1HNZC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hnzC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hnzC02
2UUAC 4B3SC 5LMNC 2HHHC 5BR8C 2ASBA 2UUBC 4DR4C 1EGAA 1HR0C 4B3MC 4BSZA 4B3TC 1ML8A 4K0KC 4DR5C 3R9XA 4JI2C 4KHPC 1N33C 2EGTA 4DV0C 2E8FA 4AQYC 1L2FA 1N2FA 2PN2A 4DCUA 2E8CA 1IBLC 4X64C 3J81D 4LFCC 2E8EA 4LFBC 4DCSA 4X66C 1N34C 4DUYC 2UU9C 5FLXD 1K0RA 2XR1A 2ZM6C 4NXNC 3AF6A 4DV7C 4JI3C 4YHHC 3IEUA 1MKYA 4DV2C 4JI5C 4YY3C 2ATWA 4GKJC 1LQLA 1USPB 1J5EC 4JI8C 3J7AD 1WF3A 2OPLA 1I94C 3I07A 4X65C 4LF7C 2UUCC 4X62C 3OTOC 5LMUC 4JI1C 4JI0C 1N32C 2BJOA 4DV1C 1UKKA 1KKGA 1XMOC 2VQFC 4JI6C 1XMQC 4LF4C 1HNXC 2PT7G 4DV4C 5IT9D 4DR3C 4DUZC 2VQEC 2CY1A 1NYEA 4DCTA 3GKUA 1USPA 1ZB9A 2YCBA 2KZFA 1XNRC 3LUSA 4DV6C 1N36C 1HNZC 2DYJA 4DV5C 2UXCC 2UXBC 3T1HC 1JOSA 4DCVA 5A2QD 2CXCA 5IWAC 1HH2P 4LF5C 1QWIA 3J80D 2QL8A 4LF8C 4JYAC 4LFAC 1WH9A 1IBKC 3AF5A 3CJEA 2ONFA 4MTNA 1PA4A 4DR6C 4JI7C 3R9WA 4DR2C 1ZB8A 1IBMC 4JI4C 4MH4A 1VLAA 2OPLB 4NOZA 3JAMD 2F4VC 4LF6C 2E7GA 4JV5C 4DV3C 2HJGA 4OX9C 1FJGC 4DR1C 3EERA 4NXMC 2D7VA 2JMPA 2UXDC 1HNWC 2E5LC 4DR7C 4B3RC 1XNQC 3IEVA 4LF9C 4XX2A 3T1YC 4GKKC
chains in the Genus database with same CATH superfamily
2PG1E 3CQ2A 2UUAC 3NI2A 5BSTA 2D1QA 1XRBA 4IR7A 4B3TC 1ML8A 3L95X 1MDBA 4RVNA 1N33C 3E7WA 4G37A 2ZZMA 1T5DX 1RY2A 1MXAA 4PROC 3ETCA 4ISBA 1TH5A 4LFBC 3A9VA 1GPMA 1N34C 5AE3A 2ZM6C 3UZ0A 1MKYA 4JI5C 1VEHA 2M5OA 4BBYA 4ZLPA 3G7SA 3I07A 5BSRA 3RV2A 4LF7C 2DPLA 3GPCA 1P4EA 2OBVA 1N32C 2QW0X 3FCCA 5A1IA 1XMOC 4G1IA 1XHJA 4WV3A 4RLFA 4RMNA 4PHTA 4D57A 3A4IA 4DUZC 2VQEC 1XRAA 4DCTA 4WS9A 2KZFA 1N36C 4I9GA 2DYJA 2UXCC 4G36A 3T1HC 2P02A 3RG2A 2CXCA 5IWAC 3KXWA 5LCIA 3J80D 2E0GA 1IBKC 3AF5A 2Z51A 1O93A 1V26A 3PESA 1YGTA 3SO4A 3S82A 5CZXA 4LF6C 1PG3A 4JV5C 4R1MA 3TQIA 4HPVA 1XDXA 4BC9A 4OX9C 1FJGC 2YX1A 4DR1C 1M6XA 4PUGA 3EERA 1MXBA 5BSWA 1AMUA 4D4IA 4JM1A 2KZ0A 4B3SC 2HHHC 5BUSA 3A26A 5BR8C 2UUBC 4B3MC 4BSZA 4L4QA 1FUGA 5H9UA 3R9XA 1MXCA 3CQ3A 4AQYC 2PN2A 2VZEA 2E8CA 1T5HX 4FUQA 4X64C 5K85A 2ZTBA 5CZVA 2XR1A 4DV7C 3VNRA 2Y4OA 1O92A 4I9FA 1P7LA 3TUFA 4BCAA 5KYTA 4GS5A 4DV1C 3A25A 2MMAB 2QVXX 4R0MA 4LF4C 5BSVA 4DR3C 2CY1A 1BA3A 1NYEA 3GKUA 2DHMA 2YCBA 3LUSA 4DV5C 1M6XC 5IFIA 1JOSA 1O9TA 1ULTA 5A2QD 4LF5C 5ADZA 1QWIA 4GXRA 2QL8A 4LF8C 4JYAC 4LFAC 3UOWA 3FCEA 1PA4A 4K0BA 4JI7C 2D1SA 4KTVA 3R9WA 4ODJA 3DLPX 2V7BA 4JI4C 5JRHA 3CQ1A 2OPLB 1RG9A 2F4VC 4DV3C 1XS3A 3EQ6A 4DG9A 2Y27A 2Y4NA 2UXDC 1HNWC 2E5LC 2P2JA 1XNQC 3IEVA 4LF9C 1NY8A 2UUCC 4L7IA 2ZZNA 2QVZX 2ASBA 5A1GA 1HR0C 1UWDA 5A19A 3DHVA 2YWCA 4DR5C 4JI2C 4BC7A 3IMLA 5T8SA 4DV0C 2E8FA 1L2FA 3LNVA 2VSQA 4X66C 2NCLA 4DUYC 3L8CA 5FLXD 1K0RA 4NXNC 2CU6A 4JI3C 5AE1A 4YHHC 3GR0A 4DV2C 4YY3C 2D1RA 1J5EC 4FTFA 4JI8C 3J7AD 2OPLA 1WCJA 1I94C 4PUHA 4LE5A 4X65C 4X62C 3OTOC 5LMUC 4JI0C 1UKKA 1KKGA 4EATA 5BUQA 5E7QA 4GXQA 1LCIA 5T8TA 4JI6C 2PT7G 4DV4C 5DV9A 2BH1X 5IT9D 3N2QA 5K8FA 4NDNA 4D4GA 3FM7A 2KDNA 1USPA 1XNRC 1HNZC 2UXBC 1V25A 3N54B 4RM2A 4DCVA 2M5HA 1HH2P 2D27A 1WH9A 2YWBA 3E7XA 3CJEA 2ONFA 3PBKA 4ZJZA 2MM9A 4MTNA 4PUIA 4DR6C 5KYVA 4DR2C 1ZB8A 2QVYX 5KEIA 1IBMC 3TR3A 3K6RA 2P2MA 3DAYA 3O2EA 2WD9A 4RVOA 4RLQA 5GTDA 2D7VA 3VNQA 3C5EA 4OYCA 3I08A 1QM4A 4XX2A 1V60A 3T1YC 5LMNC 4DR4C 1EGAA 2PROA 4KTTA 2WP0C 4K0KC 1PG4A 4KHPC 2EGTA 4TPSB 3LAXA 1XRCA 1FLOA 1N2FA 4DCUA 1YJ7A 1IBLC 3AY0A 3J81D 4LFCC 2E8EA 2D1TA 4DCSA 2UU9C 3AF6A 3IEUA 3CW8X 2ATWA 4GKJC 1LQLA 1USPB 5BURA 1IB8A 1WF3A 3A9UA 5BSUA 4IZ6A 3LGXA 2OO4A 4JI1C 2BJOA 5AE2A 2P2BA 3PROC 4R1LA 3NYRA 4DG8A 4D56A 3GR1A 5BSMA 4OXIA 2VQFC 1XMQC 1HNXC 2P2QA 3CW9A 4RM3A 3UEBA 3UX3A 4FUTA 1ZB9A 1PU1A 2D28C 4DV6C 3LNOA 3H2TA 2MCQA 3B7WA 3ETOA 3NYQA 3UX2A 4U5YD 3VNSA 3TDEA 4PZPA 1O90A 2JNVA 2P20A 4MH4A 1VLAA 4NOZA 3JAMD 2E7GA 2HJGA 1P4EC 1MDFA 2P2FA 3NPDA 4NXMC 2JMPA 4DR7C 4L2ZA 4B3RC 3R44A 3IPLA 1MD9A 2AYAA 4GKKC
chains in the Genus database with same CATH topology
2UUAC 3NI2A 5BSTA 2D1QA 1XRBA 4IR7A 4B3TC 1ML8A 3L95X 1MDBA 4RVNA 1N33C 3E7WA 4G37A 1T5DX 1RY2A 1MXAA 4PROC 3ETCA 4ISBA 4LFBC 3A9VA 1GPMA 1N34C 5AE3A 2ZM6C 3UZ0A 1MKYA 4JI5C 4BBYA 4ZLPA 3G7SA 3I07A 5BSRA 3RV2A 4LF7C 2DPLA 3GPCA 2OBVA 1N32C 2QW0X 3FCCA 5A1IA 1XMOC 4G1IA 4WV3A 4RLFA 4RMNA 4PHTA 4D57A 3A4IA 4DUZC 2VQEC 1XRAA 4DCTA 4WS9A 2KZFA 1N36C 4I9GA 2DYJA 2UXCC 4G36A 3T1HC 2P02A 3RG2A 2CXCA 5IWAC 3KXWA 3J80D 2E0GA 1IBKC 3AF5A 1O93A 1V26A 3PESA 3SO4A 3S82A 5CZXA 4LF6C 1PG3A 4JV5C 4R1MA 3TQIA 4HPVA 4BC9A 4OX9C 1FJGC 4DR1C 3EERA 1MXBA 5BSWA 1AMUA 4D4IA 4JM1A 4B3SC 2HHHC 5BUSA 5BR8C 2UUBC 4B3MC 4BSZA 4L4QA 1FUGA 5H9UA 3R9XA 1MXCA 4AQYC 2PN2A 2VZEA 2E8CA 1T5HX 4FUQA 4X64C 5K85A 5CZVA 2XR1A 4DV7C 3VNRA 2Y4OA 1O92A 4I9FA 1P7LA 3TUFA 4BCAA 5KYTA 4GS5A 4DV1C 2QVXX 4R0MA 4LF4C 5BSVA 4DR3C 2CY1A 1BA3A 1NYEA 3GKUA 2YCBA 3LUSA 4DV5C 5IFIA 1JOSA 1O9TA 1ULTA 5A2QD 4LF5C 5ADZA 1QWIA 4GXRA 2QL8A 4LF8C 4JYAC 4LFAC 3UOWA 3FCEA 1PA4A 4K0BA 4JI7C 2D1SA 4KTVA 3R9WA 4ODJA 3DLPX 2V7BA 4JI4C 5JRHA 2OPLB 1RG9A 2F4VC 4DV3C 3EQ6A 4DG9A 2Y27A 2Y4NA 2UXDC 1HNWC 2E5LC 2P2JA 1XNQC 3IEVA 4LF9C 2UUCC 4L7IA 2QVZX 2ASBA 5A1GA 1HR0C 5A19A 3DHVA 2YWCA 4DR5C 4JI2C 4BC7A 3IMLA 5T8SA 4DV0C 2E8FA 1L2FA 3LNVA 2VSQA 4X66C 4DUYC 3L8CA 5FLXD 1K0RA 4NXNC 4JI3C 5AE1A 4YHHC 3GR0A 4DV2C 4YY3C 2D1RA 1J5EC 4FTFA 4JI8C 3J7AD 2OPLA 1I94C 4LE5A 4X65C 4X62C 3OTOC 5LMUC 4JI0C 1UKKA 1KKGA 4EATA 5BUQA 5E7QA 4GXQA 1LCIA 5T8TA 4JI6C 2PT7G 4DV4C 5DV9A 2BH1X 5IT9D 3N2QA 5K8FA 4NDNA 4D4GA 1USPA 1XNRC 1HNZC 2UXBC 1V25A 3N54B 4RM2A 4DCVA 1HH2P 2D27A 1WH9A 2YWBA 3E7XA 3CJEA 2ONFA 3PBKA 4MTNA 4ZJZA 4DR6C 5KYVA 4DR2C 1ZB8A 2QVYX 5KEIA 1IBMC 2P2MA 3DAYA 2WD9A 4RVOA 4RLQA 5GTDA 2D7VA 3VNQA 3C5EA 4OYCA 3I08A 1QM4A 4XX2A 3T1YC 5LMNC 4DR4C 1EGAA 2PROA 4KTTA 2WP0C 4K0KC 1PG4A 4KHPC 2EGTA 4TPSB 3LAXA 1XRCA 1N2FA 4DCUA 1YJ7A 1IBLC 3J81D 4LFCC 2E8EA 2D1TA 4DCSA 2UU9C 3AF6A 3IEUA 3CW8X 2ATWA 4GKJC 1LQLA 1USPB 5BURA 1WF3A 3A9UA 5BSUA 4IZ6A 3LGXA 2OO4A 4JI1C 2BJOA 5AE2A 2P2BA 3PROC 4R1LA 3NYRA 4DG8A 4D56A 3GR1A 5BSMA 4OXIA 2VQFC 1XMQC 1HNXC 2P2QA 3CW9A 4RM3A 4FUTA 1ZB9A 2D28C 4DV6C 3H2TA 3B7WA 3ETOA 3NYQA 4U5YD 3VNSA 3TDEA 4PZPA 1O90A 2P20A 4MH4A 1VLAA 4NOZA 3JAMD 2E7GA 2HJGA 1MDFA 2P2FA 3NPDA 4NXMC 2JMPA 4DR7C 4L2ZA 4B3RC 3R44A 3IPLA 1MD9A 2AYAA 4GKKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA C;  4B3S C;  5LMN C;  2HHH C;  5BR8 C;  2ASB A;  2UUB C;  4DR4 C;  1EGA A;  1HR0 C;  4B3M C;  4BSZ A;  4B3T C;  1ML8 A;  4K0K C;  4DR5 C;  3R9X A;  4JI2 C;  4KHP C;  1N33 C;  2EGT A;  4DV0 C;  2E8F A;  4AQY C;  1L2F A;  1N2F A;  2PN2 A;  4DCU A;  2E8C A;  1IBL C;  4X64 C;  3J81 D;  4LFC C;  2E8E A;  4LFB C;  4DCS A;  4X66 C;  1N34 C;  4DUY C;  2UU9 C;  5FLX D;  1K0R A;  2XR1 A;  2ZM6 C;  4NXN C;  3AF6 A;  4DV7 C;  4JI3 C;  4YHH C;  3IEU A;  1MKY A;  4DV2 C;  4JI5 C;  4YY3 C;  2ATW A;  4GKJ C;  1LQL A;  1USP B;  1J5E C;  4JI8 C;  3J7A D;  1WF3 A;  2OPL A;  1I94 C;  3I07 A;  4X65 C;  4LF7 C;  2UUC C;  4X62 C;  3OTO C;  5LMU C;  4JI1 C;  4JI0 C;  1N32 C;  2BJO A;  4DV1 C;  1UKK A;  1KKG A;  1XMO C;  2VQF C;  4JI6 C;  1XMQ C;  4LF4 C;  1HNX C;  2PT7 G;  4DV4 C;  5IT9 D;  4DR3 C;  4DUZ C;  2VQE C;  2CY1 A;  1NYE A;  4DCT A;  3GKU A;  1USP A;  1ZB9 A;  2YCB A;  2KZF A;  1XNR C;  3LUS A;  4DV6 C;  1N36 C;  1HNZ C;  2DYJ A;  4DV5 C;  2UXC C;  2UXB C;  3T1H C;  1JOS A;  4DCV A;  5A2Q D;  2CXC A;  5IWA C;  1HH2 P;  4LF5 C;  1QWI A;  3J80 D;  2QL8 A;  4LF8 C;  4JYA C;  4LFA C;  1WH9 A;  1IBK C;  3AF5 A;  3CJE A;  2ONF A;  4MTN A;  1PA4 A;  4DR6 C;  4JI7 C;  3R9W A;  4DR2 C;  1ZB8 A;  1IBM C;  4JI4 C;  4MH4 A;  1VLA A;  2OPL B;  4NOZ A;  3JAM D;  2F4V C;  4LF6 C;  2E7G A;  4JV5 C;  4DV3 C;  2HJG A;  4OX9 C;  1FJG C;  4DR1 C;  3EER A;  4NXM C;  2D7V A;  2JMP A;  2UXD C;  1HNW C;  2E5L C;  4DR7 C;  4B3R C;  1XNQ C;  3IEV A;  4LF9 C;  4XX2 A;  3T1Y C;  4GKK C; 
#chains in the Genus database with same CATH topology
 2PG1 E;  3CQ2 A;  2UUA C;  3NI2 A;  5BST A;  2D1Q A;  1XRB A;  4IR7 A;  4B3T C;  1ML8 A;  3L95 X;  1MDB A;  4RVN A;  1N33 C;  3E7W A;  4G37 A;  2ZZM A;  1T5D X;  1RY2 A;  1MXA A;  4PRO C;  3ETC A;  4ISB A;  1TH5 A;  4LFB C;  3A9V A;  1GPM A;  1N34 C;  5AE3 A;  2ZM6 C;  3UZ0 A;  1MKY A;  4JI5 C;  1VEH A;  2M5O A;  4BBY A;  4ZLP A;  3G7S A;  3I07 A;  5BSR A;  3RV2 A;  4LF7 C;  2DPL A;  3GPC A;  1P4E A;  2OBV A;  1N32 C;  2QW0 X;  3FCC A;  5A1I A;  1XMO C;  4G1I A;  1XHJ A;  4WV3 A;  4RLF A;  4RMN A;  4PHT A;  4D57 A;  3A4I A;  4DUZ C;  2VQE C;  1XRA A;  4DCT A;  4WS9 A;  2KZF A;  1N36 C;  4I9G A;  2DYJ A;  2UXC C;  4G36 A;  3T1H C;  2P02 A;  3RG2 A;  2CXC A;  5IWA C;  3KXW A;  5LCI A;  3J80 D;  2E0G A;  1IBK C;  3AF5 A;  2Z51 A;  1O93 A;  1V26 A;  3PES A;  1YGT A;  3SO4 A;  3S82 A;  5CZX A;  4LF6 C;  1PG3 A;  4JV5 C;  4R1M A;  3TQI A;  4HPV A;  1XDX A;  4BC9 A;  4OX9 C;  1FJG C;  2YX1 A;  4DR1 C;  1M6X A;  4PUG A;  3EER A;  1MXB A;  5BSW A;  1AMU A;  4D4I A;  4JM1 A;  2KZ0 A;  4B3S C;  2HHH C;  5BUS A;  3A26 A;  5BR8 C;  2UUB C;  4B3M C;  4BSZ A;  4L4Q A;  1FUG A;  5H9U A;  3R9X A;  1MXC A;  3CQ3 A;  4AQY C;  2PN2 A;  2VZE A;  2E8C A;  1T5H X;  4FUQ A;  4X64 C;  5K85 A;  2ZTB A;  5CZV A;  2XR1 A;  4DV7 C;  3VNR A;  2Y4O A;  1O92 A;  4I9F A;  1P7L A;  3TUF A;  4BCA A;  5KYT A;  4GS5 A;  4DV1 C;  3A25 A;  2MMA B;  2QVX X;  4R0M A;  4LF4 C;  5BSV A;  4DR3 C;  2CY1 A;  1BA3 A;  1NYE A;  3GKU A;  2DHM A;  2YCB A;  3LUS A;  4DV5 C;  1M6X C;  5IFI A;  1JOS A;  1O9T A;  1ULT A;  5A2Q D;  4LF5 C;  5ADZ A;  1QWI A;  4GXR A;  2QL8 A;  4LF8 C;  4JYA C;  4LFA C;  3UOW A;  3FCE A;  1PA4 A;  4K0B A;  4JI7 C;  2D1S A;  4KTV A;  3R9W A;  4ODJ A;  3DLP X;  2V7B A;  4JI4 C;  5JRH A;  3CQ1 A;  2OPL B;  1RG9 A;  2F4V C;  4DV3 C;  1XS3 A;  3EQ6 A;  4DG9 A;  2Y27 A;  2Y4N A;  2UXD C;  1HNW C;  2E5L C;  2P2J A;  1XNQ C;  3IEV A;  4LF9 C;  1NY8 A;  2UUC C;  4L7I A;  2ZZN A;  2QVZ X;  2ASB A;  5A1G A;  1HR0 C;  1UWD A;  5A19 A;  3DHV A;  2YWC A;  4DR5 C;  4JI2 C;  4BC7 A;  3IML A;  5T8S A;  4DV0 C;  2E8F A;  1L2F A;  3LNV A;  2VSQ A;  4X66 C;  2NCL A;  4DUY C;  3L8C A;  5FLX D;  1K0R A;  4NXN C;  2CU6 A;  4JI3 C;  5AE1 A;  4YHH C;  3GR0 A;  4DV2 C;  4YY3 C;  2D1R A;  1J5E C;  4FTF A;  4JI8 C;  3J7A D;  2OPL A;  1WCJ A;  1I94 C;  4PUH A;  4LE5 A;  4X65 C;  4X62 C;  3OTO C;  5LMU C;  4JI0 C;  1UKK A;  1KKG A;  4EAT A;  5BUQ A;  5E7Q A;  4GXQ A;  1LCI A;  5T8T A;  4JI6 C;  2PT7 G;  4DV4 C;  5DV9 A;  2BH1 X;  5IT9 D;  3N2Q A;  5K8F A;  4NDN A;  4D4G A;  3FM7 A;  2KDN A;  1USP A;  1XNR C;  1HNZ C;  2UXB C;  1V25 A;  3N54 B;  4RM2 A;  4DCV A;  2M5H A;  1HH2 P;  2D27 A;  1WH9 A;  2YWB A;  3E7X A;  3CJE A;  2ONF A;  3PBK A;  4ZJZ A;  2MM9 A;  4MTN A;  4PUI A;  4DR6 C;  5KYV A;  4DR2 C;  1ZB8 A;  2QVY X;  5KEI A;  1IBM C;  3TR3 A;  3K6R A;  2P2M A;  3DAY A;  3O2E A;  2WD9 A;  4RVO A;  4RLQ A;  5GTD A;  2D7V A;  3VNQ A;  3C5E A;  4OYC A;  3I08 A;  1QM4 A;  4XX2 A;  1V60 A;  3T1Y C;  5LMN C;  4DR4 C;  1EGA A;  2PRO A;  4KTT A;  2WP0 C;  4K0K C;  1PG4 A;  4KHP C;  2EGT A;  4TPS B;  3LAX A;  1XRC A;  1FLO A;  1N2F A;  4DCU A;  1YJ7 A;  1IBL C;  3AY0 A;  3J81 D;  4LFC C;  2E8E A;  2D1T A;  4DCS A;  2UU9 C;  3AF6 A;  3IEU A;  3CW8 X;  2ATW A;  4GKJ C;  1LQL A;  1USP B;  5BUR A;  1IB8 A;  1WF3 A;  3A9U A;  5BSU A;  4IZ6 A;  3LGX A;  2OO4 A;  4JI1 C;  2BJO A;  5AE2 A;  2P2B A;  3PRO C;  4R1L A;  3NYR A;  4DG8 A;  4D56 A;  3GR1 A;  5BSM A;  4OXI A;  2VQF C;  1XMQ C;  1HNX C;  2P2Q A;  3CW9 A;  4RM3 A;  3UEB A;  3UX3 A;  4FUT A;  1ZB9 A;  1PU1 A;  2D28 C;  4DV6 C;  3LNO A;  3H2T A;  2MCQ A;  3B7W A;  3ETO A;  3NYQ A;  3UX2 A;  4U5Y D;  3VNS A;  3TDE A;  4PZP A;  1O90 A;  2JNV A;  2P20 A;  4MH4 A;  1VLA A;  4NOZ A;  3JAM D;  2E7G A;  2HJG A;  1P4E C;  1MDF A;  2P2F A;  3NPD A;  4NXM C;  2JMP A;  4DR7 C;  4L2Z A;  4B3R C;  3R44 A;  3IPL A;  1MD9 A;  2AYA A;  4GKK C; 
#chains in the Genus database with same CATH homology
 2UUA C;  3NI2 A;  5BST A;  2D1Q A;  1XRB A;  4IR7 A;  4B3T C;  1ML8 A;  3L95 X;  1MDB A;  4RVN A;  1N33 C;  3E7W A;  4G37 A;  1T5D X;  1RY2 A;  1MXA A;  4PRO C;  3ETC A;  4ISB A;  4LFB C;  3A9V A;  1GPM A;  1N34 C;  5AE3 A;  2ZM6 C;  3UZ0 A;  1MKY A;  4JI5 C;  4BBY A;  4ZLP A;  3G7S A;  3I07 A;  5BSR A;  3RV2 A;  4LF7 C;  2DPL A;  3GPC A;  2OBV A;  1N32 C;  2QW0 X;  3FCC A;  5A1I A;  1XMO C;  4G1I A;  4WV3 A;  4RLF A;  4RMN A;  4PHT A;  4D57 A;  3A4I A;  4DUZ C;  2VQE C;  1XRA A;  4DCT A;  4WS9 A;  2KZF A;  1N36 C;  4I9G A;  2DYJ A;  2UXC C;  4G36 A;  3T1H C;  2P02 A;  3RG2 A;  2CXC A;  5IWA C;  3KXW A;  3J80 D;  2E0G A;  1IBK C;  3AF5 A;  1O93 A;  1V26 A;  3PES A;  3SO4 A;  3S82 A;  5CZX A;  4LF6 C;  1PG3 A;  4JV5 C;  4R1M A;  3TQI A;  4HPV A;  4BC9 A;  4OX9 C;  1FJG C;  4DR1 C;  3EER A;  1MXB A;  5BSW A;  1AMU A;  4D4I A;  4JM1 A;  4B3S C;  2HHH C;  5BUS A;  5BR8 C;  2UUB C;  4B3M C;  4BSZ A;  4L4Q A;  1FUG A;  5H9U A;  3R9X A;  1MXC A;  4AQY C;  2PN2 A;  2VZE A;  2E8C A;  1T5H X;  4FUQ A;  4X64 C;  5K85 A;  5CZV A;  2XR1 A;  4DV7 C;  3VNR A;  2Y4O A;  1O92 A;  4I9F A;  1P7L A;  3TUF A;  4BCA A;  5KYT A;  4GS5 A;  4DV1 C;  2QVX X;  4R0M A;  4LF4 C;  5BSV A;  4DR3 C;  2CY1 A;  1BA3 A;  1NYE A;  3GKU A;  2YCB A;  3LUS A;  4DV5 C;  5IFI A;  1JOS A;  1O9T A;  1ULT A;  5A2Q D;  4LF5 C;  5ADZ A;  1QWI A;  4GXR A;  2QL8 A;  4LF8 C;  4JYA C;  4LFA C;  3UOW A;  3FCE A;  1PA4 A;  4K0B A;  4JI7 C;  2D1S A;  4KTV A;  3R9W A;  4ODJ A;  3DLP X;  2V7B A;  4JI4 C;  5JRH A;  2OPL B;  1RG9 A;  2F4V C;  4DV3 C;  3EQ6 A;  4DG9 A;  2Y27 A;  2Y4N A;  2UXD C;  1HNW C;  2E5L C;  2P2J A;  1XNQ C;  3IEV A;  4LF9 C;  2UUC C;  4L7I A;  2QVZ X;  2ASB A;  5A1G A;  1HR0 C;  5A19 A;  3DHV A;  2YWC A;  4DR5 C;  4JI2 C;  4BC7 A;  3IML A;  5T8S A;  4DV0 C;  2E8F A;  1L2F A;  3LNV A;  2VSQ A;  4X66 C;  4DUY C;  3L8C A;  5FLX D;  1K0R A;  4NXN C;  4JI3 C;  5AE1 A;  4YHH C;  3GR0 A;  4DV2 C;  4YY3 C;  2D1R A;  1J5E C;  4FTF A;  4JI8 C;  3J7A D;  2OPL A;  1I94 C;  4LE5 A;  4X65 C;  4X62 C;  3OTO C;  5LMU C;  4JI0 C;  1UKK A;  1KKG A;  4EAT A;  5BUQ A;  5E7Q A;  4GXQ A;  1LCI A;  5T8T A;  4JI6 C;  2PT7 G;  4DV4 C;  5DV9 A;  2BH1 X;  5IT9 D;  3N2Q A;  5K8F A;  4NDN A;  4D4G A;  1USP A;  1XNR C;  1HNZ C;  2UXB C;  1V25 A;  3N54 B;  4RM2 A;  4DCV A;  1HH2 P;  2D27 A;  1WH9 A;  2YWB A;  3E7X A;  3CJE A;  2ONF A;  3PBK A;  4MTN A;  4ZJZ A;  4DR6 C;  5KYV A;  4DR2 C;  1ZB8 A;  2QVY X;  5KEI A;  1IBM C;  2P2M A;  3DAY A;  2WD9 A;  4RVO A;  4RLQ A;  5GTD A;  2D7V A;  3VNQ A;  3C5E A;  4OYC A;  3I08 A;  1QM4 A;  4XX2 A;  3T1Y C;  5LMN C;  4DR4 C;  1EGA A;  2PRO A;  4KTT A;  2WP0 C;  4K0K C;  1PG4 A;  4KHP C;  2EGT A;  4TPS B;  3LAX A;  1XRC A;  1N2F A;  4DCU A;  1YJ7 A;  1IBL C;  3J81 D;  4LFC C;  2E8E A;  2D1T A;  4DCS A;  2UU9 C;  3AF6 A;  3IEU A;  3CW8 X;  2ATW A;  4GKJ C;  1LQL A;  1USP B;  5BUR A;  1WF3 A;  3A9U A;  5BSU A;  4IZ6 A;  3LGX A;  2OO4 A;  4JI1 C;  2BJO A;  5AE2 A;  2P2B A;  3PRO C;  4R1L A;  3NYR A;  4DG8 A;  4D56 A;  3GR1 A;  5BSM A;  4OXI A;  2VQF C;  1XMQ C;  1HNX C;  2P2Q A;  3CW9 A;  4RM3 A;  4FUT A;  1ZB9 A;  2D28 C;  4DV6 C;  3H2T A;  3B7W A;  3ETO A;  3NYQ A;  4U5Y D;  3VNS A;  3TDE A;  4PZP A;  1O90 A;  2P20 A;  4MH4 A;  1VLA A;  4NOZ A;  3JAM D;  2E7G A;  2HJG A;  1MDF A;  2P2F A;  3NPD A;  4NXM C;  2JMP A;  4DR7 C;  4L2Z A;  4B3R C;  3R44 A;  3IPL A;  1MD9 A;  2AYA A;  4GKK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...