1HNZC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hnzC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hnzC02
5LMNC 3R9WA 4DUZC 4X65C 2D7VA 4X64C 3AF6A 2E8FA 4DCSA 2E7GA 5LMUC 1N36C 4DR7C 5A2QD 4DV4C 3CJEA 2UUAC 1JOSA 3AF5A 4XX2A 2XR1A 2F4VC 1KKGA 5IWAC 4LFAC 2OPLA 4B3TC 2ASBA 4DCVA 2KZFA 2OPLB 1QWIA 4DR5C 4LF7C 4DR2C 1ML8A 4JI3C 4DV0C 2ATWA 3OTOC 1USPA 2CY1A 4JI8C 3J7AD 4DV7C 1ZB9A 2VQEC 2E8EA 1XNQC 2DYJA 2YCBA 2PT7G 1N32C 4KHPC 4LF4C 3IEUA 4NXNC 2JMPA 2UUBC 1HH2P 3I07A 5FLXD 2HJGA 3IEVA 2PN2A 2UU9C 4DCUA 2UUCC 1HNZC 1LQLA 4DV1C 4NOZA 1PA4A 1UKKA 4DR1C 4JV5C 4GKKC 1HNWC 4DR4C 1XMOC 1IBKC 4LF9C 4OX9C 4DCTA 4JI4C 4DUYC 4YY3C 4LF5C 3J80D 4DV5C 4LF8C 1XMQC 2BJOA 3T1YC 3J81D 1K0RA 2UXBC 1N2FA 1XNRC 4B3SC 4DR6C 1WF3A 4X62C 4YHHC 1WH9A 4B3RC 1I94C 2ZM6C 4DV2C 2E5LC 1IBMC 4JYAC 2UXDC 1ZB8A 3JAMD 1MKYA 1N34C 4LF6C 4K0KC 3R9XA 4JI5C 3GKUA 2E8CA 4BSZA 1HR0C 1USPB 4B3MC 4MTNA 1L2FA 1VLAA 3LUSA 1HNXC 4JI1C 4AQYC 2EGTA 4JI6C 2CXCA 4GKJC 1N33C 4DV3C 4JI7C 4JI0C 1NYEA 5IT9D 4MH4A 2VQFC 4NXMC 2ONFA 4DV6C 1EGAA 4LFBC 4JI2C 2HHHC 3EERA 4DR3C 4LFCC 5BR8C 3T1HC 1J5EC 2QL8A 1FJGC 1IBLC 2UXCC 4X66C
chains in the Genus database with same CATH superfamily
5LMNC 3R9WA 4IZ6A 1LCIA 4X64C 3I08A 4BC7A 3EQ6A 5A2QD 4DV4C 3CJEA 3AF5A 4XX2A 4ISBA 2ASBA 3CQ3A 2KZFA 4IR7A 4DG8A 4DR5C 3L8CA 3TUFA 1ML8A 4DV0C 2D1SA 3OTOC 1ZB9A 5T8SA 2E8EA 1WCJA 1XNQC 4EATA 3I07A 3LAXA 2PN2A 1HNZC 1MXBA 5BURA 4DR1C 2P02A 4GKKC 4ZJZA 4DR4C 3N54B 4WV3A 3UX2A 3ETCA 2KZ0A 2VZEA 2WP0C 4DUYC 4YY3C 1PG3A 2D1QA 1MXAA 2ZTBA 1AMUA 3E7WA 4DV5C 4ZLPA 3T1YC 4RMNA 4DR6C 1WF3A 4X62C 2ZM6C 1UWDA 1V60A 1ZB8A 2DPLA 2KDNA 4BCAA 4LF6C 4K0KC 4FUQA 3R9XA 2QVXX 4RM2A 5BSMA 2M5HA 4BBYA 2AYAA 1HNXC 3FCEA 4JI1C 1N33C 3NYRA 4JI7C 3RG2A 5ADZA 2ONFA 5LCIA 1M6XC 4JI2C 1P4EC 4ODJA 1J5EC 1IBLC 2D28C 2P20A 2Y27A 2MCQA 4RLQA 4L2ZA 4X65C 2P2MA 1O90A 5LMUC 3A9UA 4DR7C 2WD9A 1NY8A 2UUAC 2D27A 1JOSA 1P7LA 2F4VC 1KKGA 3G7SA 2NCLA 2OPLA 1MDFA 3LGXA 4DCVA 1RG9A 5BSUA 1O92A 2P2FA 3B7WA 4DR2C 3H2TA 4JI8C 2CY1A 4DV7C 1MDBA 5GTDA 5A1IA 1FLOA 4NXNC 1PG4A 2UUBC 1FUGA 2QVYX 3DAYA 3RV2A 1XHJA 1XRAA 5BSTA 4NOZA 4JV5C 1HNWC 4OX9C 4LF9C 4JI4C 2E0GA 4GS5A 3VNQA 3J80D 1YJ7A 3NYQA 5E7QA 3IPLA 2M5OA 5JRHA 1K0RA 2UXBC 1N2FA 3GR1A 1XNRC 1VEHA 1XRCA 4B3RC 1I94C 4DV2C 5BUSA 2E5LC 1IBMC 3NPDA 3JAMD 3SO4A 1N34C 1XRBA 3NI2A 4JI5C 3A9VA 4BSZA 5T8TA 1HR0C 1L2FA 4AQYC 1IB8A 2EGTA 4RVNA 2CXCA 4GKJC 3A25A 3TR3A 4BC9A 4JI0C 1NYEA 5IT9D 4PZPA 1O93A 2VQFC 4G1IA 5K85A 2P2BA 3KXWA 4RVOA 5BUQA 1EGAA 2BH1X 4LFBC 3EERA 4DR3C 4LFCC 3T1HC 5A1GA 4LE5A 1RY2A 1GPMA 4DUZC 2MM9A 2D7VA 3LNOA 2E8FA 4DCSA 2Y4OA 3R44A 3E7XA 3UOWA 1N36C 4PHTA 5KEIA 4LFAC 4R0MA 4B3TC 4D4IA 3AY0A 2D1RA 4PUGA 1QWIA 4LF7C 2ATWA 3O2EA 4JI3C 4HPVA 3TDEA 5KYVA 5AE1A 3J7AD 1YGTA 1O9TA 3PROC 2DYJA 2PT7G 4TPSB 4LF4C 4GXQA 3IEUA 2JMPA 4DG9A 1HH2P 4FTFA 5FLXD 1MD9A 2UU9C 2UUCC 4NDNA 1LQLA 3L95X 3VNRA 4R1LA 3LNVA 1IBKC 4G36A 2YX1A 5BSWA 2PG1E 1P4EA 2YWBA 1XMQC 2BJOA 2OBVA 4JM1A 3CW9A 1QM4A 3J81D 4YHHC 1WH9A 4RLFA 1V25A 4D4GA 4OYCA 2YWCA 3N2QA 3GKUA 2E8CA 3UZ0A 1USPB 3GR0A 1VLAA 3C5EA 4WS9A 1TH5A 3K6RA 4DV3C 4MH4A 2P2QA 3PBKA 4DV6C 3PESA 1XS3A 4RM3A 3TQIA 4L4QA 4PUHA 4U5YD 2HHHC 3S82A 5BSRA 2ZZNA 2OO4A 4I9FA 5BR8C 1FJGC 2UXCC 4X66C 1ULTA 2QW0X 3AF6A 5K8FA 3DLPX 4OXIA 2E7GA 5CZXA 2ZZMA 3A4IA 1T5HX 2XR1A 3CQ1A 5IWAC 2MMAB 4FUTA 5H9UA 2CU6A 4PUIA 1V26A 4L7IA 2OPLB 4R1MA 1T5DX 3VNSA 1USPA 3UX3A 2VQEC 2YCBA 1N32C 4KHPC 3FM7A 2HJGA 3IEVA 2PROA 4DCUA 1M6XA 4GXRA 4KTVA 4DV1C 1PA4A 1UKKA 1XMOC 5AE3A 4DCTA 4K0BA 1PU1A 5IFIA 4D56A 4I9GA 4LF5C 2VSQA 4LF8C 3GPCA 4KTTA 1MXCA 4B3SC 3CW8X 3DHVA 5CZVA 5DV9A 5A19A 4JYAC 2UXDC 2D1TA 2V7BA 1MKYA 1BA3A 2Y4NA 3UEBA 2QVZX 2Z51A 3A26A 4B3MC 4MTNA 2JNVA 2P2JA 3LUSA 3FCCA 1XDXA 2DHMA 4JI6C 5BSVA 5KYTA 4NXMC 4D57A 5AE2A 4G37A 3IMLA 4PROC 3CQ2A 2QL8A 3ETOA
chains in the Genus database with same CATH topology
5LMNC 3R9WA 4IZ6A 1LCIA 4X64C 3I08A 4BC7A 3EQ6A 5A2QD 4DV4C 3CJEA 3AF5A 4XX2A 4ISBA 2ASBA 2KZFA 4IR7A 4DG8A 4DR5C 3L8CA 3TUFA 1ML8A 4DV0C 2D1SA 3OTOC 1ZB9A 5T8SA 2E8EA 1XNQC 4EATA 3I07A 3LAXA 2PN2A 1HNZC 1MXBA 5BURA 4DR1C 2P02A 4GKKC 4ZJZA 4DR4C 3N54B 4WV3A 3ETCA 2WP0C 2VZEA 4DUYC 4YY3C 1PG3A 2D1QA 1MXAA 1AMUA 3E7WA 4DV5C 4ZLPA 3T1YC 4RMNA 4DR6C 1WF3A 4X62C 2ZM6C 1ZB8A 2DPLA 4BCAA 4LF6C 4K0KC 4FUQA 3R9XA 2QVXX 4RM2A 5BSMA 4BBYA 2AYAA 1HNXC 3FCEA 4JI1C 1N33C 3NYRA 4JI7C 3RG2A 5ADZA 2ONFA 4JI2C 4ODJA 1J5EC 1IBLC 2D28C 2P20A 2Y27A 4RLQA 4L2ZA 4X65C 2P2MA 1O90A 5LMUC 3A9UA 4DR7C 2WD9A 2UUAC 2D27A 1JOSA 1P7LA 2F4VC 1KKGA 3G7SA 2OPLA 1MDFA 3LGXA 4DCVA 1RG9A 5BSUA 1O92A 2P2FA 3B7WA 4DR2C 3H2TA 4JI8C 2CY1A 4DV7C 1MDBA 5GTDA 5A1IA 4NXNC 1PG4A 2UUBC 1FUGA 2QVYX 3DAYA 3RV2A 1XRAA 5BSTA 4NOZA 4JV5C 1HNWC 4OX9C 4LF9C 4JI4C 2E0GA 4GS5A 3VNQA 3J80D 1YJ7A 3NYQA 5E7QA 3IPLA 5JRHA 1K0RA 2UXBC 1N2FA 3GR1A 1XNRC 1XRCA 4B3RC 1I94C 4DV2C 5BUSA 2E5LC 1IBMC 3NPDA 3JAMD 3SO4A 1N34C 1XRBA 3NI2A 4JI5C 3A9VA 4BSZA 5T8TA 1HR0C 1L2FA 4AQYC 2EGTA 4RVNA 2CXCA 4GKJC 4BC9A 4JI0C 1NYEA 5IT9D 4PZPA 1O93A 2VQFC 4G1IA 5K85A 2P2BA 3KXWA 4RVOA 5BUQA 1EGAA 2BH1X 4LFBC 3EERA 4DR3C 4LFCC 3T1HC 5A1GA 4LE5A 1RY2A 1GPMA 4DUZC 2D7VA 2E8FA 4DCSA 2Y4OA 3R44A 3E7XA 3UOWA 1N36C 4PHTA 5KEIA 4LFAC 4R0MA 4B3TC 4D4IA 2D1RA 1QWIA 4LF7C 2ATWA 4JI3C 4HPVA 3TDEA 5KYVA 5AE1A 3J7AD 1O9TA 3PROC 2DYJA 2PT7G 4TPSB 4LF4C 4GXQA 3IEUA 2JMPA 4DG9A 1HH2P 4FTFA 5FLXD 1MD9A 2UU9C 2UUCC 4NDNA 1LQLA 3L95X 3VNRA 4R1LA 3LNVA 1IBKC 4G36A 5BSWA 2YWBA 1XMQC 2BJOA 2OBVA 4JM1A 3CW9A 1QM4A 3J81D 4YHHC 1WH9A 4RLFA 1V25A 4D4GA 4OYCA 2YWCA 3N2QA 3GKUA 2E8CA 3UZ0A 1USPB 3GR0A 1VLAA 3C5EA 4WS9A 4DV3C 4MH4A 2P2QA 3PBKA 4DV6C 3PESA 4RM3A 3TQIA 4L4QA 4U5YD 2HHHC 3S82A 5BSRA 2OO4A 4I9FA 5BR8C 1FJGC 2UXCC 4X66C 1ULTA 2QW0X 3AF6A 5K8FA 3DLPX 4OXIA 2E7GA 5CZXA 3A4IA 1T5HX 2XR1A 5IWAC 4FUTA 5H9UA 1V26A 4L7IA 2OPLB 4R1MA 1T5DX 3VNSA 1USPA 2VQEC 2YCBA 1N32C 4KHPC 2HJGA 3IEVA 2PROA 4DCUA 4GXRA 4KTVA 4DV1C 1PA4A 1UKKA 1XMOC 5AE3A 4DCTA 4K0BA 5IFIA 4D56A 4I9GA 4LF5C 2VSQA 4LF8C 3GPCA 4KTTA 1MXCA 4B3SC 3CW8X 3DHVA 5CZVA 5DV9A 5A19A 4JYAC 2UXDC 2D1TA 2V7BA 1MKYA 1BA3A 2Y4NA 2QVZX 4B3MC 4MTNA 2P2JA 3LUSA 3FCCA 4JI6C 5BSVA 5KYTA 4NXMC 4D57A 5AE2A 4G37A 3IMLA 4PROC 2QL8A 3ETOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN C;  3R9W A;  4DUZ C;  4X65 C;  2D7V A;  4X64 C;  3AF6 A;  2E8F A;  4DCS A;  2E7G A;  5LMU C;  1N36 C;  4DR7 C;  5A2Q D;  4DV4 C;  3CJE A;  2UUA C;  1JOS A;  3AF5 A;  4XX2 A;  2XR1 A;  2F4V C;  1KKG A;  5IWA C;  4LFA C;  2OPL A;  4B3T C;  2ASB A;  4DCV A;  2KZF A;  2OPL B;  1QWI A;  4DR5 C;  4LF7 C;  4DR2 C;  1ML8 A;  4JI3 C;  4DV0 C;  2ATW A;  3OTO C;  1USP A;  2CY1 A;  4JI8 C;  3J7A D;  4DV7 C;  1ZB9 A;  2VQE C;  2E8E A;  1XNQ C;  2DYJ A;  2YCB A;  2PT7 G;  1N32 C;  4KHP C;  4LF4 C;  3IEU A;  4NXN C;  2JMP A;  2UUB C;  1HH2 P;  3I07 A;  5FLX D;  2HJG A;  3IEV A;  2PN2 A;  2UU9 C;  4DCU A;  2UUC C;  1HNZ C;  1LQL A;  4DV1 C;  4NOZ A;  1PA4 A;  1UKK A;  4DR1 C;  4JV5 C;  4GKK C;  1HNW C;  4DR4 C;  1XMO C;  1IBK C;  4LF9 C;  4OX9 C;  4DCT A;  4JI4 C;  4DUY C;  4YY3 C;  4LF5 C;  3J80 D;  4DV5 C;  4LF8 C;  1XMQ C;  2BJO A;  3T1Y C;  3J81 D;  1K0R A;  2UXB C;  1N2F A;  1XNR C;  4B3S C;  4DR6 C;  1WF3 A;  4X62 C;  4YHH C;  1WH9 A;  4B3R C;  1I94 C;  2ZM6 C;  4DV2 C;  2E5L C;  1IBM C;  4JYA C;  2UXD C;  1ZB8 A;  3JAM D;  1MKY A;  1N34 C;  4LF6 C;  4K0K C;  3R9X A;  4JI5 C;  3GKU A;  2E8C A;  4BSZ A;  1HR0 C;  1USP B;  4B3M C;  4MTN A;  1L2F A;  1VLA A;  3LUS A;  1HNX C;  4JI1 C;  4AQY C;  2EGT A;  4JI6 C;  2CXC A;  4GKJ C;  1N33 C;  4DV3 C;  4JI7 C;  4JI0 C;  1NYE A;  5IT9 D;  4MH4 A;  2VQF C;  4NXM C;  2ONF A;  4DV6 C;  1EGA A;  4LFB C;  4JI2 C;  2HHH C;  3EER A;  4DR3 C;  4LFC C;  5BR8 C;  3T1H C;  1J5E C;  2QL8 A;  1FJG C;  1IBL C;  2UXC C;  4X66 C; 
#chains in the Genus database with same CATH topology
 5LMN C;  3R9W A;  4IZ6 A;  1LCI A;  4X64 C;  3I08 A;  4BC7 A;  3EQ6 A;  5A2Q D;  4DV4 C;  3CJE A;  3AF5 A;  4XX2 A;  4ISB A;  2ASB A;  3CQ3 A;  2KZF A;  4IR7 A;  4DG8 A;  4DR5 C;  3L8C A;  3TUF A;  1ML8 A;  4DV0 C;  2D1S A;  3OTO C;  1ZB9 A;  5T8S A;  2E8E A;  1WCJ A;  1XNQ C;  4EAT A;  3I07 A;  3LAX A;  2PN2 A;  1HNZ C;  1MXB A;  5BUR A;  4DR1 C;  2P02 A;  4GKK C;  4ZJZ A;  4DR4 C;  3N54 B;  4WV3 A;  3UX2 A;  3ETC A;  2KZ0 A;  2VZE A;  2WP0 C;  4DUY C;  4YY3 C;  1PG3 A;  2D1Q A;  1MXA A;  2ZTB A;  1AMU A;  3E7W A;  4DV5 C;  4ZLP A;  3T1Y C;  4RMN A;  4DR6 C;  1WF3 A;  4X62 C;  2ZM6 C;  1UWD A;  1V60 A;  1ZB8 A;  2DPL A;  2KDN A;  4BCA A;  4LF6 C;  4K0K C;  4FUQ A;  3R9X A;  2QVX X;  4RM2 A;  5BSM A;  2M5H A;  4BBY A;  2AYA A;  1HNX C;  3FCE A;  4JI1 C;  1N33 C;  3NYR A;  4JI7 C;  3RG2 A;  5ADZ A;  2ONF A;  5LCI A;  1M6X C;  4JI2 C;  1P4E C;  4ODJ A;  1J5E C;  1IBL C;  2D28 C;  2P20 A;  2Y27 A;  2MCQ A;  4RLQ A;  4L2Z A;  4X65 C;  2P2M A;  1O90 A;  5LMU C;  3A9U A;  4DR7 C;  2WD9 A;  1NY8 A;  2UUA C;  2D27 A;  1JOS A;  1P7L A;  2F4V C;  1KKG A;  3G7S A;  2NCL A;  2OPL A;  1MDF A;  3LGX A;  4DCV A;  1RG9 A;  5BSU A;  1O92 A;  2P2F A;  3B7W A;  4DR2 C;  3H2T A;  4JI8 C;  2CY1 A;  4DV7 C;  1MDB A;  5GTD A;  5A1I A;  1FLO A;  4NXN C;  1PG4 A;  2UUB C;  1FUG A;  2QVY X;  3DAY A;  3RV2 A;  1XHJ A;  1XRA A;  5BST A;  4NOZ A;  4JV5 C;  1HNW C;  4OX9 C;  4LF9 C;  4JI4 C;  2E0G A;  4GS5 A;  3VNQ A;  3J80 D;  1YJ7 A;  3NYQ A;  5E7Q A;  3IPL A;  2M5O A;  5JRH A;  1K0R A;  2UXB C;  1N2F A;  3GR1 A;  1XNR C;  1VEH A;  1XRC A;  4B3R C;  1I94 C;  4DV2 C;  5BUS A;  2E5L C;  1IBM C;  3NPD A;  3JAM D;  3SO4 A;  1N34 C;  1XRB A;  3NI2 A;  4JI5 C;  3A9V A;  4BSZ A;  5T8T A;  1HR0 C;  1L2F A;  4AQY C;  1IB8 A;  2EGT A;  4RVN A;  2CXC A;  4GKJ C;  3A25 A;  3TR3 A;  4BC9 A;  4JI0 C;  1NYE A;  5IT9 D;  4PZP A;  1O93 A;  2VQF C;  4G1I A;  5K85 A;  2P2B A;  3KXW A;  4RVO A;  5BUQ A;  1EGA A;  2BH1 X;  4LFB C;  3EER A;  4DR3 C;  4LFC C;  3T1H C;  5A1G A;  4LE5 A;  1RY2 A;  1GPM A;  4DUZ C;  2MM9 A;  2D7V A;  3LNO A;  2E8F A;  4DCS A;  2Y4O A;  3R44 A;  3E7X A;  3UOW A;  1N36 C;  4PHT A;  5KEI A;  4LFA C;  4R0M A;  4B3T C;  4D4I A;  3AY0 A;  2D1R A;  4PUG A;  1QWI A;  4LF7 C;  2ATW A;  3O2E A;  4JI3 C;  4HPV A;  3TDE A;  5KYV A;  5AE1 A;  3J7A D;  1YGT A;  1O9T A;  3PRO C;  2DYJ A;  2PT7 G;  4TPS B;  4LF4 C;  4GXQ A;  3IEU A;  2JMP A;  4DG9 A;  1HH2 P;  4FTF A;  5FLX D;  1MD9 A;  2UU9 C;  2UUC C;  4NDN A;  1LQL A;  3L95 X;  3VNR A;  4R1L A;  3LNV A;  1IBK C;  4G36 A;  2YX1 A;  5BSW A;  2PG1 E;  1P4E A;  2YWB A;  1XMQ C;  2BJO A;  2OBV A;  4JM1 A;  3CW9 A;  1QM4 A;  3J81 D;  4YHH C;  1WH9 A;  4RLF A;  1V25 A;  4D4G A;  4OYC A;  2YWC A;  3N2Q A;  3GKU A;  2E8C A;  3UZ0 A;  1USP B;  3GR0 A;  1VLA A;  3C5E A;  4WS9 A;  1TH5 A;  3K6R A;  4DV3 C;  4MH4 A;  2P2Q A;  3PBK A;  4DV6 C;  3PES A;  1XS3 A;  4RM3 A;  3TQI A;  4L4Q A;  4PUH A;  4U5Y D;  2HHH C;  3S82 A;  5BSR A;  2ZZN A;  2OO4 A;  4I9F A;  5BR8 C;  1FJG C;  2UXC C;  4X66 C;  1ULT A;  2QW0 X;  3AF6 A;  5K8F A;  3DLP X;  4OXI A;  2E7G A;  5CZX A;  2ZZM A;  3A4I A;  1T5H X;  2XR1 A;  3CQ1 A;  5IWA C;  2MMA B;  4FUT A;  5H9U A;  2CU6 A;  4PUI A;  1V26 A;  4L7I A;  2OPL B;  4R1M A;  1T5D X;  3VNS A;  1USP A;  3UX3 A;  2VQE C;  2YCB A;  1N32 C;  4KHP C;  3FM7 A;  2HJG A;  3IEV A;  2PRO A;  4DCU A;  1M6X A;  4GXR A;  4KTV A;  4DV1 C;  1PA4 A;  1UKK A;  1XMO C;  5AE3 A;  4DCT A;  4K0B A;  1PU1 A;  5IFI A;  4D56 A;  4I9G A;  4LF5 C;  2VSQ A;  4LF8 C;  3GPC A;  4KTT A;  1MXC A;  4B3S C;  3CW8 X;  3DHV A;  5CZV A;  5DV9 A;  5A19 A;  4JYA C;  2UXD C;  2D1T A;  2V7B A;  1MKY A;  1BA3 A;  2Y4N A;  3UEB A;  2QVZ X;  2Z51 A;  3A26 A;  4B3M C;  4MTN A;  2JNV A;  2P2J A;  3LUS A;  3FCC A;  1XDX A;  2DHM A;  4JI6 C;  5BSV A;  5KYT A;  4NXM C;  4D57 A;  5AE2 A;  4G37 A;  3IML A;  4PRO C;  3CQ2 A;  2QL8 A;  3ETO A; 
#chains in the Genus database with same CATH homology
 5LMN C;  3R9W A;  4IZ6 A;  1LCI A;  4X64 C;  3I08 A;  4BC7 A;  3EQ6 A;  5A2Q D;  4DV4 C;  3CJE A;  3AF5 A;  4XX2 A;  4ISB A;  2ASB A;  2KZF A;  4IR7 A;  4DG8 A;  4DR5 C;  3L8C A;  3TUF A;  1ML8 A;  4DV0 C;  2D1S A;  3OTO C;  1ZB9 A;  5T8S A;  2E8E A;  1XNQ C;  4EAT A;  3I07 A;  3LAX A;  2PN2 A;  1HNZ C;  1MXB A;  5BUR A;  4DR1 C;  2P02 A;  4GKK C;  4ZJZ A;  4DR4 C;  3N54 B;  4WV3 A;  3ETC A;  2WP0 C;  2VZE A;  4DUY C;  4YY3 C;  1PG3 A;  2D1Q A;  1MXA A;  1AMU A;  3E7W A;  4DV5 C;  4ZLP A;  3T1Y C;  4RMN A;  4DR6 C;  1WF3 A;  4X62 C;  2ZM6 C;  1ZB8 A;  2DPL A;  4BCA A;  4LF6 C;  4K0K C;  4FUQ A;  3R9X A;  2QVX X;  4RM2 A;  5BSM A;  4BBY A;  2AYA A;  1HNX C;  3FCE A;  4JI1 C;  1N33 C;  3NYR A;  4JI7 C;  3RG2 A;  5ADZ A;  2ONF A;  4JI2 C;  4ODJ A;  1J5E C;  1IBL C;  2D28 C;  2P20 A;  2Y27 A;  4RLQ A;  4L2Z A;  4X65 C;  2P2M A;  1O90 A;  5LMU C;  3A9U A;  4DR7 C;  2WD9 A;  2UUA C;  2D27 A;  1JOS A;  1P7L A;  2F4V C;  1KKG A;  3G7S A;  2OPL A;  1MDF A;  3LGX A;  4DCV A;  1RG9 A;  5BSU A;  1O92 A;  2P2F A;  3B7W A;  4DR2 C;  3H2T A;  4JI8 C;  2CY1 A;  4DV7 C;  1MDB A;  5GTD A;  5A1I A;  4NXN C;  1PG4 A;  2UUB C;  1FUG A;  2QVY X;  3DAY A;  3RV2 A;  1XRA A;  5BST A;  4NOZ A;  4JV5 C;  1HNW C;  4OX9 C;  4LF9 C;  4JI4 C;  2E0G A;  4GS5 A;  3VNQ A;  3J80 D;  1YJ7 A;  3NYQ A;  5E7Q A;  3IPL A;  5JRH A;  1K0R A;  2UXB C;  1N2F A;  3GR1 A;  1XNR C;  1XRC A;  4B3R C;  1I94 C;  4DV2 C;  5BUS A;  2E5L C;  1IBM C;  3NPD A;  3JAM D;  3SO4 A;  1N34 C;  1XRB A;  3NI2 A;  4JI5 C;  3A9V A;  4BSZ A;  5T8T A;  1HR0 C;  1L2F A;  4AQY C;  2EGT A;  4RVN A;  2CXC A;  4GKJ C;  4BC9 A;  4JI0 C;  1NYE A;  5IT9 D;  4PZP A;  1O93 A;  2VQF C;  4G1I A;  5K85 A;  2P2B A;  3KXW A;  4RVO A;  5BUQ A;  1EGA A;  2BH1 X;  4LFB C;  3EER A;  4DR3 C;  4LFC C;  3T1H C;  5A1G A;  4LE5 A;  1RY2 A;  1GPM A;  4DUZ C;  2D7V A;  2E8F A;  4DCS A;  2Y4O A;  3R44 A;  3E7X A;  3UOW A;  1N36 C;  4PHT A;  5KEI A;  4LFA C;  4R0M A;  4B3T C;  4D4I A;  2D1R A;  1QWI A;  4LF7 C;  2ATW A;  4JI3 C;  4HPV A;  3TDE A;  5KYV A;  5AE1 A;  3J7A D;  1O9T A;  3PRO C;  2DYJ A;  2PT7 G;  4TPS B;  4LF4 C;  4GXQ A;  3IEU A;  2JMP A;  4DG9 A;  1HH2 P;  4FTF A;  5FLX D;  1MD9 A;  2UU9 C;  2UUC C;  4NDN A;  1LQL A;  3L95 X;  3VNR A;  4R1L A;  3LNV A;  1IBK C;  4G36 A;  5BSW A;  2YWB A;  1XMQ C;  2BJO A;  2OBV A;  4JM1 A;  3CW9 A;  1QM4 A;  3J81 D;  4YHH C;  1WH9 A;  4RLF A;  1V25 A;  4D4G A;  4OYC A;  2YWC A;  3N2Q A;  3GKU A;  2E8C A;  3UZ0 A;  1USP B;  3GR0 A;  1VLA A;  3C5E A;  4WS9 A;  4DV3 C;  4MH4 A;  2P2Q A;  3PBK A;  4DV6 C;  3PES A;  4RM3 A;  3TQI A;  4L4Q A;  4U5Y D;  2HHH C;  3S82 A;  5BSR A;  2OO4 A;  4I9F A;  5BR8 C;  1FJG C;  2UXC C;  4X66 C;  1ULT A;  2QW0 X;  3AF6 A;  5K8F A;  3DLP X;  4OXI A;  2E7G A;  5CZX A;  3A4I A;  1T5H X;  2XR1 A;  5IWA C;  4FUT A;  5H9U A;  1V26 A;  4L7I A;  2OPL B;  4R1M A;  1T5D X;  3VNS A;  1USP A;  2VQE C;  2YCB A;  1N32 C;  4KHP C;  2HJG A;  3IEV A;  2PRO A;  4DCU A;  4GXR A;  4KTV A;  4DV1 C;  1PA4 A;  1UKK A;  1XMO C;  5AE3 A;  4DCT A;  4K0B A;  5IFI A;  4D56 A;  4I9G A;  4LF5 C;  2VSQ A;  4LF8 C;  3GPC A;  4KTT A;  1MXC A;  4B3S C;  3CW8 X;  3DHV A;  5CZV A;  5DV9 A;  5A19 A;  4JYA C;  2UXD C;  2D1T A;  2V7B A;  1MKY A;  1BA3 A;  2Y4N A;  2QVZ X;  4B3M C;  4MTN A;  2P2J A;  3LUS A;  3FCC A;  4JI6 C;  5BSV A;  5KYT A;  4NXM C;  4D57 A;  5AE2 A;  4G37 A;  3IML A;  4PRO C;  2QL8 A;  3ETO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...