4OX9C

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ox9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ox9C02
2PN2A 4DR3C 3GKUA 4LFCC 4DV0C 4LFBC 4DR1C 2CY1A 4YY3C 1NYEA 5FLXD 4JYAC 5LMUC 5IT9D 1USPB 1IBKC 1QWIA 1PA4A 1XMOC 2UXCC 4DCUA 2YCBA 4DV7C 4DV5C 4LF8C 4LF4C 4MTNA 3IEVA 1L2FA 2ATWA 2ZM6C 4JI4C 2HHHC 4B3SC 1N32C 4DUZC 4DV3C 4X66C 5LMNC 1J5EC 3LUSA 4BSZA 1ZB9A 1ZB8A 2OPLB 4MH4A 2UUBC 3AF6A 4B3TC 4LFAC 2VQEC 4DV2C 4DV4C 1N33C 1HR0C 4JV5C 5IWAC 2F4VC 3OTOC 2QL8A 4DR4C 1N34C 1XNRC 1IBMC 3IEUA 1MKYA 2CXCA 4B3RC 2KZFA 2DYJA 1ML8A 1XNQC 1HH2P 4B3MC 4OX9C 4GKJC 4JI1C 5BR8C 4JI5C 1EGAA 1UKKA 4NXMC 2UUCC 1HNWC 3JAMD 1XMQC 1IBLC 1HNXC 3J80D 2UU9C 4K0KC 2XR1A 4JI3C 1KKGA 1VLAA 1USPA 3CJEA 1LQLA 4DR7C 4JI2C 4LF7C 4JI0C 1N36C 2BJOA 2ONFA 2PT7G 4GKKC 3J7AD 2EGTA 5A2QD 2UXBC 1N2FA 2JMPA 4NOZA 4JI6C 4LF6C 2UXDC 4DR2C 4LF9C 3R9WA 4DCTA 2HJGA 4DCVA 4X65C 2VQFC 2ASBA 2E5LC 1I94C 1JOSA 4DR5C 4JI8C 4DR6C 2OPLA 4DCSA 3I07A 1K0RA 1WF3A 4DV1C 3EERA 2E8FA 4AQYC 4YHHC 2D7VA 3J81D 4X62C 2UUAC 4LF5C 4JI7C 4XX2A 4X64C 1WH9A 4NXNC 3AF5A 3T1HC 1FJGC 3R9XA 2E8EA 4DUYC 2E7GA 4KHPC 4DV6C 3T1YC 2E8CA 1HNZC
chains in the Genus database with same CATH superfamily
1P4EC 2P02A 4DR1C 5IFIA 1XRAA 3CQ3A 1XRBA 4JYAC 5IT9D 4G37A 1QWIA 5AE2A 4DCUA 3AY0A 4DV5C 4G1IA 1NY8A 4OXIA 3LAXA 3IEVA 5T8SA 1WCJA 3IMLA 4JI4C 2HHHC 1FLOA 4B3SC 4BBYA 4RLQA 1MXAA 3LUSA 4BSZA 1XS3A 4MH4A 2UUBC 1O90A 4JV5C 4L2ZA 4KTVA 1N34C 1O93A 2ZZNA 1IBMC 3K6RA 3IEUA 1MKYA 4RMNA 1HH2P 2YWBA 3VNSA 4GKJC 1EGAA 1UKKA 1IBLC 1T5HX 2D27A 2XR1A 1P4EA 2YWCA 1USPA 2E0GA 2P20A 3CW8X 4LF7C 1N36C 4GKKC 3E7XA 2P2MA 4BC7A 3J7AD 1TH5A 5BURA 4D4GA 2JMPA 5BSRA 3R44A 4DR2C 4DCVA 4JM1A 2BH1X 2E5LC 2M5HA 4TPSB 4ZLPA 3UOWA 1FUGA 2PG1E 4JI8C 3TUFA 4HPVA 1WF3A 1MDBA 1MXBA 5AE1A 3H2TA 2D7VA 3B7WA 4BCAA 1IB8A 4U5YD 4R0MA 4JI7C 5K85A 4L4QA 2E8EA 2E7GA 2VSQA 1T5DX 1ULTA 1MDFA 4RVNA 2CY1A 5H9UA 4YY3C 3I08A 4KTTA 3CQ2A 5FLXD 4PROC 4RM2A 1IBKC 2M5OA 1XMOC 1PU1A 2UXCC 4LF8C 4NDNA 1YGTA 4WV3A 1GPMA 5A1GA 1N32C 4DUZC 4DV3C 3PBKA 4GXRA 3DAYA 4ZJZA 1V25A 1HR0C 5IWAC 4IZ6A 1AMUA 5A1IA 4WS9A 3OTOC 2QL8A 1MD9A 3NYQA 2DYJA 2QW0X 4K0BA 4PUGA 3EQ6A 3DHVA 4JI1C 1YJ7A 4FUQA 2UUCC 3JAMD 1LCIA 3A4IA 4IR7A 3L8CA 3S82A 3UZ0A 3NI2A 3DLPX 1KKGA 5ADZA 4JI2C 2BJOA 2ONFA 2PT7G 3FCEA 3A9UA 1BA3A 1O92A 2EGTA 2UXBC 5BSWA 3TQIA 4JI6C 1V26A 4R1LA 3VNQA 2HJGA 4DCTA 4I9GA 4X65C 2P2QA 3N2QA 3TR3A 2ASBA 3C5EA 3UX2A 4L7IA 1I94C 2NCLA 4DR6C 2OPLA 4DCSA 3IPLA 1RY2A 2E8FA 4YHHC 2P2FA 4G36A 1XRCA 3LGXA 2VZEA 3A9VA 2Z51A 2PROA 3ETCA 3J81D 2UUAC 3L95X 2P2BA 2D28C 4PUIA 2KZ0A 3R9XA 4DUYC 4KHPC 4DV6C 3NPDA 2E8CA 4PUHA 1VEHA 4DR3C 4LFCC 4DV0C 1PG3A 2WD9A 1V60A 4PZPA 5LMUC 5BSMA 4PHTA 1USPB 3VNRA 2YCBA 4GS5A 2P2JA 2QVYX 1L2FA 2ATWA 2ZM6C 2YX1A 3E7WA 1P7LA 4I9FA 3A25A 4X66C 1J5EC 2MMAB 4ISBA 1ZB9A 3FM7A 3CQ1A 2D1QA 4D57A 4B3TC 4DV2C 4DV4C 3O2EA 2F4VC 2QVZX 5BUQA 3RV2A 4RVOA 4DR4C 5CZVA 2CXCA 2KZFA 1ML8A 3PESA 2Y4NA 3UX3A 3NYRA 4DG9A 4DG8A 5BR8C 4RM3A 2D1SA 4D56A 3LNOA 2V7BA 1HNWC 5DV9A 3UEBA 1HNXC 4K0KC 2MM9A 2OBVA 3GR1A 4R1MA 2AYAA 5KYTA 5A2QD 4NOZA 5KYVA 2UXDC 1QM4A 3R9WA 2VQFC 3N54B 5BUSA 4FUTA 2MCQA 3PROC 1K0RA 2CU6A 4AQYC 2QVXX 3CW9A 5BSVA 1UWDA 5T8TA 1XHJA 4XX2A 5E7QA 3ETOA 1FJGC 2ZTBA 4GXQA 1HNZC 2PN2A 3GKUA 4LFBC 2Y4OA 1NYEA 2Y27A 1XDXA 3A26A 3G7SA 1M6XA 5LCIA 1PG4A 1PA4A 2ZZMA 4DV7C 4LF4C 4MTNA 5A19A 5LMNC 1ZB8A 4RLFA 2OPLB 3AF6A 4LFAC 2VQEC 1N33C 5CZXA 1XNRC 3LNVA 4OYCA 4B3RC 4ODJA 1XNQC 1RG9A 4B3MC 4OX9C 5BSTA 3FCCA 4JI5C 4NXMC 1XMQC 4EATA 3J80D 2UU9C 4JI3C 1VLAA 2KDNA 3CJEA 1LQLA 4DR7C 5JRHA 4JI0C 2WP0C 4LE5A 3GR0A 5GTDA 1N2FA 4LF6C 4LF9C 3GPCA 5BSUA 1MXCA 1M6XC 4FTFA 3KXWA 3RG2A 1JOSA 4DR5C 3I07A 4DV1C 2DHMA 3EERA 3TDEA 1O9TA 5K8FA 2D1RA 2OO4A 2DPLA 4X62C 2D1TA 4BC9A 4LF5C 5KEIA 4X64C 1WH9A 4NXNC 3AF5A 3T1HC 3SO4A 5AE3A 3T1YC 4D4IA 2JNVA
chains in the Genus database with same CATH topology
2P02A 4DR1C 5IFIA 1XRAA 1XRBA 4JYAC 5IT9D 4G37A 1QWIA 5AE2A 4DCUA 4DV5C 4G1IA 4OXIA 3LAXA 3IEVA 5T8SA 4JI4C 3IMLA 2HHHC 4B3SC 4BBYA 4RLQA 1MXAA 3LUSA 4BSZA 4MH4A 2UUBC 1O90A 4JV5C 4L2ZA 4KTVA 1N34C 1O93A 1IBMC 3IEUA 1MKYA 4RMNA 1HH2P 2YWBA 3VNSA 4GKJC 1EGAA 1UKKA 1IBLC 1T5HX 2D27A 2XR1A 2YWCA 1USPA 2E0GA 2P20A 3CW8X 4LF7C 1N36C 4GKKC 3E7XA 2P2MA 4BC7A 3J7AD 5BURA 4D4GA 2JMPA 5BSRA 3R44A 4DR2C 4DCVA 4JM1A 2BH1X 2E5LC 4TPSB 4ZLPA 3UOWA 1FUGA 4JI8C 3TUFA 4HPVA 1WF3A 1MDBA 1MXBA 5AE1A 3H2TA 2D7VA 3B7WA 4BCAA 4U5YD 4R0MA 4JI7C 5K85A 4L4QA 2E8EA 2E7GA 2VSQA 1T5DX 1ULTA 1MDFA 4RVNA 2CY1A 5H9UA 4YY3C 3I08A 4KTTA 5FLXD 4PROC 4RM2A 1IBKC 1XMOC 2UXCC 4LF8C 4NDNA 4WV3A 1GPMA 5A1GA 1N32C 4DUZC 4DV3C 3PBKA 4GXRA 3DAYA 4ZJZA 1V25A 1HR0C 5IWAC 4IZ6A 1AMUA 5A1IA 4WS9A 3OTOC 2QL8A 1MD9A 3NYQA 2DYJA 2QW0X 4K0BA 3EQ6A 3DHVA 4JI1C 1YJ7A 4FUQA 2UUCC 3JAMD 1LCIA 3A4IA 4IR7A 3L8CA 3S82A 3UZ0A 3NI2A 3DLPX 1KKGA 5ADZA 4JI2C 2BJOA 2ONFA 2PT7G 3FCEA 3A9UA 1BA3A 1O92A 2EGTA 2UXBC 5BSWA 3TQIA 4JI6C 1V26A 4R1LA 3VNQA 2HJGA 4DCTA 4I9GA 4X65C 2P2QA 3N2QA 2ASBA 3C5EA 4L7IA 1I94C 4DR6C 2OPLA 4DCSA 3IPLA 1RY2A 2E8FA 4YHHC 2P2FA 4G36A 1XRCA 3LGXA 3J81D 3A9VA 2PROA 3ETCA 2UUAC 3L95X 2P2BA 2D28C 3R9XA 4DUYC 4KHPC 4DV6C 3NPDA 2E8CA 4DR3C 4LFCC 4DV0C 1PG3A 2WD9A 4PZPA 5LMUC 5BSMA 4PHTA 1USPB 3VNRA 2YCBA 4GS5A 2P2JA 2QVYX 1L2FA 2ATWA 2ZM6C 3E7WA 1P7LA 4I9FA 4X66C 1J5EC 4ISBA 1ZB9A 2D1QA 4D57A 4B3TC 4DV2C 4DV4C 2F4VC 2QVZX 5BUQA 3RV2A 4RVOA 4DR4C 5CZVA 2CXCA 2KZFA 1ML8A 3PESA 2Y4NA 3NYRA 4DG9A 4DG8A 5BR8C 4RM3A 2D1SA 4D56A 2V7BA 1HNWC 5DV9A 1HNXC 4K0KC 2OBVA 3GR1A 4R1MA 2AYAA 5KYTA 5A2QD 4NOZA 5KYVA 2UXDC 1QM4A 3R9WA 2VQFC 3N54B 5BUSA 4FUTA 3PROC 1K0RA 4AQYC 2QVXX 3CW9A 5BSVA 5T8TA 4XX2A 5E7QA 3ETOA 1FJGC 4GXQA 1HNZC 2PN2A 3GKUA 4LFBC 2Y4OA 1NYEA 2Y27A 3G7SA 1PG4A 1PA4A 4DV7C 4LF4C 4MTNA 5A19A 5LMNC 1ZB8A 4RLFA 2OPLB 3AF6A 4LFAC 2VQEC 1N33C 5CZXA 1XNRC 3LNVA 4OYCA 4B3RC 4ODJA 1XNQC 1RG9A 4B3MC 4OX9C 5BSTA 3FCCA 4JI5C 4NXMC 1XMQC 4EATA 3J80D 2UU9C 4JI3C 1VLAA 3CJEA 1LQLA 4DR7C 5JRHA 4JI0C 2WP0C 4LE5A 3GR0A 5GTDA 1N2FA 4LF6C 4LF9C 3GPCA 5BSUA 1MXCA 4FTFA 3KXWA 3RG2A 1JOSA 4DR5C 3I07A 4DV1C 3EERA 3TDEA 1O9TA 5K8FA 2D1RA 2OO4A 2DPLA 4X62C 2D1TA 4BC9A 4LF5C 5KEIA 4X64C 1WH9A 4NXNC 3AF5A 3T1HC 3SO4A 5AE3A 3T1YC 4D4IA 2VZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PN2 A;  4DR3 C;  3GKU A;  4LFC C;  4DV0 C;  4LFB C;  4DR1 C;  2CY1 A;  4YY3 C;  1NYE A;  5FLX D;  4JYA C;  5LMU C;  5IT9 D;  1USP B;  1IBK C;  1QWI A;  1PA4 A;  1XMO C;  2UXC C;  4DCU A;  2YCB A;  4DV7 C;  4DV5 C;  4LF8 C;  4LF4 C;  4MTN A;  3IEV A;  1L2F A;  2ATW A;  2ZM6 C;  4JI4 C;  2HHH C;  4B3S C;  1N32 C;  4DUZ C;  4DV3 C;  4X66 C;  5LMN C;  1J5E C;  3LUS A;  4BSZ A;  1ZB9 A;  1ZB8 A;  2OPL B;  4MH4 A;  2UUB C;  3AF6 A;  4B3T C;  4LFA C;  2VQE C;  4DV2 C;  4DV4 C;  1N33 C;  1HR0 C;  4JV5 C;  5IWA C;  2F4V C;  3OTO C;  2QL8 A;  4DR4 C;  1N34 C;  1XNR C;  1IBM C;  3IEU A;  1MKY A;  2CXC A;  4B3R C;  2KZF A;  2DYJ A;  1ML8 A;  1XNQ C;  1HH2 P;  4B3M C;  4OX9 C;  4GKJ C;  4JI1 C;  5BR8 C;  4JI5 C;  1EGA A;  1UKK A;  4NXM C;  2UUC C;  1HNW C;  3JAM D;  1XMQ C;  1IBL C;  1HNX C;  3J80 D;  2UU9 C;  4K0K C;  2XR1 A;  4JI3 C;  1KKG A;  1VLA A;  1USP A;  3CJE A;  1LQL A;  4DR7 C;  4JI2 C;  4LF7 C;  4JI0 C;  1N36 C;  2BJO A;  2ONF A;  2PT7 G;  4GKK C;  3J7A D;  2EGT A;  5A2Q D;  2UXB C;  1N2F A;  2JMP A;  4NOZ A;  4JI6 C;  4LF6 C;  2UXD C;  4DR2 C;  4LF9 C;  3R9W A;  4DCT A;  2HJG A;  4DCV A;  4X65 C;  2VQF C;  2ASB A;  2E5L C;  1I94 C;  1JOS A;  4DR5 C;  4JI8 C;  4DR6 C;  2OPL A;  4DCS A;  3I07 A;  1K0R A;  1WF3 A;  4DV1 C;  3EER A;  2E8F A;  4AQY C;  4YHH C;  2D7V A;  3J81 D;  4X62 C;  2UUA C;  4LF5 C;  4JI7 C;  4XX2 A;  4X64 C;  1WH9 A;  4NXN C;  3AF5 A;  3T1H C;  1FJG C;  3R9X A;  2E8E A;  4DUY C;  2E7G A;  4KHP C;  4DV6 C;  3T1Y C;  2E8C A;  1HNZ C; 
#chains in the Genus database with same CATH topology
 1P4E C;  2P02 A;  4DR1 C;  5IFI A;  1XRA A;  3CQ3 A;  1XRB A;  4JYA C;  5IT9 D;  4G37 A;  1QWI A;  5AE2 A;  4DCU A;  3AY0 A;  4DV5 C;  4G1I A;  1NY8 A;  4OXI A;  3LAX A;  3IEV A;  5T8S A;  1WCJ A;  3IML A;  4JI4 C;  2HHH C;  1FLO A;  4B3S C;  4BBY A;  4RLQ A;  1MXA A;  3LUS A;  4BSZ A;  1XS3 A;  4MH4 A;  2UUB C;  1O90 A;  4JV5 C;  4L2Z A;  4KTV A;  1N34 C;  1O93 A;  2ZZN A;  1IBM C;  3K6R A;  3IEU A;  1MKY A;  4RMN A;  1HH2 P;  2YWB A;  3VNS A;  4GKJ C;  1EGA A;  1UKK A;  1IBL C;  1T5H X;  2D27 A;  2XR1 A;  1P4E A;  2YWC A;  1USP A;  2E0G A;  2P20 A;  3CW8 X;  4LF7 C;  1N36 C;  4GKK C;  3E7X A;  2P2M A;  4BC7 A;  3J7A D;  1TH5 A;  5BUR A;  4D4G A;  2JMP A;  5BSR A;  3R44 A;  4DR2 C;  4DCV A;  4JM1 A;  2BH1 X;  2E5L C;  2M5H A;  4TPS B;  4ZLP A;  3UOW A;  1FUG A;  2PG1 E;  4JI8 C;  3TUF A;  4HPV A;  1WF3 A;  1MDB A;  1MXB A;  5AE1 A;  3H2T A;  2D7V A;  3B7W A;  4BCA A;  1IB8 A;  4U5Y D;  4R0M A;  4JI7 C;  5K85 A;  4L4Q A;  2E8E A;  2E7G A;  2VSQ A;  1T5D X;  1ULT A;  1MDF A;  4RVN A;  2CY1 A;  5H9U A;  4YY3 C;  3I08 A;  4KTT A;  3CQ2 A;  5FLX D;  4PRO C;  4RM2 A;  1IBK C;  2M5O A;  1XMO C;  1PU1 A;  2UXC C;  4LF8 C;  4NDN A;  1YGT A;  4WV3 A;  1GPM A;  5A1G A;  1N32 C;  4DUZ C;  4DV3 C;  3PBK A;  4GXR A;  3DAY A;  4ZJZ A;  1V25 A;  1HR0 C;  5IWA C;  4IZ6 A;  1AMU A;  5A1I A;  4WS9 A;  3OTO C;  2QL8 A;  1MD9 A;  3NYQ A;  2DYJ A;  2QW0 X;  4K0B A;  4PUG A;  3EQ6 A;  3DHV A;  4JI1 C;  1YJ7 A;  4FUQ A;  2UUC C;  3JAM D;  1LCI A;  3A4I A;  4IR7 A;  3L8C A;  3S82 A;  3UZ0 A;  3NI2 A;  3DLP X;  1KKG A;  5ADZ A;  4JI2 C;  2BJO A;  2ONF A;  2PT7 G;  3FCE A;  3A9U A;  1BA3 A;  1O92 A;  2EGT A;  2UXB C;  5BSW A;  3TQI A;  4JI6 C;  1V26 A;  4R1L A;  3VNQ A;  2HJG A;  4DCT A;  4I9G A;  4X65 C;  2P2Q A;  3N2Q A;  3TR3 A;  2ASB A;  3C5E A;  3UX2 A;  4L7I A;  1I94 C;  2NCL A;  4DR6 C;  2OPL A;  4DCS A;  3IPL A;  1RY2 A;  2E8F A;  4YHH C;  2P2F A;  4G36 A;  1XRC A;  3LGX A;  2VZE A;  3A9V A;  2Z51 A;  2PRO A;  3ETC A;  3J81 D;  2UUA C;  3L95 X;  2P2B A;  2D28 C;  4PUI A;  2KZ0 A;  3R9X A;  4DUY C;  4KHP C;  4DV6 C;  3NPD A;  2E8C A;  4PUH A;  1VEH A;  4DR3 C;  4LFC C;  4DV0 C;  1PG3 A;  2WD9 A;  1V60 A;  4PZP A;  5LMU C;  5BSM A;  4PHT A;  1USP B;  3VNR A;  2YCB A;  4GS5 A;  2P2J A;  2QVY X;  1L2F A;  2ATW A;  2ZM6 C;  2YX1 A;  3E7W A;  1P7L A;  4I9F A;  3A25 A;  4X66 C;  1J5E C;  2MMA B;  4ISB A;  1ZB9 A;  3FM7 A;  3CQ1 A;  2D1Q A;  4D57 A;  4B3T C;  4DV2 C;  4DV4 C;  3O2E A;  2F4V C;  2QVZ X;  5BUQ A;  3RV2 A;  4RVO A;  4DR4 C;  5CZV A;  2CXC A;  2KZF A;  1ML8 A;  3PES A;  2Y4N A;  3UX3 A;  3NYR A;  4DG9 A;  4DG8 A;  5BR8 C;  4RM3 A;  2D1S A;  4D56 A;  3LNO A;  2V7B A;  1HNW C;  5DV9 A;  3UEB A;  1HNX C;  4K0K C;  2MM9 A;  2OBV A;  3GR1 A;  4R1M A;  2AYA A;  5KYT A;  5A2Q D;  4NOZ A;  5KYV A;  2UXD C;  1QM4 A;  3R9W A;  2VQF C;  3N54 B;  5BUS A;  4FUT A;  2MCQ A;  3PRO C;  1K0R A;  2CU6 A;  4AQY C;  2QVX X;  3CW9 A;  5BSV A;  1UWD A;  5T8T A;  1XHJ A;  4XX2 A;  5E7Q A;  3ETO A;  1FJG C;  2ZTB A;  4GXQ A;  1HNZ C;  2PN2 A;  3GKU A;  4LFB C;  2Y4O A;  1NYE A;  2Y27 A;  1XDX A;  3A26 A;  3G7S A;  1M6X A;  5LCI A;  1PG4 A;  1PA4 A;  2ZZM A;  4DV7 C;  4LF4 C;  4MTN A;  5A19 A;  5LMN C;  1ZB8 A;  4RLF A;  2OPL B;  3AF6 A;  4LFA C;  2VQE C;  1N33 C;  5CZX A;  1XNR C;  3LNV A;  4OYC A;  4B3R C;  4ODJ A;  1XNQ C;  1RG9 A;  4B3M C;  4OX9 C;  5BST A;  3FCC A;  4JI5 C;  4NXM C;  1XMQ C;  4EAT A;  3J80 D;  2UU9 C;  4JI3 C;  1VLA A;  2KDN A;  3CJE A;  1LQL A;  4DR7 C;  5JRH A;  4JI0 C;  2WP0 C;  4LE5 A;  3GR0 A;  5GTD A;  1N2F A;  4LF6 C;  4LF9 C;  3GPC A;  5BSU A;  1MXC A;  1M6X C;  4FTF A;  3KXW A;  3RG2 A;  1JOS A;  4DR5 C;  3I07 A;  4DV1 C;  2DHM A;  3EER A;  3TDE A;  1O9T A;  5K8F A;  2D1R A;  2OO4 A;  2DPL A;  4X62 C;  2D1T A;  4BC9 A;  4LF5 C;  5KEI A;  4X64 C;  1WH9 A;  4NXN C;  3AF5 A;  3T1H C;  3SO4 A;  5AE3 A;  3T1Y C;  4D4I A;  2JNV A; 
#chains in the Genus database with same CATH homology
 2P02 A;  4DR1 C;  5IFI A;  1XRA A;  1XRB A;  4JYA C;  5IT9 D;  4G37 A;  1QWI A;  5AE2 A;  4DCU A;  4DV5 C;  4G1I A;  4OXI A;  3LAX A;  3IEV A;  5T8S A;  4JI4 C;  3IML A;  2HHH C;  4B3S C;  4BBY A;  4RLQ A;  1MXA A;  3LUS A;  4BSZ A;  4MH4 A;  2UUB C;  1O90 A;  4JV5 C;  4L2Z A;  4KTV A;  1N34 C;  1O93 A;  1IBM C;  3IEU A;  1MKY A;  4RMN A;  1HH2 P;  2YWB A;  3VNS A;  4GKJ C;  1EGA A;  1UKK A;  1IBL C;  1T5H X;  2D27 A;  2XR1 A;  2YWC A;  1USP A;  2E0G A;  2P20 A;  3CW8 X;  4LF7 C;  1N36 C;  4GKK C;  3E7X A;  2P2M A;  4BC7 A;  3J7A D;  5BUR A;  4D4G A;  2JMP A;  5BSR A;  3R44 A;  4DR2 C;  4DCV A;  4JM1 A;  2BH1 X;  2E5L C;  4TPS B;  4ZLP A;  3UOW A;  1FUG A;  4JI8 C;  3TUF A;  4HPV A;  1WF3 A;  1MDB A;  1MXB A;  5AE1 A;  3H2T A;  2D7V A;  3B7W A;  4BCA A;  4U5Y D;  4R0M A;  4JI7 C;  5K85 A;  4L4Q A;  2E8E A;  2E7G A;  2VSQ A;  1T5D X;  1ULT A;  1MDF A;  4RVN A;  2CY1 A;  5H9U A;  4YY3 C;  3I08 A;  4KTT A;  5FLX D;  4PRO C;  4RM2 A;  1IBK C;  1XMO C;  2UXC C;  4LF8 C;  4NDN A;  4WV3 A;  1GPM A;  5A1G A;  1N32 C;  4DUZ C;  4DV3 C;  3PBK A;  4GXR A;  3DAY A;  4ZJZ A;  1V25 A;  1HR0 C;  5IWA C;  4IZ6 A;  1AMU A;  5A1I A;  4WS9 A;  3OTO C;  2QL8 A;  1MD9 A;  3NYQ A;  2DYJ A;  2QW0 X;  4K0B A;  3EQ6 A;  3DHV A;  4JI1 C;  1YJ7 A;  4FUQ A;  2UUC C;  3JAM D;  1LCI A;  3A4I A;  4IR7 A;  3L8C A;  3S82 A;  3UZ0 A;  3NI2 A;  3DLP X;  1KKG A;  5ADZ A;  4JI2 C;  2BJO A;  2ONF A;  2PT7 G;  3FCE A;  3A9U A;  1BA3 A;  1O92 A;  2EGT A;  2UXB C;  5BSW A;  3TQI A;  4JI6 C;  1V26 A;  4R1L A;  3VNQ A;  2HJG A;  4DCT A;  4I9G A;  4X65 C;  2P2Q A;  3N2Q A;  2ASB A;  3C5E A;  4L7I A;  1I94 C;  4DR6 C;  2OPL A;  4DCS A;  3IPL A;  1RY2 A;  2E8F A;  4YHH C;  2P2F A;  4G36 A;  1XRC A;  3LGX A;  3J81 D;  3A9V A;  2PRO A;  3ETC A;  2UUA C;  3L95 X;  2P2B A;  2D28 C;  3R9X A;  4DUY C;  4KHP C;  4DV6 C;  3NPD A;  2E8C A;  4DR3 C;  4LFC C;  4DV0 C;  1PG3 A;  2WD9 A;  4PZP A;  5LMU C;  5BSM A;  4PHT A;  1USP B;  3VNR A;  2YCB A;  4GS5 A;  2P2J A;  2QVY X;  1L2F A;  2ATW A;  2ZM6 C;  3E7W A;  1P7L A;  4I9F A;  4X66 C;  1J5E C;  4ISB A;  1ZB9 A;  2D1Q A;  4D57 A;  4B3T C;  4DV2 C;  4DV4 C;  2F4V C;  2QVZ X;  5BUQ A;  3RV2 A;  4RVO A;  4DR4 C;  5CZV A;  2CXC A;  2KZF A;  1ML8 A;  3PES A;  2Y4N A;  3NYR A;  4DG9 A;  4DG8 A;  5BR8 C;  4RM3 A;  2D1S A;  4D56 A;  2V7B A;  1HNW C;  5DV9 A;  1HNX C;  4K0K C;  2OBV A;  3GR1 A;  4R1M A;  2AYA A;  5KYT A;  5A2Q D;  4NOZ A;  5KYV A;  2UXD C;  1QM4 A;  3R9W A;  2VQF C;  3N54 B;  5BUS A;  4FUT A;  3PRO C;  1K0R A;  4AQY C;  2QVX X;  3CW9 A;  5BSV A;  5T8T A;  4XX2 A;  5E7Q A;  3ETO A;  1FJG C;  4GXQ A;  1HNZ C;  2PN2 A;  3GKU A;  4LFB C;  2Y4O A;  1NYE A;  2Y27 A;  3G7S A;  1PG4 A;  1PA4 A;  4DV7 C;  4LF4 C;  4MTN A;  5A19 A;  5LMN C;  1ZB8 A;  4RLF A;  2OPL B;  3AF6 A;  4LFA C;  2VQE C;  1N33 C;  5CZX A;  1XNR C;  3LNV A;  4OYC A;  4B3R C;  4ODJ A;  1XNQ C;  1RG9 A;  4B3M C;  4OX9 C;  5BST A;  3FCC A;  4JI5 C;  4NXM C;  1XMQ C;  4EAT A;  3J80 D;  2UU9 C;  4JI3 C;  1VLA A;  3CJE A;  1LQL A;  4DR7 C;  5JRH A;  4JI0 C;  2WP0 C;  4LE5 A;  3GR0 A;  5GTD A;  1N2F A;  4LF6 C;  4LF9 C;  3GPC A;  5BSU A;  1MXC A;  4FTF A;  3KXW A;  3RG2 A;  1JOS A;  4DR5 C;  3I07 A;  4DV1 C;  3EER A;  3TDE A;  1O9T A;  5K8F A;  2D1R A;  2OO4 A;  2DPL A;  4X62 C;  2D1T A;  4BC9 A;  4LF5 C;  5KEI A;  4X64 C;  1WH9 A;  4NXN C;  3AF5 A;  3T1H C;  3SO4 A;  5AE3 A;  3T1Y C;  4D4I A;  2VZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...