4OX9C

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ox9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ox9C02
2D7VA 1HH2P 4JYAC 1FJGC 4YHHC 1HNXC 1ML8A 1XNRC 3AF6A 2PT7G 3EERA 4LF8C 2EGTA 2E8CA 3LUSA 5BR8C 4LF9C 1EGAA 4NXMC 1QWIA 2ONFA 4X65C 1MKYA 2OPLA 2ZM6C 1L2FA 4KHPC 1HNZC 2XR1A 4DUYC 4DR2C 3IEUA 1PA4A 2UUAC 2VQEC 2BJOA 1IBMC 1VLAA 5IWAC 1LQLA 3AF5A 4LF6C 1USPB 2JMPA 4JI7C 4X64C 4DV3C 1I94C 4AQYC 4X66C 3OTOC 4DV5C 2HHHC 2ASBA 4LF4C 2E8EA 2E5LC 4DV0C 2QL8A 4OX9C 4JI4C 2UUBC 1ZB8A 4JI1C 4B3TC 4DR1C 1N36C 1IBLC 3IEVA 1KKGA 2DYJA 4GKKC 4JI6C 4DCVA 5FLXD 4GKJC 4BSZA 4DR5C 2VQFC 2OPLB 2UXDC 1JOSA 3T1HC 3J80D 4DCSA 4DR3C 4NXNC 3I07A 4LFCC 2E7GA 4DV2C 2UXBC 1N33C 2UUCC 4MTNA 1USPA 1HNWC 4DV6C 3CJEA 4XX2A 3GKUA 4DCTA 4LFAC 4JI5C 4DCUA 5LMNC 1ZB9A 1XNQC 2CY1A 1UKKA 1XMOC 2ATWA 3J81D 1N2FA 4JV5C 1XMQC 5IT9D 2F4VC 3R9WA 3T1YC 3JAMD 4LF7C 2PN2A 2CXCA 4LF5C 4K0KC 4MH4A 1HR0C 4JI8C 1N32C 2E8FA 1K0RA 4NOZA 3R9XA 2HJGA 1IBKC 4LFBC 4JI3C 4DR4C 1WF3A 4YY3C 4DV1C 5A2QD 4DV7C 4JI0C 1NYEA 2KZFA 4X62C 4DR6C 3J7AD 4DR7C 2UU9C 4JI2C 4B3RC 5LMUC 4B3SC 1WH9A 4DUZC 2UXCC 1J5EC 1N34C 4B3MC 4DV4C 2YCBA
chains in the Genus database with same CATH superfamily
1HH2P 4JYAC 4YHHC 4I9FA 1ML8A 1XNRC 3AF6A 4G37A 3B7WA 4DG9A 4TPSB 1EGAA 4NXMC 2JNVA 4X65C 2OO4A 3LAXA 2ZM6C 3NYRA 4WS9A 2M5OA 2VZEA 2UUAC 2VQEC 1LQLA 3AF5A 1USPB 4X64C 2P2JA 3N2QA 5DV9A 2YWCA 2HHHC 2E0GA 4OX9C 2PG1E 4KTTA 4NDNA 1FLOA 5BSTA 5BURA 1PG3A 3CQ3A 2ZZMA 3R44A 4G1IA 4EATA 2Y4OA 4FUQA 3T1HC 3UEBA 4DCSA 2D1SA 1P4EC 2ZTBA 2E7GA 4DV2C 3A25A 1XS3A 3CJEA 3RG2A 1T5DX 2MM9A 5LMNC 1XNQC 1MXCA 5IFIA 5E7QA 3LGXA 2QW0X 3A26A 2QVYX 4OXIA 5T8TA 5A19A 3JAMD 2MMAB 3FCCA 4LF5C 1XRAA 3DAYA 4RLQA 5BSRA 2E8FA 1MDBA 4RM3A 4LE5A 4BC9A 2P2BA 3I08A 1MXBA 4JI0C 1IB8A 4ODJA 1NYEA 4X62C 1XDXA 4RLFA 5BSMA 2UU9C 3CQ2A 4B3RC 3E7WA 5LMUC 4L2ZA 4PUHA 1N34C 2M5HA 4JM1A 1BA3A 4PHTA 1HNXC 2PT7G 1LCIA 3EERA 4GXRA 1P4EA 1QWIA 2DPLA 2YX1A 3CW8X 2XR1A 1PA4A 1WCJA 1VLAA 5IWAC 5K8FA 4JI7C 4DV3C 3LNOA 4PUGA 5A1IA 4X66C 2DHMA 3N54B 2UUBC 4JI1C 2Z51A 4B3TC 3UX3A 1N36C 1KKGA 5AE1A 1FUGA 5AE2A 4JI6C 4DCVA 5FLXD 4BSZA 4DR5C 2VQFC 3TR3A 3J80D 4IR7A 4DR3C 2KZ0A 1GPMA 3G7SA 1MD9A 3K6RA 2UXBC 2UUCC 4DCTA 3GKUA 2OBVA 3RV2A 1ULTA 1ZB9A 3TQIA 4PZPA 5GTDA 1UKKA 2ATWA 5IT9D 3R9WA 3NYQA 4G36A 2PN2A 3TUFA 3UZ0A 1N32C 1K0RA 1IBKC 4FUTA 4YY3C 4DR6C 4RVOA 1QM4A 1PG4A 2D1RA 4D57A 4JI2C 3PESA 4L4QA 1NY8A 3IPLA 2WP0C 4PROC 2QVZX 4B3SC 1WH9A 1O92A 4DUZC 1J5EC 4I9GA 3VNQA 2D7VA 1YJ7A 1PU1A 4LF8C 3LUSA 5BR8C 1MDFA 2QVXX 2KDNA 2P2QA 1L2FA 4DG8A 3SO4A 4RMNA 4DR2C 3IEUA 4R1LA 5ADZA 2BJOA 5T8SA 1VEHA 4DV5C 2BH1X 4D56A 4WV3A 4DV0C 4IZ6A 2D27A 4JI4C 4BBYA 3DLPX 3L8CA 1ZB8A 4DR1C 3LNVA 2DYJA 3VNSA 1V25A 4OYCA 2OPLB 4HPVA 3FCEA 4ISBA 2YWBA 4U5YD 4D4IA 1V60A 3I07A 2P2MA 4LFCC 1XRCA 3NI2A 1N33C 1USPA 4D4GA 1HNWC 3UOWA 4XX2A 4ZLPA 3H2TA 4DCUA 3A9UA 2AYAA 5K85A 2CY1A 1XMOC 2D1TA 4JV5C 1MXAA 5BUSA 4FTFA 3T1YC 2D1QA 4LF7C 2CXCA 4MH4A 1HR0C 3R9XA 4NOZA 2HJGA 1O93A 3CW9A 1M6XC 1RG9A 4JI3C 4DV7C 3GPCA 3A9VA 3CQ1A 2KZFA 3UX2A 5LCIA 3J7AD 1XHJA 4BC7A 4DR7C 1XRBA 3C5EA 1AMUA 2D28C 4L7IA 2UXCC 3AY0A 2NCLA 5KEIA 1UWDA 4B3MC 2YCBA 1FJGC 2P02A 5KYTA 2V7BA 5CZVA 2PROA 2EGTA 2E8CA 5BUQA 5JRHA 4LF9C 2Y27A 1YGTA 2ONFA 2P2FA 2OPLA 1M6XA 4KHPC 1HNZC 2P20A 4DUYC 1IBMC 4LF6C 2JMPA 3ETOA 4PUIA 1I94C 4AQYC 1TH5A 3OTOC 1T5HX 2ASBA 4LF4C 2E8EA 2E5LC 2QL8A 5AE3A 3L95X 5BSWA 1P7LA 3GR1A 4ZJZA 1IBLC 3IEVA 3O2EA 4GKKC 1O9TA 4KTVA 3EQ6A 4GKJC 5BSVA 5KYVA 2UXDC 1JOSA 5A1GA 4NXNC 4RVNA 2MCQA 5H9UA 3GR0A 4MTNA 4DV6C 4LFAC 4BCAA 4JI5C 2Y4NA 4R0MA 4R1MA 2WD9A 3J81D 1N2FA 3E7XA 3PBKA 1XMQC 3FM7A 3KXWA 2F4VC 3S82A 3TDEA 2VSQA 2CU6A 5BSUA 4K0KC 3A4IA 3DHVA 4JI8C 3NPDA 1O90A 4K0BA 4LFBC 4DR4C 3ETCA 1RY2A 1WF3A 4DV1C 5A2QD 4GXQA 3IMLA 4RM2A 1V26A 3PROC 2ZZNA 5CZXA 3VNRA 4GS5A 4DV4C 1MKYA
chains in the Genus database with same CATH topology
1HH2P 4JYAC 4YHHC 4I9FA 1ML8A 1XNRC 3AF6A 4G37A 3B7WA 4DG9A 4TPSB 1EGAA 4NXMC 4X65C 2OO4A 3LAXA 2ZM6C 3NYRA 4WS9A 2VZEA 2UUAC 2VQEC 1LQLA 3AF5A 1USPB 4X64C 2P2JA 3N2QA 5DV9A 2YWCA 2HHHC 2E0GA 4OX9C 4KTTA 4NDNA 5BSTA 5BURA 1PG3A 3R44A 4G1IA 4EATA 2Y4OA 4FUQA 3T1HC 4DCSA 2D1SA 2E7GA 4DV2C 3CJEA 3RG2A 1T5DX 5LMNC 1XNQC 1MXCA 5IFIA 5E7QA 3LGXA 2QW0X 2QVYX 4OXIA 5T8TA 5A19A 3JAMD 3FCCA 4LF5C 1XRAA 3DAYA 4RLQA 5BSRA 2E8FA 1MDBA 4RM3A 4LE5A 4BC9A 2P2BA 3I08A 1MXBA 4JI0C 4ODJA 1NYEA 4X62C 4RLFA 5BSMA 2UU9C 4B3RC 3E7WA 5LMUC 4L2ZA 1N34C 4JM1A 1BA3A 4PHTA 1HNXC 2PT7G 1LCIA 3EERA 4GXRA 1QWIA 2DPLA 3CW8X 2XR1A 1PA4A 1VLAA 5IWAC 5K8FA 4JI7C 4DV3C 5A1IA 4X66C 3N54B 2UUBC 4JI1C 4B3TC 1N36C 1KKGA 5AE1A 1FUGA 5AE2A 4JI6C 4DCVA 5FLXD 4BSZA 4DR5C 2VQFC 3J80D 4IR7A 4DR3C 1GPMA 3G7SA 1MD9A 2UXBC 2UUCC 4DCTA 3GKUA 2OBVA 3RV2A 1ULTA 1ZB9A 3TQIA 4PZPA 5GTDA 1UKKA 2ATWA 5IT9D 3R9WA 3NYQA 4G36A 2PN2A 3TUFA 3UZ0A 1N32C 1K0RA 1IBKC 4FUTA 4YY3C 4DR6C 4RVOA 1QM4A 1PG4A 2D1RA 4D57A 4JI2C 3PESA 4L4QA 3IPLA 2WP0C 4PROC 2QVZX 4B3SC 1WH9A 1O92A 4DUZC 1J5EC 4I9GA 3VNQA 2D7VA 1YJ7A 4LF8C 3LUSA 5BR8C 1MDFA 2QVXX 2P2QA 1L2FA 4DG8A 3SO4A 4RMNA 4DR2C 3IEUA 4R1LA 5ADZA 2BJOA 5T8SA 4DV5C 2BH1X 4D56A 4WV3A 4DV0C 4IZ6A 2D27A 4JI4C 4BBYA 3DLPX 3L8CA 1ZB8A 4DR1C 3LNVA 2DYJA 3VNSA 1V25A 4OYCA 2OPLB 4HPVA 3FCEA 4ISBA 2YWBA 4U5YD 4D4IA 3I07A 2P2MA 4LFCC 1XRCA 3NI2A 1N33C 1USPA 4D4GA 1HNWC 3UOWA 4XX2A 4ZLPA 3H2TA 4DCUA 3A9UA 2AYAA 5K85A 2CY1A 1XMOC 2D1TA 4JV5C 1MXAA 5BUSA 4FTFA 3T1YC 2D1QA 4LF7C 2CXCA 4MH4A 1HR0C 3R9XA 4NOZA 2HJGA 1O93A 3CW9A 1RG9A 4JI3C 4DV7C 3GPCA 3A9VA 2KZFA 3J7AD 4BC7A 4DR7C 1XRBA 3C5EA 1AMUA 2D28C 4L7IA 2UXCC 5KEIA 4B3MC 2YCBA 1FJGC 2P02A 5KYTA 2V7BA 5CZVA 2PROA 2EGTA 2E8CA 5BUQA 5JRHA 4LF9C 2Y27A 2ONFA 2P2FA 2OPLA 4KHPC 1HNZC 2P20A 4DUYC 1IBMC 4LF6C 2JMPA 3ETOA 1I94C 4AQYC 3OTOC 1T5HX 2ASBA 4LF4C 2E8EA 2E5LC 2QL8A 5AE3A 3L95X 5BSWA 1P7LA 3GR1A 4ZJZA 1IBLC 3IEVA 4GKKC 1O9TA 4KTVA 3EQ6A 4GKJC 5BSVA 5KYVA 2UXDC 1JOSA 5A1GA 4NXNC 4RVNA 5H9UA 3GR0A 4MTNA 4DV6C 4LFAC 4BCAA 4JI5C 2Y4NA 4R0MA 4R1MA 2WD9A 3J81D 1N2FA 3E7XA 3PBKA 1XMQC 3KXWA 2F4VC 3S82A 3TDEA 2VSQA 5BSUA 4K0KC 3A4IA 3DHVA 4JI8C 3NPDA 1O90A 4K0BA 4LFBC 4DR4C 3ETCA 1RY2A 1WF3A 4DV1C 5A2QD 4GXQA 3IMLA 4RM2A 1V26A 3PROC 5CZXA 3VNRA 4GS5A 4DV4C 1MKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7V A;  1HH2 P;  4JYA C;  1FJG C;  4YHH C;  1HNX C;  1ML8 A;  1XNR C;  3AF6 A;  2PT7 G;  3EER A;  4LF8 C;  2EGT A;  2E8C A;  3LUS A;  5BR8 C;  4LF9 C;  1EGA A;  4NXM C;  1QWI A;  2ONF A;  4X65 C;  1MKY A;  2OPL A;  2ZM6 C;  1L2F A;  4KHP C;  1HNZ C;  2XR1 A;  4DUY C;  4DR2 C;  3IEU A;  1PA4 A;  2UUA C;  2VQE C;  2BJO A;  1IBM C;  1VLA A;  5IWA C;  1LQL A;  3AF5 A;  4LF6 C;  1USP B;  2JMP A;  4JI7 C;  4X64 C;  4DV3 C;  1I94 C;  4AQY C;  4X66 C;  3OTO C;  4DV5 C;  2HHH C;  2ASB A;  4LF4 C;  2E8E A;  2E5L C;  4DV0 C;  2QL8 A;  4OX9 C;  4JI4 C;  2UUB C;  1ZB8 A;  4JI1 C;  4B3T C;  4DR1 C;  1N36 C;  1IBL C;  3IEV A;  1KKG A;  2DYJ A;  4GKK C;  4JI6 C;  4DCV A;  5FLX D;  4GKJ C;  4BSZ A;  4DR5 C;  2VQF C;  2OPL B;  2UXD C;  1JOS A;  3T1H C;  3J80 D;  4DCS A;  4DR3 C;  4NXN C;  3I07 A;  4LFC C;  2E7G A;  4DV2 C;  2UXB C;  1N33 C;  2UUC C;  4MTN A;  1USP A;  1HNW C;  4DV6 C;  3CJE A;  4XX2 A;  3GKU A;  4DCT A;  4LFA C;  4JI5 C;  4DCU A;  5LMN C;  1ZB9 A;  1XNQ C;  2CY1 A;  1UKK A;  1XMO C;  2ATW A;  3J81 D;  1N2F A;  4JV5 C;  1XMQ C;  5IT9 D;  2F4V C;  3R9W A;  3T1Y C;  3JAM D;  4LF7 C;  2PN2 A;  2CXC A;  4LF5 C;  4K0K C;  4MH4 A;  1HR0 C;  4JI8 C;  1N32 C;  2E8F A;  1K0R A;  4NOZ A;  3R9X A;  2HJG A;  1IBK C;  4LFB C;  4JI3 C;  4DR4 C;  1WF3 A;  4YY3 C;  4DV1 C;  5A2Q D;  4DV7 C;  4JI0 C;  1NYE A;  2KZF A;  4X62 C;  4DR6 C;  3J7A D;  4DR7 C;  2UU9 C;  4JI2 C;  4B3R C;  5LMU C;  4B3S C;  1WH9 A;  4DUZ C;  2UXC C;  1J5E C;  1N34 C;  4B3M C;  4DV4 C;  2YCB A; 
#chains in the Genus database with same CATH topology
 1HH2 P;  4JYA C;  4YHH C;  4I9F A;  1ML8 A;  1XNR C;  3AF6 A;  4G37 A;  3B7W A;  4DG9 A;  4TPS B;  1EGA A;  4NXM C;  2JNV A;  4X65 C;  2OO4 A;  3LAX A;  2ZM6 C;  3NYR A;  4WS9 A;  2M5O A;  2VZE A;  2UUA C;  2VQE C;  1LQL A;  3AF5 A;  1USP B;  4X64 C;  2P2J A;  3N2Q A;  5DV9 A;  2YWC A;  2HHH C;  2E0G A;  4OX9 C;  2PG1 E;  4KTT A;  4NDN A;  1FLO A;  5BST A;  5BUR A;  1PG3 A;  3CQ3 A;  2ZZM A;  3R44 A;  4G1I A;  4EAT A;  2Y4O A;  4FUQ A;  3T1H C;  3UEB A;  4DCS A;  2D1S A;  1P4E C;  2ZTB A;  2E7G A;  4DV2 C;  3A25 A;  1XS3 A;  3CJE A;  3RG2 A;  1T5D X;  2MM9 A;  5LMN C;  1XNQ C;  1MXC A;  5IFI A;  5E7Q A;  3LGX A;  2QW0 X;  3A26 A;  2QVY X;  4OXI A;  5T8T A;  5A19 A;  3JAM D;  2MMA B;  3FCC A;  4LF5 C;  1XRA A;  3DAY A;  4RLQ A;  5BSR A;  2E8F A;  1MDB A;  4RM3 A;  4LE5 A;  4BC9 A;  2P2B A;  3I08 A;  1MXB A;  4JI0 C;  1IB8 A;  4ODJ A;  1NYE A;  4X62 C;  1XDX A;  4RLF A;  5BSM A;  2UU9 C;  3CQ2 A;  4B3R C;  3E7W A;  5LMU C;  4L2Z A;  4PUH A;  1N34 C;  2M5H A;  4JM1 A;  1BA3 A;  4PHT A;  1HNX C;  2PT7 G;  1LCI A;  3EER A;  4GXR A;  1P4E A;  1QWI A;  2DPL A;  2YX1 A;  3CW8 X;  2XR1 A;  1PA4 A;  1WCJ A;  1VLA A;  5IWA C;  5K8F A;  4JI7 C;  4DV3 C;  3LNO A;  4PUG A;  5A1I A;  4X66 C;  2DHM A;  3N54 B;  2UUB C;  4JI1 C;  2Z51 A;  4B3T C;  3UX3 A;  1N36 C;  1KKG A;  5AE1 A;  1FUG A;  5AE2 A;  4JI6 C;  4DCV A;  5FLX D;  4BSZ A;  4DR5 C;  2VQF C;  3TR3 A;  3J80 D;  4IR7 A;  4DR3 C;  2KZ0 A;  1GPM A;  3G7S A;  1MD9 A;  3K6R A;  2UXB C;  2UUC C;  4DCT A;  3GKU A;  2OBV A;  3RV2 A;  1ULT A;  1ZB9 A;  3TQI A;  4PZP A;  5GTD A;  1UKK A;  2ATW A;  5IT9 D;  3R9W A;  3NYQ A;  4G36 A;  2PN2 A;  3TUF A;  3UZ0 A;  1N32 C;  1K0R A;  1IBK C;  4FUT A;  4YY3 C;  4DR6 C;  4RVO A;  1QM4 A;  1PG4 A;  2D1R A;  4D57 A;  4JI2 C;  3PES A;  4L4Q A;  1NY8 A;  3IPL A;  2WP0 C;  4PRO C;  2QVZ X;  4B3S C;  1WH9 A;  1O92 A;  4DUZ C;  1J5E C;  4I9G A;  3VNQ A;  2D7V A;  1YJ7 A;  1PU1 A;  4LF8 C;  3LUS A;  5BR8 C;  1MDF A;  2QVX X;  2KDN A;  2P2Q A;  1L2F A;  4DG8 A;  3SO4 A;  4RMN A;  4DR2 C;  3IEU A;  4R1L A;  5ADZ A;  2BJO A;  5T8S A;  1VEH A;  4DV5 C;  2BH1 X;  4D56 A;  4WV3 A;  4DV0 C;  4IZ6 A;  2D27 A;  4JI4 C;  4BBY A;  3DLP X;  3L8C A;  1ZB8 A;  4DR1 C;  3LNV A;  2DYJ A;  3VNS A;  1V25 A;  4OYC A;  2OPL B;  4HPV A;  3FCE A;  4ISB A;  2YWB A;  4U5Y D;  4D4I A;  1V60 A;  3I07 A;  2P2M A;  4LFC C;  1XRC A;  3NI2 A;  1N33 C;  1USP A;  4D4G A;  1HNW C;  3UOW A;  4XX2 A;  4ZLP A;  3H2T A;  4DCU A;  3A9U A;  2AYA A;  5K85 A;  2CY1 A;  1XMO C;  2D1T A;  4JV5 C;  1MXA A;  5BUS A;  4FTF A;  3T1Y C;  2D1Q A;  4LF7 C;  2CXC A;  4MH4 A;  1HR0 C;  3R9X A;  4NOZ A;  2HJG A;  1O93 A;  3CW9 A;  1M6X C;  1RG9 A;  4JI3 C;  4DV7 C;  3GPC A;  3A9V A;  3CQ1 A;  2KZF A;  3UX2 A;  5LCI A;  3J7A D;  1XHJ A;  4BC7 A;  4DR7 C;  1XRB A;  3C5E A;  1AMU A;  2D28 C;  4L7I A;  2UXC C;  3AY0 A;  2NCL A;  5KEI A;  1UWD A;  4B3M C;  2YCB A;  1FJG C;  2P02 A;  5KYT A;  2V7B A;  5CZV A;  2PRO A;  2EGT A;  2E8C A;  5BUQ A;  5JRH A;  4LF9 C;  2Y27 A;  1YGT A;  2ONF A;  2P2F A;  2OPL A;  1M6X A;  4KHP C;  1HNZ C;  2P20 A;  4DUY C;  1IBM C;  4LF6 C;  2JMP A;  3ETO A;  4PUI A;  1I94 C;  4AQY C;  1TH5 A;  3OTO C;  1T5H X;  2ASB A;  4LF4 C;  2E8E A;  2E5L C;  2QL8 A;  5AE3 A;  3L95 X;  5BSW A;  1P7L A;  3GR1 A;  4ZJZ A;  1IBL C;  3IEV A;  3O2E A;  4GKK C;  1O9T A;  4KTV A;  3EQ6 A;  4GKJ C;  5BSV A;  5KYV A;  2UXD C;  1JOS A;  5A1G A;  4NXN C;  4RVN A;  2MCQ A;  5H9U A;  3GR0 A;  4MTN A;  4DV6 C;  4LFA C;  4BCA A;  4JI5 C;  2Y4N A;  4R0M A;  4R1M A;  2WD9 A;  3J81 D;  1N2F A;  3E7X A;  3PBK A;  1XMQ C;  3FM7 A;  3KXW A;  2F4V C;  3S82 A;  3TDE A;  2VSQ A;  2CU6 A;  5BSU A;  4K0K C;  3A4I A;  3DHV A;  4JI8 C;  3NPD A;  1O90 A;  4K0B A;  4LFB C;  4DR4 C;  3ETC A;  1RY2 A;  1WF3 A;  4DV1 C;  5A2Q D;  4GXQ A;  3IML A;  4RM2 A;  1V26 A;  3PRO C;  2ZZN A;  5CZX A;  3VNR A;  4GS5 A;  4DV4 C;  1MKY A; 
#chains in the Genus database with same CATH homology
 1HH2 P;  4JYA C;  4YHH C;  4I9F A;  1ML8 A;  1XNR C;  3AF6 A;  4G37 A;  3B7W A;  4DG9 A;  4TPS B;  1EGA A;  4NXM C;  4X65 C;  2OO4 A;  3LAX A;  2ZM6 C;  3NYR A;  4WS9 A;  2VZE A;  2UUA C;  2VQE C;  1LQL A;  3AF5 A;  1USP B;  4X64 C;  2P2J A;  3N2Q A;  5DV9 A;  2YWC A;  2HHH C;  2E0G A;  4OX9 C;  4KTT A;  4NDN A;  5BST A;  5BUR A;  1PG3 A;  3R44 A;  4G1I A;  4EAT A;  2Y4O A;  4FUQ A;  3T1H C;  4DCS A;  2D1S A;  2E7G A;  4DV2 C;  3CJE A;  3RG2 A;  1T5D X;  5LMN C;  1XNQ C;  1MXC A;  5IFI A;  5E7Q A;  3LGX A;  2QW0 X;  2QVY X;  4OXI A;  5T8T A;  5A19 A;  3JAM D;  3FCC A;  4LF5 C;  1XRA A;  3DAY A;  4RLQ A;  5BSR A;  2E8F A;  1MDB A;  4RM3 A;  4LE5 A;  4BC9 A;  2P2B A;  3I08 A;  1MXB A;  4JI0 C;  4ODJ A;  1NYE A;  4X62 C;  4RLF A;  5BSM A;  2UU9 C;  4B3R C;  3E7W A;  5LMU C;  4L2Z A;  1N34 C;  4JM1 A;  1BA3 A;  4PHT A;  1HNX C;  2PT7 G;  1LCI A;  3EER A;  4GXR A;  1QWI A;  2DPL A;  3CW8 X;  2XR1 A;  1PA4 A;  1VLA A;  5IWA C;  5K8F A;  4JI7 C;  4DV3 C;  5A1I A;  4X66 C;  3N54 B;  2UUB C;  4JI1 C;  4B3T C;  1N36 C;  1KKG A;  5AE1 A;  1FUG A;  5AE2 A;  4JI6 C;  4DCV A;  5FLX D;  4BSZ A;  4DR5 C;  2VQF C;  3J80 D;  4IR7 A;  4DR3 C;  1GPM A;  3G7S A;  1MD9 A;  2UXB C;  2UUC C;  4DCT A;  3GKU A;  2OBV A;  3RV2 A;  1ULT A;  1ZB9 A;  3TQI A;  4PZP A;  5GTD A;  1UKK A;  2ATW A;  5IT9 D;  3R9W A;  3NYQ A;  4G36 A;  2PN2 A;  3TUF A;  3UZ0 A;  1N32 C;  1K0R A;  1IBK C;  4FUT A;  4YY3 C;  4DR6 C;  4RVO A;  1QM4 A;  1PG4 A;  2D1R A;  4D57 A;  4JI2 C;  3PES A;  4L4Q A;  3IPL A;  2WP0 C;  4PRO C;  2QVZ X;  4B3S C;  1WH9 A;  1O92 A;  4DUZ C;  1J5E C;  4I9G A;  3VNQ A;  2D7V A;  1YJ7 A;  4LF8 C;  3LUS A;  5BR8 C;  1MDF A;  2QVX X;  2P2Q A;  1L2F A;  4DG8 A;  3SO4 A;  4RMN A;  4DR2 C;  3IEU A;  4R1L A;  5ADZ A;  2BJO A;  5T8S A;  4DV5 C;  2BH1 X;  4D56 A;  4WV3 A;  4DV0 C;  4IZ6 A;  2D27 A;  4JI4 C;  4BBY A;  3DLP X;  3L8C A;  1ZB8 A;  4DR1 C;  3LNV A;  2DYJ A;  3VNS A;  1V25 A;  4OYC A;  2OPL B;  4HPV A;  3FCE A;  4ISB A;  2YWB A;  4U5Y D;  4D4I A;  3I07 A;  2P2M A;  4LFC C;  1XRC A;  3NI2 A;  1N33 C;  1USP A;  4D4G A;  1HNW C;  3UOW A;  4XX2 A;  4ZLP A;  3H2T A;  4DCU A;  3A9U A;  2AYA A;  5K85 A;  2CY1 A;  1XMO C;  2D1T A;  4JV5 C;  1MXA A;  5BUS A;  4FTF A;  3T1Y C;  2D1Q A;  4LF7 C;  2CXC A;  4MH4 A;  1HR0 C;  3R9X A;  4NOZ A;  2HJG A;  1O93 A;  3CW9 A;  1RG9 A;  4JI3 C;  4DV7 C;  3GPC A;  3A9V A;  2KZF A;  3J7A D;  4BC7 A;  4DR7 C;  1XRB A;  3C5E A;  1AMU A;  2D28 C;  4L7I A;  2UXC C;  5KEI A;  4B3M C;  2YCB A;  1FJG C;  2P02 A;  5KYT A;  2V7B A;  5CZV A;  2PRO A;  2EGT A;  2E8C A;  5BUQ A;  5JRH A;  4LF9 C;  2Y27 A;  2ONF A;  2P2F A;  2OPL A;  4KHP C;  1HNZ C;  2P20 A;  4DUY C;  1IBM C;  4LF6 C;  2JMP A;  3ETO A;  1I94 C;  4AQY C;  3OTO C;  1T5H X;  2ASB A;  4LF4 C;  2E8E A;  2E5L C;  2QL8 A;  5AE3 A;  3L95 X;  5BSW A;  1P7L A;  3GR1 A;  4ZJZ A;  1IBL C;  3IEV A;  4GKK C;  1O9T A;  4KTV A;  3EQ6 A;  4GKJ C;  5BSV A;  5KYV A;  2UXD C;  1JOS A;  5A1G A;  4NXN C;  4RVN A;  5H9U A;  3GR0 A;  4MTN A;  4DV6 C;  4LFA C;  4BCA A;  4JI5 C;  2Y4N A;  4R0M A;  4R1M A;  2WD9 A;  3J81 D;  1N2F A;  3E7X A;  3PBK A;  1XMQ C;  3KXW A;  2F4V C;  3S82 A;  3TDE A;  2VSQ A;  5BSU A;  4K0K C;  3A4I A;  3DHV A;  4JI8 C;  3NPD A;  1O90 A;  4K0B A;  4LFB C;  4DR4 C;  3ETC A;  1RY2 A;  1WF3 A;  4DV1 C;  5A2Q D;  4GXQ A;  3IML A;  4RM2 A;  1V26 A;  3PRO C;  5CZX A;  3VNR A;  4GS5 A;  4DV4 C;  1MKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...