1HNZC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hnzC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hnzC02
1JOSA 2KZFA 1XNRC 3IEVA 4JYAC 2UUCC 1XMOC 4JI6C 1ZB9A 2OPLB 1WH9A 1EGAA 2XR1A 4DCUA 4LFCC 3I07A 5A2QD 4DR6C 1USPA 4X62C 2YCBA 2UUAC 5IT9D 2JMPA 4JV5C 4DV2C 2DYJA 4MTNA 4XX2A 2E5LC 2UXBC 1XMQC 2VQEC 2E7GA 1HH2P 1HNXC 4DR7C 2ZM6C 1XNQC 2E8EA 3AF6A 3IEUA 2HJGA 2F4VC 4DR4C 1N2FA 3LUSA 2BJOA 1I94C 4MH4A 4JI3C 1N34C 1MKYA 5BR8C 4JI1C 2UUBC 4JI8C 1L2FA 5LMNC 1N32C 3T1HC 4KHPC 4LF7C 4X64C 3R9WA 3EERA 1QWIA 2E8CA 1IBMC 1N33C 3AF5A 4JI0C 4DR5C 1PA4A 4GKKC 3CJEA 4DV3C 1N36C 1HNZC 3GKUA 3J80D 1ML8A 4DUZC 4DCVA 4DR3C 2PT7G 1LQLA 4OX9C 1KKGA 4LF9C 1HR0C 1VLAA 4AQYC 1USPB 5LMUC 4JI7C 4LFBC 2OPLA 3J81D 2E8FA 4B3SC 3OTOC 4NXNC 2QL8A 5IWAC 4DV4C 4B3TC 2EGTA 4DUYC 4YY3C 4BSZA 3T1YC 4LF6C 4X65C 4LF4C 1NYEA 2HHHC 4GKJC 4X66C 2ATWA 1ZB8A 4DV5C 1J5EC 2CXCA 2D7VA 2PN2A 4DV0C 1K0RA 1IBKC 4JI2C 4LFAC 2ASBA 4LF8C 3J7AD 4DCTA 4DV1C 4K0KC 4LF5C 1HNWC 2CY1A 4B3MC 3R9XA 1UKKA 4DR2C 4NXMC 5FLXD 2ONFA 2VQFC 2UXDC 2UXCC 4DV7C 4YHHC 4JI5C 1FJGC 1WF3A 1IBLC 4DR1C 2UU9C 4JI4C 4NOZA 4DV6C 4B3RC 3JAMD 4DCSA
chains in the Genus database with same CATH superfamily
2KZFA 4ZJZA 2UUCC 2PG1E 3GR1A 1XMOC 1MXAA 3VNRA 1EGAA 2XR1A 2P2QA 3LGXA 5T8TA 5BSVA 5K8FA 4MTNA 3O2EA 2VZEA 5CZXA 4D56A 3RG2A 2E7GA 1HH2P 4LE5A 5LCIA 3A4IA 1MD9A 2QW0X 2F4VC 3C5EA 2V7BA 4DR4C 2BJOA 1I94C 4EATA 4MH4A 2ZZNA 5BR8C 2UUBC 1L2FA 3T1HC 4GXQA 4KTTA 4LF7C 2VSQA 3R9WA 3ETOA 3N2QA 3EERA 2MM9A 1PA4A 2P02A 5AE2A 1XRBA 1N36C 4IR7A 1YJ7A 4JI7C 3UX2A 1USPB 1M6XC 2OPLA 3J81D 4B3SC 3OTOC 4FUQA 4NXNC 5A19A 3EQ6A 2YWCA 4YY3C 5BUSA 4JM1A 3LAXA 1NYEA 2ATWA 1MXCA 2CXCA 1O92A 4D4GA 4GS5A 4U5YD 2ASBA 3B7WA 4ODJA 4D4IA 1UKKA 4DR2C 5FLXD 1XHJA 3GPCA 2VQFC 2UXDC 2UXCC 4DV7C 4YHHC 1FJGC 1MXBA 1IBLC 3R44A 1BA3A 4RLFA 5DV9A 2Y27A 2UU9C 4IZ6A 4JI4C 4DV6C 4BBYA 3NPDA 1JOSA 4PUHA 2QVZX 5ADZA 1XNRC 4OYCA 4JYAC 1ZB9A 4R1MA 1XRCA 4LFCC 4X62C 2YCBA 2UUAC 3H2TA 2MCQA 5IT9D 2DYJA 2WP0C 4XX2A 1XMQC 3SO4A 3PBKA 1HNXC 1PG4A 1M6XA 2JNVA 2D28C 2HJGA 3LUSA 3AY0A 3IPLA 1XRAA 2M5OA 2ZZMA 1MDFA 4RMNA 3UOWA 1P7LA 1IBMC 1UWDA 3AF5A 4FUTA 2PROA 3A9VA 4DR5C 3CJEA 3GR0A 2YWBA 4DUZC 4R0MA 4DR3C 4OX9C 2QVXX 4AQYC 2QVYX 5LMUC 4BC9A 3K6RA 2YX1A 4PUGA 5BUQA 4DV4C 4B3TC 1PG3A 3LNOA 3NYQA 4LF4C 2HHHC 4X66C 4BCAA 4DV5C 2PN2A 5T8SA 4DV0C 4PUIA 1P4EC 4BC7A 3DHVA 4I9GA 4K0KC 4B3MC 4G36A 2D1TA 4G37A 4DG8A 1WF3A 1RG9A 3I08A 4DG9A 3JAMD 3IEVA 3L95X 5AE3A 4JI6C 2NCLA 3CQ1A 3CW8X 4G1IA 4DCUA 3CQ3A 3FCCA 1USPA 1T5DX 2CU6A 2JMPA 1V26A 2P2FA 4JV5C 3E7WA 2UXBC 2VQEC 1YGTA 4DR7C 1XNQC 4L2ZA 2E8EA 3ETCA 3IEUA 2P2BA 3A26A 3DLPX 1N2FA 4JI3C 1MKYA 5BSTA 4JI1C 5LMNC 3TUFA 4KHPC 1O9TA 3NYRA 1P4EA 2P20A 2DHMA 3UX3A 1N33C 2D1QA 3UZ0A 3UEBA 4JI0C 1HNZC 3J80D 2DPLA 1MDBA 1PU1A 5CZVA 1LQLA 2ZTBA 4LF9C 1HR0C 1VLAA 2OO4A 2D1RA 1WCJA 3CQ2A 4LFBC 1O93A 2D1SA 2D27A 2EGTA 3L8CA 1NY8A 5KYVA 4RVOA 4X65C 3FM7A 4PZPA 5K85A 3TR3A 2WD9A 2KDNA 1K0RA 1IBKC 4I9FA 4ZLPA 1FUGA 4LF8C 1XDXA 1VEHA 5IFIA 4L7IA 2KZ0A 1HNWC 4RLQA 2CY1A 1V25A 2BH1X 2M5HA 2Y4OA 4OXIA 4FTFA 4WV3A 1XS3A 2Z51A 4DR1C 3VNSA 4D57A 4PHTA 4DCSA 3KXWA 3VNQA 2OPLB 1WH9A 2AYAA 1T5HX 3I07A 5A2QD 4DR6C 1O90A 3PROC 4DV2C 2E5LC 5BSMA 5H9UA 3N54B 5BSRA 4GXRA 3DAYA 3A9UA 2ZM6C 3TQIA 3AF6A 2E0GA 4KTVA 5KEIA 3G7SA 2OBVA 3CW9A 1N34C 1ULTA 1V60A 2P2MA 4JI8C 1N32C 5A1IA 5BSWA 4L4QA 5KYTA 4X64C 4TPSB 1QWIA 2E8CA 3E7XA 5BURA 1GPMA 4HPVA 4GKKC 3NI2A 4WS9A 4DV3C 1FLOA 3GKUA 1ML8A 1QM4A 5BSUA 4K0BA 3RV2A 4DCVA 5GTDA 2PT7G 5A1GA 3A25A 1KKGA 5AE1A 1LCIA 3TDEA 2E8FA 4RM3A 4ISBA 1RY2A 2QL8A 5IWAC 4RM2A 4R1LA 2Y4NA 4DUYC 3PESA 4BSZA 1AMUA 4NDNA 3T1YC 4LF6C 4GKJC 2P2JA 1ZB8A 1J5EC 2D7VA 3LNVA 3S82A 4JI2C 4LFAC 4PROC 5JRHA 3J7AD 4DCTA 4DV1C 2MMAB 4LF5C 5E7QA 3FCEA 3IMLA 3R9XA 4NXMC 2ONFA 4JI5C 4RVNA 1IB8A 4NOZA 1TH5A 4B3RC
chains in the Genus database with same CATH topology
2KZFA 4ZJZA 2UUCC 3GR1A 1XMOC 1MXAA 3VNRA 1EGAA 2XR1A 2P2QA 3LGXA 5T8TA 5BSVA 5K8FA 4MTNA 2VZEA 5CZXA 4D56A 3RG2A 2E7GA 1HH2P 4LE5A 3A4IA 1MD9A 2QW0X 2F4VC 3C5EA 2V7BA 4DR4C 2BJOA 1I94C 4EATA 4MH4A 5BR8C 2UUBC 1L2FA 3T1HC 4GXQA 4KTTA 4LF7C 2VSQA 3R9WA 3ETOA 3N2QA 3EERA 1PA4A 2P02A 5AE2A 1XRBA 1N36C 4IR7A 1YJ7A 4JI7C 1USPB 2OPLA 3J81D 4B3SC 3OTOC 4FUQA 4NXNC 5A19A 3EQ6A 2YWCA 4YY3C 5BUSA 4JM1A 3LAXA 1NYEA 2ATWA 1MXCA 2CXCA 1O92A 4D4GA 4GS5A 4U5YD 2ASBA 3B7WA 4ODJA 4D4IA 1UKKA 4DR2C 5FLXD 3GPCA 2VQFC 2UXDC 2UXCC 4DV7C 4YHHC 1FJGC 1MXBA 1IBLC 3R44A 1BA3A 4RLFA 5DV9A 2Y27A 2UU9C 4IZ6A 4JI4C 4DV6C 4BBYA 3NPDA 1JOSA 5ADZA 2QVZX 1XNRC 4OYCA 4JYAC 1ZB9A 4R1MA 1XRCA 4LFCC 4X62C 2YCBA 2UUAC 3H2TA 5IT9D 2DYJA 2WP0C 4XX2A 1XMQC 3SO4A 3PBKA 1HNXC 1PG4A 2D28C 2HJGA 3LUSA 3IPLA 1XRAA 1MDFA 4RMNA 3UOWA 1P7LA 1IBMC 3AF5A 4FUTA 2PROA 3A9VA 4DR5C 3CJEA 3GR0A 2YWBA 4DUZC 4R0MA 4DR3C 4OX9C 2QVXX 4AQYC 2QVYX 5LMUC 4BC9A 4DV4C 5BUQA 4B3TC 1PG3A 3NYQA 4LF4C 2HHHC 4X66C 4BCAA 4DV5C 2PN2A 5T8SA 4DV0C 4BC7A 3DHVA 4I9GA 4K0KC 4B3MC 4G36A 2D1TA 4G37A 4DG8A 1WF3A 1RG9A 3I08A 4DG9A 3JAMD 3IEVA 3L95X 5AE3A 4JI6C 3CW8X 4G1IA 4DCUA 3FCCA 1USPA 1T5DX 2JMPA 1V26A 2P2FA 4JV5C 3E7WA 2UXBC 2VQEC 4DR7C 1XNQC 4L2ZA 2E8EA 3ETCA 3IEUA 2P2BA 3DLPX 1N2FA 4JI3C 1MKYA 5BSTA 4JI1C 5LMNC 3TUFA 4KHPC 1O9TA 3NYRA 2P20A 1N33C 2D1QA 3UZ0A 4JI0C 1HNZC 3J80D 2DPLA 1MDBA 5CZVA 1LQLA 4LF9C 1HR0C 1VLAA 2OO4A 2D1RA 4LFBC 1O93A 2D1SA 2D27A 2EGTA 3L8CA 5KYVA 4RVOA 4X65C 4PZPA 5K85A 2WD9A 1K0RA 1IBKC 4I9FA 4ZLPA 1FUGA 4LF8C 5IFIA 4L7IA 1HNWC 4RLQA 2CY1A 1V25A 2BH1X 2Y4OA 4OXIA 4FTFA 4WV3A 4DR1C 3VNSA 4D57A 4PHTA 4DCSA 3KXWA 3VNQA 2OPLB 1WH9A 2AYAA 1T5HX 3I07A 5A2QD 4DR6C 1O90A 3PROC 4DV2C 2E5LC 5BSMA 5H9UA 3N54B 5BSRA 4GXRA 3DAYA 3A9UA 2ZM6C 3TQIA 3AF6A 2E0GA 4KTVA 5KEIA 3G7SA 2OBVA 3CW9A 1N34C 1ULTA 2P2MA 4JI8C 1N32C 5A1IA 5BSWA 4L4QA 5KYTA 4X64C 4TPSB 1QWIA 2E8CA 3E7XA 5BURA 1GPMA 4HPVA 4GKKC 3NI2A 4WS9A 4DV3C 3GKUA 1ML8A 1QM4A 5BSUA 4K0BA 3RV2A 4DCVA 5GTDA 2PT7G 5A1GA 1KKGA 5AE1A 1LCIA 3TDEA 2E8FA 4RM3A 4ISBA 1RY2A 2QL8A 5IWAC 4RM2A 4R1LA 2Y4NA 4DUYC 3PESA 4BSZA 1AMUA 4NDNA 3T1YC 4LF6C 4GKJC 2P2JA 1ZB8A 1J5EC 2D7VA 3LNVA 3S82A 4JI2C 4LFAC 4PROC 5JRHA 3J7AD 4DCTA 4DV1C 4LF5C 5E7QA 3FCEA 3IMLA 3R9XA 4NXMC 2ONFA 4JI5C 4RVNA 4NOZA 4B3RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOS A;  2KZF A;  1XNR C;  3IEV A;  4JYA C;  2UUC C;  1XMO C;  4JI6 C;  1ZB9 A;  2OPL B;  1WH9 A;  1EGA A;  2XR1 A;  4DCU A;  4LFC C;  3I07 A;  5A2Q D;  4DR6 C;  1USP A;  4X62 C;  2YCB A;  2UUA C;  5IT9 D;  2JMP A;  4JV5 C;  4DV2 C;  2DYJ A;  4MTN A;  4XX2 A;  2E5L C;  2UXB C;  1XMQ C;  2VQE C;  2E7G A;  1HH2 P;  1HNX C;  4DR7 C;  2ZM6 C;  1XNQ C;  2E8E A;  3AF6 A;  3IEU A;  2HJG A;  2F4V C;  4DR4 C;  1N2F A;  3LUS A;  2BJO A;  1I94 C;  4MH4 A;  4JI3 C;  1N34 C;  1MKY A;  5BR8 C;  4JI1 C;  2UUB C;  4JI8 C;  1L2F A;  5LMN C;  1N32 C;  3T1H C;  4KHP C;  4LF7 C;  4X64 C;  3R9W A;  3EER A;  1QWI A;  2E8C A;  1IBM C;  1N33 C;  3AF5 A;  4JI0 C;  4DR5 C;  1PA4 A;  4GKK C;  3CJE A;  4DV3 C;  1N36 C;  1HNZ C;  3GKU A;  3J80 D;  1ML8 A;  4DUZ C;  4DCV A;  4DR3 C;  2PT7 G;  1LQL A;  4OX9 C;  1KKG A;  4LF9 C;  1HR0 C;  1VLA A;  4AQY C;  1USP B;  5LMU C;  4JI7 C;  4LFB C;  2OPL A;  3J81 D;  2E8F A;  4B3S C;  3OTO C;  4NXN C;  2QL8 A;  5IWA C;  4DV4 C;  4B3T C;  2EGT A;  4DUY C;  4YY3 C;  4BSZ A;  3T1Y C;  4LF6 C;  4X65 C;  4LF4 C;  1NYE A;  2HHH C;  4GKJ C;  4X66 C;  2ATW A;  1ZB8 A;  4DV5 C;  1J5E C;  2CXC A;  2D7V A;  2PN2 A;  4DV0 C;  1K0R A;  1IBK C;  4JI2 C;  4LFA C;  2ASB A;  4LF8 C;  3J7A D;  4DCT A;  4DV1 C;  4K0K C;  4LF5 C;  1HNW C;  2CY1 A;  4B3M C;  3R9X A;  1UKK A;  4DR2 C;  4NXM C;  5FLX D;  2ONF A;  2VQF C;  2UXD C;  2UXC C;  4DV7 C;  4YHH C;  4JI5 C;  1FJG C;  1WF3 A;  1IBL C;  4DR1 C;  2UU9 C;  4JI4 C;  4NOZ A;  4DV6 C;  4B3R C;  3JAM D;  4DCS A; 
#chains in the Genus database with same CATH topology
 2KZF A;  4ZJZ A;  2UUC C;  2PG1 E;  3GR1 A;  1XMO C;  1MXA A;  3VNR A;  1EGA A;  2XR1 A;  2P2Q A;  3LGX A;  5T8T A;  5BSV A;  5K8F A;  4MTN A;  3O2E A;  2VZE A;  5CZX A;  4D56 A;  3RG2 A;  2E7G A;  1HH2 P;  4LE5 A;  5LCI A;  3A4I A;  1MD9 A;  2QW0 X;  2F4V C;  3C5E A;  2V7B A;  4DR4 C;  2BJO A;  1I94 C;  4EAT A;  4MH4 A;  2ZZN A;  5BR8 C;  2UUB C;  1L2F A;  3T1H C;  4GXQ A;  4KTT A;  4LF7 C;  2VSQ A;  3R9W A;  3ETO A;  3N2Q A;  3EER A;  2MM9 A;  1PA4 A;  2P02 A;  5AE2 A;  1XRB A;  1N36 C;  4IR7 A;  1YJ7 A;  4JI7 C;  3UX2 A;  1USP B;  1M6X C;  2OPL A;  3J81 D;  4B3S C;  3OTO C;  4FUQ A;  4NXN C;  5A19 A;  3EQ6 A;  2YWC A;  4YY3 C;  5BUS A;  4JM1 A;  3LAX A;  1NYE A;  2ATW A;  1MXC A;  2CXC A;  1O92 A;  4D4G A;  4GS5 A;  4U5Y D;  2ASB A;  3B7W A;  4ODJ A;  4D4I A;  1UKK A;  4DR2 C;  5FLX D;  1XHJ A;  3GPC A;  2VQF C;  2UXD C;  2UXC C;  4DV7 C;  4YHH C;  1FJG C;  1MXB A;  1IBL C;  3R44 A;  1BA3 A;  4RLF A;  5DV9 A;  2Y27 A;  2UU9 C;  4IZ6 A;  4JI4 C;  4DV6 C;  4BBY A;  3NPD A;  1JOS A;  4PUH A;  2QVZ X;  5ADZ A;  1XNR C;  4OYC A;  4JYA C;  1ZB9 A;  4R1M A;  1XRC A;  4LFC C;  4X62 C;  2YCB A;  2UUA C;  3H2T A;  2MCQ A;  5IT9 D;  2DYJ A;  2WP0 C;  4XX2 A;  1XMQ C;  3SO4 A;  3PBK A;  1HNX C;  1PG4 A;  1M6X A;  2JNV A;  2D28 C;  2HJG A;  3LUS A;  3AY0 A;  3IPL A;  1XRA A;  2M5O A;  2ZZM A;  1MDF A;  4RMN A;  3UOW A;  1P7L A;  1IBM C;  1UWD A;  3AF5 A;  4FUT A;  2PRO A;  3A9V A;  4DR5 C;  3CJE A;  3GR0 A;  2YWB A;  4DUZ C;  4R0M A;  4DR3 C;  4OX9 C;  2QVX X;  4AQY C;  2QVY X;  5LMU C;  4BC9 A;  3K6R A;  2YX1 A;  4PUG A;  5BUQ A;  4DV4 C;  4B3T C;  1PG3 A;  3LNO A;  3NYQ A;  4LF4 C;  2HHH C;  4X66 C;  4BCA A;  4DV5 C;  2PN2 A;  5T8S A;  4DV0 C;  4PUI A;  1P4E C;  4BC7 A;  3DHV A;  4I9G A;  4K0K C;  4B3M C;  4G36 A;  2D1T A;  4G37 A;  4DG8 A;  1WF3 A;  1RG9 A;  3I08 A;  4DG9 A;  3JAM D;  3IEV A;  3L95 X;  5AE3 A;  4JI6 C;  2NCL A;  3CQ1 A;  3CW8 X;  4G1I A;  4DCU A;  3CQ3 A;  3FCC A;  1USP A;  1T5D X;  2CU6 A;  2JMP A;  1V26 A;  2P2F A;  4JV5 C;  3E7W A;  2UXB C;  2VQE C;  1YGT A;  4DR7 C;  1XNQ C;  4L2Z A;  2E8E A;  3ETC A;  3IEU A;  2P2B A;  3A26 A;  3DLP X;  1N2F A;  4JI3 C;  1MKY A;  5BST A;  4JI1 C;  5LMN C;  3TUF A;  4KHP C;  1O9T A;  3NYR A;  1P4E A;  2P20 A;  2DHM A;  3UX3 A;  1N33 C;  2D1Q A;  3UZ0 A;  3UEB A;  4JI0 C;  1HNZ C;  3J80 D;  2DPL A;  1MDB A;  1PU1 A;  5CZV A;  1LQL A;  2ZTB A;  4LF9 C;  1HR0 C;  1VLA A;  2OO4 A;  2D1R A;  1WCJ A;  3CQ2 A;  4LFB C;  1O93 A;  2D1S A;  2D27 A;  2EGT A;  3L8C A;  1NY8 A;  5KYV A;  4RVO A;  4X65 C;  3FM7 A;  4PZP A;  5K85 A;  3TR3 A;  2WD9 A;  2KDN A;  1K0R A;  1IBK C;  4I9F A;  4ZLP A;  1FUG A;  4LF8 C;  1XDX A;  1VEH A;  5IFI A;  4L7I A;  2KZ0 A;  1HNW C;  4RLQ A;  2CY1 A;  1V25 A;  2BH1 X;  2M5H A;  2Y4O A;  4OXI A;  4FTF A;  4WV3 A;  1XS3 A;  2Z51 A;  4DR1 C;  3VNS A;  4D57 A;  4PHT A;  4DCS A;  3KXW A;  3VNQ A;  2OPL B;  1WH9 A;  2AYA A;  1T5H X;  3I07 A;  5A2Q D;  4DR6 C;  1O90 A;  3PRO C;  4DV2 C;  2E5L C;  5BSM A;  5H9U A;  3N54 B;  5BSR A;  4GXR A;  3DAY A;  3A9U A;  2ZM6 C;  3TQI A;  3AF6 A;  2E0G A;  4KTV A;  5KEI A;  3G7S A;  2OBV A;  3CW9 A;  1N34 C;  1ULT A;  1V60 A;  2P2M A;  4JI8 C;  1N32 C;  5A1I A;  5BSW A;  4L4Q A;  5KYT A;  4X64 C;  4TPS B;  1QWI A;  2E8C A;  3E7X A;  5BUR A;  1GPM A;  4HPV A;  4GKK C;  3NI2 A;  4WS9 A;  4DV3 C;  1FLO A;  3GKU A;  1ML8 A;  1QM4 A;  5BSU A;  4K0B A;  3RV2 A;  4DCV A;  5GTD A;  2PT7 G;  5A1G A;  3A25 A;  1KKG A;  5AE1 A;  1LCI A;  3TDE A;  2E8F A;  4RM3 A;  4ISB A;  1RY2 A;  2QL8 A;  5IWA C;  4RM2 A;  4R1L A;  2Y4N A;  4DUY C;  3PES A;  4BSZ A;  1AMU A;  4NDN A;  3T1Y C;  4LF6 C;  4GKJ C;  2P2J A;  1ZB8 A;  1J5E C;  2D7V A;  3LNV A;  3S82 A;  4JI2 C;  4LFA C;  4PRO C;  5JRH A;  3J7A D;  4DCT A;  4DV1 C;  2MMA B;  4LF5 C;  5E7Q A;  3FCE A;  3IML A;  3R9X A;  4NXM C;  2ONF A;  4JI5 C;  4RVN A;  1IB8 A;  4NOZ A;  1TH5 A;  4B3R C; 
#chains in the Genus database with same CATH homology
 2KZF A;  4ZJZ A;  2UUC C;  3GR1 A;  1XMO C;  1MXA A;  3VNR A;  1EGA A;  2XR1 A;  2P2Q A;  3LGX A;  5T8T A;  5BSV A;  5K8F A;  4MTN A;  2VZE A;  5CZX A;  4D56 A;  3RG2 A;  2E7G A;  1HH2 P;  4LE5 A;  3A4I A;  1MD9 A;  2QW0 X;  2F4V C;  3C5E A;  2V7B A;  4DR4 C;  2BJO A;  1I94 C;  4EAT A;  4MH4 A;  5BR8 C;  2UUB C;  1L2F A;  3T1H C;  4GXQ A;  4KTT A;  4LF7 C;  2VSQ A;  3R9W A;  3ETO A;  3N2Q A;  3EER A;  1PA4 A;  2P02 A;  5AE2 A;  1XRB A;  1N36 C;  4IR7 A;  1YJ7 A;  4JI7 C;  1USP B;  2OPL A;  3J81 D;  4B3S C;  3OTO C;  4FUQ A;  4NXN C;  5A19 A;  3EQ6 A;  2YWC A;  4YY3 C;  5BUS A;  4JM1 A;  3LAX A;  1NYE A;  2ATW A;  1MXC A;  2CXC A;  1O92 A;  4D4G A;  4GS5 A;  4U5Y D;  2ASB A;  3B7W A;  4ODJ A;  4D4I A;  1UKK A;  4DR2 C;  5FLX D;  3GPC A;  2VQF C;  2UXD C;  2UXC C;  4DV7 C;  4YHH C;  1FJG C;  1MXB A;  1IBL C;  3R44 A;  1BA3 A;  4RLF A;  5DV9 A;  2Y27 A;  2UU9 C;  4IZ6 A;  4JI4 C;  4DV6 C;  4BBY A;  3NPD A;  1JOS A;  5ADZ A;  2QVZ X;  1XNR C;  4OYC A;  4JYA C;  1ZB9 A;  4R1M A;  1XRC A;  4LFC C;  4X62 C;  2YCB A;  2UUA C;  3H2T A;  5IT9 D;  2DYJ A;  2WP0 C;  4XX2 A;  1XMQ C;  3SO4 A;  3PBK A;  1HNX C;  1PG4 A;  2D28 C;  2HJG A;  3LUS A;  3IPL A;  1XRA A;  1MDF A;  4RMN A;  3UOW A;  1P7L A;  1IBM C;  3AF5 A;  4FUT A;  2PRO A;  3A9V A;  4DR5 C;  3CJE A;  3GR0 A;  2YWB A;  4DUZ C;  4R0M A;  4DR3 C;  4OX9 C;  2QVX X;  4AQY C;  2QVY X;  5LMU C;  4BC9 A;  4DV4 C;  5BUQ A;  4B3T C;  1PG3 A;  3NYQ A;  4LF4 C;  2HHH C;  4X66 C;  4BCA A;  4DV5 C;  2PN2 A;  5T8S A;  4DV0 C;  4BC7 A;  3DHV A;  4I9G A;  4K0K C;  4B3M C;  4G36 A;  2D1T A;  4G37 A;  4DG8 A;  1WF3 A;  1RG9 A;  3I08 A;  4DG9 A;  3JAM D;  3IEV A;  3L95 X;  5AE3 A;  4JI6 C;  3CW8 X;  4G1I A;  4DCU A;  3FCC A;  1USP A;  1T5D X;  2JMP A;  1V26 A;  2P2F A;  4JV5 C;  3E7W A;  2UXB C;  2VQE C;  4DR7 C;  1XNQ C;  4L2Z A;  2E8E A;  3ETC A;  3IEU A;  2P2B A;  3DLP X;  1N2F A;  4JI3 C;  1MKY A;  5BST A;  4JI1 C;  5LMN C;  3TUF A;  4KHP C;  1O9T A;  3NYR A;  2P20 A;  1N33 C;  2D1Q A;  3UZ0 A;  4JI0 C;  1HNZ C;  3J80 D;  2DPL A;  1MDB A;  5CZV A;  1LQL A;  4LF9 C;  1HR0 C;  1VLA A;  2OO4 A;  2D1R A;  4LFB C;  1O93 A;  2D1S A;  2D27 A;  2EGT A;  3L8C A;  5KYV A;  4RVO A;  4X65 C;  4PZP A;  5K85 A;  2WD9 A;  1K0R A;  1IBK C;  4I9F A;  4ZLP A;  1FUG A;  4LF8 C;  5IFI A;  4L7I A;  1HNW C;  4RLQ A;  2CY1 A;  1V25 A;  2BH1 X;  2Y4O A;  4OXI A;  4FTF A;  4WV3 A;  4DR1 C;  3VNS A;  4D57 A;  4PHT A;  4DCS A;  3KXW A;  3VNQ A;  2OPL B;  1WH9 A;  2AYA A;  1T5H X;  3I07 A;  5A2Q D;  4DR6 C;  1O90 A;  3PRO C;  4DV2 C;  2E5L C;  5BSM A;  5H9U A;  3N54 B;  5BSR A;  4GXR A;  3DAY A;  3A9U A;  2ZM6 C;  3TQI A;  3AF6 A;  2E0G A;  4KTV A;  5KEI A;  3G7S A;  2OBV A;  3CW9 A;  1N34 C;  1ULT A;  2P2M A;  4JI8 C;  1N32 C;  5A1I A;  5BSW A;  4L4Q A;  5KYT A;  4X64 C;  4TPS B;  1QWI A;  2E8C A;  3E7X A;  5BUR A;  1GPM A;  4HPV A;  4GKK C;  3NI2 A;  4WS9 A;  4DV3 C;  3GKU A;  1ML8 A;  1QM4 A;  5BSU A;  4K0B A;  3RV2 A;  4DCV A;  5GTD A;  2PT7 G;  5A1G A;  1KKG A;  5AE1 A;  1LCI A;  3TDE A;  2E8F A;  4RM3 A;  4ISB A;  1RY2 A;  2QL8 A;  5IWA C;  4RM2 A;  4R1L A;  2Y4N A;  4DUY C;  3PES A;  4BSZ A;  1AMU A;  4NDN A;  3T1Y C;  4LF6 C;  4GKJ C;  2P2J A;  1ZB8 A;  1J5E C;  2D7V A;  3LNV A;  3S82 A;  4JI2 C;  4LFA C;  4PRO C;  5JRH A;  3J7A D;  4DCT A;  4DV1 C;  4LF5 C;  5E7Q A;  3FCE A;  3IML A;  3R9X A;  4NXM C;  2ONF A;  4JI5 C;  4RVN A;  4NOZ A;  4B3R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...