;  3K6R A;  4DUY C;  1XNQ C;  4G1I A;  3NI2 A;  2ONF A;  4DG9 A;  5E7Q A;  1N34 C;  3R9X A;  1MDF A;  3NPD A;  5IT9 D;  5BSR A;  1T5D X;  2YCB A;  1LQL A;  2Y4N A;  2VQF C;  2Z51 A;  4DV2 C;  1WH9 A;  2D1T A;  4L7I A;  5LCI A;  3T1H C;  3UZ0 A;  1V25 A;  2OBV A;  4PRO C;  4YY3 C;  3TUF A;  2KDN A;  3LGX A;  4AQY C;  1UKK A;  1HH2 P;  2UUA C;  2D28 C;  2M5O A;  4RMN A;  2UXB C;  5BSM A;  4D57 A;  3FM7 A;  4G36 A;  4DUZ C;  3VNS A;  4JV5 C;  1TH5 A;  1FJG C;  3CQ3 A;  4D56 A;  4PZP A;  5T8T A;  4JI3 C;  3PRO C;  4D4G A;  4GXQ A;  3RV2 A;  1NYE A;  1LCI A;  2UXD C;  4LF8 C;  1ML8 A;  5BSU A;  4R0M A;  2P2Q A;  3CW9 A;  4ISB A;  5BST A;  5T8S A;  4BBY A;  5JRH A;  3JAM D;  4X66 C;  4L2Z A;  1PG4 A;  2V7B A;  2E7G A;  1V60 A;  4DV7 C;  2P2M A;  1N33 C;  1XDX A;  2AYA A;  4PHT A;  4XX2 A;  1XS3 A;  4U5Y D;  4X65 C;  2YWB A;  3LUS A;  5KYT A;  1HNX C;  2F4V C;  3KXW A;  4X62 C;  4DG8 A;  1IBL C;  2BJO A;  4B3R C;  2QVZ X;  4JM1 A;  1FUG A;  3H2T A;  2MM9 A;  1MXC A;  4KTT A;  5IFI A;  3A9V A;  2OPL A;  2NCL A;  2DHM A;  1V26 A;  2ZZM A;  1VEH A;  3UX3 A;  5AE1 A;  5BSW A;  4RLF A;  4RVO A;  3UX2 A;  1IBM C;  2E8E A;  4LF5 C;  4BC7 A;  1PU1 A;  1MXB A;  1USP A;  2VZE A;  4NDN A;  1ZB9 A;  4NXM C;  2CXC A;  3RG2 A;  3AF5 A;  5A2Q D;  3VNQ A;  4LF6 C;  2UU9 C;  3AF6 A;  1WF3 A;  3DLP X;  1K0R A;  2PT7 G;  3L8C A;  3LNO A;  2EGT A;  4DR5 C;  4FTF A;  1L2F A;  1T5H X;  3EER A;  4DCT A;  3FCC A;  2E5L C;  4R1M A;  3A26 A;  1ZB8 A;  5CZV A;  4DCU A;  4ZLP A;  3CJE A;  4KHP C;  3DAY A;  3GR1 A;  1UWD A;  2ATW A;  3N54 B;  5ADZ A;  3N2Q A;  2ZTB A;  4GXR A;  4BCA A;  5GTD A;  1MKY A;  5KEI A;  1PG3 A;  4K0K C;  1XRA A;  1MD9 A;  3ETO A;  1PA4 A;  2HJG A;  1AMU A;  2ASB A;  2D1R A;  2D27 A;  1NY8 A;  2YWC A;  1N36 C;  1J5E C;  4JI0 C;  3LAX A;  1O9T A;  3L95 X;  4I9F A;  4WS9 A;  3GR0 A;  4JI8 C;  4DR2 C;  3NYR A;  1EGA A;  1RG9 A;  4JI4 C;  3J7A D;  2ZZN A;  4DV3 C;  4DR1 C;  4B3T C;  3B7W A;  2MCQ A;  3PBK A;  4RVN A;  1P4E C;  1XRB A;  5H9U A;  4G37 A;  1YGT A;  1O93 A;  4OXI A;  3SO4 A;  4DV4 C;  3UEB A;  3PES A;  4GS5 A;  4DCV A;  1HR0 C;  3E7X A;  2DPL A;  1O92 A;  1M6X A;  2D7V A;  5A1I A;  4PUG A;  5AE2 A;  3CW8 X;  5K85 A;  4B3S C;  3DHV A;  2HHH C;  1QWI A;  4JI2 C;  4ODJ A;  5K8F A;  4R1L A;  4DV0 C;  4DR6 C;  3TR3 A;  2P2F A;  4FUQ A;  2Y4O A;  5BUS A;  5LMN C;  2QVY X;  4ZJZ A;  4LFB C;  5A1G A;  5AE3 A;  4LF4 C;  4PUH A;  1WCJ A;  3O2E A;  5CZX A;  4JI6 C;  2WD9 A;  3T1Y C;  5BUR A;  4JI7 C;  3A25 A;  4JYA C;  4LF9 C;  3CQ1 A;  3LNV A;  2XR1 A;  3ETC A;  3IML A;  3IEU A;  1FLO A;  4MTN A;  1IBK C;  1HNZ C;  4NXN C;  4NOZ A;  4I9G A;  2ZM6 C;  2E8C A;  3I08 A;  2M5H A;  2PN2 A;  1XNR C;  1JOS A;  2CY1 A;  3FCE A;  4JI1 C;  1MDB A;  4K0B A;  3OTO C;  2UXC C;  2P2J A;  3GPC A;  1YJ7 A;  4BC9 A;  2WP0 C;  4PUI A;  3IEV A;  3E7W A;  3J81 D;  2JMP A;  3EQ6 A;  1IB8 A; 
#chains in the Genus database with same CATH homology
 3R44 A;  4KTV A;  4RM2 A;  1BA3 A;  4GKJ C;  2KZF A;  5A19 A;  1ULT A;  4HPV A;  4B3M C;  4YHH C;  4RM3 A;  2P02 A;  4X64 C;  3TDE A;  5KYV A;  2OO4 A;  4RLQ A;  4IZ6 A;  4LFC C;  5BSV A;  1N2F A;  2VSQ A;  1KKG A;  3C5E A;  3A9U A;  1P7L A;  4WV3 A;  5LMU C;  4BSZ A;  4DV1 C;  4TPS B;  2D1Q A;  3S82 A;  2BH1 X;  3A4I A;  4D4I A;  4GKK C;  1QM4 A;  5BUQ A;  3G7S A;  2OPL B;  2QW0 X;  4FUT A;  1RY2 A;  2QL8 A;  4LE5 A;  2E0G A;  3R9W A;  4DV6 C;  2VQE C;  3GKU A;  3VNR A;  4EAT A;  3NYQ A;  1XMO C;  2P2B A;  2UUB C;  1USP B;  4OYC A;  3J80 D;  1I94 C;  1MXA A;  4DV5 C;  2PRO A;  4LF7 C;  1HNW C;  1VLA A;  3TQI A;  4LFA C;  2D1S A;  4OX9 C;  4MH4 A;  4DR7 C;  1N32 C;  2E8F A;  5FLX D;  2QVX X;  4DR4 C;  2P20 A;  1XMQ C;  4DCS A;  4DR3 C;  5IWA C;  3I07 A;  2DYJ A;  4L4Q A;  1O90 A;  4IR7 A;  2Y27 A;  5DV9 A;  1XRC A;  5BR8 C;  4JI5 C;  1GPM A;  3UOW A;  2UUC C;  3IPL A;  4DUY C;  1XNQ C;  4G1I A;  3NI2 A;  2ONF A;  4DG9 A;  1N34 C;  5E7Q A;  3R9X A;  1MDF A;  3NPD A;  5IT9 D;  5BSR A;  1T5D X;  2YCB A;  1LQL A;  2Y4N A;  2VQF C;  4DV2 C;  1WH9 A;  2D1T A;  4L7I A;  3T1H C;  3UZ0 A;  1V25 A;  2OBV A;  4PRO C;  4YY3 C;  3TUF A;  3LGX A;  4AQY C;  1UKK A;  1HH2 P;  2UUA C;  2D28 C;  4RMN A;  2UXB C;  5BSM A;  4D57 A;  4G36 A;  4DUZ C;  3VNS A;  4JV5 C;  1FJG C;  4D56 A;  4PZP A;  5T8T A;  4JI3 C;  3PRO C;  4D4G A;  4GXQ A;  3RV2 A;  1NYE A;  1LCI A;  2UXD C;  4LF8 C;  1ML8 A;  5BSU A;  4R0M A;  2P2Q A;  3CW9 A;  4ISB A;  5BST A;  5T8S A;  4BBY A;  5JRH A;  3JAM D;  4X66 C;  4L2Z A;  1PG4 A;  2V7B A;  2E7G A;  4DV7 C;  2P2M A;  1N33 C;  2AYA A;  4PHT A;  4XX2 A;  4X65 C;  4U5Y D;  2YWB A;  3LUS A;  5KYT A;  1HNX C;  2F4V C;  3KXW A;  4X62 C;  4DG8 A;  1IBL C;  2BJO A;  4B3R C;  2QVZ X;  4JM1 A;  1FUG A;  3H2T A;  1MXC A;  4KTT A;  5IFI A;  3A9V A;  2OPL A;  1V26 A;  5AE1 A;  5BSW A;  4RLF A;  4RVO A;  1IBM C;  2E8E A;  4LF5 C;  4BC7 A;  1MXB A;  1USP A;  2VZE A;  4NDN A;  1ZB9 A;  4NXM C;  2CXC A;  3RG2 A;  3AF5 A;  5A2Q D;  3VNQ A;  4LF6 C;  2UU9 C;  3AF6 A;  1WF3 A;  3DLP X;  1K0R A;  2PT7 G;  3L8C A;  2EGT A;  4DR5 C;  4FTF A;  1L2F A;  1T5H X;  3EER A;  4DCT A;  3FCC A;  2E5L C;  4R1M A;  1ZB8 A;  5CZV A;  4DCU A;  4ZLP A;  3CJE A;  4KHP C;  3DAY A;  3GR1 A;  2ATW A;  3N54 B;  5ADZ A;  3N2Q A;  4GXR A;  4BCA A;  5GTD A;  1MKY A;  5KEI A;  1PG3 A;  4K0K C;  1XRA A;  1MD9 A;  3ETO A;  1PA4 A;  2HJG A;  1AMU A;  2ASB A;  2D1R A;  2D27 A;  2YWC A;  1N36 C;  1J5E C;  4JI0 C;  3LAX A;  1O9T A;  3L95 X;  4I9F A;  4WS9 A;  3GR0 A;  4JI8 C;  4DR2 C;  3NYR A;  1EGA A;  1RG9 A;  4JI4 C;  3J7A D;  4DV3 C;  4DR1 C;  4B3T C;  3B7W A;  3PBK A;  4RVN A;  1XRB A;  5H9U A;  4G37 A;  1O93 A;  4OXI A;  3SO4 A;  4DV4 C;  3PES A;  4GS5 A;  4DCV A;  1HR0 C;  3E7X A;  2DPL A;  1O92 A;  2D7V A;  5A1I A;  5AE2 A;  3CW8 X;  5K85 A;  4B3S C;  3DHV A;  2HHH C;  1QWI A;  4JI2 C;  4ODJ A;  5K8F A;  4R1L A;  4DV0 C;  4DR6 C;  2P2F A;  4FUQ A;  2Y4O A;  5BUS A;  5LMN C;  2QVY X;  4ZJZ A;  4LFB C;  5A1G A;  5AE3 A;  4LF4 C;  5CZX A;  4JI6 C;  2WD9 A;  3T1Y C;  5BUR A;  4JI7 C;  4JYA C;  4LF9 C;  3LNV A;  2XR1 A;  3ETC A;  3IML A;  3IEU A;  4MTN A;  1IBK C;  1HNZ C;  4NXN C;  4NOZ A;  4I9G A;  2ZM6 C;  2E8C A;  3I08 A;  2PN2 A;  1XNR C;  1JOS A;  2CY1 A;  3FCE A;  4JI1 C;  1MDB A;  4K0B A;  3OTO C;  2UXC C;  2P2J A;  3GPC A;  1YJ7 A;  4BC9 A;  2WP0 C;  3IEV A;  3E7W A;  3J81 D;  2JMP A;  3EQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...