4OX9C

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ox9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ox9C02
4LF7C 4MH4A 2VQFC 4JV5C 2BJOA 3R9WA 4JI3C 2E8FA 5IT9D 4DR5C 1HNXC 1NYEA 2D7VA 4NOZA 2OPLB 4JI0C 4DCSA 4KHPC 2UU9C 4NXNC 2F4VC 1ZB9A 3T1HC 1HR0C 1L2FA 1N33C 4B3RC 4JI7C 1IBLC 2UUAC 4JI2C 2UUBC 3I07A 1USPA 2ASBA 4JI4C 5IWAC 4DV2C 3IEUA 4JI8C 4LFBC 3R9XA 1I94C 4X64C 4MTNA 3J81D 4JYAC 1XNRC 1JOSA 3EERA 4DR6C 4DR1C 2CY1A 1HH2P 4DR7C 3J80D 5BR8C 2UXBC 1WH9A 4DR2C 4DV3C 4X65C 4BSZA 4DCUA 1HNZC 3IEVA 4DCVA 2E7GA 5LMUC 1N34C 1WF3A 1K0RA 1KKGA 2PT7G 1ZB8A 1N2FA 1XMQC 2VQEC 4K0KC 3J7AD 1N36C 4JI5C 4OX9C 4LF8C 2QL8A 2XR1A 2E5LC 2EGTA 4DR4C 4B3SC 1QWIA 3T1YC 4JI6C 4B3TC 2UUCC 4DV7C 4YHHC 3CJEA 2KZFA 2OPLA 2ZM6C 4DV5C 4JI1C 3OTOC 1J5EC 4LF5C 1USPB 1XNQC 1N32C 2UXDC 5FLXD 3JAMD 1LQLA 2HHHC 4DV1C 2E8EA 3GKUA 2PN2A 4DUZC 4NXMC 1VLAA 1IBKC 4X62C 4DV0C 4LF9C 2JMPA 4YY3C 2UXCC 2HJGA 2ONFA 2E8CA 4DCTA 3AF5A 1PA4A 4GKKC 4B3MC 2YCBA 1FJGC 3LUSA 2ATWA 4X66C 4DR3C 1XMOC 4DV4C 4XX2A 1EGAA 3AF6A 1IBMC 4DUYC 5LMNC 4DV6C 4GKJC 4LF6C 2CXCA 4AQYC 1UKKA 1MKYA 4LF4C 4LFCC 1ML8A 1HNWC 5A2QD 4LFAC 2DYJA
chains in the Genus database with same CATH superfamily
2YX1A 4MH4A 2E8FA 4K0BA 1NYEA 5T8SA 4KHPC 5BSVA 2P2FA 1MD9A 2UU9C 4NXNC 5CZXA 1HR0C 1N33C 3LAXA 1XRCA 4JI2C 2QW0X 3N2QA 4OYCA 2JNVA 3IEUA 3CQ2A 3UEBA 3LGXA 4HPVA 3R9XA 1I94C 5A19A 4MTNA 3J81D 4JYAC 3C5EA 3L8CA 2YWCA 4RLFA 3TQIA 4DR6C 1IB8A 5BR8C 1WCJA 1T5HX 4D4IA 3ETCA 4PUIA 3S82A 4DCUA 4DCVA 2E7GA 1YGTA 1TH5A 5GTDA 1KKGA 1AMUA 2PT7G 1N2FA 5BSTA 3J7AD 4LF8C 4B3SC 3A4IA 2PROA 4BBYA 4B3TC 4L2ZA 3CJEA 2KZFA 3AY0A 1USPB 4WV3A 3JAMD 1LCIA 2HHHC 4DV1C 2E8EA 1VLAA 1IBKC 2D1TA 5H9UA 4TPSB 2E8CA 5BSUA 4GKKC 2ZZMA 1PG4A 4BC9A 2D1SA 4WS9A 2AYAA 2MMAB 1IBMC 1XS3A 4GS5A 4IR7A 4DV6C 3DAYA 2CXCA 3UZ0A 3G7SA 1MXBA 3I08A 5BSWA 4LFCC 2DYJA 2VQFC 4JV5C 4JI3C 3GR0A 1GPMA 4DR5C 2Y27A 3FM7A 4FTFA 3SO4A 3T1HC 4B3RC 1IBLC 3RG2A 2UUBC 2ASBA 3R44A 4JI4C 4DV2C 1PU1A 1ULTA 5LCIA 3FCCA 4X64C 3RV2A 1XNRC 1JOSA 4KTTA 2VSQA 4DR1C 2Y4NA 2D27A 4KTVA 2UXBC 1WH9A 3UX2A 4DR2C 5K85A 1V25A 1XRAA 3LNOA 2V7BA 5LMUC 4NDNA 1K0RA 4OXIA 4R1MA 1ZB8A 1XMQC 4K0KC 4EATA 2ZZNA 2EGTA 4PHTA 1QWIA 3VNRA 3T1YC 4JI6C 5AE2A 3TR3A 3A9VA 4D4GA 1T5DX 2QVXX 2Z51A 3OTOC 1J5EC 4R1LA 4LF5C 1N32C 5BSMA 3LNVA 1LQLA 3FCEA 1M6XC 4D57A 1XDXA 2YWBA 2HJGA 2ONFA 4RM3A 4PUGA 4RVOA 1PA4A 4RLQA 3B7WA 2YCBA 3LUSA 4DR3C 3A25A 2P02A 1EGAA 4XX2A 3EQ6A 1RG9A 1RY2A 3NYQA 3O2EA 4I9GA 3NYRA 4LF7C 2BJOA 5DV9A 3R9WA 1MDBA 5IT9D 3H2TA 4ZJZA 4RMNA 4JM1A 4DCSA 4RM2A 2OPLB 4JI0C 1PG3A 2F4VC 1L2FA 2NCLA 3N54B 4FUQA 3VNQA 2UUAC 5BURA 3I07A 1FLOA 1USPA 2ZTBA 1O93A 3GPCA 3VNSA 5IWAC 1MXCA 4DG8A 3NPDA 4JI8C 1MXAA 2CU6A 5BUSA 3DLPX 5T8TA 3E7XA 4G37A 2MCQA 2CY1A 1NY8A 3IMLA 1HH2P 4U5YD 3J80D 5AE1A 4DG9A 4L4QA 4X65C 4G36A 1V26A 4LE5A 4BSZA 3IPLA 2DHMA 5A1IA 4GXQA 5BUQA 2QVZX 4FUTA 2P2JA 1WF3A 2VQEC 3KXWA 4JI5C 2M5HA 2QL8A 2XR1A 2E5LC 4DR4C 2UUCC 1MDFA 2QVYX 1XHJA 3E7WA 4D56A 2D1RA 4BC7A 2UXDC 2DPLA 5FLXD 2PN2A 2MM9A 3ETOA 1FUGA 2WD9A 4R0MA 4DV0C 1P4EC 3TUFA 4LF9C 3GR1A 2M5OA 4YY3C 1O9TA 5KYTA 3NI2A 1V60A 2BH1X 5BSRA 1FJGC 3CQ3A 2ATWA 1XMOC 4DV4C 3AF6A 5IFIA 5LMNC 5KEIA 3CQ1A 1XRBA 3UX3A 4LF6C 4LF4C 3TDEA 1HNWC 1ML8A 5A2QD 5CZVA 4LFAC 4I9FA 2PG1E 1HNXC 1QM4A 2WP0C 4NOZA 2D7VA 4G1IA 1O92A 2OO4A 5AE3A 1ZB9A 1P7LA 4JI7C 1P4EA 3DHVA 2P2MA 3UOWA 2P2BA 5E7QA 4RVNA 3PROC 4LFBC 4ODJA 1YJ7A 1BA3A 3EERA 3A9UA 5ADZA 4DR7C 2E0GA 4PROC 3CW8X 4BCAA 4DV3C 1M6XA 5KYVA 4PUHA 1HNZC 3IEVA 1N34C 3K6RA 1VEHA 1N36C 4OX9C 4IZ6A 2VZEA 1O90A 4ZLPA 4DV7C 3CW9A 4YHHC 2KDNA 2OPLA 3A26A 2ZM6C 4DV5C 5JRHA 4JI1C 1XNQC 4L7IA 3GKUA 4DUZC 4NXMC 4X62C 3PBKA 2JMPA 2KZ0A 2UXCC 4ISBA 4DCTA 5A1GA 3AF5A 2P20A 4B3MC 4PZPA 2Y4OA 4X66C 2D28C 5K8FA 4DUYC 4GXRA 1UWDA 3L95X 4GKJC 4AQYC 2OBVA 1UKKA 1MKYA 2D1QA 2P2QA 3PESA
chains in the Genus database with same CATH topology
4MH4A 2E8FA 4K0BA 1NYEA 5T8SA 4KHPC 5BSVA 2P2FA 1MD9A 2UU9C 4NXNC 5CZXA 1HR0C 1N33C 3LAXA 1XRCA 4JI2C 2QW0X 3N2QA 4OYCA 3IEUA 3LGXA 4HPVA 3R9XA 1I94C 5A19A 4MTNA 3J81D 4JYAC 3C5EA 3L8CA 2YWCA 4RLFA 3TQIA 4DR6C 5BR8C 1T5HX 4D4IA 3ETCA 3S82A 4DCUA 4DCVA 2E7GA 5GTDA 1KKGA 1AMUA 2PT7G 1N2FA 5BSTA 3J7AD 4LF8C 4B3SC 3A4IA 2PROA 4BBYA 4B3TC 4L2ZA 3CJEA 2KZFA 1USPB 4WV3A 3JAMD 1LCIA 2HHHC 4DV1C 2E8EA 1VLAA 1IBKC 2D1TA 5H9UA 4TPSB 2E8CA 5BSUA 4GKKC 1PG4A 4BC9A 2D1SA 4WS9A 2AYAA 1IBMC 4GS5A 4IR7A 4DV6C 3DAYA 2CXCA 3UZ0A 3G7SA 1MXBA 3I08A 5BSWA 4LFCC 2DYJA 2VQFC 4JV5C 4JI3C 3GR0A 1GPMA 4DR5C 2Y27A 4FTFA 3SO4A 3T1HC 4B3RC 1IBLC 3RG2A 2UUBC 2ASBA 3R44A 4JI4C 4DV2C 1ULTA 3FCCA 4X64C 3RV2A 1XNRC 1JOSA 4KTTA 2VSQA 4DR1C 2Y4NA 2D27A 4KTVA 2UXBC 4DR2C 1WH9A 5K85A 1V25A 1XRAA 2V7BA 5LMUC 4NDNA 1K0RA 4OXIA 4R1MA 1ZB8A 1XMQC 4K0KC 4EATA 2EGTA 4PHTA 1QWIA 3VNRA 3T1YC 4JI6C 5AE2A 3A9VA 4D4GA 1T5DX 2QVXX 3OTOC 1J5EC 4R1LA 4LF5C 1N32C 5BSMA 3LNVA 1LQLA 3FCEA 4D57A 2YWBA 2HJGA 2ONFA 4RM3A 4RVOA 1PA4A 4RLQA 3B7WA 2YCBA 3LUSA 4DR3C 2P02A 1EGAA 4XX2A 3EQ6A 1RG9A 1RY2A 3NYQA 4I9GA 3NYRA 4LF7C 2BJOA 5DV9A 3R9WA 1MDBA 5IT9D 3H2TA 4ZJZA 4RMNA 4JM1A 4DCSA 4RM2A 2OPLB 4JI0C 1PG3A 2F4VC 1L2FA 3N54B 4FUQA 3VNQA 2UUAC 5BURA 3I07A 1USPA 1O93A 3GPCA 3VNSA 5IWAC 1MXCA 4DG8A 3NPDA 4JI8C 1MXAA 5BUSA 3DLPX 5T8TA 3E7XA 4G37A 2CY1A 3IMLA 1HH2P 4U5YD 3J80D 5AE1A 4DG9A 4L4QA 4X65C 4G36A 1V26A 4LE5A 4BSZA 3IPLA 5A1IA 4GXQA 5BUQA 2QVZX 4FUTA 2P2JA 1WF3A 2VQEC 3KXWA 4JI5C 2QL8A 2XR1A 2E5LC 4DR4C 2UUCC 1MDFA 2QVYX 3E7WA 4D56A 2D1RA 4BC7A 2UXDC 2DPLA 5FLXD 2PN2A 3ETOA 1FUGA 2WD9A 4R0MA 4DV0C 3TUFA 4LF9C 3GR1A 4YY3C 1O9TA 5KYTA 3NI2A 2BH1X 5BSRA 1FJGC 2ATWA 1XMOC 4DV4C 3AF6A 5IFIA 5LMNC 5KEIA 1XRBA 4LF6C 4LF4C 3TDEA 1HNWC 1ML8A 5A2QD 5CZVA 4LFAC 4I9FA 1HNXC 1QM4A 2WP0C 4NOZA 2D7VA 4G1IA 1O92A 2OO4A 5AE3A 1ZB9A 1P7LA 4JI7C 3DHVA 2P2MA 3UOWA 2P2BA 5E7QA 4RVNA 3PROC 4LFBC 4ODJA 1YJ7A 1BA3A 3EERA 3A9UA 5ADZA 4DR7C 2E0GA 4PROC 3CW8X 4BCAA 4DV3C 5KYVA 3IEVA 1HNZC 1N34C 1N36C 4OX9C 4IZ6A 2VZEA 1O90A 4ZLPA 4DV7C 3CW9A 4YHHC 2OPLA 2ZM6C 4DV5C 5JRHA 4JI1C 1XNQC 4L7IA 3GKUA 4DUZC 4NXMC 4X62C 3PBKA 2JMPA 2UXCC 4ISBA 4DCTA 5A1GA 3AF5A 2P20A 4B3MC 4PZPA 2Y4OA 4X66C 2D28C 5K8FA 4DUYC 4GXRA 3L95X 4GKJC 4AQYC 2OBVA 1UKKA 1MKYA 2D1QA 2P2QA 3PESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 C;  4MH4 A;  2VQF C;  4JV5 C;  2BJO A;  3R9W A;  4JI3 C;  2E8F A;  5IT9 D;  4DR5 C;  1HNX C;  1NYE A;  2D7V A;  4NOZ A;  2OPL B;  4JI0 C;  4DCS A;  4KHP C;  2UU9 C;  4NXN C;  2F4V C;  1ZB9 A;  3T1H C;  1HR0 C;  1L2F A;  1N33 C;  4B3R C;  4JI7 C;  1IBL C;  2UUA C;  4JI2 C;  2UUB C;  3I07 A;  1USP A;  2ASB A;  4JI4 C;  5IWA C;  4DV2 C;  3IEU A;  4JI8 C;  4LFB C;  3R9X A;  1I94 C;  4X64 C;  4MTN A;  3J81 D;  4JYA C;  1XNR C;  1JOS A;  3EER A;  4DR6 C;  4DR1 C;  2CY1 A;  1HH2 P;  4DR7 C;  3J80 D;  5BR8 C;  2UXB C;  1WH9 A;  4DR2 C;  4DV3 C;  4X65 C;  4BSZ A;  4DCU A;  1HNZ C;  3IEV A;  4DCV A;  2E7G A;  5LMU C;  1N34 C;  1WF3 A;  1K0R A;  1KKG A;  2PT7 G;  1ZB8 A;  1N2F A;  1XMQ C;  2VQE C;  4K0K C;  3J7A D;  1N36 C;  4JI5 C;  4OX9 C;  4LF8 C;  2QL8 A;  2XR1 A;  2E5L C;  2EGT A;  4DR4 C;  4B3S C;  1QWI A;  3T1Y C;  4JI6 C;  4B3T C;  2UUC C;  4DV7 C;  4YHH C;  3CJE A;  2KZF A;  2OPL A;  2ZM6 C;  4DV5 C;  4JI1 C;  3OTO C;  1J5E C;  4LF5 C;  1USP B;  1XNQ C;  1N32 C;  2UXD C;  5FLX D;  3JAM D;  1LQL A;  2HHH C;  4DV1 C;  2E8E A;  3GKU A;  2PN2 A;  4DUZ C;  4NXM C;  1VLA A;  1IBK C;  4X62 C;  4DV0 C;  4LF9 C;  2JMP A;  4YY3 C;  2UXC C;  2HJG A;  2ONF A;  2E8C A;  4DCT A;  3AF5 A;  1PA4 A;  4GKK C;  4B3M C;  2YCB A;  1FJG C;  3LUS A;  2ATW A;  4X66 C;  4DR3 C;  1XMO C;  4DV4 C;  4XX2 A;  1EGA A;  3AF6 A;  1IBM C;  4DUY C;  5LMN C;  4DV6 C;  4GKJ C;  4LF6 C;  2CXC A;  4AQY C;  1UKK A;  1MKY A;  4LF4 C;  4LFC C;  1ML8 A;  1HNW C;  5A2Q D;  4LFA C;  2DYJ A; 
#chains in the Genus database with same CATH topology
 2YX1 A;  4MH4 A;  2E8F A;  4K0B A;  1NYE A;  5T8S A;  4KHP C;  5BSV A;  2P2F A;  1MD9 A;  2UU9 C;  4NXN C;  5CZX A;  1HR0 C;  1N33 C;  3LAX A;  1XRC A;  4JI2 C;  2QW0 X;  3N2Q A;  4OYC A;  2JNV A;  3IEU A;  3CQ2 A;  3UEB A;  3LGX A;  4HPV A;  3R9X A;  1I94 C;  5A19 A;  4MTN A;  3J81 D;  4JYA C;  3C5E A;  3L8C A;  2YWC A;  4RLF A;  3TQI A;  4DR6 C;  1IB8 A;  5BR8 C;  1WCJ A;  1T5H X;  4D4I A;  3ETC A;  4PUI A;  3S82 A;  4DCU A;  4DCV A;  2E7G A;  1YGT A;  1TH5 A;  5GTD A;  1KKG A;  1AMU A;  2PT7 G;  1N2F A;  5BST A;  3J7A D;  4LF8 C;  4B3S C;  3A4I A;  2PRO A;  4BBY A;  4B3T C;  4L2Z A;  3CJE A;  2KZF A;  3AY0 A;  1USP B;  4WV3 A;  3JAM D;  1LCI A;  2HHH C;  4DV1 C;  2E8E A;  1VLA A;  1IBK C;  2D1T A;  5H9U A;  4TPS B;  2E8C A;  5BSU A;  4GKK C;  2ZZM A;  1PG4 A;  4BC9 A;  2D1S A;  4WS9 A;  2AYA A;  2MMA B;  1IBM C;  1XS3 A;  4GS5 A;  4IR7 A;  4DV6 C;  3DAY A;  2CXC A;  3UZ0 A;  3G7S A;  1MXB A;  3I08 A;  5BSW A;  4LFC C;  2DYJ A;  2VQF C;  4JV5 C;  4JI3 C;  3GR0 A;  1GPM A;  4DR5 C;  2Y27 A;  3FM7 A;  4FTF A;  3SO4 A;  3T1H C;  4B3R C;  1IBL C;  3RG2 A;  2UUB C;  2ASB A;  3R44 A;  4JI4 C;  4DV2 C;  1PU1 A;  1ULT A;  5LCI A;  3FCC A;  4X64 C;  3RV2 A;  1XNR C;  1JOS A;  4KTT A;  2VSQ A;  4DR1 C;  2Y4N A;  2D27 A;  4KTV A;  2UXB C;  1WH9 A;  3UX2 A;  4DR2 C;  5K85 A;  1V25 A;  1XRA A;  3LNO A;  2V7B A;  5LMU C;  4NDN A;  1K0R A;  4OXI A;  4R1M A;  1ZB8 A;  1XMQ C;  4K0K C;  4EAT A;  2ZZN A;  2EGT A;  4PHT A;  1QWI A;  3VNR A;  3T1Y C;  4JI6 C;  5AE2 A;  3TR3 A;  3A9V A;  4D4G A;  1T5D X;  2QVX X;  2Z51 A;  3OTO C;  1J5E C;  4R1L A;  4LF5 C;  1N32 C;  5BSM A;  3LNV A;  1LQL A;  3FCE A;  1M6X C;  4D57 A;  1XDX A;  2YWB A;  2HJG A;  2ONF A;  4RM3 A;  4PUG A;  4RVO A;  1PA4 A;  4RLQ A;  3B7W A;  2YCB A;  3LUS A;  4DR3 C;  3A25 A;  2P02 A;  1EGA A;  4XX2 A;  3EQ6 A;  1RG9 A;  1RY2 A;  3NYQ A;  3O2E A;  4I9G A;  3NYR A;  4LF7 C;  2BJO A;  5DV9 A;  3R9W A;  1MDB A;  5IT9 D;  3H2T A;  4ZJZ A;  4RMN A;  4JM1 A;  4DCS A;  4RM2 A;  2OPL B;  4JI0 C;  1PG3 A;  2F4V C;  1L2F A;  2NCL A;  3N54 B;  4FUQ A;  3VNQ A;  2UUA C;  5BUR A;  3I07 A;  1FLO A;  1USP A;  2ZTB A;  1O93 A;  3GPC A;  3VNS A;  5IWA C;  1MXC A;  4DG8 A;  3NPD A;  4JI8 C;  1MXA A;  2CU6 A;  5BUS A;  3DLP X;  5T8T A;  3E7X A;  4G37 A;  2MCQ A;  2CY1 A;  1NY8 A;  3IML A;  1HH2 P;  4U5Y D;  3J80 D;  5AE1 A;  4DG9 A;  4L4Q A;  4X65 C;  4G36 A;  1V26 A;  4LE5 A;  4BSZ A;  3IPL A;  2DHM A;  5A1I A;  4GXQ A;  5BUQ A;  2QVZ X;  4FUT A;  2P2J A;  1WF3 A;  2VQE C;  3KXW A;  4JI5 C;  2M5H A;  2QL8 A;  2XR1 A;  2E5L C;  4DR4 C;  2UUC C;  1MDF A;  2QVY X;  1XHJ A;  3E7W A;  4D56 A;  2D1R A;  4BC7 A;  2UXD C;  2DPL A;  5FLX D;  2PN2 A;  2MM9 A;  3ETO A;  1FUG A;  2WD9 A;  4R0M A;  4DV0 C;  1P4E C;  3TUF A;  4LF9 C;  3GR1 A;  2M5O A;  4YY3 C;  1O9T A;  5KYT A;  3NI2 A;  1V60 A;  2BH1 X;  5BSR A;  1FJG C;  3CQ3 A;  2ATW A;  1XMO C;  4DV4 C;  3AF6 A;  5IFI A;  5LMN C;  5KEI A;  3CQ1 A;  1XRB A;  3UX3 A;  4LF6 C;  4LF4 C;  3TDE A;  1HNW C;  1ML8 A;  5A2Q D;  5CZV A;  4LFA C;  4I9F A;  2PG1 E;  1HNX C;  1QM4 A;  2WP0 C;  4NOZ A;  2D7V A;  4G1I A;  1O92 A;  2OO4 A;  5AE3 A;  1ZB9 A;  1P7L A;  4JI7 C;  1P4E A;  3DHV A;  2P2M A;  3UOW A;  2P2B A;  5E7Q A;  4RVN A;  3PRO C;  4LFB C;  4ODJ A;  1YJ7 A;  1BA3 A;  3EER A;  3A9U A;  5ADZ A;  4DR7 C;  2E0G A;  4PRO C;  3CW8 X;  4BCA A;  4DV3 C;  1M6X A;  5KYV A;  4PUH A;  1HNZ C;  3IEV A;  1N34 C;  3K6R A;  1VEH A;  1N36 C;  4OX9 C;  4IZ6 A;  2VZE A;  1O90 A;  4ZLP A;  4DV7 C;  3CW9 A;  4YHH C;  2KDN A;  2OPL A;  3A26 A;  2ZM6 C;  4DV5 C;  5JRH A;  4JI1 C;  1XNQ C;  4L7I A;  3GKU A;  4DUZ C;  4NXM C;  4X62 C;  3PBK A;  2JMP A;  2KZ0 A;  2UXC C;  4ISB A;  4DCT A;  5A1G A;  3AF5 A;  2P20 A;  4B3M C;  4PZP A;  2Y4O A;  4X66 C;  2D28 C;  5K8F A;  4DUY C;  4GXR A;  1UWD A;  3L95 X;  4GKJ C;  4AQY C;  2OBV A;  1UKK A;  1MKY A;  2D1Q A;  2P2Q A;  3PES A; 
#chains in the Genus database with same CATH homology
 4MH4 A;  2E8F A;  4K0B A;  1NYE A;  5T8S A;  4KHP C;  5BSV A;  2P2F A;  1MD9 A;  2UU9 C;  4NXN C;  5CZX A;  1HR0 C;  1N33 C;  3LAX A;  1XRC A;  4JI2 C;  2QW0 X;  3N2Q A;  4OYC A;  3IEU A;  3LGX A;  4HPV A;  3R9X A;  1I94 C;  5A19 A;  4MTN A;  3J81 D;  4JYA C;  3C5E A;  3L8C A;  2YWC A;  4RLF A;  3TQI A;  4DR6 C;  5BR8 C;  1T5H X;  4D4I A;  3ETC A;  3S82 A;  4DCU A;  4DCV A;  2E7G A;  5GTD A;  1KKG A;  1AMU A;  2PT7 G;  1N2F A;  5BST A;  3J7A D;  4LF8 C;  4B3S C;  3A4I A;  2PRO A;  4BBY A;  4B3T C;  4L2Z A;  3CJE A;  2KZF A;  1USP B;  4WV3 A;  3JAM D;  1LCI A;  2HHH C;  4DV1 C;  2E8E A;  1VLA A;  1IBK C;  2D1T A;  5H9U A;  4TPS B;  2E8C A;  5BSU A;  4GKK C;  1PG4 A;  4BC9 A;  2D1S A;  4WS9 A;  2AYA A;  1IBM C;  4GS5 A;  4IR7 A;  4DV6 C;  3DAY A;  2CXC A;  3UZ0 A;  3G7S A;  1MXB A;  3I08 A;  5BSW A;  4LFC C;  2DYJ A;  2VQF C;  4JV5 C;  4JI3 C;  3GR0 A;  1GPM A;  4DR5 C;  2Y27 A;  4FTF A;  3SO4 A;  3T1H C;  4B3R C;  1IBL C;  3RG2 A;  2UUB C;  2ASB A;  3R44 A;  4JI4 C;  4DV2 C;  1ULT A;  3FCC A;  4X64 C;  3RV2 A;  1XNR C;  1JOS A;  4KTT A;  2VSQ A;  4DR1 C;  2Y4N A;  2D27 A;  4KTV A;  2UXB C;  4DR2 C;  1WH9 A;  5K85 A;  1V25 A;  1XRA A;  2V7B A;  5LMU C;  4NDN A;  1K0R A;  4OXI A;  4R1M A;  1ZB8 A;  1XMQ C;  4K0K C;  4EAT A;  2EGT A;  4PHT A;  1QWI A;  3VNR A;  3T1Y C;  4JI6 C;  5AE2 A;  3A9V A;  4D4G A;  1T5D X;  2QVX X;  3OTO C;  1J5E C;  4R1L A;  4LF5 C;  1N32 C;  5BSM A;  3LNV A;  1LQL A;  3FCE A;  4D57 A;  2YWB A;  2HJG A;  2ONF A;  4RM3 A;  4RVO A;  1PA4 A;  4RLQ A;  3B7W A;  2YCB A;  3LUS A;  4DR3 C;  2P02 A;  1EGA A;  4XX2 A;  3EQ6 A;  1RG9 A;  1RY2 A;  3NYQ A;  4I9G A;  3NYR A;  4LF7 C;  2BJO A;  5DV9 A;  3R9W A;  1MDB A;  5IT9 D;  3H2T A;  4ZJZ A;  4RMN A;  4JM1 A;  4DCS A;  4RM2 A;  2OPL B;  4JI0 C;  1PG3 A;  2F4V C;  1L2F A;  3N54 B;  4FUQ A;  3VNQ A;  2UUA C;  5BUR A;  3I07 A;  1USP A;  1O93 A;  3GPC A;  3VNS A;  5IWA C;  1MXC A;  4DG8 A;  3NPD A;  4JI8 C;  1MXA A;  5BUS A;  3DLP X;  5T8T A;  3E7X A;  4G37 A;  2CY1 A;  3IML A;  1HH2 P;  4U5Y D;  3J80 D;  5AE1 A;  4DG9 A;  4L4Q A;  4X65 C;  4G36 A;  1V26 A;  4LE5 A;  4BSZ A;  3IPL A;  5A1I A;  4GXQ A;  5BUQ A;  2QVZ X;  4FUT A;  2P2J A;  1WF3 A;  2VQE C;  3KXW A;  4JI5 C;  2QL8 A;  2XR1 A;  2E5L C;  4DR4 C;  2UUC C;  1MDF A;  2QVY X;  3E7W A;  4D56 A;  2D1R A;  4BC7 A;  2UXD C;  2DPL A;  5FLX D;  2PN2 A;  3ETO A;  1FUG A;  2WD9 A;  4R0M A;  4DV0 C;  3TUF A;  4LF9 C;  3GR1 A;  4YY3 C;  1O9T A;  5KYT A;  3NI2 A;  2BH1 X;  5BSR A;  1FJG C;  2ATW A;  1XMO C;  4DV4 C;  3AF6 A;  5IFI A;  5LMN C;  5KEI A;  1XRB A;  4LF6 C;  4LF4 C;  3TDE A;  1HNW C;  1ML8 A;  5A2Q D;  5CZV A;  4LFA C;  4I9F A;  1HNX C;  1QM4 A;  2WP0 C;  4NOZ A;  2D7V A;  4G1I A;  1O92 A;  2OO4 A;  5AE3 A;  1ZB9 A;  1P7L A;  4JI7 C;  3DHV A;  2P2M A;  3UOW A;  2P2B A;  5E7Q A;  4RVN A;  3PRO C;  4LFB C;  4ODJ A;  1YJ7 A;  1BA3 A;  3EER A;  3A9U A;  5ADZ A;  4DR7 C;  2E0G A;  4PRO C;  3CW8 X;  4BCA A;  4DV3 C;  5KYV A;  3IEV A;  1HNZ C;  1N34 C;  1N36 C;  4OX9 C;  4IZ6 A;  2VZE A;  1O90 A;  4ZLP A;  4DV7 C;  3CW9 A;  4YHH C;  2OPL A;  2ZM6 C;  4DV5 C;  5JRH A;  4JI1 C;  1XNQ C;  4L7I A;  3GKU A;  4DUZ C;  4NXM C;  4X62 C;  3PBK A;  2JMP A;  2UXC C;  4ISB A;  4DCT A;  5A1G A;  3AF5 A;  2P20 A;  4B3M C;  4PZP A;  2Y4O A;  4X66 C;  2D28 C;  5K8F A;  4DUY C;  4GXR A;  3L95 X;  4GKJ C;  4AQY C;  2OBV A;  1UKK A;  1MKY A;  2D1Q A;  2P2Q A;  3PES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...