5LMNC

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5lmnC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5lmnC02
3T1YC 2F4VC 4GKKC 2VQEC 4JI7C 3LUSA 4YHHC 2UXCC 2CXCA 3J7AD 4DCTA 1XMOC 1K0RA 1LQLA 2EGTA 4JI1C 2DYJA 4DV6C 4AQYC 4DR7C 1NYEA 2PT7G 1WH9A 4X64C 4X66C 4JI3C 4DV3C 1IBKC 2CY1A 2UUAC 4DV4C 2OPLB 4DV1C 1N34C 4DV2C 3IEUA 1PA4A 5BR8C 4KHPC 1HH2P 1HR0C 4GKJC 2KZFA 2HHHC 4B3MC 4NXMC 4LFBC 4LF4C 4DCUA 4B3RC 2PN2A 2VQFC 2OPLA 5A2QD 1USPA 2D7VA 1FJGC 4DV0C 1XMQC 4JI6C 4NOZA 4DR5C 4MH4A 1IBMC 1ML8A 1ZB9A 4BSZA 1VLAA 2QL8A 4JI5C 2E8CA 3EERA 4DUYC 4JI4C 4LF5C 1QWIA 4B3SC 2UUBC 1IBLC 3T1HC 1N36C 2JMPA 4OX9C 1HNZC 4DUZC 2E7GA 4DR1C 1XNQC 4X65C 5LMUC 4K0KC 4JI2C 4XX2A 4LFCC 1KKGA 2UUCC 5LMNC 3IEVA 1EGAA 1JOSA 2UXDC 4B3TC 3R9XA 2BJOA 1MKYA 3J80D 2E8EA 1I94C 5IWAC 2UXBC 4DR4C 4LFAC 4JV5C 3CJEA 2E8FA 1UKKA 2ZM6C 4JYAC 2YCBA 2HJGA 1J5EC 1ZB8A 1WF3A 3J81D 2ONFA 4JI0C 3R9WA 2ASBA 1XNRC 4DV7C 3AF5A 3AF6A 4LF9C 1N33C 2XR1A 4MTNA 3GKUA 4YY3C 5IT9D 1N32C 2UU9C 4X62C 4DR2C 2E5LC 5FLXD 1HNXC 1L2FA 4LF8C 1USPB 4DR6C 4DCVA 3I07A 4LF6C 2ATWA 4DV5C 4NXNC 4DR3C 1HNWC 1N2FA 3JAMD 4LF7C 4DCSA 3OTOC 4JI8C
chains in the Genus database with same CATH superfamily
3T1YC 3TDEA 3LUSA 2ZZNA 1FUGA 3N54B 5H9UA 3J7AD 4DCTA 2EGTA 1MXBA 4DV6C 3CW8X 3VNQA 4RVNA 1IBKC 4D4IA 1P4EA 3S82A 3LNOA 4K0BA 1O93A 2KZFA 4B3MC 1YGTA 4NXMC 4LFBC 4BC9A 5DV9A 1RY2A 2D7VA 2QVXX 1XRBA 4NOZA 1GPMA 1ZB9A 2QL8A 5AE2A 2DHMA 4JI5C 2E8CA 4DUYC 1V25A 4U5YD 1IBLC 2JMPA 2D28C 4D56A 3A25A 4RLQA 1XRCA 4RMNA 4DR1C 3C5EA 4PZPA 2WP0C 2UUCC 1JOSA 5A1IA 2BJOA 2P20A 4PROC 2MCQA 3CQ1A 4NDNA 2E8EA 5IWAC 4DR4C 4RM3A 4WS9A 1ULTA 2AYAA 2MMAB 4JYAC 2OBVA 3EQ6A 1J5EC 2ONFA 3K6RA 4LF9C 1M6XC 4L7IA 2NCLA 4X62C 1L2FA 1USPB 3PROC 4LF6C 2ATWA 3ETOA 4GXRA 5KEIA 4DCSA 3DLPX 4GKKC 2F4VC 3R44A 4YHHC 2P2BA 1RG9A 5BSTA 2M5HA 1P4EC 1XMOC 4DG8A 3IPLA 2QW0X 2DYJA 5CZXA 4DR7C 1NYEA 5BURA 2UUAC 3UOWA 2OPLB 1XRAA 4DV1C 4DV2C 3IEUA 1PA4A 4KHPC 1HH2P 1HR0C 5K8FA 2HHHC 1O90A 3TUFA 3FCCA 3RV2A 1PG3A 2OPLA 2QVYX 1FJGC 1XMQC 4DR5C 4MH4A 4BSZA 1VLAA 2CU6A 4R1MA 5BSRA 4JI4C 4ZLPA 3UX3A 2UUBC 3T1HC 1N36C 2JNVA 3L8CA 2E7GA 3GR0A 1MXCA 4K0KC 4JI2C 4XX2A 4RVOA 2ZTBA 3PBKA 5A19A 3UX2A 1MDBA 4FUTA 2Y4OA 1MKYA 3J80D 3B7WA 4LFAC 3LGXA 4JV5C 3CJEA 1TH5A 3CQ3A 1UKKA 5GTDA 4PHTA 4G1IA 1XDXA 4ISBA 2HJGA 4D57A 3J81D 3R9WA 4OXIA 5BSUA 2Z51A 3PESA 4MTNA 4ODJA 5IT9D 1MDFA 5KYTA 2E5LC 5AE3A 3NPDA 2OO4A 4WV3A 4DG9A 4IZ6A 3I07A 4DCVA 2P2QA 1HNWC 4FTFA 5JRHA 4R0MA 2VQEC 2V7BA 2CXCA 3ETCA 4GXQA 5BSVA 2KDNA 1K0RA 1LQLA 4JI1C 5T8TA 1V26A 2PT7G 3VNSA 1WH9A 4ZJZA 4X66C 4RM2A 3NI2A 3UEBA 4KTVA 4DV4C 5LCIA 3G7SA 2PG1E 4TPSB 5BR8C 1AMUA 1UWDA 4GKJC 2WD9A 4DCUA 2PN2A 2VQFC 5BUSA 1USPA 2VSQA 4BBYA 4DV0C 5K85A 4JI6C 3I08A 2QVZX 3CW9A 1NY8A 5E7QA 3A9VA 2Y4NA 1QWIA 3TR3A 4B3SC 3LAXA 5BSWA 3NYRA 3TQIA 5T8SA 1XNQC 4X65C 4LFCC 1KKGA 2P2JA 2UXDC 3O2EA 3R9XA 4PUHA 4PUIA 5IFIA 4EATA 1I94C 3KXWA 2UXBC 5BUQA 1MD9A 2E8FA 2ZM6C 1M6XA 4I9GA 1V60A 3LNVA 3FM7A 1WF3A 2E0GA 4L2ZA 2ASBA 1O9TA 3FCEA 4DV7C 1QM4A 3AF5A 4G36A 2XR1A 4I9FA 2YWBA 4YY3C 1LCIA 1N32C 3SO4A 4PUGA 4DR2C 5FLXD 1HNXC 1FLOA 4DR6C 1O92A 4DV5C 1N2FA 3A26A 3GPCA 2DPLA 4LF7C 1IB8A 3N2QA 4HPVA 4OYCA 3UZ0A 3GR1A 4JI7C 4R1LA 2UXCC 3A4IA 3IMLA 2KZ0A 2P02A 4AQYC 1MXAA 4X64C 5ADZA 4L4QA 2PROA 4JI3C 4DV3C 2CY1A 2P2MA 1N34C 4RLFA 4LE5A 5A1GA 5CZVA 5BSMA 1T5DX 4LF4C 4B3RC 1YJ7A 2D1RA 1PG4A 5A2QD 2P2FA 2YX1A 1IBMC 1ML8A 4G37A 1XHJA 3L95X 3EERA 1P7LA 4LF5C 3A9UA 1T5HX 4OX9C 3CQ2A 1HNZC 4DUZC 2BH1X 2MM9A 4JM1A 3H2TA 3RG2A 5LMUC 5LMNC 3IEVA 3DAYA 1EGAA 2D1SA 1XS3A 4B3TC 2D1TA 3VNRA 5AE1A 1BA3A 2Y27A 2YCBA 3E7XA 1ZB8A 4JI0C 4BCAA 4D4GA 3E7WA 5KYVA 4BC7A 1XNRC 3NYQA 3AF6A 1N33C 4GS5A 2ZZMA 3GKUA 2D1QA 4FUQA 2UU9C 2M5OA 2YWCA 2D27A 1PU1A 3DHVA 1VEHA 4LF8C 4IR7A 3AY0A 2VZEA 4NXNC 4DR3C 1WCJA 3JAMD 4KTTA 3OTOC 4JI8C
chains in the Genus database with same CATH topology
3T1YC 3TDEA 3LUSA 1FUGA 3N54B 5H9UA 3J7AD 4DCTA 2EGTA 1MXBA 4DV6C 3CW8X 3VNQA 4RVNA 1IBKC 4D4IA 3S82A 4K0BA 1O93A 2KZFA 4B3MC 4NXMC 4LFBC 4BC9A 5DV9A 1RY2A 2D7VA 2QVXX 1XRBA 4NOZA 1GPMA 1ZB9A 2QL8A 5AE2A 4JI5C 2E8CA 4DUYC 1V25A 4U5YD 1IBLC 2JMPA 2D28C 4D56A 4RLQA 1XRCA 4RMNA 4DR1C 3C5EA 4PZPA 2WP0C 2UUCC 1JOSA 5A1IA 2BJOA 2P20A 4PROC 4NDNA 2E8EA 5IWAC 4DR4C 4RM3A 4WS9A 1ULTA 2AYAA 4JYAC 2OBVA 3EQ6A 1J5EC 2ONFA 4LF9C 4L7IA 4X62C 1L2FA 1USPB 3PROC 4LF6C 2ATWA 3ETOA 4GXRA 5KEIA 4DCSA 3DLPX 4GKKC 2F4VC 3R44A 4YHHC 2P2BA 1RG9A 5BSTA 1XMOC 4DG8A 3IPLA 2QW0X 2DYJA 5CZXA 4DR7C 1NYEA 5BURA 2UUAC 3UOWA 2OPLB 1XRAA 4DV1C 4DV2C 3IEUA 1PA4A 4KHPC 1HH2P 1HR0C 5K8FA 2HHHC 1O90A 3TUFA 3FCCA 3RV2A 1PG3A 2OPLA 2QVYX 1FJGC 1XMQC 4DR5C 4MH4A 4BSZA 1VLAA 4R1MA 5BSRA 4JI4C 4ZLPA 2UUBC 3T1HC 1N36C 3L8CA 2E7GA 3GR0A 1MXCA 4K0KC 4JI2C 4XX2A 4RVOA 3PBKA 5A19A 1MDBA 4FUTA 2Y4OA 1MKYA 3J80D 3B7WA 4LFAC 3LGXA 4JV5C 3CJEA 1UKKA 5GTDA 4PHTA 4G1IA 4ISBA 2HJGA 4D57A 3J81D 3R9WA 4OXIA 5BSUA 3PESA 4MTNA 4ODJA 5IT9D 1MDFA 5KYTA 2E5LC 5AE3A 3NPDA 2OO4A 4WV3A 4DG9A 4IZ6A 3I07A 4DCVA 2P2QA 1HNWC 4FTFA 5JRHA 4R0MA 2VQEC 2V7BA 2CXCA 3ETCA 4GXQA 5BSVA 1K0RA 1LQLA 4JI1C 5T8TA 1V26A 2PT7G 3VNSA 1WH9A 4ZJZA 4X66C 4RM2A 3NI2A 4KTVA 4DV4C 3G7SA 4TPSB 5BR8C 1AMUA 4GKJC 2WD9A 4DCUA 2PN2A 2VQFC 5BUSA 1USPA 2VSQA 4BBYA 4DV0C 5K85A 4JI6C 3I08A 2QVZX 3CW9A 5E7QA 3A9VA 2Y4NA 1QWIA 4B3SC 3LAXA 5BSWA 3NYRA 3TQIA 5T8SA 1XNQC 4X65C 4LFCC 1KKGA 2P2JA 2UXDC 3R9XA 5IFIA 4EATA 1I94C 3KXWA 2UXBC 5BUQA 1MD9A 2E8FA 2ZM6C 4I9GA 3LNVA 1WF3A 2E0GA 4L2ZA 2ASBA 1O9TA 4DV7C 3FCEA 1QM4A 3AF5A 4G36A 2XR1A 4I9FA 2YWBA 4YY3C 1LCIA 1N32C 3SO4A 4DR2C 5FLXD 1HNXC 4DR6C 1O92A 4DV5C 1N2FA 3GPCA 2DPLA 4LF7C 3N2QA 4HPVA 4OYCA 3UZ0A 3GR1A 4JI7C 4R1LA 2UXCC 3A4IA 3IMLA 2P02A 4AQYC 1MXAA 4X64C 5ADZA 4L4QA 2PROA 4JI3C 4DV3C 2CY1A 2P2MA 1N34C 4RLFA 4LE5A 5A1GA 5CZVA 5BSMA 1T5DX 4LF4C 4B3RC 1YJ7A 2D1RA 1PG4A 5A2QD 2P2FA 1IBMC 1ML8A 4G37A 3L95X 3EERA 1P7LA 4LF5C 3A9UA 1T5HX 4OX9C 1HNZC 4DUZC 2BH1X 4JM1A 3H2TA 3RG2A 5LMUC 5LMNC 3IEVA 3DAYA 1EGAA 2D1SA 4B3TC 2D1TA 3VNRA 5AE1A 1BA3A 2Y27A 2YCBA 3E7XA 1ZB8A 4JI0C 4BCAA 4D4GA 3E7WA 5KYVA 4BC7A 1XNRC 3NYQA 3AF6A 1N33C 4GS5A 3GKUA 2D1QA 4FUQA 2UU9C 2YWCA 2D27A 3DHVA 4LF8C 4IR7A 2VZEA 4NXNC 4DR3C 3JAMD 4KTTA 3OTOC 4JI8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y C;  2F4V C;  4GKK C;  2VQE C;  4JI7 C;  3LUS A;  4YHH C;  2UXC C;  2CXC A;  3J7A D;  4DCT A;  1XMO C;  1K0R A;  1LQL A;  2EGT A;  4JI1 C;  2DYJ A;  4DV6 C;  4AQY C;  4DR7 C;  1NYE A;  2PT7 G;  1WH9 A;  4X64 C;  4X66 C;  4JI3 C;  4DV3 C;  1IBK C;  2CY1 A;  2UUA C;  4DV4 C;  2OPL B;  4DV1 C;  1N34 C;  4DV2 C;  3IEU A;  1PA4 A;  5BR8 C;  4KHP C;  1HH2 P;  1HR0 C;  4GKJ C;  2KZF A;  2HHH C;  4B3M C;  4NXM C;  4LFB C;  4LF4 C;  4DCU A;  4B3R C;  2PN2 A;  2VQF C;  2OPL A;  5A2Q D;  1USP A;  2D7V A;  1FJG C;  4DV0 C;  1XMQ C;  4JI6 C;  4NOZ A;  4DR5 C;  4MH4 A;  1IBM C;  1ML8 A;  1ZB9 A;  4BSZ A;  1VLA A;  2QL8 A;  4JI5 C;  2E8C A;  3EER A;  4DUY C;  4JI4 C;  4LF5 C;  1QWI A;  4B3S C;  2UUB C;  1IBL C;  3T1H C;  1N36 C;  2JMP A;  4OX9 C;  1HNZ C;  4DUZ C;  2E7G A;  4DR1 C;  1XNQ C;  4X65 C;  5LMU C;  4K0K C;  4JI2 C;  4XX2 A;  4LFC C;  1KKG A;  2UUC C;  5LMN C;  3IEV A;  1EGA A;  1JOS A;  2UXD C;  4B3T C;  3R9X A;  2BJO A;  1MKY A;  3J80 D;  2E8E A;  1I94 C;  5IWA C;  2UXB C;  4DR4 C;  4LFA C;  4JV5 C;  3CJE A;  2E8F A;  1UKK A;  2ZM6 C;  4JYA C;  2YCB A;  2HJG A;  1J5E C;  1ZB8 A;  1WF3 A;  3J81 D;  2ONF A;  4JI0 C;  3R9W A;  2ASB A;  1XNR C;  4DV7 C;  3AF5 A;  3AF6 A;  4LF9 C;  1N33 C;  2XR1 A;  4MTN A;  3GKU A;  4YY3 C;  5IT9 D;  1N32 C;  2UU9 C;  4X62 C;  4DR2 C;  2E5L C;  5FLX D;  1HNX C;  1L2F A;  4LF8 C;  1USP B;  4DR6 C;  4DCV A;  3I07 A;  4LF6 C;  2ATW A;  4DV5 C;  4NXN C;  4DR3 C;  1HNW C;  1N2F A;  3JAM D;  4LF7 C;  4DCS A;  3OTO C;  4JI8 C; 
#chains in the Genus database with same CATH topology
 3T1Y C;  3TDE A;  3LUS A;  2ZZN A;  1FUG A;  3N54 B;  5H9U A;  3J7A D;  4DCT A;  2EGT A;  1MXB A;  4DV6 C;  3CW8 X;  3VNQ A;  4RVN A;  1IBK C;  4D4I A;  1P4E A;  3S82 A;  3LNO A;  4K0B A;  1O93 A;  2KZF A;  4B3M C;  1YGT A;  4NXM C;  4LFB C;  4BC9 A;  5DV9 A;  1RY2 A;  2D7V A;  2QVX X;  1XRB A;  4NOZ A;  1GPM A;  1ZB9 A;  2QL8 A;  5AE2 A;  2DHM A;  4JI5 C;  2E8C A;  4DUY C;  1V25 A;  4U5Y D;  1IBL C;  2JMP A;  2D28 C;  4D56 A;  3A25 A;  4RLQ A;  1XRC A;  4RMN A;  4DR1 C;  3C5E A;  4PZP A;  2WP0 C;  2UUC C;  1JOS A;  5A1I A;  2BJO A;  2P20 A;  4PRO C;  2MCQ A;  3CQ1 A;  4NDN A;  2E8E A;  5IWA C;  4DR4 C;  4RM3 A;  4WS9 A;  1ULT A;  2AYA A;  2MMA B;  4JYA C;  2OBV A;  3EQ6 A;  1J5E C;  2ONF A;  3K6R A;  4LF9 C;  1M6X C;  4L7I A;  2NCL A;  4X62 C;  1L2F A;  1USP B;  3PRO C;  4LF6 C;  2ATW A;  3ETO A;  4GXR A;  5KEI A;  4DCS A;  3DLP X;  4GKK C;  2F4V C;  3R44 A;  4YHH C;  2P2B A;  1RG9 A;  5BST A;  2M5H A;  1P4E C;  1XMO C;  4DG8 A;  3IPL A;  2QW0 X;  2DYJ A;  5CZX A;  4DR7 C;  1NYE A;  5BUR A;  2UUA C;  3UOW A;  2OPL B;  1XRA A;  4DV1 C;  4DV2 C;  3IEU A;  1PA4 A;  4KHP C;  1HH2 P;  1HR0 C;  5K8F A;  2HHH C;  1O90 A;  3TUF A;  3FCC A;  3RV2 A;  1PG3 A;  2OPL A;  2QVY X;  1FJG C;  1XMQ C;  4DR5 C;  4MH4 A;  4BSZ A;  1VLA A;  2CU6 A;  4R1M A;  5BSR A;  4JI4 C;  4ZLP A;  3UX3 A;  2UUB C;  3T1H C;  1N36 C;  2JNV A;  3L8C A;  2E7G A;  3GR0 A;  1MXC A;  4K0K C;  4JI2 C;  4XX2 A;  4RVO A;  2ZTB A;  3PBK A;  5A19 A;  3UX2 A;  1MDB A;  4FUT A;  2Y4O A;  1MKY A;  3J80 D;  3B7W A;  4LFA C;  3LGX A;  4JV5 C;  3CJE A;  1TH5 A;  3CQ3 A;  1UKK A;  5GTD A;  4PHT A;  4G1I A;  1XDX A;  4ISB A;  2HJG A;  4D57 A;  3J81 D;  3R9W A;  4OXI A;  5BSU A;  2Z51 A;  3PES A;  4MTN A;  4ODJ A;  5IT9 D;  1MDF A;  5KYT A;  2E5L C;  5AE3 A;  3NPD A;  2OO4 A;  4WV3 A;  4DG9 A;  4IZ6 A;  3I07 A;  4DCV A;  2P2Q A;  1HNW C;  4FTF A;  5JRH A;  4R0M A;  2VQE C;  2V7B A;  2CXC A;  3ETC A;  4GXQ A;  5BSV A;  2KDN A;  1K0R A;  1LQL A;  4JI1 C;  5T8T A;  1V26 A;  2PT7 G;  3VNS A;  1WH9 A;  4ZJZ A;  4X66 C;  4RM2 A;  3NI2 A;  3UEB A;  4KTV A;  4DV4 C;  5LCI A;  3G7S A;  2PG1 E;  4TPS B;  5BR8 C;  1AMU A;  1UWD A;  4GKJ C;  2WD9 A;  4DCU A;  2PN2 A;  2VQF C;  5BUS A;  1USP A;  2VSQ A;  4BBY A;  4DV0 C;  5K85 A;  4JI6 C;  3I08 A;  2QVZ X;  3CW9 A;  1NY8 A;  5E7Q A;  3A9V A;  2Y4N A;  1QWI A;  3TR3 A;  4B3S C;  3LAX A;  5BSW A;  3NYR A;  3TQI A;  5T8S A;  1XNQ C;  4X65 C;  4LFC C;  1KKG A;  2P2J A;  2UXD C;  3O2E A;  3R9X A;  4PUH A;  4PUI A;  5IFI A;  4EAT A;  1I94 C;  3KXW A;  2UXB C;  5BUQ A;  1MD9 A;  2E8F A;  2ZM6 C;  1M6X A;  4I9G A;  1V60 A;  3LNV A;  3FM7 A;  1WF3 A;  2E0G A;  4L2Z A;  2ASB A;  1O9T A;  3FCE A;  4DV7 C;  1QM4 A;  3AF5 A;  4G36 A;  2XR1 A;  4I9F A;  2YWB A;  4YY3 C;  1LCI A;  1N32 C;  3SO4 A;  4PUG A;  4DR2 C;  5FLX D;  1HNX C;  1FLO A;  4DR6 C;  1O92 A;  4DV5 C;  1N2F A;  3A26 A;  3GPC A;  2DPL A;  4LF7 C;  1IB8 A;  3N2Q A;  4HPV A;  4OYC A;  3UZ0 A;  3GR1 A;  4JI7 C;  4R1L A;  2UXC C;  3A4I A;  3IML A;  2KZ0 A;  2P02 A;  4AQY C;  1MXA A;  4X64 C;  5ADZ A;  4L4Q A;  2PRO A;  4JI3 C;  4DV3 C;  2CY1 A;  2P2M A;  1N34 C;  4RLF A;  4LE5 A;  5A1G A;  5CZV A;  5BSM A;  1T5D X;  4LF4 C;  4B3R C;  1YJ7 A;  2D1R A;  1PG4 A;  5A2Q D;  2P2F A;  2YX1 A;  1IBM C;  1ML8 A;  4G37 A;  1XHJ A;  3L95 X;  3EER A;  1P7L A;  4LF5 C;  3A9U A;  1T5H X;  4OX9 C;  3CQ2 A;  1HNZ C;  4DUZ C;  2BH1 X;  2MM9 A;  4JM1 A;  3H2T A;  3RG2 A;  5LMU C;  5LMN C;  3IEV A;  3DAY A;  1EGA A;  2D1S A;  1XS3 A;  4B3T C;  2D1T A;  3VNR A;  5AE1 A;  1BA3 A;  2Y27 A;  2YCB A;  3E7X A;  1ZB8 A;  4JI0 C;  4BCA A;  4D4G A;  3E7W A;  5KYV A;  4BC7 A;  1XNR C;  3NYQ A;  3AF6 A;  1N33 C;  4GS5 A;  2ZZM A;  3GKU A;  2D1Q A;  4FUQ A;  2UU9 C;  2M5O A;  2YWC A;  2D27 A;  1PU1 A;  3DHV A;  1VEH A;  4LF8 C;  4IR7 A;  3AY0 A;  2VZE A;  4NXN C;  4DR3 C;  1WCJ A;  3JAM D;  4KTT A;  3OTO C;  4JI8 C; 
#chains in the Genus database with same CATH homology
 3T1Y C;  3TDE A;  3LUS A;  1FUG A;  3N54 B;  5H9U A;  3J7A D;  4DCT A;  2EGT A;  1MXB A;  4DV6 C;  3CW8 X;  3VNQ A;  4RVN A;  1IBK C;  4D4I A;  3S82 A;  4K0B A;  1O93 A;  2KZF A;  4B3M C;  4NXM C;  4LFB C;  4BC9 A;  5DV9 A;  1RY2 A;  2D7V A;  2QVX X;  1XRB A;  4NOZ A;  1GPM A;  1ZB9 A;  2QL8 A;  5AE2 A;  4JI5 C;  2E8C A;  4DUY C;  1V25 A;  4U5Y D;  1IBL C;  2JMP A;  2D28 C;  4D56 A;  4RLQ A;  1XRC A;  4RMN A;  4DR1 C;  3C5E A;  4PZP A;  2WP0 C;  2UUC C;  1JOS A;  5A1I A;  2BJO A;  2P20 A;  4PRO C;  4NDN A;  2E8E A;  5IWA C;  4DR4 C;  4RM3 A;  4WS9 A;  1ULT A;  2AYA A;  4JYA C;  2OBV A;  3EQ6 A;  1J5E C;  2ONF A;  4LF9 C;  4L7I A;  4X62 C;  1L2F A;  1USP B;  3PRO C;  4LF6 C;  2ATW A;  3ETO A;  4GXR A;  5KEI A;  4DCS A;  3DLP X;  4GKK C;  2F4V C;  3R44 A;  4YHH C;  2P2B A;  1RG9 A;  5BST A;  1XMO C;  4DG8 A;  3IPL A;  2QW0 X;  2DYJ A;  5CZX A;  4DR7 C;  1NYE A;  5BUR A;  2UUA C;  3UOW A;  2OPL B;  1XRA A;  4DV1 C;  4DV2 C;  3IEU A;  1PA4 A;  4KHP C;  1HH2 P;  1HR0 C;  5K8F A;  2HHH C;  1O90 A;  3TUF A;  3FCC A;  3RV2 A;  1PG3 A;  2OPL A;  2QVY X;  1FJG C;  1XMQ C;  4DR5 C;  4MH4 A;  4BSZ A;  1VLA A;  4R1M A;  5BSR A;  4JI4 C;  4ZLP A;  2UUB C;  3T1H C;  1N36 C;  3L8C A;  2E7G A;  3GR0 A;  1MXC A;  4K0K C;  4JI2 C;  4XX2 A;  4RVO A;  3PBK A;  5A19 A;  1MDB A;  4FUT A;  2Y4O A;  1MKY A;  3J80 D;  3B7W A;  4LFA C;  3LGX A;  4JV5 C;  3CJE A;  1UKK A;  5GTD A;  4PHT A;  4G1I A;  4ISB A;  2HJG A;  4D57 A;  3J81 D;  3R9W A;  4OXI A;  5BSU A;  3PES A;  4MTN A;  4ODJ A;  5IT9 D;  1MDF A;  5KYT A;  2E5L C;  5AE3 A;  3NPD A;  2OO4 A;  4WV3 A;  4DG9 A;  4IZ6 A;  3I07 A;  4DCV A;  2P2Q A;  1HNW C;  4FTF A;  5JRH A;  4R0M A;  2VQE C;  2V7B A;  2CXC A;  3ETC A;  4GXQ A;  5BSV A;  1K0R A;  1LQL A;  4JI1 C;  5T8T A;  1V26 A;  2PT7 G;  3VNS A;  1WH9 A;  4ZJZ A;  4X66 C;  4RM2 A;  3NI2 A;  4KTV A;  4DV4 C;  3G7S A;  4TPS B;  5BR8 C;  1AMU A;  4GKJ C;  2WD9 A;  4DCU A;  2PN2 A;  2VQF C;  5BUS A;  1USP A;  2VSQ A;  4BBY A;  4DV0 C;  5K85 A;  4JI6 C;  3I08 A;  2QVZ X;  3CW9 A;  5E7Q A;  3A9V A;  2Y4N A;  1QWI A;  4B3S C;  3LAX A;  5BSW A;  3NYR A;  3TQI A;  5T8S A;  1XNQ C;  4X65 C;  4LFC C;  1KKG A;  2P2J A;  2UXD C;  3R9X A;  5IFI A;  4EAT A;  1I94 C;  3KXW A;  2UXB C;  5BUQ A;  1MD9 A;  2E8F A;  2ZM6 C;  4I9G A;  3LNV A;  1WF3 A;  2E0G A;  4L2Z A;  2ASB A;  1O9T A;  4DV7 C;  3FCE A;  1QM4 A;  3AF5 A;  4G36 A;  2XR1 A;  4I9F A;  2YWB A;  4YY3 C;  1LCI A;  1N32 C;  3SO4 A;  4DR2 C;  5FLX D;  1HNX C;  4DR6 C;  1O92 A;  4DV5 C;  1N2F A;  3GPC A;  2DPL A;  4LF7 C;  3N2Q A;  4HPV A;  4OYC A;  3UZ0 A;  3GR1 A;  4JI7 C;  4R1L A;  2UXC C;  3A4I A;  3IML A;  2P02 A;  4AQY C;  1MXA A;  4X64 C;  5ADZ A;  4L4Q A;  2PRO A;  4JI3 C;  4DV3 C;  2CY1 A;  2P2M A;  1N34 C;  4RLF A;  4LE5 A;  5A1G A;  5CZV A;  5BSM A;  1T5D X;  4LF4 C;  4B3R C;  1YJ7 A;  2D1R A;  1PG4 A;  5A2Q D;  2P2F A;  1IBM C;  1ML8 A;  4G37 A;  3L95 X;  3EER A;  1P7L A;  4LF5 C;  3A9U A;  1T5H X;  4OX9 C;  1HNZ C;  4DUZ C;  2BH1 X;  4JM1 A;  3H2T A;  3RG2 A;  5LMU C;  5LMN C;  3IEV A;  3DAY A;  1EGA A;  2D1S A;  4B3T C;  2D1T A;  3VNR A;  5AE1 A;  1BA3 A;  2Y27 A;  2YCB A;  3E7X A;  1ZB8 A;  4JI0 C;  4BCA A;  4D4G A;  3E7W A;  5KYV A;  4BC7 A;  1XNR C;  3NYQ A;  3AF6 A;  1N33 C;  4GS5 A;  3GKU A;  2D1Q A;  4FUQ A;  2UU9 C;  2YWC A;  2D27 A;  3DHV A;  4LF8 C;  4IR7 A;  2VZE A;  4NXN C;  4DR3 C;  3JAM D;  4KTT A;  3OTO C;  4JI8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...