1XMQC

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xmqC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xmqC02
1XNRC 2UUAC 1HH2P 1N34C 4LF6C 1L2FA 3T1HC 4X64C 4NOZA 4X62C 3CJEA 3AF6A 4BSZA 2F4VC 1XNQC 4GKJC 1ML8A 3R9XA 2ONFA 3J80D 4DR3C 4GKKC 5LMUC 4AQYC 4LFCC 4JI0C 1QWIA 2E7GA 2OPLA 2OPLB 4B3RC 4JI8C 4XX2A 1VLAA 4OX9C 1WF3A 4DV0C 4B3MC 4DR6C 2VQFC 5LMNC 1I94C 2ASBA 4K0KC 4DUYC 4NXNC 3JAMD 5BR8C 4YHHC 3R9WA 2CY1A 3IEUA 4LF4C 4JI1C 2UXBC 4KHPC 1EGAA 1IBMC 3J81D 4LF9C 2EGTA 1XMOC 1IBLC 4DV6C 2E8EA 1USPB 4NXMC 5A2QD 1N36C 4DR7C 1HNWC 3J7AD 2YCBA 2E8CA 3I07A 4DR5C 1N2FA 4DV7C 2XR1A 3IEVA 2KZFA 4DR2C 5FLXD 4LFBC 2D7VA 1FJGC 3AF5A 1HNZC 4DR4C 2UU9C 1N32C 1KKGA 2JMPA 4DV1C 2ZM6C 4MH4A 4DCSA 1ZB9A 4B3TC 2QL8A 4JI5C 2PT7G 4JYAC 4JI7C 4LF5C 4JI3C 1USPA 2HJGA 1XMQC 2ATWA 2CXCA 4DCVA 3OTOC 2HHHC 1NYEA 4YY3C 5IWAC 4JI2C 1N33C 4X65C 1MKYA 2DYJA 2UUBC 2VQEC 4B3SC 4MTNA 2E5LC 1ZB8A 1UKKA 4DR1C 1LQLA 1PA4A 3LUSA 5IT9D 4LFAC 4LF8C 4DV2C 1J5EC 4JI6C 4DV4C 4DV5C 1HR0C 2UXCC 4DV3C 4JI4C 4LF7C 1IBKC 4JV5C 2BJOA 3EERA 2UUCC 4DUZC 3T1YC 1K0RA 1WH9A 3GKUA 2PN2A 2E8FA 1HNXC 4X66C 4DCUA 4DCTA 1JOSA 2UXDC
chains in the Genus database with same CATH superfamily
1PG4A 4PZPA 3CW8X 4JM1A 4BSZA 5KYTA 4WS9A 4RMNA 2F4VC 1XNQC 1ML8A 4DR3C 2QW0X 4PUGA 4R1MA 3UEBA 1QWIA 3UOWA 2M5HA 1MDFA 3A26A 4DV0C 1T5DX 1PU1A 1I94C 3A25A 3L95X 4EATA 4NXNC 4RM2A 3L8CA 5A1GA 3JAMD 2QVYX 2P2FA 4RLQA 1NY8A 1IBMC 3J81D 4LF9C 1FLOA 4RLFA 5A19A 2VSQA 1YJ7A 5A2QD 3J7AD 3ETOA 1XRAA 2KZFA 3K6RA 1VEHA 2YWCA 3CQ1A 4D4IA 4DR4C 3SO4A 3VNQA 4OYCA 5H9UA 4FUQA 4DV1C 2ZM6C 4PUHA 5ADZA 3FM7A 2QL8A 3N2QA 5K85A 5K8FA 1PG3A 3GPCA 4DG9A 4DCVA 3OTOC 3UX3A 4ZJZA 4YY3C 1P7LA 4X65C 4B3SC 4D56A 1ZB8A 5T8SA 5IT9D 4LF8C 3LNOA 1J5EC 4DV4C 3I08A 2BJOA 2UUCC 1XS3A 4BBYA 2E8FA 1T5HX 3GR0A 3B7WA 1FUGA 2HHHC 4FTFA 1XNRC 3LGXA 1L2FA 3PROC 4X64C 5T8TA 3AF6A 3NYQA 4GKJC 2ONFA 4GKKC 5LMUC 1TH5A 2E7GA 4RVNA 2JNVA 3CQ2A 4RVOA 5E7QA 1M6XA 1WF3A 3GR1A 2Y4NA 4I9FA 2VQFC 4G37A 2MCQA 2KZ0A 4DUYC 3N54B 4BCAA 5KEIA 3NI2A 4TPSB 3DHVA 3FCEA 1WCJA 4JI1C 3LNVA 1IBLC 1XDXA 1O90A 5BSRA 1USPB 4NXMC 1N36C 4ODJA 5AE1A 1P4EA 5AE2A 2AYAA 5CZVA 1N2FA 4DR5C 2XR1A 2D1SA 2WD9A 4K0BA 5FLXD 3AF5A 2D1TA 4D4GA 1KKGA 3LAXA 1IB8A 3E7XA 3ETCA 4MH4A 3PESA 3A4IA 2WP0C 1ZB9A 4B3TC 4JI5C 2P2MA 4ISBA 3E7WA 4OXIA 3R44A 4LF5C 4FUTA 4JI3C 4NDNA 2QVXX 1NYEA 1MD9A 2DYJA 2E0GA 4DR1C 1LQLA 1XRCA 2D28C 5AE3A 4JI4C 4LF7C 4L4QA 1IBKC 4JV5C 2V7BA 2YX1A 4LE5A 3VNRA 3T1YC 3DLPX 3NYRA 2CU6A 4X66C 3DAYA 1V60A 1MXAA 2UXDC 4BC7A 2P02A 2UUAC 4LF6C 4NOZA 5BUQA 3R9XA 4AQYC 4LFCC 3CQ3A 2OPLB 5KYVA 4B3RC 2Y27A 5IFIA 2D27A 2P20A 3S82A 5LMNC 5JRHA 3A9UA 1QM4A 2ASBA 5CZXA 3O2EA 3H2TA 4GS5A 4WV3A 4YHHC 3R9WA 3IEUA 2UXBC 4KHPC 2EGTA 4ZLPA 4DV6C 2E8EA 2VZEA 1HNWC 5DV9A 2YCBA 2E8CA 3I07A 3IEVA 2ZZNA 2YWBA 4DR2C 1LCIA 2PG1E 3AY0A 2D7VA 1AMUA 2P2BA 2P2JA 4PROC 1N32C 3C5EA 4KTTA 1M6XC 2ZZMA 4R1LA 4DCSA 3G7SA 2PT7G 4JYAC 4JI7C 5BURA 1ULTA 2BH1X 1XMQC 4BC9A 2CXCA 5BSVA 2D1RA 5IWAC 4JI2C 3EQ6A 4RM3A 2UUBC 3TUFA 4MTNA 2DPLA 2E5LC 1UKKA 2M5OA 2MMAB 1PA4A 3LUSA 1O9TA 3RV2A 1P4EC 4JI6C 5LCIA 2OO4A 1HR0C 2UXCC 2DHMA 1O93A 4HPVA 3CW9A 4DUZC 1K0RA 1WH9A 2PN2A 3FCCA 1V25A 2P2QA 1MDBA 1HH2P 1N34C 2NCLA 3T1HC 4X62C 3CJEA 5A1IA 1V26A 3J80D 4I9GA 1XHJA 4L7IA 4JI0C 2OPLA 3KXWA 4JI8C 4XX2A 1XRBA 4G1IA 3TR3A 1VLAA 4OX9C 4U5YD 4KTVA 3VNSA 4B3MC 4DR6C 3RG2A 3PBKA 2QVZX 5GTDA 4K0KC 5BR8C 2CY1A 4LF4C 2D1QA 1EGAA 1MXCA 5BSMA 4GXQA 1XMOC 4DR7C 3UZ0A 5BSUA 3NPDA 3TQIA 2OBVA 4DV7C 3IMLA 1RG9A 4LFBC 1FJGC 1HNZC 5BSTA 4DG8A 1RY2A 4GXRA 2UU9C 1O92A 4D57A 1UWDA 2JMPA 4L2ZA 4PHTA 5BUSA 1YGTA 4R0MA 4IZ6A 2ZTBA 1USPA 4G36A 2Y4OA 2HJGA 4PUIA 2ATWA 5BSWA 3TDEA 1N33C 1MKYA 3A9VA 1BA3A 2VQEC 4LFAC 4DV2C 2Z51A 4DV5C 4DV3C 2MM9A 3EERA 1MXBA 1GPMA 2PROA 3GKUA 1HNXC 3IPLA 2KDNA 3UX2A 4DCUA 4IR7A 4DCTA 1JOSA
chains in the Genus database with same CATH topology
1PG4A 4PZPA 3CW8X 4JM1A 4BSZA 5KYTA 4WS9A 4RMNA 2F4VC 1XNQC 1ML8A 4DR3C 2QW0X 4R1MA 1QWIA 3UOWA 1MDFA 4DV0C 1T5DX 1I94C 3L95X 4EATA 4NXNC 4RM2A 3L8CA 5A1GA 3JAMD 2QVYX 2P2FA 4RLQA 1IBMC 3J81D 4LF9C 4RLFA 5A19A 2VSQA 1YJ7A 5A2QD 3J7AD 3ETOA 1XRAA 2KZFA 2YWCA 4D4IA 4DR4C 3SO4A 3VNQA 4OYCA 5H9UA 4FUQA 4DV1C 2ZM6C 5ADZA 2QL8A 3N2QA 5K85A 5K8FA 1PG3A 3GPCA 4DG9A 4DCVA 3OTOC 4ZJZA 4YY3C 1P7LA 4X65C 4B3SC 4D56A 1ZB8A 5T8SA 5IT9D 4LF8C 1J5EC 4DV4C 3I08A 2BJOA 2UUCC 4BBYA 2E8FA 1T5HX 3GR0A 3B7WA 1FUGA 2HHHC 4FTFA 1XNRC 3LGXA 1L2FA 3PROC 4X64C 5T8TA 3AF6A 3NYQA 4GKJC 2ONFA 4GKKC 5LMUC 2E7GA 4RVNA 4RVOA 5E7QA 1WF3A 3GR1A 2Y4NA 4I9FA 2VQFC 4G37A 4DUYC 3N54B 4BCAA 5KEIA 3NI2A 4TPSB 3DHVA 3FCEA 4JI1C 3LNVA 1IBLC 1O90A 5BSRA 1USPB 4NXMC 1N36C 4ODJA 5AE1A 5AE2A 2AYAA 5CZVA 1N2FA 4DR5C 2XR1A 2D1SA 2WD9A 4K0BA 5FLXD 3AF5A 2D1TA 4D4GA 1KKGA 3LAXA 3E7XA 3ETCA 4MH4A 3PESA 3A4IA 2WP0C 1ZB9A 4B3TC 4JI5C 2P2MA 4ISBA 3E7WA 4OXIA 3R44A 4LF5C 4FUTA 4JI3C 4NDNA 2QVXX 1NYEA 1MD9A 2DYJA 2E0GA 4DR1C 1LQLA 1XRCA 2D28C 5AE3A 4JI4C 4LF7C 4L4QA 1IBKC 4JV5C 2V7BA 4LE5A 3VNRA 3T1YC 3DLPX 3NYRA 4X66C 3DAYA 1MXAA 2UXDC 4BC7A 2P02A 2UUAC 4LF6C 4NOZA 5BUQA 3R9XA 4AQYC 4LFCC 2OPLB 5KYVA 4B3RC 2Y27A 5IFIA 2D27A 2P20A 3S82A 5LMNC 5JRHA 3A9UA 1QM4A 2ASBA 5CZXA 3H2TA 4GS5A 4WV3A 4YHHC 3R9WA 3IEUA 2UXBC 4KHPC 2EGTA 4ZLPA 4DV6C 2E8EA 2VZEA 1HNWC 5DV9A 2YCBA 2E8CA 3I07A 3IEVA 2YWBA 4DR2C 1LCIA 2D7VA 1AMUA 2P2BA 2P2JA 4PROC 1N32C 3C5EA 4KTTA 4R1LA 4DCSA 3G7SA 2PT7G 4JYAC 4JI7C 5BURA 1ULTA 2BH1X 1XMQC 4BC9A 2CXCA 5BSVA 2D1RA 5IWAC 4JI2C 3EQ6A 4RM3A 2UUBC 3TUFA 4MTNA 2DPLA 2E5LC 1UKKA 1PA4A 3LUSA 1O9TA 3RV2A 4JI6C 1HR0C 2OO4A 2UXCC 1O93A 4HPVA 3CW9A 4DUZC 1K0RA 1WH9A 2PN2A 3FCCA 1V25A 2P2QA 1MDBA 1HH2P 1N34C 3T1HC 4X62C 3CJEA 5A1IA 1V26A 3J80D 4I9GA 4L7IA 4JI0C 2OPLA 3KXWA 4JI8C 4XX2A 1XRBA 4G1IA 1VLAA 4OX9C 4U5YD 4KTVA 3VNSA 4B3MC 4DR6C 3RG2A 3PBKA 2QVZX 5GTDA 4K0KC 5BR8C 2CY1A 4LF4C 2D1QA 1EGAA 1MXCA 5BSMA 4GXQA 1XMOC 4DR7C 3UZ0A 5BSUA 3NPDA 3TQIA 2OBVA 4DV7C 3IMLA 1RG9A 4LFBC 1FJGC 1HNZC 5BSTA 4DG8A 1RY2A 4GXRA 2UU9C 1O92A 4D57A 2JMPA 4L2ZA 4PHTA 5BUSA 4R0MA 4IZ6A 1USPA 4G36A 2Y4OA 2HJGA 2ATWA 5BSWA 3TDEA 1N33C 1MKYA 3A9VA 1BA3A 2VQEC 4LFAC 4DV2C 4DV5C 4DV3C 3EERA 1MXBA 1GPMA 2PROA 3GKUA 1HNXC 3IPLA 4DCUA 4IR7A 4DCTA 1JOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR C;  2UUA C;  1HH2 P;  1N34 C;  4LF6 C;  1L2F A;  3T1H C;  4X64 C;  4NOZ A;  4X62 C;  3CJE A;  3AF6 A;  4BSZ A;  2F4V C;  1XNQ C;  4GKJ C;  1ML8 A;  3R9X A;  2ONF A;  3J80 D;  4DR3 C;  4GKK C;  5LMU C;  4AQY C;  4LFC C;  4JI0 C;  1QWI A;  2E7G A;  2OPL A;  2OPL B;  4B3R C;  4JI8 C;  4XX2 A;  1VLA A;  4OX9 C;  1WF3 A;  4DV0 C;  4B3M C;  4DR6 C;  2VQF C;  5LMN C;  1I94 C;  2ASB A;  4K0K C;  4DUY C;  4NXN C;  3JAM D;  5BR8 C;  4YHH C;  3R9W A;  2CY1 A;  3IEU A;  4LF4 C;  4JI1 C;  2UXB C;  4KHP C;  1EGA A;  1IBM C;  3J81 D;  4LF9 C;  2EGT A;  1XMO C;  1IBL C;  4DV6 C;  2E8E A;  1USP B;  4NXM C;  5A2Q D;  1N36 C;  4DR7 C;  1HNW C;  3J7A D;  2YCB A;  2E8C A;  3I07 A;  4DR5 C;  1N2F A;  4DV7 C;  2XR1 A;  3IEV A;  2KZF A;  4DR2 C;  5FLX D;  4LFB C;  2D7V A;  1FJG C;  3AF5 A;  1HNZ C;  4DR4 C;  2UU9 C;  1N32 C;  1KKG A;  2JMP A;  4DV1 C;  2ZM6 C;  4MH4 A;  4DCS A;  1ZB9 A;  4B3T C;  2QL8 A;  4JI5 C;  2PT7 G;  4JYA C;  4JI7 C;  4LF5 C;  4JI3 C;  1USP A;  2HJG A;  1XMQ C;  2ATW A;  2CXC A;  4DCV A;  3OTO C;  2HHH C;  1NYE A;  4YY3 C;  5IWA C;  4JI2 C;  1N33 C;  4X65 C;  1MKY A;  2DYJ A;  2UUB C;  2VQE C;  4B3S C;  4MTN A;  2E5L C;  1ZB8 A;  1UKK A;  4DR1 C;  1LQL A;  1PA4 A;  3LUS A;  5IT9 D;  4LFA C;  4LF8 C;  4DV2 C;  1J5E C;  4JI6 C;  4DV4 C;  4DV5 C;  1HR0 C;  2UXC C;  4DV3 C;  4JI4 C;  4LF7 C;  1IBK C;  4JV5 C;  2BJO A;  3EER A;  2UUC C;  4DUZ C;  3T1Y C;  1K0R A;  1WH9 A;  3GKU A;  2PN2 A;  2E8F A;  1HNX C;  4X66 C;  4DCU A;  4DCT A;  1JOS A;  2UXD C; 
#chains in the Genus database with same CATH topology
 1PG4 A;  4PZP A;  3CW8 X;  4JM1 A;  4BSZ A;  5KYT A;  4WS9 A;  4RMN A;  2F4V C;  1XNQ C;  1ML8 A;  4DR3 C;  2QW0 X;  4PUG A;  4R1M A;  3UEB A;  1QWI A;  3UOW A;  2M5H A;  1MDF A;  3A26 A;  4DV0 C;  1T5D X;  1PU1 A;  1I94 C;  3A25 A;  3L95 X;  4EAT A;  4NXN C;  4RM2 A;  3L8C A;  5A1G A;  3JAM D;  2QVY X;  2P2F A;  4RLQ A;  1NY8 A;  1IBM C;  3J81 D;  4LF9 C;  1FLO A;  4RLF A;  5A19 A;  2VSQ A;  1YJ7 A;  5A2Q D;  3J7A D;  3ETO A;  1XRA A;  2KZF A;  3K6R A;  1VEH A;  2YWC A;  3CQ1 A;  4D4I A;  4DR4 C;  3SO4 A;  3VNQ A;  4OYC A;  5H9U A;  4FUQ A;  4DV1 C;  2ZM6 C;  4PUH A;  5ADZ A;  3FM7 A;  2QL8 A;  3N2Q A;  5K85 A;  5K8F A;  1PG3 A;  3GPC A;  4DG9 A;  4DCV A;  3OTO C;  3UX3 A;  4ZJZ A;  4YY3 C;  1P7L A;  4X65 C;  4B3S C;  4D56 A;  1ZB8 A;  5T8S A;  5IT9 D;  4LF8 C;  3LNO A;  1J5E C;  4DV4 C;  3I08 A;  2BJO A;  2UUC C;  1XS3 A;  4BBY A;  2E8F A;  1T5H X;  3GR0 A;  3B7W A;  1FUG A;  2HHH C;  4FTF A;  1XNR C;  3LGX A;  1L2F A;  3PRO C;  4X64 C;  5T8T A;  3AF6 A;  3NYQ A;  4GKJ C;  2ONF A;  4GKK C;  5LMU C;  1TH5 A;  2E7G A;  4RVN A;  2JNV A;  3CQ2 A;  4RVO A;  5E7Q A;  1M6X A;  1WF3 A;  3GR1 A;  2Y4N A;  4I9F A;  2VQF C;  4G37 A;  2MCQ A;  2KZ0 A;  4DUY C;  3N54 B;  4BCA A;  5KEI A;  3NI2 A;  4TPS B;  3DHV A;  3FCE A;  1WCJ A;  4JI1 C;  3LNV A;  1IBL C;  1XDX A;  1O90 A;  5BSR A;  1USP B;  4NXM C;  1N36 C;  4ODJ A;  5AE1 A;  1P4E A;  5AE2 A;  2AYA A;  5CZV A;  1N2F A;  4DR5 C;  2XR1 A;  2D1S A;  2WD9 A;  4K0B A;  5FLX D;  3AF5 A;  2D1T A;  4D4G A;  1KKG A;  3LAX A;  1IB8 A;  3E7X A;  3ETC A;  4MH4 A;  3PES A;  3A4I A;  2WP0 C;  1ZB9 A;  4B3T C;  4JI5 C;  2P2M A;  4ISB A;  3E7W A;  4OXI A;  3R44 A;  4LF5 C;  4FUT A;  4JI3 C;  4NDN A;  2QVX X;  1NYE A;  1MD9 A;  2DYJ A;  2E0G A;  4DR1 C;  1LQL A;  1XRC A;  2D28 C;  5AE3 A;  4JI4 C;  4LF7 C;  4L4Q A;  1IBK C;  4JV5 C;  2V7B A;  2YX1 A;  4LE5 A;  3VNR A;  3T1Y C;  3DLP X;  3NYR A;  2CU6 A;  4X66 C;  3DAY A;  1V60 A;  1MXA A;  2UXD C;  4BC7 A;  2P02 A;  2UUA C;  4LF6 C;  4NOZ A;  5BUQ A;  3R9X A;  4AQY C;  4LFC C;  3CQ3 A;  2OPL B;  5KYV A;  4B3R C;  2Y27 A;  5IFI A;  2D27 A;  2P20 A;  3S82 A;  5LMN C;  5JRH A;  3A9U A;  1QM4 A;  2ASB A;  5CZX A;  3O2E A;  3H2T A;  4GS5 A;  4WV3 A;  4YHH C;  3R9W A;  3IEU A;  2UXB C;  4KHP C;  2EGT A;  4ZLP A;  4DV6 C;  2E8E A;  2VZE A;  1HNW C;  5DV9 A;  2YCB A;  2E8C A;  3I07 A;  3IEV A;  2ZZN A;  2YWB A;  4DR2 C;  1LCI A;  2PG1 E;  3AY0 A;  2D7V A;  1AMU A;  2P2B A;  2P2J A;  4PRO C;  1N32 C;  3C5E A;  4KTT A;  1M6X C;  2ZZM A;  4R1L A;  4DCS A;  3G7S A;  2PT7 G;  4JYA C;  4JI7 C;  5BUR A;  1ULT A;  2BH1 X;  1XMQ C;  4BC9 A;  2CXC A;  5BSV A;  2D1R A;  5IWA C;  4JI2 C;  3EQ6 A;  4RM3 A;  2UUB C;  3TUF A;  4MTN A;  2DPL A;  2E5L C;  1UKK A;  2M5O A;  2MMA B;  1PA4 A;  3LUS A;  1O9T A;  3RV2 A;  1P4E C;  4JI6 C;  5LCI A;  2OO4 A;  1HR0 C;  2UXC C;  2DHM A;  1O93 A;  4HPV A;  3CW9 A;  4DUZ C;  1K0R A;  1WH9 A;  2PN2 A;  3FCC A;  1V25 A;  2P2Q A;  1MDB A;  1HH2 P;  1N34 C;  2NCL A;  3T1H C;  4X62 C;  3CJE A;  5A1I A;  1V26 A;  3J80 D;  4I9G A;  1XHJ A;  4L7I A;  4JI0 C;  2OPL A;  3KXW A;  4JI8 C;  4XX2 A;  1XRB A;  4G1I A;  3TR3 A;  1VLA A;  4OX9 C;  4U5Y D;  4KTV A;  3VNS A;  4B3M C;  4DR6 C;  3RG2 A;  3PBK A;  2QVZ X;  5GTD A;  4K0K C;  5BR8 C;  2CY1 A;  4LF4 C;  2D1Q A;  1EGA A;  1MXC A;  5BSM A;  4GXQ A;  1XMO C;  4DR7 C;  3UZ0 A;  5BSU A;  3NPD A;  3TQI A;  2OBV A;  4DV7 C;  3IML A;  1RG9 A;  4LFB C;  1FJG C;  1HNZ C;  5BST A;  4DG8 A;  1RY2 A;  4GXR A;  2UU9 C;  1O92 A;  4D57 A;  1UWD A;  2JMP A;  4L2Z A;  4PHT A;  5BUS A;  1YGT A;  4R0M A;  4IZ6 A;  2ZTB A;  1USP A;  4G36 A;  2Y4O A;  2HJG A;  4PUI A;  2ATW A;  5BSW A;  3TDE A;  1N33 C;  1MKY A;  3A9V A;  1BA3 A;  2VQE C;  4LFA C;  4DV2 C;  2Z51 A;  4DV5 C;  4DV3 C;  2MM9 A;  3EER A;  1MXB A;  1GPM A;  2PRO A;  3GKU A;  1HNX C;  3IPL A;  2KDN A;  3UX2 A;  4DCU A;  4IR7 A;  4DCT A;  1JOS A; 
#chains in the Genus database with same CATH homology
 1PG4 A;  4PZP A;  3CW8 X;  4JM1 A;  4BSZ A;  5KYT A;  4WS9 A;  4RMN A;  2F4V C;  1XNQ C;  1ML8 A;  4DR3 C;  2QW0 X;  4R1M A;  1QWI A;  3UOW A;  1MDF A;  4DV0 C;  1T5D X;  1I94 C;  3L95 X;  4EAT A;  4NXN C;  4RM2 A;  3L8C A;  5A1G A;  3JAM D;  2QVY X;  2P2F A;  4RLQ A;  1IBM C;  3J81 D;  4LF9 C;  4RLF A;  5A19 A;  2VSQ A;  1YJ7 A;  5A2Q D;  3J7A D;  3ETO A;  1XRA A;  2KZF A;  2YWC A;  4D4I A;  4DR4 C;  3SO4 A;  3VNQ A;  4OYC A;  5H9U A;  4FUQ A;  4DV1 C;  2ZM6 C;  5ADZ A;  2QL8 A;  3N2Q A;  5K85 A;  5K8F A;  1PG3 A;  3GPC A;  4DG9 A;  4DCV A;  3OTO C;  4ZJZ A;  4YY3 C;  1P7L A;  4X65 C;  4B3S C;  4D56 A;  1ZB8 A;  5T8S A;  5IT9 D;  4LF8 C;  1J5E C;  4DV4 C;  3I08 A;  2BJO A;  2UUC C;  4BBY A;  2E8F A;  1T5H X;  3GR0 A;  3B7W A;  1FUG A;  2HHH C;  4FTF A;  1XNR C;  3LGX A;  1L2F A;  3PRO C;  4X64 C;  5T8T A;  3AF6 A;  3NYQ A;  4GKJ C;  2ONF A;  4GKK C;  5LMU C;  2E7G A;  4RVN A;  4RVO A;  5E7Q A;  1WF3 A;  3GR1 A;  2Y4N A;  4I9F A;  2VQF C;  4G37 A;  4DUY C;  3N54 B;  4BCA A;  5KEI A;  3NI2 A;  4TPS B;  3DHV A;  3FCE A;  4JI1 C;  3LNV A;  1IBL C;  1O90 A;  5BSR A;  1USP B;  4NXM C;  1N36 C;  4ODJ A;  5AE1 A;  5AE2 A;  2AYA A;  5CZV A;  1N2F A;  4DR5 C;  2XR1 A;  2D1S A;  2WD9 A;  4K0B A;  5FLX D;  3AF5 A;  2D1T A;  4D4G A;  1KKG A;  3LAX A;  3E7X A;  3ETC A;  4MH4 A;  3PES A;  3A4I A;  2WP0 C;  1ZB9 A;  4B3T C;  4JI5 C;  2P2M A;  4ISB A;  3E7W A;  4OXI A;  3R44 A;  4LF5 C;  4FUT A;  4JI3 C;  4NDN A;  2QVX X;  1NYE A;  1MD9 A;  2DYJ A;  2E0G A;  4DR1 C;  1LQL A;  1XRC A;  2D28 C;  5AE3 A;  4JI4 C;  4LF7 C;  4L4Q A;  1IBK C;  4JV5 C;  2V7B A;  4LE5 A;  3VNR A;  3T1Y C;  3DLP X;  3NYR A;  4X66 C;  3DAY A;  1MXA A;  2UXD C;  4BC7 A;  2P02 A;  2UUA C;  4LF6 C;  4NOZ A;  5BUQ A;  3R9X A;  4AQY C;  4LFC C;  2OPL B;  5KYV A;  4B3R C;  2Y27 A;  5IFI A;  2D27 A;  2P20 A;  3S82 A;  5LMN C;  5JRH A;  3A9U A;  1QM4 A;  2ASB A;  5CZX A;  3H2T A;  4GS5 A;  4WV3 A;  4YHH C;  3R9W A;  3IEU A;  2UXB C;  4KHP C;  2EGT A;  4ZLP A;  4DV6 C;  2E8E A;  2VZE A;  1HNW C;  5DV9 A;  2YCB A;  2E8C A;  3I07 A;  3IEV A;  2YWB A;  4DR2 C;  1LCI A;  2D7V A;  1AMU A;  2P2B A;  2P2J A;  4PRO C;  1N32 C;  3C5E A;  4KTT A;  4R1L A;  4DCS A;  3G7S A;  2PT7 G;  4JYA C;  4JI7 C;  5BUR A;  1ULT A;  2BH1 X;  1XMQ C;  4BC9 A;  2CXC A;  5BSV A;  2D1R A;  5IWA C;  4JI2 C;  3EQ6 A;  4RM3 A;  2UUB C;  3TUF A;  4MTN A;  2DPL A;  2E5L C;  1UKK A;  1PA4 A;  3LUS A;  1O9T A;  3RV2 A;  4JI6 C;  1HR0 C;  2OO4 A;  2UXC C;  1O93 A;  4HPV A;  3CW9 A;  4DUZ C;  1K0R A;  1WH9 A;  2PN2 A;  3FCC A;  1V25 A;  2P2Q A;  1MDB A;  1HH2 P;  1N34 C;  3T1H C;  4X62 C;  3CJE A;  5A1I A;  1V26 A;  3J80 D;  4I9G A;  4L7I A;  4JI0 C;  2OPL A;  3KXW A;  4JI8 C;  4XX2 A;  1XRB A;  4G1I A;  1VLA A;  4OX9 C;  4U5Y D;  4KTV A;  3VNS A;  4B3M C;  4DR6 C;  3RG2 A;  3PBK A;  2QVZ X;  5GTD A;  4K0K C;  5BR8 C;  2CY1 A;  4LF4 C;  2D1Q A;  1EGA A;  1MXC A;  5BSM A;  4GXQ A;  1XMO C;  4DR7 C;  3UZ0 A;  5BSU A;  3NPD A;  3TQI A;  2OBV A;  4DV7 C;  3IML A;  1RG9 A;  4LFB C;  1FJG C;  1HNZ C;  5BST A;  4DG8 A;  1RY2 A;  4GXR A;  2UU9 C;  1O92 A;  4D57 A;  2JMP A;  4L2Z A;  4PHT A;  5BUS A;  4R0M A;  4IZ6 A;  1USP A;  4G36 A;  2Y4O A;  2HJG A;  2ATW A;  5BSW A;  3TDE A;  1N33 C;  1MKY A;  3A9V A;  1BA3 A;  2VQE C;  4LFA C;  4DV2 C;  4DV5 C;  4DV3 C;  3EER A;  1MXB A;  1GPM A;  2PRO A;  3GKU A;  1HNX C;  3IPL A;  4DCU A;  4IR7 A;  4DCT A;  1JOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...