4OX9C

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ox9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ox9C02
1HNWC 1MKYA 2UUCC 2UXBC 1K0RA 1N34C 5LMUC 1XMOC 4DR3C 1N33C 4DR5C 1I94C 2CY1A 4LFCC 1ZB8A 3IEVA 2PT7G 3R9XA 1XNRC 1N2FA 1USPB 3OTOC 4KHPC 1LQLA 3CJEA 4DV7C 4X66C 4DCVA 4B3MC 4LF4C 2HJGA 3JAMD 1UKKA 1WH9A 4GKKC 4DR7C 2DYJA 4JYAC 4JI4C 4JI7C 2VQFC 2QL8A 4X62C 1IBKC 2D7VA 5FLXD 3AF5A 4X64C 5BR8C 4LFAC 2CXCA 3GKUA 4MTNA 2ASBA 4GKJC 4NXNC 1J5EC 4YY3C 2VQEC 2ZM6C 4DUZC 1VLAA 2BJOA 2UU9C 4B3TC 4DV2C 4LF8C 4JI3C 2HHHC 1L2FA 2OPLB 4DUYC 4BSZA 1WF3A 4JV5C 5IWAC 1XNQC 4DCSA 4LFBC 4DR4C 3IEUA 2EGTA 4B3RC 1FJGC 4B3SC 4LF6C 2E8EA 4LF7C 3J81D 1IBMC 4NXMC 4XX2A 2PN2A 4JI0C 1ML8A 3J7AD 1N32C 1HR0C 1HH2P 2E7GA 5IT9D 1XMQC 4X65C 4DV6C 4NOZA 1JOSA 1NYEA 2ATWA 3I07A 3T1YC 4LF9C 4DV5C 2YCBA 2E8CA 3J80D 1ZB9A 1IBLC 1EGAA 3LUSA 5A2QD 1USPA 3AF6A 2E8FA 3T1HC 2UUBC 4JI8C 4JI6C 4JI5C 1PA4A 2F4VC 4DV4C 4K0KC 2UUAC 4OX9C 4MH4A 1HNZC 2OPLA 4AQYC 1N36C 2UXCC 1KKGA 2KZFA 4JI1C 2JMPA 4DV0C 1HNXC 2UXDC 4DCTA 4DR1C 2ONFA 4DR2C 3R9WA 3EERA 5LMNC 4DCUA 4DV1C 4DV3C 1QWIA 4YHHC 2E5LC 4LF5C 2XR1A 4DR6C 4JI2C
chains in the Genus database with same CATH superfamily
4G37A 1MKYA 3K6RA 4DR3C 1I94C 2PT7G 1XNRC 3UX2A 1USPB 4KHPC 1LQLA 4PHTA 3TDEA 4PUGA 2VSQA 4X66C 4PUIA 4DCVA 4LF4C 2HJGA 3JAMD 1UWDA 4GKKC 4DR7C 3B7WA 2VQFC 2QVYX 1IBKC 5AE1A 4RVNA 5FLXD 4LFAC 4RLQA 2AYAA 1J5EC 2VQEC 3UZ0A 3DHVA 4DG9A 4JI3C 4PUHA 2D28C 1M6XC 4DUYC 4ZLPA 2KZ0A 2Y27A 4BC7A 2ZTBA 2DHMA 3L8CA 3IMLA 4L4QA 2P20A 4B3SC 2Z51A 4LF7C 4NXMC 1P7LA 3UX3A 3LAXA 5BSUA 4DG8A 1HR0C 2PG1E 4IZ6A 5IT9D 1XMQC 4X65C 3LNOA 5KEIA 1JOSA 2P2MA 3I07A 4LF9C 4DV5C 1BA3A 1ZB9A 5A1GA 2P2FA 2P2JA 4RVOA 3AF6A 5AE2A 4K0KC 1VEHA 4ISBA 3S82A 3CQ2A 2UXCC 1KKGA 4KTVA 2UXDC 4JI1C 1HNXC 4DR1C 4PZPA 3R9WA 3C5EA 4EATA 5LMNC 2OO4A 2P2QA 3PBKA 2YWCA 4K0BA 4G36A 2M5HA 3ETOA 3PESA 2UUCC 1V60A 2UXBC 5LMUC 1XMOC 4DR5C 3L95X 1ZB8A 3IEVA 1XDXA 1MXAA 1N2FA 3O2EA 4B3MC 2JNVA 5BURA 5KYTA 1T5DX 1NY8A 5BR8C 5A19A 4MTNA 4RLFA 1YJ7A 1IB8A 4DUZC 1O9TA 3A9UA 5BUQA 3FM7A 4LF8C 2HHHC 2OPLB 4GS5A 4LFBC 3NYRA 5CZXA 1FJGC 3ETCA 2V7BA 4LF6C 3NPDA 5JRHA 4XX2A 4RM3A 1P4EA 5LCIA 3SO4A 3J7AD 1N32C 4I9GA 1LCIA 1XS3A 1FUGA 2ATWA 3LNVA 2E8CA 3UOWA 1TH5A 3VNQA 1EGAA 1O90A 1RY2A 2NCLA 2P02A 5BSRA 4JI8C 4D56A 4MH4A 4OYCA 2MCQA 2OPLA 3GPCA 2CU6A 2KZFA 3FCCA 4DV0C 4D4GA 3TQIA 4DCTA 4HPVA 4DCUA 4D57A 4NDNA 1MDFA 5BSVA 4DV3C 1QWIA 3N2QA 3NI2A 2E5LC 3PROC 5T8TA 5K8FA 2XR1A 2D1SA 1HNWC 2KDNA 2DPLA 4WV3A 1N34C 1N33C 4U5YD 4LFCC 3GR1A 5BUSA 4GXQA 3RV2A 1GPMA 3OTOC 1WCJA 1V25A 5IFIA 3NYQA 3N54B 1M6XA 1UKKA 5E7QA 2DYJA 2VZEA 4JYAC 4JI7C 3R44A 4PROC 4R0MA 2QL8A 5CZVA 4X62C 3FCEA 2PROA 5T8SA 4X64C 4R1LA 2YWBA 3E7XA 3H2TA 4ZJZA 4GKJC 4OXIA 4NXNC 4FUQA 3A9VA 2ZM6C 2BJOA 3E7WA 4B3TC 1O93A 5GTDA 3I08A 4D4IA 4JV5C 2D1RA 4DR4C 2EGTA 3VNRA 4B3RC 1ULTA 2D1TA 2D27A 3J81D 5KYVA 2OBVA 4G1IA 2PN2A 4LE5A 1ML8A 1HH2P 2MMAB 4DV6C 4ODJA 3LGXA 1V26A 3J80D 4R1MA 4BC9A 1MD9A 1IBLC 4I9FA 3TUFA 3CQ3A 1XRCA 3T1HC 2UUBC 4JI5C 1PA4A 4JM1A 4DV4C 2UUAC 5DV9A 1O92A 4OX9C 1HNZC 2YX1A 2ZZNA 3G7SA 2JMPA 1XRAA 2ONFA 3EERA 3TR3A 4RMNA 4DV1C 3A25A 3DAYA 3GR0A 4FTFA 1XRBA 1FLOA 3A4IA 4LF5C 4DR6C 2MM9A 2Y4NA 1K0RA 4RM2A 2CY1A 1XHJA 3EQ6A 5H9UA 3A26A 1MXBA 3R9XA 3CJEA 4DV7C 2QW0X 1WH9A 1PU1A 4JI4C 2M5OA 2BH1X 4BBYA 2D7VA 3AF5A 2WP0C 3DLPX 2CXCA 3KXWA 3UEBA 3GKUA 3CW8X 2QVXX 2ASBA 5ADZA 2Y4OA 4YY3C 1MXCA 1VLAA 2UU9C 4DV2C 2WD9A 1L2FA 1MDBA 4BCAA 1AMUA 4BSZA 5AE3A 3RG2A 1PG4A 1WF3A 1P4EC 5IWAC 1XNQC 4DCSA 4WS9A 3IEUA 3IPLA 4KTTA 4FUTA 3AY0A 2E8EA 1IBMC 4JI0C 1YGTA 2E7GA 4NOZA 1NYEA 1PG3A 3T1YC 5BSWA 2YCBA 2P2BA 4IR7A 5K85A 3VNSA 4L7IA 5BSTA 4TPSB 3LUSA 3CW9A 3CQ1A 5A2QD 1USPA 2E8FA 2E0GA 4JI6C 2QVZX 1T5HX 2F4VC 5A1IA 1QM4A 1N36C 4AQYC 2ZZMA 5BSMA 4DR2C 2D1QA 4GXRA 4YHHC 1RG9A 4L2ZA 4JI2C
chains in the Genus database with same CATH topology
4G37A 1MKYA 4DR3C 1I94C 2PT7G 1XNRC 1USPB 4KHPC 1LQLA 4PHTA 3TDEA 2VSQA 4X66C 4DCVA 4LF4C 2HJGA 3JAMD 4GKKC 4DR7C 3B7WA 2VQFC 2QVYX 1IBKC 5AE1A 4RVNA 5FLXD 4LFAC 4RLQA 2AYAA 1J5EC 2VQEC 3UZ0A 3DHVA 4DG9A 4JI3C 2D28C 4DUYC 4ZLPA 2Y27A 4BC7A 3L8CA 3IMLA 4L4QA 2P20A 4B3SC 4LF7C 4NXMC 1P7LA 3LAXA 5BSUA 4DG8A 1HR0C 4IZ6A 5IT9D 1XMQC 4X65C 5KEIA 1JOSA 2P2MA 3I07A 4LF9C 4DV5C 1BA3A 1ZB9A 5A1GA 2P2FA 2P2JA 4RVOA 3AF6A 5AE2A 4K0KC 4ISBA 3S82A 2UXCC 1KKGA 4KTVA 2UXDC 4JI1C 1HNXC 4DR1C 4PZPA 3R9WA 3C5EA 4EATA 5LMNC 2OO4A 2P2QA 3PBKA 2YWCA 4K0BA 4G36A 3PESA 3ETOA 2UUCC 2UXBC 5LMUC 1XMOC 4DR5C 3L95X 1ZB8A 3IEVA 1MXAA 1N2FA 4B3MC 5BURA 5KYTA 1T5DX 5BR8C 5A19A 4MTNA 4RLFA 1YJ7A 4DUZC 1O9TA 3A9UA 5BUQA 4LF8C 2HHHC 2OPLB 4GS5A 4LFBC 3NYRA 5CZXA 1FJGC 3ETCA 2V7BA 4LF6C 3NPDA 5JRHA 4XX2A 4RM3A 3SO4A 3J7AD 1N32C 4I9GA 1LCIA 1FUGA 2ATWA 3LNVA 2E8CA 3UOWA 3VNQA 1EGAA 1O90A 1RY2A 2P02A 5BSRA 4JI8C 4D56A 4MH4A 4OYCA 2OPLA 3GPCA 2KZFA 3FCCA 4DV0C 4D4GA 3TQIA 4DCTA 4HPVA 4DCUA 4D57A 4NDNA 1MDFA 5BSVA 4DV3C 1QWIA 3N2QA 3NI2A 2E5LC 3PROC 5T8TA 5K8FA 2XR1A 2D1SA 1HNWC 2DPLA 4WV3A 1N34C 1N33C 4U5YD 4LFCC 3GR1A 5BUSA 4GXQA 3RV2A 1GPMA 3OTOC 1V25A 5IFIA 3NYQA 3N54B 1UKKA 5E7QA 2DYJA 2VZEA 4JYAC 4JI7C 3R44A 4PROC 4R0MA 2QL8A 5CZVA 4X62C 3FCEA 2PROA 5T8SA 4X64C 4R1LA 2YWBA 3E7XA 3H2TA 4ZJZA 4GKJC 4OXIA 4NXNC 4FUQA 3A9VA 2ZM6C 2BJOA 3E7WA 4B3TC 1O93A 5GTDA 3I08A 4D4IA 4JV5C 2D1RA 4DR4C 2EGTA 3VNRA 4B3RC 1ULTA 2D1TA 2D27A 3J81D 5KYVA 2OBVA 4G1IA 2PN2A 4LE5A 1ML8A 1HH2P 4DV6C 4ODJA 3LGXA 1V26A 3J80D 4R1MA 4BC9A 1MD9A 1IBLC 4I9FA 3TUFA 1XRCA 3T1HC 2UUBC 4JI5C 1PA4A 4JM1A 4DV4C 2UUAC 5DV9A 1O92A 4OX9C 1HNZC 3G7SA 2JMPA 1XRAA 2ONFA 3EERA 4RMNA 4DV1C 3DAYA 4FTFA 3GR0A 1XRBA 3A4IA 4LF5C 4DR6C 2Y4NA 1K0RA 4RM2A 2CY1A 3EQ6A 5H9UA 1MXBA 3R9XA 3CJEA 4DV7C 2QW0X 1WH9A 4JI4C 2BH1X 4BBYA 2D7VA 3AF5A 2WP0C 3DLPX 2CXCA 3KXWA 3GKUA 3CW8X 2QVXX 2ASBA 5ADZA 2Y4OA 4YY3C 1MXCA 1VLAA 2UU9C 4DV2C 2WD9A 1L2FA 1MDBA 4BCAA 1AMUA 4BSZA 5AE3A 3RG2A 1PG4A 1WF3A 5IWAC 1XNQC 4DCSA 4WS9A 3IEUA 3IPLA 4KTTA 4FUTA 2E8EA 1IBMC 4JI0C 2E7GA 4NOZA 1NYEA 1PG3A 3T1YC 5BSWA 2YCBA 2P2BA 4IR7A 5K85A 3VNSA 4L7IA 5BSTA 4TPSB 3LUSA 3CW9A 5A2QD 1USPA 2E8FA 2E0GA 4JI6C 2QVZX 1T5HX 2F4VC 5A1IA 1QM4A 1N36C 4AQYC 5BSMA 4DR2C 2D1QA 4GXRA 4YHHC 1RG9A 4L2ZA 4JI2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW C;  1MKY A;  2UUC C;  2UXB C;  1K0R A;  1N34 C;  5LMU C;  1XMO C;  4DR3 C;  1N33 C;  4DR5 C;  1I94 C;  2CY1 A;  4LFC C;  1ZB8 A;  3IEV A;  2PT7 G;  3R9X A;  1XNR C;  1N2F A;  1USP B;  3OTO C;  4KHP C;  1LQL A;  3CJE A;  4DV7 C;  4X66 C;  4DCV A;  4B3M C;  4LF4 C;  2HJG A;  3JAM D;  1UKK A;  1WH9 A;  4GKK C;  4DR7 C;  2DYJ A;  4JYA C;  4JI4 C;  4JI7 C;  2VQF C;  2QL8 A;  4X62 C;  1IBK C;  2D7V A;  5FLX D;  3AF5 A;  4X64 C;  5BR8 C;  4LFA C;  2CXC A;  3GKU A;  4MTN A;  2ASB A;  4GKJ C;  4NXN C;  1J5E C;  4YY3 C;  2VQE C;  2ZM6 C;  4DUZ C;  1VLA A;  2BJO A;  2UU9 C;  4B3T C;  4DV2 C;  4LF8 C;  4JI3 C;  2HHH C;  1L2F A;  2OPL B;  4DUY C;  4BSZ A;  1WF3 A;  4JV5 C;  5IWA C;  1XNQ C;  4DCS A;  4LFB C;  4DR4 C;  3IEU A;  2EGT A;  4B3R C;  1FJG C;  4B3S C;  4LF6 C;  2E8E A;  4LF7 C;  3J81 D;  1IBM C;  4NXM C;  4XX2 A;  2PN2 A;  4JI0 C;  1ML8 A;  3J7A D;  1N32 C;  1HR0 C;  1HH2 P;  2E7G A;  5IT9 D;  1XMQ C;  4X65 C;  4DV6 C;  4NOZ A;  1JOS A;  1NYE A;  2ATW A;  3I07 A;  3T1Y C;  4LF9 C;  4DV5 C;  2YCB A;  2E8C A;  3J80 D;  1ZB9 A;  1IBL C;  1EGA A;  3LUS A;  5A2Q D;  1USP A;  3AF6 A;  2E8F A;  3T1H C;  2UUB C;  4JI8 C;  4JI6 C;  4JI5 C;  1PA4 A;  2F4V C;  4DV4 C;  4K0K C;  2UUA C;  4OX9 C;  4MH4 A;  1HNZ C;  2OPL A;  4AQY C;  1N36 C;  2UXC C;  1KKG A;  2KZF A;  4JI1 C;  2JMP A;  4DV0 C;  1HNX C;  2UXD C;  4DCT A;  4DR1 C;  2ONF A;  4DR2 C;  3R9W A;  3EER A;  5LMN C;  4DCU A;  4DV1 C;  4DV3 C;  1QWI A;  4YHH C;  2E5L C;  4LF5 C;  2XR1 A;  4DR6 C;  4JI2 C; 
#chains in the Genus database with same CATH topology
 4G37 A;  1MKY A;  3K6R A;  4DR3 C;  1I94 C;  2PT7 G;  1XNR C;  3UX2 A;  1USP B;  4KHP C;  1LQL A;  4PHT A;  3TDE A;  4PUG A;  2VSQ A;  4X66 C;  4PUI A;  4DCV A;  4LF4 C;  2HJG A;  3JAM D;  1UWD A;  4GKK C;  4DR7 C;  3B7W A;  2VQF C;  2QVY X;  1IBK C;  5AE1 A;  4RVN A;  5FLX D;  4LFA C;  4RLQ A;  2AYA A;  1J5E C;  2VQE C;  3UZ0 A;  3DHV A;  4DG9 A;  4JI3 C;  4PUH A;  2D28 C;  1M6X C;  4DUY C;  4ZLP A;  2KZ0 A;  2Y27 A;  4BC7 A;  2ZTB A;  2DHM A;  3L8C A;  3IML A;  4L4Q A;  2P20 A;  4B3S C;  2Z51 A;  4LF7 C;  4NXM C;  1P7L A;  3UX3 A;  3LAX A;  5BSU A;  4DG8 A;  1HR0 C;  2PG1 E;  4IZ6 A;  5IT9 D;  1XMQ C;  4X65 C;  3LNO A;  5KEI A;  1JOS A;  2P2M A;  3I07 A;  4LF9 C;  4DV5 C;  1BA3 A;  1ZB9 A;  5A1G A;  2P2F A;  2P2J A;  4RVO A;  3AF6 A;  5AE2 A;  4K0K C;  1VEH A;  4ISB A;  3S82 A;  3CQ2 A;  2UXC C;  1KKG A;  4KTV A;  2UXD C;  4JI1 C;  1HNX C;  4DR1 C;  4PZP A;  3R9W A;  3C5E A;  4EAT A;  5LMN C;  2OO4 A;  2P2Q A;  3PBK A;  2YWC A;  4K0B A;  4G36 A;  2M5H A;  3ETO A;  3PES A;  2UUC C;  1V60 A;  2UXB C;  5LMU C;  1XMO C;  4DR5 C;  3L95 X;  1ZB8 A;  3IEV A;  1XDX A;  1MXA A;  1N2F A;  3O2E A;  4B3M C;  2JNV A;  5BUR A;  5KYT A;  1T5D X;  1NY8 A;  5BR8 C;  5A19 A;  4MTN A;  4RLF A;  1YJ7 A;  1IB8 A;  4DUZ C;  1O9T A;  3A9U A;  5BUQ A;  3FM7 A;  4LF8 C;  2HHH C;  2OPL B;  4GS5 A;  4LFB C;  3NYR A;  5CZX A;  1FJG C;  3ETC A;  2V7B A;  4LF6 C;  3NPD A;  5JRH A;  4XX2 A;  4RM3 A;  1P4E A;  5LCI A;  3SO4 A;  3J7A D;  1N32 C;  4I9G A;  1LCI A;  1XS3 A;  1FUG A;  2ATW A;  3LNV A;  2E8C A;  3UOW A;  1TH5 A;  3VNQ A;  1EGA A;  1O90 A;  1RY2 A;  2NCL A;  2P02 A;  5BSR A;  4JI8 C;  4D56 A;  4MH4 A;  4OYC A;  2MCQ A;  2OPL A;  3GPC A;  2CU6 A;  2KZF A;  3FCC A;  4DV0 C;  4D4G A;  3TQI A;  4DCT A;  4HPV A;  4DCU A;  4D57 A;  4NDN A;  1MDF A;  5BSV A;  4DV3 C;  1QWI A;  3N2Q A;  3NI2 A;  2E5L C;  3PRO C;  5T8T A;  5K8F A;  2XR1 A;  2D1S A;  1HNW C;  2KDN A;  2DPL A;  4WV3 A;  1N34 C;  1N33 C;  4U5Y D;  4LFC C;  3GR1 A;  5BUS A;  4GXQ A;  3RV2 A;  1GPM A;  3OTO C;  1WCJ A;  1V25 A;  5IFI A;  3NYQ A;  3N54 B;  1M6X A;  1UKK A;  5E7Q A;  2DYJ A;  2VZE A;  4JYA C;  4JI7 C;  3R44 A;  4PRO C;  4R0M A;  2QL8 A;  5CZV A;  4X62 C;  3FCE A;  2PRO A;  5T8S A;  4X64 C;  4R1L A;  2YWB A;  3E7X A;  3H2T A;  4ZJZ A;  4GKJ C;  4OXI A;  4NXN C;  4FUQ A;  3A9V A;  2ZM6 C;  2BJO A;  3E7W A;  4B3T C;  1O93 A;  5GTD A;  3I08 A;  4D4I A;  4JV5 C;  2D1R A;  4DR4 C;  2EGT A;  3VNR A;  4B3R C;  1ULT A;  2D1T A;  2D27 A;  3J81 D;  5KYV A;  2OBV A;  4G1I A;  2PN2 A;  4LE5 A;  1ML8 A;  1HH2 P;  2MMA B;  4DV6 C;  4ODJ A;  3LGX A;  1V26 A;  3J80 D;  4R1M A;  4BC9 A;  1MD9 A;  1IBL C;  4I9F A;  3TUF A;  3CQ3 A;  1XRC A;  3T1H C;  2UUB C;  4JI5 C;  1PA4 A;  4JM1 A;  4DV4 C;  2UUA C;  5DV9 A;  1O92 A;  4OX9 C;  1HNZ C;  2YX1 A;  2ZZN A;  3G7S A;  2JMP A;  1XRA A;  2ONF A;  3EER A;  3TR3 A;  4RMN A;  4DV1 C;  3A25 A;  3DAY A;  3GR0 A;  4FTF A;  1XRB A;  1FLO A;  3A4I A;  4LF5 C;  4DR6 C;  2MM9 A;  2Y4N A;  1K0R A;  4RM2 A;  2CY1 A;  1XHJ A;  3EQ6 A;  5H9U A;  3A26 A;  1MXB A;  3R9X A;  3CJE A;  4DV7 C;  2QW0 X;  1WH9 A;  1PU1 A;  4JI4 C;  2M5O A;  2BH1 X;  4BBY A;  2D7V A;  3AF5 A;  2WP0 C;  3DLP X;  2CXC A;  3KXW A;  3UEB A;  3GKU A;  3CW8 X;  2QVX X;  2ASB A;  5ADZ A;  2Y4O A;  4YY3 C;  1MXC A;  1VLA A;  2UU9 C;  4DV2 C;  2WD9 A;  1L2F A;  1MDB A;  4BCA A;  1AMU A;  4BSZ A;  5AE3 A;  3RG2 A;  1PG4 A;  1WF3 A;  1P4E C;  5IWA C;  1XNQ C;  4DCS A;  4WS9 A;  3IEU A;  3IPL A;  4KTT A;  4FUT A;  3AY0 A;  2E8E A;  1IBM C;  4JI0 C;  1YGT A;  2E7G A;  4NOZ A;  1NYE A;  1PG3 A;  3T1Y C;  5BSW A;  2YCB A;  2P2B A;  4IR7 A;  5K85 A;  3VNS A;  4L7I A;  5BST A;  4TPS B;  3LUS A;  3CW9 A;  3CQ1 A;  5A2Q D;  1USP A;  2E8F A;  2E0G A;  4JI6 C;  2QVZ X;  1T5H X;  2F4V C;  5A1I A;  1QM4 A;  1N36 C;  4AQY C;  2ZZM A;  5BSM A;  4DR2 C;  2D1Q A;  4GXR A;  4YHH C;  1RG9 A;  4L2Z A;  4JI2 C; 
#chains in the Genus database with same CATH homology
 4G37 A;  1MKY A;  4DR3 C;  1I94 C;  2PT7 G;  1XNR C;  1USP B;  4KHP C;  1LQL A;  4PHT A;  3TDE A;  2VSQ A;  4X66 C;  4DCV A;  4LF4 C;  2HJG A;  3JAM D;  4GKK C;  4DR7 C;  3B7W A;  2VQF C;  2QVY X;  1IBK C;  5AE1 A;  4RVN A;  5FLX D;  4LFA C;  4RLQ A;  2AYA A;  1J5E C;  2VQE C;  3UZ0 A;  3DHV A;  4DG9 A;  4JI3 C;  2D28 C;  4DUY C;  4ZLP A;  2Y27 A;  4BC7 A;  3L8C A;  3IML A;  4L4Q A;  2P20 A;  4B3S C;  4LF7 C;  4NXM C;  1P7L A;  3LAX A;  5BSU A;  4DG8 A;  1HR0 C;  4IZ6 A;  5IT9 D;  1XMQ C;  4X65 C;  5KEI A;  1JOS A;  2P2M A;  3I07 A;  4LF9 C;  4DV5 C;  1BA3 A;  1ZB9 A;  5A1G A;  2P2F A;  2P2J A;  4RVO A;  3AF6 A;  5AE2 A;  4K0K C;  4ISB A;  3S82 A;  2UXC C;  1KKG A;  4KTV A;  2UXD C;  4JI1 C;  1HNX C;  4DR1 C;  4PZP A;  3R9W A;  3C5E A;  4EAT A;  5LMN C;  2OO4 A;  2P2Q A;  3PBK A;  2YWC A;  4K0B A;  4G36 A;  3PES A;  3ETO A;  2UUC C;  2UXB C;  5LMU C;  1XMO C;  4DR5 C;  3L95 X;  1ZB8 A;  3IEV A;  1MXA A;  1N2F A;  4B3M C;  5BUR A;  5KYT A;  1T5D X;  5BR8 C;  5A19 A;  4MTN A;  4RLF A;  1YJ7 A;  4DUZ C;  1O9T A;  3A9U A;  5BUQ A;  4LF8 C;  2HHH C;  2OPL B;  4GS5 A;  4LFB C;  3NYR A;  5CZX A;  1FJG C;  3ETC A;  2V7B A;  4LF6 C;  3NPD A;  5JRH A;  4XX2 A;  4RM3 A;  3SO4 A;  3J7A D;  1N32 C;  4I9G A;  1LCI A;  1FUG A;  2ATW A;  3LNV A;  2E8C A;  3UOW A;  3VNQ A;  1EGA A;  1O90 A;  1RY2 A;  2P02 A;  5BSR A;  4JI8 C;  4D56 A;  4MH4 A;  4OYC A;  2OPL A;  3GPC A;  2KZF A;  3FCC A;  4DV0 C;  4D4G A;  3TQI A;  4DCT A;  4HPV A;  4DCU A;  4D57 A;  4NDN A;  1MDF A;  5BSV A;  4DV3 C;  1QWI A;  3N2Q A;  3NI2 A;  2E5L C;  3PRO C;  5T8T A;  5K8F A;  2XR1 A;  2D1S A;  1HNW C;  2DPL A;  4WV3 A;  1N34 C;  1N33 C;  4U5Y D;  4LFC C;  3GR1 A;  5BUS A;  4GXQ A;  3RV2 A;  1GPM A;  3OTO C;  1V25 A;  5IFI A;  3NYQ A;  3N54 B;  1UKK A;  5E7Q A;  2DYJ A;  2VZE A;  4JYA C;  4JI7 C;  3R44 A;  4PRO C;  4R0M A;  2QL8 A;  5CZV A;  4X62 C;  3FCE A;  2PRO A;  5T8S A;  4X64 C;  4R1L A;  2YWB A;  3E7X A;  3H2T A;  4ZJZ A;  4GKJ C;  4OXI A;  4NXN C;  4FUQ A;  3A9V A;  2ZM6 C;  2BJO A;  3E7W A;  4B3T C;  1O93 A;  5GTD A;  3I08 A;  4D4I A;  4JV5 C;  2D1R A;  4DR4 C;  2EGT A;  3VNR A;  4B3R C;  1ULT A;  2D1T A;  2D27 A;  3J81 D;  5KYV A;  2OBV A;  4G1I A;  2PN2 A;  4LE5 A;  1ML8 A;  1HH2 P;  4DV6 C;  4ODJ A;  3LGX A;  1V26 A;  3J80 D;  4R1M A;  4BC9 A;  1MD9 A;  1IBL C;  4I9F A;  3TUF A;  1XRC A;  3T1H C;  2UUB C;  4JI5 C;  1PA4 A;  4JM1 A;  4DV4 C;  2UUA C;  5DV9 A;  1O92 A;  4OX9 C;  1HNZ C;  3G7S A;  2JMP A;  1XRA A;  2ONF A;  3EER A;  4RMN A;  4DV1 C;  3DAY A;  4FTF A;  3GR0 A;  1XRB A;  3A4I A;  4LF5 C;  4DR6 C;  2Y4N A;  1K0R A;  4RM2 A;  2CY1 A;  3EQ6 A;  5H9U A;  1MXB A;  3R9X A;  3CJE A;  4DV7 C;  2QW0 X;  1WH9 A;  4JI4 C;  2BH1 X;  4BBY A;  2D7V A;  3AF5 A;  2WP0 C;  3DLP X;  2CXC A;  3KXW A;  3GKU A;  3CW8 X;  2QVX X;  2ASB A;  5ADZ A;  2Y4O A;  4YY3 C;  1MXC A;  1VLA A;  2UU9 C;  4DV2 C;  2WD9 A;  1L2F A;  1MDB A;  4BCA A;  1AMU A;  4BSZ A;  5AE3 A;  3RG2 A;  1PG4 A;  1WF3 A;  5IWA C;  1XNQ C;  4DCS A;  4WS9 A;  3IEU A;  3IPL A;  4KTT A;  4FUT A;  2E8E A;  1IBM C;  4JI0 C;  2E7G A;  4NOZ A;  1NYE A;  1PG3 A;  3T1Y C;  5BSW A;  2YCB A;  2P2B A;  4IR7 A;  5K85 A;  3VNS A;  4L7I A;  5BST A;  4TPS B;  3LUS A;  3CW9 A;  5A2Q D;  1USP A;  2E8F A;  2E0G A;  4JI6 C;  2QVZ X;  1T5H X;  2F4V C;  5A1I A;  1QM4 A;  1N36 C;  4AQY C;  5BSM A;  4DR2 C;  2D1Q A;  4GXR A;  4YHH C;  1RG9 A;  4L2Z A;  4JI2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...