4OX9C

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ox9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ox9C02
1N34C 1USPA 4JI1C 3IEUA 4DV3C 4DUYC 4B3TC 1HNZC 2D7VA 2OPLB 1LQLA 3LUSA 1HNWC 2VQFC 2PT7G 4JV5C 5LMNC 4BSZA 1N33C 5IWAC 4JI7C 5LMUC 1I94C 1HR0C 2UXDC 1N2FA 1WH9A 3T1YC 2OPLA 5FLXD 2PN2A 2DYJA 1K0RA 1ZB8A 4DR7C 4DV4C 4YY3C 4X62C 1HNXC 2UU9C 2E8FA 4DR1C 1IBKC 4DR3C 3GKUA 2YCBA 4X65C 4JI0C 1ML8A 4JI5C 4XX2A 4LF6C 3JAMD 4DR6C 4DV6C 4MTNA 4DV1C 5BR8C 4DUZC 2E7GA 4LFCC 3CJEA 3I07A 4JI2C 4KHPC 4LFBC 1IBLC 4DR2C 2E5LC 1MKYA 4B3SC 2ONFA 2VQEC 4LF4C 1HH2P 3AF6A 4DCUA 2BJOA 4NOZA 4MH4A 4JI8C 4DR4C 4DV2C 1XMQC 3J81D 1IBMC 4JI6C 3R9WA 4DV0C 1ZB9A 4X66C 2ASBA 4DCTA 2CY1A 3EERA 2CXCA 3J7AD 4DCSA 5A2QD 2KZFA 4LF8C 4JI4C 1L2FA 4LF9C 4LF7C 4K0KC 1WF3A 4B3MC 2UXBC 4LFAC 4NXNC 2UXCC 2QL8A 1XMOC 2XR1A 4YHHC 2UUCC 4GKJC 3OTOC 1EGAA 4JYAC 1N36C 3R9XA 1N32C 4DV5C 2ZM6C 2HJGA 1UKKA 3AF5A 2JMPA 5IT9D 1KKGA 4DR5C 1PA4A 3IEVA 4LF5C 4AQYC 1QWIA 1XNRC 2HHHC 4DV7C 4NXMC 4B3RC 1JOSA 1NYEA 4JI3C 4OX9C 1FJGC 1USPB 2E8EA 2E8CA 2UUBC 1XNQC 1J5EC 2ATWA 2UUAC 3J80D 2F4VC 4X64C 1VLAA 3T1HC 2EGTA 4DCVA 4GKKC
chains in the Genus database with same CATH superfamily
2JNVA 1BA3A 3H2TA 2D28C 3IEUA 4RLFA 5K85A 1HNZC 2QVYX 2OPLB 5LMNC 3ETCA 3LNVA 1PG3A 1I94C 3NPDA 4RVOA 2OPLA 5JRHA 3FCCA 3UOWA 4JI0C 2P02A 2OBVA 1V25A 4DV1C 4DUZC 3RV2A 4I9FA 1IBLC 1MKYA 4B3SC 2D1RA 3DLPX 3S82A 3NI2A 4DV0C 4X66C 5KEIA 1YGTA 1VEHA 5IFIA 2D1SA 2P2JA 4DG9A 4LF9C 1LCIA 4DG8A 4B3MC 5T8SA 2UXBC 5E7QA 2UXCC 1FUGA 1YJ7A 2YWBA 4RLQA 2M5OA 1XMOC 3NYRA 1MXAA 3A26A 1P7LA 3VNSA 4GXRA 3A4IA 2JMPA 4DR5C 3CQ2A 1QWIA 1T5DX 1NY8A 1GPMA 4OYCA 4JI3C 2DPLA 4RM3A 2ATWA 4OXIA 2EGTA 1N34C 1RY2A 2Y4OA 4DUYC 1O9TA 4D4IA 2D7VA 4R1LA 1HNWC 4PUGA 4PROC 1N33C 5BSWA 4IR7A 3UEBA 2PN2A 2WP0C 1ZB8A 4DR3C 5H9UA 4X65C 2YCBA 4JI5C 3TUFA 4DR6C 2BH1X 2KDNA 5BUSA 3UX3A 3GR1A 2CU6A 1XS3A 4LFCC 3CJEA 3I07A 4JI2C 4TPSB 2VQEC 2MM9A 5BSUA 4ISBA 2QVXX 4LE5A 4JI8C 4DR4C 4DV2C 1XMQC 5A19A 3R9WA 4G1IA 3R44A 3EERA 5BSVA 2CXCA 4LF8C 1L2FA 1T5HX 4K0KC 3GPCA 4LFAC 4NXNC 1MDBA 2QL8A 4I9GA 1MXBA 5BSMA 2Y27A 3L8CA 3N2QA 1EGAA 3E7WA 3SO4A 1TH5A 4PZPA 4ZJZA 2MCQA 1KKGA 1PA4A 4LF5C 3PBKA 4DV7C 2D1TA 4B3RC 1JOSA 2QVZX 4PHTA 1USPB 2P20A 1XNQC 2PG1E 5BURA 2UUAC 3PESA 3AY0A 3UX2A 4IZ6A 4X64C 2ZZMA 3ETOA 3G7SA 1USPA 2M5HA 3VNQA 4B3TC 4GS5A 2D1QA 1XHJA 5KYVA 5LCIA 3LUSA 2VQFC 1XRAA 2PT7G 4ODJA 3UZ0A 3CQ1A 4BSZA 3RG2A 2P2QA 5IWAC 4JI7C 1HR0C 2UXDC 2P2FA 1WH9A 2NCLA 2MMAB 2DYJA 3N54B 3LNOA 1O90A 4YY3C 4X62C 1HNXC 2UU9C 2KZ0A 2E8FA 2DHMA 4WS9A 4DR1C 1IBKC 3GKUA 2Y4NA 4XX2A 4DV6C 4D57A 2E7GA 1PU1A 4FUQA 5A1IA 4KHPC 4LFBC 2PROA 4DR2C 2E5LC 2VSQA 1XRCA 4KTVA 5DV9A 4DCUA 3I08A 2BJOA 3A9VA 1AMUA 1ZB9A 5AE1A 4DCTA 5BSTA 1P4EA 4DCSA 5A2QD 2KZFA 5GTDA 4JI4C 3IMLA 3EQ6A 3FCEA 2P2BA 3A9UA 4BBYA 2P2MA 2UUCC 2D27A 4JYAC 1PG4A 3R9XA 1N32C 4DV5C 2ZM6C 2VZEA 2HJGA 1UKKA 3AF5A 1MD9A 5CZXA 1P4EC 5T8TA 3L95X 1XNRC 5AE2A 1RG9A 2E8EA 2E8CA 1XDXA 2UUBC 3KXWA 1J5EC 4FTFA 3TQIA 3J80D 4GXQA 4HPVA 4G36A 3GR0A 4FUTA 3T1HC 4DCVA 3PROC 2WD9A 4JI1C 4DV3C 3IPLA 3NYQA 1O92A 4BC7A 3C5EA 2Z51A 4WV3A 1LQLA 3VNRA 4JV5C 1IB8A 3E7XA 5LMUC 1FLOA 3FM7A 1N2FA 3T1YC 3O2EA 5FLXD 5BUQA 1O93A 1K0RA 4DR7C 3CW8X 4DV4C 5K8FA 1MDFA 1UWDA 3TDEA 1MXCA 4RMNA 1ML8A 4EATA 4LF6C 3JAMD 4MTNA 4JM1A 2ZZNA 3TR3A 4KTTA 5BR8C 4PUHA 4BC9A 4NDNA 1WCJA 2ONFA 3DHVA 1ULTA 5CZVA 2OO4A 4LF4C 1HH2P 3AF6A 5ADZA 3A25A 2AYAA 3LGXA 4R0MA 4K0BA 4RM2A 4BCAA 4NOZA 4MH4A 2ZTBA 2YX1A 3J81D 1IBMC 4JI6C 2V7BA 3B7WA 4D56A 4D4GA 2ASBA 4RVNA 3DAYA 2CY1A 2QW0X 3J7AD 5BSRA 4L4QA 2E0GA 4LF7C 1WF3A 4G37A 1M6XA 1XRBA 3LAXA 2XR1A 1V60A 4YHHC 4R1MA 4GKJC 3OTOC 4L2ZA 1QM4A 1N36C 3K6RA 4U5YD 4ZLPA 4PUIA 1V26A 4L7IA 3CQ3A 5IT9D 5AE3A 2YWCA 3IEVA 4AQYC 2HHHC 4NXMC 4OX9C 1NYEA 5A1GA 5KYTA 1M6XC 1FJGC 2F4VC 3CW9A 1VLAA 4GKKC
chains in the Genus database with same CATH topology
1BA3A 3H2TA 2D28C 3IEUA 4RLFA 5K85A 1HNZC 2QVYX 2OPLB 5LMNC 3ETCA 3LNVA 1PG3A 1I94C 3NPDA 4RVOA 2OPLA 5JRHA 3FCCA 3UOWA 4JI0C 2P02A 2OBVA 1V25A 4DV1C 4DUZC 3RV2A 4I9FA 1IBLC 1MKYA 4B3SC 2D1RA 3DLPX 3S82A 3NI2A 4DV0C 4X66C 5KEIA 5IFIA 2D1SA 2P2JA 4DG9A 4LF9C 1LCIA 4DG8A 4B3MC 5T8SA 2UXBC 5E7QA 2UXCC 1FUGA 1YJ7A 2YWBA 4RLQA 1XMOC 3NYRA 1MXAA 1P7LA 3VNSA 4GXRA 3A4IA 2JMPA 4DR5C 1QWIA 1T5DX 1GPMA 4OYCA 4JI3C 2DPLA 4RM3A 2ATWA 4OXIA 2EGTA 1N34C 1RY2A 2Y4OA 4DUYC 1O9TA 4D4IA 2D7VA 4R1LA 1HNWC 4PROC 1N33C 5BSWA 4IR7A 2PN2A 2WP0C 1ZB8A 4DR3C 5H9UA 4X65C 2YCBA 4JI5C 3TUFA 4DR6C 2BH1X 5BUSA 3GR1A 4LFCC 3CJEA 3I07A 4JI2C 4TPSB 2VQEC 5BSUA 4ISBA 2QVXX 4LE5A 4JI8C 4DR4C 4DV2C 1XMQC 5A19A 3R9WA 4G1IA 3R44A 3EERA 5BSVA 2CXCA 4LF8C 1L2FA 1T5HX 4K0KC 3GPCA 4LFAC 4NXNC 1MDBA 2QL8A 4I9GA 1MXBA 5BSMA 2Y27A 3L8CA 3N2QA 1EGAA 3E7WA 3SO4A 4PZPA 4ZJZA 1KKGA 1PA4A 4LF5C 3PBKA 4DV7C 2D1TA 4B3RC 1JOSA 2QVZX 4PHTA 1USPB 2P20A 1XNQC 5BURA 2UUAC 4X64C 3PESA 4IZ6A 3ETOA 3G7SA 1USPA 3VNQA 4B3TC 4GS5A 2D1QA 5KYVA 3LUSA 2VQFC 1XRAA 2PT7G 4ODJA 3UZ0A 4BSZA 3RG2A 2P2QA 5IWAC 4JI7C 1HR0C 2UXDC 2P2FA 1WH9A 2DYJA 3N54B 1O90A 4YY3C 4X62C 1HNXC 2UU9C 2E8FA 4DR1C 4WS9A 1IBKC 3GKUA 2Y4NA 4XX2A 4DV6C 4D57A 2E7GA 4FUQA 5A1IA 4KHPC 4LFBC 2PROA 4DR2C 2E5LC 2VSQA 1XRCA 4KTVA 5DV9A 4DCUA 3I08A 2BJOA 3A9VA 1AMUA 1ZB9A 5AE1A 4DCTA 5BSTA 4DCSA 5A2QD 2KZFA 5GTDA 4JI4C 3IMLA 3EQ6A 3FCEA 2P2BA 3A9UA 4BBYA 2P2MA 2UUCC 2D27A 4JYAC 1PG4A 3R9XA 1N32C 4DV5C 2ZM6C 2VZEA 2HJGA 1UKKA 3AF5A 1MD9A 5CZXA 5T8TA 3L95X 1XNRC 5AE2A 1RG9A 2E8EA 2E8CA 2UUBC 3KXWA 1J5EC 4FTFA 3TQIA 3J80D 4GXQA 4HPVA 4G36A 3GR0A 4FUTA 3T1HC 4DCVA 3PROC 2WD9A 4JI1C 4DV3C 3IPLA 3NYQA 1O92A 4BC7A 3C5EA 4WV3A 1LQLA 3VNRA 4JV5C 3E7XA 5LMUC 1N2FA 3T1YC 5FLXD 5BUQA 1O93A 1K0RA 4DR7C 3CW8X 4DV4C 5K8FA 1MDFA 3TDEA 1MXCA 4RMNA 1ML8A 4EATA 4LF6C 3JAMD 4MTNA 4JM1A 4KTTA 5BR8C 4BC9A 4NDNA 2ONFA 3DHVA 1ULTA 5CZVA 2OO4A 4LF4C 1HH2P 3AF6A 5ADZA 2AYAA 3LGXA 4R0MA 4K0BA 4RM2A 4BCAA 4NOZA 4MH4A 3J81D 1IBMC 4JI6C 2V7BA 3B7WA 4D56A 4D4GA 2ASBA 4RVNA 3DAYA 2CY1A 2QW0X 3J7AD 5BSRA 4L4QA 2E0GA 4LF7C 1WF3A 4G37A 1XRBA 3LAXA 2XR1A 4YHHC 4R1MA 4GKJC 3OTOC 4L2ZA 1QM4A 1N36C 4U5YD 4ZLPA 1V26A 4L7IA 5IT9D 5AE3A 2YWCA 3IEVA 4AQYC 2HHHC 4NXMC 4OX9C 1NYEA 5A1GA 5KYTA 1FJGC 2F4VC 3CW9A 1VLAA 4GKKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 C;  1USP A;  4JI1 C;  3IEU A;  4DV3 C;  4DUY C;  4B3T C;  1HNZ C;  2D7V A;  2OPL B;  1LQL A;  3LUS A;  1HNW C;  2VQF C;  2PT7 G;  4JV5 C;  5LMN C;  4BSZ A;  1N33 C;  5IWA C;  4JI7 C;  5LMU C;  1I94 C;  1HR0 C;  2UXD C;  1N2F A;  1WH9 A;  3T1Y C;  2OPL A;  5FLX D;  2PN2 A;  2DYJ A;  1K0R A;  1ZB8 A;  4DR7 C;  4DV4 C;  4YY3 C;  4X62 C;  1HNX C;  2UU9 C;  2E8F A;  4DR1 C;  1IBK C;  4DR3 C;  3GKU A;  2YCB A;  4X65 C;  4JI0 C;  1ML8 A;  4JI5 C;  4XX2 A;  4LF6 C;  3JAM D;  4DR6 C;  4DV6 C;  4MTN A;  4DV1 C;  5BR8 C;  4DUZ C;  2E7G A;  4LFC C;  3CJE A;  3I07 A;  4JI2 C;  4KHP C;  4LFB C;  1IBL C;  4DR2 C;  2E5L C;  1MKY A;  4B3S C;  2ONF A;  2VQE C;  4LF4 C;  1HH2 P;  3AF6 A;  4DCU A;  2BJO A;  4NOZ A;  4MH4 A;  4JI8 C;  4DR4 C;  4DV2 C;  1XMQ C;  3J81 D;  1IBM C;  4JI6 C;  3R9W A;  4DV0 C;  1ZB9 A;  4X66 C;  2ASB A;  4DCT A;  2CY1 A;  3EER A;  2CXC A;  3J7A D;  4DCS A;  5A2Q D;  2KZF A;  4LF8 C;  4JI4 C;  1L2F A;  4LF9 C;  4LF7 C;  4K0K C;  1WF3 A;  4B3M C;  2UXB C;  4LFA C;  4NXN C;  2UXC C;  2QL8 A;  1XMO C;  2XR1 A;  4YHH C;  2UUC C;  4GKJ C;  3OTO C;  1EGA A;  4JYA C;  1N36 C;  3R9X A;  1N32 C;  4DV5 C;  2ZM6 C;  2HJG A;  1UKK A;  3AF5 A;  2JMP A;  5IT9 D;  1KKG A;  4DR5 C;  1PA4 A;  3IEV A;  4LF5 C;  4AQY C;  1QWI A;  1XNR C;  2HHH C;  4DV7 C;  4NXM C;  4B3R C;  1JOS A;  1NYE A;  4JI3 C;  4OX9 C;  1FJG C;  1USP B;  2E8E A;  2E8C A;  2UUB C;  1XNQ C;  1J5E C;  2ATW A;  2UUA C;  3J80 D;  2F4V C;  4X64 C;  1VLA A;  3T1H C;  2EGT A;  4DCV A;  4GKK C; 
#chains in the Genus database with same CATH topology
 2JNV A;  1BA3 A;  3H2T A;  2D28 C;  3IEU A;  4RLF A;  5K85 A;  1HNZ C;  2QVY X;  2OPL B;  5LMN C;  3ETC A;  3LNV A;  1PG3 A;  1I94 C;  3NPD A;  4RVO A;  2OPL A;  5JRH A;  3FCC A;  3UOW A;  4JI0 C;  2P02 A;  2OBV A;  1V25 A;  4DV1 C;  4DUZ C;  3RV2 A;  4I9F A;  1IBL C;  1MKY A;  4B3S C;  2D1R A;  3DLP X;  3S82 A;  3NI2 A;  4DV0 C;  4X66 C;  5KEI A;  1YGT A;  1VEH A;  5IFI A;  2D1S A;  2P2J A;  4DG9 A;  4LF9 C;  1LCI A;  4DG8 A;  4B3M C;  5T8S A;  2UXB C;  5E7Q A;  2UXC C;  1FUG A;  1YJ7 A;  2YWB A;  4RLQ A;  2M5O A;  1XMO C;  3NYR A;  1MXA A;  3A26 A;  1P7L A;  3VNS A;  4GXR A;  3A4I A;  2JMP A;  4DR5 C;  3CQ2 A;  1QWI A;  1T5D X;  1NY8 A;  1GPM A;  4OYC A;  4JI3 C;  2DPL A;  4RM3 A;  2ATW A;  4OXI A;  2EGT A;  1N34 C;  1RY2 A;  2Y4O A;  4DUY C;  1O9T A;  4D4I A;  2D7V A;  4R1L A;  1HNW C;  4PUG A;  4PRO C;  1N33 C;  5BSW A;  4IR7 A;  3UEB A;  2PN2 A;  2WP0 C;  1ZB8 A;  4DR3 C;  5H9U A;  4X65 C;  2YCB A;  4JI5 C;  3TUF A;  4DR6 C;  2BH1 X;  2KDN A;  5BUS A;  3UX3 A;  3GR1 A;  2CU6 A;  1XS3 A;  4LFC C;  3CJE A;  3I07 A;  4JI2 C;  4TPS B;  2VQE C;  2MM9 A;  5BSU A;  4ISB A;  2QVX X;  4LE5 A;  4JI8 C;  4DR4 C;  4DV2 C;  1XMQ C;  5A19 A;  3R9W A;  4G1I A;  3R44 A;  3EER A;  5BSV A;  2CXC A;  4LF8 C;  1L2F A;  1T5H X;  4K0K C;  3GPC A;  4LFA C;  4NXN C;  1MDB A;  2QL8 A;  4I9G A;  1MXB A;  5BSM A;  2Y27 A;  3L8C A;  3N2Q A;  1EGA A;  3E7W A;  3SO4 A;  1TH5 A;  4PZP A;  4ZJZ A;  2MCQ A;  1KKG A;  1PA4 A;  4LF5 C;  3PBK A;  4DV7 C;  2D1T A;  4B3R C;  1JOS A;  2QVZ X;  4PHT A;  1USP B;  2P20 A;  1XNQ C;  2PG1 E;  5BUR A;  2UUA C;  3PES A;  3AY0 A;  3UX2 A;  4IZ6 A;  4X64 C;  2ZZM A;  3ETO A;  3G7S A;  1USP A;  2M5H A;  3VNQ A;  4B3T C;  4GS5 A;  2D1Q A;  1XHJ A;  5KYV A;  5LCI A;  3LUS A;  2VQF C;  1XRA A;  2PT7 G;  4ODJ A;  3UZ0 A;  3CQ1 A;  4BSZ A;  3RG2 A;  2P2Q A;  5IWA C;  4JI7 C;  1HR0 C;  2UXD C;  2P2F A;  1WH9 A;  2NCL A;  2MMA B;  2DYJ A;  3N54 B;  3LNO A;  1O90 A;  4YY3 C;  4X62 C;  1HNX C;  2UU9 C;  2KZ0 A;  2E8F A;  2DHM A;  4WS9 A;  4DR1 C;  1IBK C;  3GKU A;  2Y4N A;  4XX2 A;  4DV6 C;  4D57 A;  2E7G A;  1PU1 A;  4FUQ A;  5A1I A;  4KHP C;  4LFB C;  2PRO A;  4DR2 C;  2E5L C;  2VSQ A;  1XRC A;  4KTV A;  5DV9 A;  4DCU A;  3I08 A;  2BJO A;  3A9V A;  1AMU A;  1ZB9 A;  5AE1 A;  4DCT A;  5BST A;  1P4E A;  4DCS A;  5A2Q D;  2KZF A;  5GTD A;  4JI4 C;  3IML A;  3EQ6 A;  3FCE A;  2P2B A;  3A9U A;  4BBY A;  2P2M A;  2UUC C;  2D27 A;  4JYA C;  1PG4 A;  3R9X A;  1N32 C;  4DV5 C;  2ZM6 C;  2VZE A;  2HJG A;  1UKK A;  3AF5 A;  1MD9 A;  5CZX A;  1P4E C;  5T8T A;  3L95 X;  1XNR C;  5AE2 A;  1RG9 A;  2E8E A;  2E8C A;  1XDX A;  2UUB C;  3KXW A;  1J5E C;  4FTF A;  3TQI A;  3J80 D;  4GXQ A;  4HPV A;  4G36 A;  3GR0 A;  4FUT A;  3T1H C;  4DCV A;  3PRO C;  2WD9 A;  4JI1 C;  4DV3 C;  3IPL A;  3NYQ A;  1O92 A;  4BC7 A;  3C5E A;  2Z51 A;  4WV3 A;  1LQL A;  3VNR A;  4JV5 C;  1IB8 A;  3E7X A;  5LMU C;  1FLO A;  3FM7 A;  1N2F A;  3T1Y C;  3O2E A;  5FLX D;  5BUQ A;  1O93 A;  1K0R A;  4DR7 C;  3CW8 X;  4DV4 C;  5K8F A;  1MDF A;  1UWD A;  3TDE A;  1MXC A;  4RMN A;  1ML8 A;  4EAT A;  4LF6 C;  3JAM D;  4MTN A;  4JM1 A;  2ZZN A;  3TR3 A;  4KTT A;  5BR8 C;  4PUH A;  4BC9 A;  4NDN A;  1WCJ A;  2ONF A;  3DHV A;  1ULT A;  5CZV A;  2OO4 A;  4LF4 C;  1HH2 P;  3AF6 A;  5ADZ A;  3A25 A;  2AYA A;  3LGX A;  4R0M A;  4K0B A;  4RM2 A;  4BCA A;  4NOZ A;  4MH4 A;  2ZTB A;  2YX1 A;  3J81 D;  1IBM C;  4JI6 C;  2V7B A;  3B7W A;  4D56 A;  4D4G A;  2ASB A;  4RVN A;  3DAY A;  2CY1 A;  2QW0 X;  3J7A D;  5BSR A;  4L4Q A;  2E0G A;  4LF7 C;  1WF3 A;  4G37 A;  1M6X A;  1XRB A;  3LAX A;  2XR1 A;  1V60 A;  4YHH C;  4R1M A;  4GKJ C;  3OTO C;  4L2Z A;  1QM4 A;  1N36 C;  3K6R A;  4U5Y D;  4ZLP A;  4PUI A;  1V26 A;  4L7I A;  3CQ3 A;  5IT9 D;  5AE3 A;  2YWC A;  3IEV A;  4AQY C;  2HHH C;  4NXM C;  4OX9 C;  1NYE A;  5A1G A;  5KYT A;  1M6X C;  1FJG C;  2F4V C;  3CW9 A;  1VLA A;  4GKK C; 
#chains in the Genus database with same CATH homology
 1BA3 A;  3H2T A;  2D28 C;  3IEU A;  4RLF A;  5K85 A;  1HNZ C;  2QVY X;  2OPL B;  5LMN C;  3ETC A;  3LNV A;  1PG3 A;  1I94 C;  3NPD A;  4RVO A;  2OPL A;  5JRH A;  3FCC A;  3UOW A;  4JI0 C;  2P02 A;  2OBV A;  1V25 A;  4DV1 C;  4DUZ C;  3RV2 A;  4I9F A;  1IBL C;  1MKY A;  4B3S C;  2D1R A;  3DLP X;  3S82 A;  3NI2 A;  4DV0 C;  4X66 C;  5KEI A;  5IFI A;  2D1S A;  2P2J A;  4DG9 A;  4LF9 C;  1LCI A;  4DG8 A;  4B3M C;  5T8S A;  2UXB C;  5E7Q A;  2UXC C;  1FUG A;  1YJ7 A;  2YWB A;  4RLQ A;  1XMO C;  3NYR A;  1MXA A;  1P7L A;  3VNS A;  4GXR A;  3A4I A;  2JMP A;  4DR5 C;  1QWI A;  1T5D X;  1GPM A;  4OYC A;  4JI3 C;  2DPL A;  4RM3 A;  2ATW A;  4OXI A;  2EGT A;  1N34 C;  1RY2 A;  2Y4O A;  4DUY C;  1O9T A;  4D4I A;  2D7V A;  4R1L A;  1HNW C;  4PRO C;  1N33 C;  5BSW A;  4IR7 A;  2PN2 A;  2WP0 C;  1ZB8 A;  4DR3 C;  5H9U A;  4X65 C;  2YCB A;  4JI5 C;  3TUF A;  4DR6 C;  2BH1 X;  5BUS A;  3GR1 A;  4LFC C;  3CJE A;  3I07 A;  4JI2 C;  4TPS B;  2VQE C;  5BSU A;  4ISB A;  2QVX X;  4LE5 A;  4JI8 C;  4DR4 C;  4DV2 C;  1XMQ C;  5A19 A;  3R9W A;  4G1I A;  3R44 A;  3EER A;  5BSV A;  2CXC A;  4LF8 C;  1L2F A;  1T5H X;  4K0K C;  3GPC A;  4LFA C;  4NXN C;  1MDB A;  2QL8 A;  4I9G A;  1MXB A;  5BSM A;  2Y27 A;  3L8C A;  3N2Q A;  1EGA A;  3E7W A;  3SO4 A;  4PZP A;  4ZJZ A;  1KKG A;  1PA4 A;  4LF5 C;  3PBK A;  4DV7 C;  2D1T A;  4B3R C;  1JOS A;  2QVZ X;  4PHT A;  1USP B;  2P20 A;  1XNQ C;  5BUR A;  2UUA C;  4X64 C;  3PES A;  4IZ6 A;  3ETO A;  3G7S A;  1USP A;  3VNQ A;  4B3T C;  4GS5 A;  2D1Q A;  5KYV A;  3LUS A;  2VQF C;  1XRA A;  2PT7 G;  4ODJ A;  3UZ0 A;  4BSZ A;  3RG2 A;  2P2Q A;  5IWA C;  4JI7 C;  1HR0 C;  2UXD C;  2P2F A;  1WH9 A;  2DYJ A;  3N54 B;  1O90 A;  4YY3 C;  4X62 C;  1HNX C;  2UU9 C;  2E8F A;  4DR1 C;  4WS9 A;  1IBK C;  3GKU A;  2Y4N A;  4XX2 A;  4DV6 C;  4D57 A;  2E7G A;  4FUQ A;  5A1I A;  4KHP C;  4LFB C;  2PRO A;  4DR2 C;  2E5L C;  2VSQ A;  1XRC A;  4KTV A;  5DV9 A;  4DCU A;  3I08 A;  2BJO A;  3A9V A;  1AMU A;  1ZB9 A;  5AE1 A;  4DCT A;  5BST A;  4DCS A;  5A2Q D;  2KZF A;  5GTD A;  4JI4 C;  3IML A;  3EQ6 A;  3FCE A;  2P2B A;  3A9U A;  4BBY A;  2P2M A;  2UUC C;  2D27 A;  4JYA C;  1PG4 A;  3R9X A;  1N32 C;  4DV5 C;  2ZM6 C;  2VZE A;  2HJG A;  1UKK A;  3AF5 A;  1MD9 A;  5CZX A;  5T8T A;  3L95 X;  1XNR C;  5AE2 A;  1RG9 A;  2E8E A;  2E8C A;  2UUB C;  3KXW A;  1J5E C;  4FTF A;  3TQI A;  3J80 D;  4GXQ A;  4HPV A;  4G36 A;  3GR0 A;  4FUT A;  3T1H C;  4DCV A;  3PRO C;  2WD9 A;  4JI1 C;  4DV3 C;  3IPL A;  3NYQ A;  1O92 A;  4BC7 A;  3C5E A;  4WV3 A;  1LQL A;  3VNR A;  4JV5 C;  3E7X A;  5LMU C;  1N2F A;  3T1Y C;  5FLX D;  5BUQ A;  1O93 A;  1K0R A;  4DR7 C;  3CW8 X;  4DV4 C;  5K8F A;  1MDF A;  3TDE A;  1MXC A;  4RMN A;  1ML8 A;  4EAT A;  4LF6 C;  3JAM D;  4MTN A;  4JM1 A;  4KTT A;  5BR8 C;  4BC9 A;  4NDN A;  2ONF A;  3DHV A;  1ULT A;  5CZV A;  2OO4 A;  4LF4 C;  1HH2 P;  3AF6 A;  5ADZ A;  2AYA A;  3LGX A;  4R0M A;  4K0B A;  4RM2 A;  4BCA A;  4NOZ A;  4MH4 A;  3J81 D;  1IBM C;  4JI6 C;  2V7B A;  3B7W A;  4D56 A;  4D4G A;  2ASB A;  4RVN A;  3DAY A;  2CY1 A;  2QW0 X;  3J7A D;  5BSR A;  4L4Q A;  2E0G A;  4LF7 C;  1WF3 A;  4G37 A;  1XRB A;  3LAX A;  2XR1 A;  4YHH C;  4R1M A;  4GKJ C;  3OTO C;  4L2Z A;  1QM4 A;  1N36 C;  4U5Y D;  4ZLP A;  1V26 A;  4L7I A;  5IT9 D;  5AE3 A;  2YWC A;  3IEV A;  4AQY C;  2HHH C;  4NXM C;  4OX9 C;  1NYE A;  5A1G A;  5KYT A;  1FJG C;  2F4V C;  3CW9 A;  1VLA A;  4GKK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...