1XMQC

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xmqC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xmqC02
2CXCA 4DR1C 4X62C 1WH9A 4GKJC 2OPLA 4DR7C 4LFBC 2ATWA 3JAMD 2CY1A 2ZM6C 2VQFC 2UXBC 1IBKC 1WF3A 2PN2A 1IBMC 1XNQC 4B3SC 1K0RA 4AQYC 1HNWC 2XR1A 2UXCC 4JI7C 5IT9D 3GKUA 4LF7C 4DV4C 3IEUA 1N36C 4MH4A 4K0KC 3R9WA 2UUCC 3LUSA 1ZB8A 2PT7G 3AF6A 4BSZA 1MKYA 3AF5A 3J7AD 4B3TC 2VQEC 2YCBA 1HR0C 2E8EA 4JI1C 2F4VC 4DR6C 1N33C 4NXNC 5BR8C 4DCTA 5IWAC 3J81D 2BJOA 2E5LC 4MTNA 4XX2A 2KZFA 4JI3C 4DCUA 1ML8A 2E7GA 3T1HC 4JI0C 4JI4C 4NOZA 4JI5C 4X64C 4DV3C 1N2FA 4DCSA 1LQLA 3IEVA 4JV5C 5FLXD 1J5EC 1HNZC 4YY3C 2UU9C 4DR5C 4GKKC 1N34C 3EERA 1HH2P 1IBLC 4LF4C 4B3RC 5A2QD 4DV2C 3OTOC 4DV6C 4DV0C 1N32C 1USPB 4DCVA 1XMQC 4JYAC 2UUAC 1ZB9A 4DR4C 4LF8C 1FJGC 4JI8C 1KKGA 1XMOC 5LMNC 2E8CA 2HJGA 4NXMC 3J80D 2OPLB 4JI6C 4LFCC 4X66C 4DR3C 1XNRC 4X65C 4JI2C 2DYJA 2JMPA 3T1YC 2HHHC 4DUZC 1HNXC 2UUBC 2QL8A 4KHPC 4DV1C 2E8FA 2ASBA 1QWIA 2UXDC 1NYEA 1I94C 4B3MC 4DUYC 5LMUC 4LFAC 3R9XA 4OX9C 1VLAA 3I07A 4DV5C 1EGAA 1UKKA 2EGTA 4YHHC 1PA4A 2ONFA 4LF6C 1USPA 1JOSA 4DV7C 2D7VA 3CJEA 1L2FA 4LF5C 4LF9C 4DR2C
chains in the Genus database with same CATH superfamily
2CXCA 5CZXA 4DR1C 4X62C 4RM3A 2KDNA 4RVNA 3JAMD 2CY1A 2ZM6C 3N54B 1RY2A 2D27A 1XNQC 2OO4A 3N2QA 4PROC 4JI7C 2D28C 1LCIA 4DV4C 3TDEA 2ZZNA 4D4GA 4KTVA 1MDBA 3CW8X 3LUSA 5JRHA 4B3TC 3K6RA 4FTFA 2DPLA 4DR6C 3I08A 3VNRA 1O93A 1NY8A 1P4EA 4RM2A 3DHVA 3T1HC 2PROA 2M5OA 3UX3A 1XHJA 4X64C 1MXCA 5BURA 4I9GA 5FLXD 4YY3C 4GKKC 1N34C 1HH2P 3NPDA 4DV6C 1M6XC 4JYAC 4DR4C 3CQ1A 1O92A 3E7WA 2M5HA 4R1LA 4X66C 2YWBA 4JI2C 1PG3A 2HHHC 1BA3A 5T8TA 4PUIA 2MM9A 1XDXA 3KXWA 4B3MC 3GR1A 3EQ6A 5BSWA 4KTTA 3A9VA 2EGTA 4YHHC 1YGTA 3H2TA 4LF6C 4PHTA 1MXAA 5KYTA 4FUTA 3IMLA 3CJEA 4DR2C 3CQ3A 2ZTBA 3PESA 3NYQA 4DR7C 4DG9A 1WF3A 3A4IA 5BSVA 1K0RA 2XR1A 1MD9A 5BSTA 3GKUA 1M6XA 3R9WA 3LAXA 1WCJA 3ETCA 3J7AD 4I9FA 5K8FA 2YCBA 4JI1C 2F4VC 1N33C 4OYCA 4DCTA 4GXRA 4GXQA 4D56A 4XX2A 4DCUA 1ML8A 4HPVA 4NOZA 4FUQA 3IEVA 5ADZA 4DR5C 4RLFA 3EERA 2P2JA 2VSQA 1IBLC 4LF4C 4B3RC 3L95X 1UWDA 1USPB 4DCVA 1MDFA 5A1IA 2MMAB 3NYRA 1FJGC 5LMNC 2E8CA 2HJGA 3TR3A 5GTDA 3J80D 2OPLB 4LFCC 1PG4A 2OBVA 2P2QA 2P2FA 1YJ7A 4D4IA 3T1YC 4R0MA 2MCQA 2D1QA 2YWCA 5BSMA 4DV1C 2ASBA 1QWIA 3G7SA 5KEIA 1I94C 5BUSA 3R9XA 1T5HX 1VLAA 4DV5C 1XRAA 5AE3A 4R1MA 3UOWA 1T5DX 2ZZMA 2D7VA 2WD9A 1L2FA 4LF5C 1V25A 4IR7A 1WH9A 2P02A 4LFBC 3L8CA 2VQFC 3DAYA 4WV3A 3PROC 2Y27A 1IBMC 1HNWC 1PU1A 2D1TA 5KYVA 5IT9D 2QVYX 4LF7C 3DLPX 3IEUA 2QVZX 1N36C 4MH4A 1V26A 4K0KC 2UUCC 3S82A 2PT7G 3NI2A 4BSZA 5K85A 3RV2A 4DG8A 3A26A 2E8EA 3ETOA 4NXNC 1XRCA 3IPLA 3E7XA 5BR8C 3VNQA 2P2BA 3J81D 2BJOA 4MTNA 2KZFA 4LE5A 2E7GA 4BC9A 4JI0C 4JI5C 4BC7A 5LCIA 4DV3C 3FCCA 1N2FA 4DCSA 1LQLA 1P4EC 4G1IA 4L4QA 4ODJA 5E7QA 1J5EC 2UU9C 4U5YD 2QVXX 5A19A 5A2QD 4DV2C 3UX2A 3OTOC 4RVOA 3LNOA 1TH5A 3FCEA 5CZVA 5T8SA 2UUAC 5AE2A 2QW0X 2E0GA 2P2MA 1XRBA 4JI8C 1XMOC 2WP0C 4NXMC 4JI6C 3UEBA 4IZ6A 2D1SA 2DYJA 2Y4OA 3UZ0A 3A9UA 1HNXC 2QL8A 5H9UA 4K0BA 4ZJZA 1NYEA 5IFIA 5DV9A 3GR0A 4NDNA 5BUQA 4LFAC 3VNSA 2V7BA 2BH1X 4BCAA 4TPSB 4PZPA 2PG1E 4ISBA 4RMNA 3A25A 3R44A 1USPA 1JOSA 3AY0A 3TQIA 4EATA 3LGXA 2Y4NA 4GKJC 2OPLA 2ATWA 2UXBC 1IBKC 2PN2A 1XS3A 3LNVA 2CU6A 4B3SC 4AQYC 1V60A 1O9TA 1IB8A 2UXCC 5BSRA 2VZEA 1FUGA 3B7WA 3CW9A 1O90A 4L7IA 1ZB8A 3AF6A 2DHMA 1MKYA 3AF5A 4D57A 3RG2A 2VQEC 1HR0C 2NCLA 5A1GA 1P7LA 5IWAC 3TUFA 2E5LC 4JI3C 4JI4C 3O2EA 4BBYA 3CQ2A 1VEHA 2D1RA 1ULTA 3FM7A 4PUHA 4JV5C 1HNZC 4WS9A 4OXIA 4JM1A 2AYAA 4DV0C 1N32C 4ZLPA 1XMQC 1MXBA 1ZB9A 4GS5A 2P20A 1AMUA 3SO4A 4LF8C 1KKGA 2Z51A 1GPMA 4L2ZA 2JNVA 3GPCA 5AE1A 4PUGA 4DR3C 1XNRC 4X65C 2JMPA 3PBKA 1QM4A 4DUZC 2UUBC 4KHPC 4G36A 2E8FA 2UXDC 2KZ0A 1RG9A 4DUYC 5LMUC 4OX9C 4RLQA 5BSUA 3I07A 1EGAA 1UKKA 1PA4A 2YX1A 1FLOA 2ONFA 4G37A 4DV7C 3C5EA 4LF9C
chains in the Genus database with same CATH topology
2CXCA 5CZXA 4DR1C 4X62C 4RM3A 4RVNA 3JAMD 2CY1A 2ZM6C 3N54B 1RY2A 2D27A 1XNQC 2OO4A 3N2QA 4PROC 4JI7C 2D28C 1LCIA 4DV4C 3TDEA 4D4GA 4KTVA 1MDBA 3CW8X 3LUSA 5JRHA 4B3TC 4FTFA 2DPLA 4DR6C 3I08A 3VNRA 1O93A 4RM2A 3DHVA 3T1HC 2PROA 4X64C 1MXCA 5BURA 4I9GA 5FLXD 4YY3C 4GKKC 1N34C 1HH2P 3NPDA 4DV6C 4JYAC 4DR4C 1O92A 3E7WA 4R1LA 4X66C 2YWBA 4JI2C 1PG3A 2HHHC 1BA3A 5T8TA 3KXWA 4B3MC 3GR1A 3EQ6A 5BSWA 4KTTA 3A9VA 2EGTA 4YHHC 3H2TA 4LF6C 4PHTA 1MXAA 5KYTA 4FUTA 3IMLA 3CJEA 4DR2C 3PESA 3NYQA 4DR7C 4DG9A 1WF3A 3A4IA 5BSVA 1K0RA 2XR1A 1MD9A 5BSTA 3GKUA 3R9WA 3LAXA 3ETCA 3J7AD 4I9FA 5K8FA 2YCBA 4JI1C 2F4VC 1N33C 4OYCA 4DCTA 4GXRA 4GXQA 4D56A 4XX2A 4DCUA 1ML8A 4HPVA 4NOZA 4FUQA 3IEVA 5ADZA 4DR5C 4RLFA 3EERA 2P2JA 2VSQA 1IBLC 4LF4C 4B3RC 3L95X 1USPB 4DCVA 1MDFA 5A1IA 3NYRA 1FJGC 5LMNC 2E8CA 2HJGA 5GTDA 3J80D 2OPLB 4LFCC 1PG4A 2OBVA 2P2QA 2P2FA 1YJ7A 4D4IA 3T1YC 4R0MA 2D1QA 2YWCA 5BSMA 4DV1C 2ASBA 1QWIA 3G7SA 5KEIA 1I94C 5BUSA 3R9XA 1T5HX 1VLAA 4DV5C 1XRAA 5AE3A 4R1MA 3UOWA 1T5DX 2D7VA 2WD9A 1L2FA 4LF5C 1V25A 4IR7A 1WH9A 2P02A 4LFBC 3L8CA 2VQFC 3DAYA 4WV3A 3PROC 2Y27A 1IBMC 1HNWC 2D1TA 5KYVA 5IT9D 2QVYX 4LF7C 3DLPX 3IEUA 2QVZX 1N36C 4MH4A 1V26A 4K0KC 2UUCC 3S82A 2PT7G 3NI2A 4BSZA 5K85A 3RV2A 4DG8A 2E8EA 3ETOA 4NXNC 1XRCA 3IPLA 3E7XA 5BR8C 3VNQA 2P2BA 3J81D 2BJOA 4MTNA 2KZFA 4LE5A 2E7GA 4BC9A 4JI0C 4JI5C 4BC7A 4DV3C 3FCCA 1N2FA 4DCSA 1LQLA 4G1IA 4L4QA 4ODJA 5E7QA 1J5EC 2UU9C 4U5YD 2QVXX 5A19A 5A2QD 4DV2C 3OTOC 4RVOA 3FCEA 5CZVA 5T8SA 2UUAC 5AE2A 2QW0X 2E0GA 2P2MA 1XRBA 4JI8C 1XMOC 2WP0C 4NXMC 4JI6C 4IZ6A 2D1SA 2DYJA 2Y4OA 3UZ0A 3A9UA 1HNXC 2QL8A 5H9UA 4K0BA 4ZJZA 1NYEA 5IFIA 5DV9A 3GR0A 4NDNA 5BUQA 4LFAC 3VNSA 2V7BA 2BH1X 4BCAA 4TPSB 4PZPA 4ISBA 4RMNA 3R44A 1USPA 1JOSA 3TQIA 4EATA 3LGXA 2Y4NA 4GKJC 2OPLA 2ATWA 2UXBC 1IBKC 2PN2A 3LNVA 4B3SC 4AQYC 1O9TA 2UXCC 5BSRA 2VZEA 1FUGA 3B7WA 3CW9A 1O90A 4L7IA 1ZB8A 3AF6A 1MKYA 3AF5A 4D57A 3RG2A 2VQEC 1HR0C 5A1GA 1P7LA 5IWAC 3TUFA 2E5LC 4JI3C 4JI4C 4BBYA 2D1RA 1ULTA 4JV5C 1HNZC 4WS9A 4OXIA 4JM1A 2AYAA 4DV0C 1N32C 4ZLPA 1XMQC 1MXBA 1ZB9A 4GS5A 2P20A 1AMUA 3SO4A 4LF8C 1KKGA 1GPMA 4L2ZA 3GPCA 5AE1A 4DR3C 1XNRC 4X65C 2JMPA 3PBKA 1QM4A 4DUZC 2UUBC 4KHPC 4G36A 2E8FA 2UXDC 1RG9A 4DUYC 5LMUC 4OX9C 4RLQA 5BSUA 3I07A 1EGAA 1UKKA 1PA4A 2ONFA 4G37A 4DV7C 3C5EA 4LF9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXC A;  4DR1 C;  4X62 C;  1WH9 A;  4GKJ C;  2OPL A;  4DR7 C;  4LFB C;  2ATW A;  3JAM D;  2CY1 A;  2ZM6 C;  2VQF C;  2UXB C;  1IBK C;  1WF3 A;  2PN2 A;  1IBM C;  1XNQ C;  4B3S C;  1K0R A;  4AQY C;  1HNW C;  2XR1 A;  2UXC C;  4JI7 C;  5IT9 D;  3GKU A;  4LF7 C;  4DV4 C;  3IEU A;  1N36 C;  4MH4 A;  4K0K C;  3R9W A;  2UUC C;  3LUS A;  1ZB8 A;  2PT7 G;  3AF6 A;  4BSZ A;  1MKY A;  3AF5 A;  3J7A D;  4B3T C;  2VQE C;  2YCB A;  1HR0 C;  2E8E A;  4JI1 C;  2F4V C;  4DR6 C;  1N33 C;  4NXN C;  5BR8 C;  4DCT A;  5IWA C;  3J81 D;  2BJO A;  2E5L C;  4MTN A;  4XX2 A;  2KZF A;  4JI3 C;  4DCU A;  1ML8 A;  2E7G A;  3T1H C;  4JI0 C;  4JI4 C;  4NOZ A;  4JI5 C;  4X64 C;  4DV3 C;  1N2F A;  4DCS A;  1LQL A;  3IEV A;  4JV5 C;  5FLX D;  1J5E C;  1HNZ C;  4YY3 C;  2UU9 C;  4DR5 C;  4GKK C;  1N34 C;  3EER A;  1HH2 P;  1IBL C;  4LF4 C;  4B3R C;  5A2Q D;  4DV2 C;  3OTO C;  4DV6 C;  4DV0 C;  1N32 C;  1USP B;  4DCV A;  1XMQ C;  4JYA C;  2UUA C;  1ZB9 A;  4DR4 C;  4LF8 C;  1FJG C;  4JI8 C;  1KKG A;  1XMO C;  5LMN C;  2E8C A;  2HJG A;  4NXM C;  3J80 D;  2OPL B;  4JI6 C;  4LFC C;  4X66 C;  4DR3 C;  1XNR C;  4X65 C;  4JI2 C;  2DYJ A;  2JMP A;  3T1Y C;  2HHH C;  4DUZ C;  1HNX C;  2UUB C;  2QL8 A;  4KHP C;  4DV1 C;  2E8F A;  2ASB A;  1QWI A;  2UXD C;  1NYE A;  1I94 C;  4B3M C;  4DUY C;  5LMU C;  4LFA C;  3R9X A;  4OX9 C;  1VLA A;  3I07 A;  4DV5 C;  1EGA A;  1UKK A;  2EGT A;  4YHH C;  1PA4 A;  2ONF A;  4LF6 C;  1USP A;  1JOS A;  4DV7 C;  2D7V A;  3CJE A;  1L2F A;  4LF5 C;  4LF9 C;  4DR2 C; 
#chains in the Genus database with same CATH topology
 2CXC A;  5CZX A;  4DR1 C;  4X62 C;  4RM3 A;  2KDN A;  4RVN A;  3JAM D;  2CY1 A;  2ZM6 C;  3N54 B;  1RY2 A;  2D27 A;  1XNQ C;  2OO4 A;  3N2Q A;  4PRO C;  4JI7 C;  2D28 C;  1LCI A;  4DV4 C;  3TDE A;  2ZZN A;  4D4G A;  4KTV A;  1MDB A;  3CW8 X;  3LUS A;  5JRH A;  4B3T C;  3K6R A;  4FTF A;  2DPL A;  4DR6 C;  3I08 A;  3VNR A;  1O93 A;  1NY8 A;  1P4E A;  4RM2 A;  3DHV A;  3T1H C;  2PRO A;  2M5O A;  3UX3 A;  1XHJ A;  4X64 C;  1MXC A;  5BUR A;  4I9G A;  5FLX D;  4YY3 C;  4GKK C;  1N34 C;  1HH2 P;  3NPD A;  4DV6 C;  1M6X C;  4JYA C;  4DR4 C;  3CQ1 A;  1O92 A;  3E7W A;  2M5H A;  4R1L A;  4X66 C;  2YWB A;  4JI2 C;  1PG3 A;  2HHH C;  1BA3 A;  5T8T A;  4PUI A;  2MM9 A;  1XDX A;  3KXW A;  4B3M C;  3GR1 A;  3EQ6 A;  5BSW A;  4KTT A;  3A9V A;  2EGT A;  4YHH C;  1YGT A;  3H2T A;  4LF6 C;  4PHT A;  1MXA A;  5KYT A;  4FUT A;  3IML A;  3CJE A;  4DR2 C;  3CQ3 A;  2ZTB A;  3PES A;  3NYQ A;  4DR7 C;  4DG9 A;  1WF3 A;  3A4I A;  5BSV A;  1K0R A;  2XR1 A;  1MD9 A;  5BST A;  3GKU A;  1M6X A;  3R9W A;  3LAX A;  1WCJ A;  3ETC A;  3J7A D;  4I9F A;  5K8F A;  2YCB A;  4JI1 C;  2F4V C;  1N33 C;  4OYC A;  4DCT A;  4GXR A;  4GXQ A;  4D56 A;  4XX2 A;  4DCU A;  1ML8 A;  4HPV A;  4NOZ A;  4FUQ A;  3IEV A;  5ADZ A;  4DR5 C;  4RLF A;  3EER A;  2P2J A;  2VSQ A;  1IBL C;  4LF4 C;  4B3R C;  3L95 X;  1UWD A;  1USP B;  4DCV A;  1MDF A;  5A1I A;  2MMA B;  3NYR A;  1FJG C;  5LMN C;  2E8C A;  2HJG A;  3TR3 A;  5GTD A;  3J80 D;  2OPL B;  4LFC C;  1PG4 A;  2OBV A;  2P2Q A;  2P2F A;  1YJ7 A;  4D4I A;  3T1Y C;  4R0M A;  2MCQ A;  2D1Q A;  2YWC A;  5BSM A;  4DV1 C;  2ASB A;  1QWI A;  3G7S A;  5KEI A;  1I94 C;  5BUS A;  3R9X A;  1T5H X;  1VLA A;  4DV5 C;  1XRA A;  5AE3 A;  4R1M A;  3UOW A;  1T5D X;  2ZZM A;  2D7V A;  2WD9 A;  1L2F A;  4LF5 C;  1V25 A;  4IR7 A;  1WH9 A;  2P02 A;  4LFB C;  3L8C A;  2VQF C;  3DAY A;  4WV3 A;  3PRO C;  2Y27 A;  1IBM C;  1HNW C;  1PU1 A;  2D1T A;  5KYV A;  5IT9 D;  2QVY X;  4LF7 C;  3DLP X;  3IEU A;  2QVZ X;  1N36 C;  4MH4 A;  1V26 A;  4K0K C;  2UUC C;  3S82 A;  2PT7 G;  3NI2 A;  4BSZ A;  5K85 A;  3RV2 A;  4DG8 A;  3A26 A;  2E8E A;  3ETO A;  4NXN C;  1XRC A;  3IPL A;  3E7X A;  5BR8 C;  3VNQ A;  2P2B A;  3J81 D;  2BJO A;  4MTN A;  2KZF A;  4LE5 A;  2E7G A;  4BC9 A;  4JI0 C;  4JI5 C;  4BC7 A;  5LCI A;  4DV3 C;  3FCC A;  1N2F A;  4DCS A;  1LQL A;  1P4E C;  4G1I A;  4L4Q A;  4ODJ A;  5E7Q A;  1J5E C;  2UU9 C;  4U5Y D;  2QVX X;  5A19 A;  5A2Q D;  4DV2 C;  3UX2 A;  3OTO C;  4RVO A;  3LNO A;  1TH5 A;  3FCE A;  5CZV A;  5T8S A;  2UUA C;  5AE2 A;  2QW0 X;  2E0G A;  2P2M A;  1XRB A;  4JI8 C;  1XMO C;  2WP0 C;  4NXM C;  4JI6 C;  3UEB A;  4IZ6 A;  2D1S A;  2DYJ A;  2Y4O A;  3UZ0 A;  3A9U A;  1HNX C;  2QL8 A;  5H9U A;  4K0B A;  4ZJZ A;  1NYE A;  5IFI A;  5DV9 A;  3GR0 A;  4NDN A;  5BUQ A;  4LFA C;  3VNS A;  2V7B A;  2BH1 X;  4BCA A;  4TPS B;  4PZP A;  2PG1 E;  4ISB A;  4RMN A;  3A25 A;  3R44 A;  1USP A;  1JOS A;  3AY0 A;  3TQI A;  4EAT A;  3LGX A;  2Y4N A;  4GKJ C;  2OPL A;  2ATW A;  2UXB C;  1IBK C;  2PN2 A;  1XS3 A;  3LNV A;  2CU6 A;  4B3S C;  4AQY C;  1V60 A;  1O9T A;  1IB8 A;  2UXC C;  5BSR A;  2VZE A;  1FUG A;  3B7W A;  3CW9 A;  1O90 A;  4L7I A;  1ZB8 A;  3AF6 A;  2DHM A;  1MKY A;  3AF5 A;  4D57 A;  3RG2 A;  2VQE C;  1HR0 C;  2NCL A;  5A1G A;  1P7L A;  5IWA C;  3TUF A;  2E5L C;  4JI3 C;  4JI4 C;  3O2E A;  4BBY A;  3CQ2 A;  1VEH A;  2D1R A;  1ULT A;  3FM7 A;  4PUH A;  4JV5 C;  1HNZ C;  4WS9 A;  4OXI A;  4JM1 A;  2AYA A;  4DV0 C;  1N32 C;  4ZLP A;  1XMQ C;  1MXB A;  1ZB9 A;  4GS5 A;  2P20 A;  1AMU A;  3SO4 A;  4LF8 C;  1KKG A;  2Z51 A;  1GPM A;  4L2Z A;  2JNV A;  3GPC A;  5AE1 A;  4PUG A;  4DR3 C;  1XNR C;  4X65 C;  2JMP A;  3PBK A;  1QM4 A;  4DUZ C;  2UUB C;  4KHP C;  4G36 A;  2E8F A;  2UXD C;  2KZ0 A;  1RG9 A;  4DUY C;  5LMU C;  4OX9 C;  4RLQ A;  5BSU A;  3I07 A;  1EGA A;  1UKK A;  1PA4 A;  2YX1 A;  1FLO A;  2ONF A;  4G37 A;  4DV7 C;  3C5E A;  4LF9 C; 
#chains in the Genus database with same CATH homology
 2CXC A;  5CZX A;  4DR1 C;  4X62 C;  4RM3 A;  4RVN A;  3JAM D;  2CY1 A;  2ZM6 C;  3N54 B;  1RY2 A;  2D27 A;  1XNQ C;  2OO4 A;  3N2Q A;  4PRO C;  4JI7 C;  2D28 C;  1LCI A;  4DV4 C;  3TDE A;  4D4G A;  4KTV A;  1MDB A;  3CW8 X;  3LUS A;  5JRH A;  4B3T C;  4FTF A;  2DPL A;  4DR6 C;  3I08 A;  3VNR A;  1O93 A;  4RM2 A;  3DHV A;  3T1H C;  2PRO A;  4X64 C;  1MXC A;  5BUR A;  4I9G A;  5FLX D;  4YY3 C;  4GKK C;  1N34 C;  1HH2 P;  3NPD A;  4DV6 C;  4JYA C;  4DR4 C;  1O92 A;  3E7W A;  4R1L A;  4X66 C;  2YWB A;  4JI2 C;  1PG3 A;  2HHH C;  1BA3 A;  5T8T A;  3KXW A;  4B3M C;  3GR1 A;  3EQ6 A;  5BSW A;  4KTT A;  3A9V A;  2EGT A;  4YHH C;  3H2T A;  4LF6 C;  4PHT A;  1MXA A;  5KYT A;  4FUT A;  3IML A;  3CJE A;  4DR2 C;  3PES A;  3NYQ A;  4DR7 C;  4DG9 A;  1WF3 A;  3A4I A;  5BSV A;  1K0R A;  2XR1 A;  1MD9 A;  5BST A;  3GKU A;  3R9W A;  3LAX A;  3ETC A;  3J7A D;  4I9F A;  5K8F A;  2YCB A;  4JI1 C;  2F4V C;  1N33 C;  4OYC A;  4DCT A;  4GXR A;  4GXQ A;  4D56 A;  4XX2 A;  4DCU A;  1ML8 A;  4HPV A;  4NOZ A;  4FUQ A;  3IEV A;  5ADZ A;  4DR5 C;  4RLF A;  3EER A;  2P2J A;  2VSQ A;  1IBL C;  4LF4 C;  4B3R C;  3L95 X;  1USP B;  4DCV A;  1MDF A;  5A1I A;  3NYR A;  1FJG C;  5LMN C;  2E8C A;  2HJG A;  5GTD A;  3J80 D;  2OPL B;  4LFC C;  1PG4 A;  2OBV A;  2P2Q A;  2P2F A;  1YJ7 A;  4D4I A;  3T1Y C;  4R0M A;  2D1Q A;  2YWC A;  5BSM A;  4DV1 C;  2ASB A;  1QWI A;  3G7S A;  5KEI A;  1I94 C;  5BUS A;  3R9X A;  1T5H X;  1VLA A;  4DV5 C;  1XRA A;  5AE3 A;  4R1M A;  3UOW A;  1T5D X;  2D7V A;  2WD9 A;  1L2F A;  4LF5 C;  1V25 A;  4IR7 A;  1WH9 A;  2P02 A;  4LFB C;  3L8C A;  2VQF C;  3DAY A;  4WV3 A;  3PRO C;  2Y27 A;  1IBM C;  1HNW C;  2D1T A;  5KYV A;  5IT9 D;  2QVY X;  4LF7 C;  3DLP X;  3IEU A;  2QVZ X;  1N36 C;  4MH4 A;  1V26 A;  4K0K C;  2UUC C;  3S82 A;  2PT7 G;  3NI2 A;  4BSZ A;  5K85 A;  3RV2 A;  4DG8 A;  2E8E A;  3ETO A;  4NXN C;  1XRC A;  3IPL A;  3E7X A;  5BR8 C;  3VNQ A;  2P2B A;  3J81 D;  2BJO A;  4MTN A;  2KZF A;  4LE5 A;  2E7G A;  4BC9 A;  4JI0 C;  4JI5 C;  4BC7 A;  4DV3 C;  3FCC A;  1N2F A;  4DCS A;  1LQL A;  4G1I A;  4L4Q A;  4ODJ A;  5E7Q A;  1J5E C;  2UU9 C;  4U5Y D;  2QVX X;  5A19 A;  5A2Q D;  4DV2 C;  3OTO C;  4RVO A;  3FCE A;  5CZV A;  5T8S A;  2UUA C;  5AE2 A;  2QW0 X;  2E0G A;  2P2M A;  1XRB A;  4JI8 C;  1XMO C;  2WP0 C;  4NXM C;  4JI6 C;  4IZ6 A;  2D1S A;  2DYJ A;  2Y4O A;  3UZ0 A;  3A9U A;  1HNX C;  2QL8 A;  5H9U A;  4K0B A;  4ZJZ A;  1NYE A;  5IFI A;  5DV9 A;  3GR0 A;  4NDN A;  5BUQ A;  4LFA C;  3VNS A;  2V7B A;  2BH1 X;  4BCA A;  4TPS B;  4PZP A;  4ISB A;  4RMN A;  3R44 A;  1USP A;  1JOS A;  3TQI A;  4EAT A;  3LGX A;  2Y4N A;  4GKJ C;  2OPL A;  2ATW A;  2UXB C;  1IBK C;  2PN2 A;  3LNV A;  4B3S C;  4AQY C;  1O9T A;  2UXC C;  5BSR A;  2VZE A;  1FUG A;  3B7W A;  3CW9 A;  1O90 A;  4L7I A;  1ZB8 A;  3AF6 A;  1MKY A;  3AF5 A;  4D57 A;  3RG2 A;  2VQE C;  1HR0 C;  5A1G A;  1P7L A;  5IWA C;  3TUF A;  2E5L C;  4JI3 C;  4JI4 C;  4BBY A;  2D1R A;  1ULT A;  4JV5 C;  1HNZ C;  4WS9 A;  4OXI A;  4JM1 A;  2AYA A;  4DV0 C;  1N32 C;  4ZLP A;  1XMQ C;  1MXB A;  1ZB9 A;  4GS5 A;  2P20 A;  1AMU A;  3SO4 A;  4LF8 C;  1KKG A;  1GPM A;  4L2Z A;  3GPC A;  5AE1 A;  4DR3 C;  1XNR C;  4X65 C;  2JMP A;  3PBK A;  1QM4 A;  4DUZ C;  2UUB C;  4KHP C;  4G36 A;  2E8F A;  2UXD C;  1RG9 A;  4DUY C;  5LMU C;  4OX9 C;  4RLQ A;  5BSU A;  3I07 A;  1EGA A;  1UKK A;  1PA4 A;  2ONF A;  4G37 A;  4DV7 C;  3C5E A;  4LF9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...