5LMNC

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5lmnC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5lmnC02
4AQYC 4BSZA 3IEVA 1QWIA 1I94C 2D7VA 2ONFA 4JI0C 4DCUA 4LF9C 2YCBA 4DCSA 5LMNC 1N33C 4X64C 1IBLC 3CJEA 1N34C 4DR4C 4K0KC 4MH4A 1KKGA 3J81D 4X62C 3AF5A 4JI7C 4DR2C 4LFAC 4DUZC 1NYEA 4DV0C 1JOSA 3T1HC 2CXCA 4JI5C 3GKUA 4DV1C 4B3TC 2UUBC 1XNRC 4DR1C 2UXDC 2E7GA 4DCTA 4DV6C 2E8EA 1HH2P 4JYAC 5FLXD 4OX9C 2E8FA 4JI6C 2EGTA 1WF3A 1HR0C 2HJGA 4DR6C 2ATWA 1PA4A 1HNZC 1HNWC 1IBMC 1K0RA 4XX2A 4DV3C 1XMQC 2JMPA 5BR8C 4DCVA 1XMOC 2E8CA 1N2FA 2UU9C 4LF5C 3EERA 2QL8A 3T1YC 2UXCC 4NOZA 2E5LC 1J5EC 1FJGC 1IBKC 2PN2A 3AF6A 1WH9A 1XNQC 3LUSA 4MTNA 1VLAA 1ZB9A 4B3MC 2HHHC 1LQLA 1N32C 1ZB8A 5IT9D 5LMUC 1MKYA 2UXBC 1UKKA 5A2QD 4LF8C 4DV7C 2UUCC 4LFCC 1USPA 3J80D 4JI3C 1EGAA 4LF7C 3R9XA 4DV2C 2UUAC 4JI8C 4LF4C 4DR5C 4YHHC 1ML8A 4DUYC 2KZFA 2DYJA 4YY3C 4DV4C 1HNXC 4B3SC 1N36C 1USPB 4DR3C 2OPLA 2OPLB 2ASBA 2XR1A 2ZM6C 3R9WA 4DR7C 4KHPC 4JI4C 3JAMD 4JI2C 4B3RC 5IWAC 3I07A 4LF6C 4NXNC 4GKJC 3OTOC 2F4VC 4JV5C 4DV5C 2CY1A 4JI1C 4X65C 2BJOA 2VQEC 1L2FA 2VQFC 4NXMC 2PT7G 3J7AD 4LFBC 4GKKC 4X66C 3IEUA
chains in the Genus database with same CATH superfamily
5BURA 1ULTA 3IEVA 1QWIA 1I94C 2PROA 5GTDA 4LF9C 2YCBA 4DCSA 5LMNC 2QVYX 3CJEA 1KKGA 4JI7C 3AF5A 5BSMA 1TH5A 4LFAC 4DUZC 4KTVA 4RVNA 1JOSA 5K85A 4I9FA 4EATA 1RG9A 4DV1C 4DR1C 1V26A 4DCTA 1HH2P 4LE5A 4G1IA 5FLXD 3UEBA 1WF3A 4PUIA 3K6RA 1HNWC 3NPDA 2ZTBA 3CW8X 2KZ0A 5BSVA 1YGTA 4GXRA 1XMOC 4OYCA 5KYTA 2D1QA 4WS9A 3E7WA 1PU1A 4LF5C 2QL8A 2ZZMA 2E5LC 4ZJZA 1J5EC 4ZLPA 1FJGC 2NCLA 3IMLA 1VLAA 3N2QA 2P2MA 2D27A 4FUQA 3LAXA 4BCAA 4DV7C 3DHVA 4IZ6A 3J80D 4JI3C 1T5HX 4DV2C 1M6XC 1P4EA 4DR5C 2KZFA 2MMAB 4YY3C 1GPMA 1WCJA 4DR3C 2ASBA 4DR7C 3PBKA 4RMNA 1P7LA 5E7QA 5IWAC 5LCIA 3CQ1A 5AE2A 2M5HA 2VQEC 1L2FA 4D57A 4LFBC 5CZVA 2OBVA 2D28C 2OO4A 4BSZA 1MXBA 1T5DX 1XRAA 4L4QA 5BSUA 4PHTA 1N34C 5K8FA 3UX3A 3GR0A 3J81D 2BH1X 2VZEA 1MXAA 1M6XA 2YWBA 4BC7A 2MCQA 4B3TC 2QVXX 3A4IA 1XRBA 2ZZNA 3RG2A 3ETOA 2MM9A 3KXWA 4I9GA 3FM7A 2P2QA 2YWCA 4R1MA 4OXIA 1HR0C 4WV3A 2HJGA 4NDNA 2ATWA 3CQ2A 1IBMC 1FLOA 2M5OA 1K0RA 1PG4A 5KYVA 1MXCA 4R0MA 3EERA 2KDNA 1O93A 4NOZA 1XRCA 1IBKC 1ZB9A 1ZB8A 1O92A 5LMUC 4L7IA 4D56A 4DG8A 4LF8C 2UUCC 5BUSA 2V7BA 5BUQA 4LF7C 3UZ0A 3R9XA 3I08A 2YX1A 1MDBA 1QM4A 1ML8A 4DUYC 4PZPA 2DYJA 3PROC 3NI2A 1HNXC 3A9UA 2Y4OA 3AY0A 3LNOA 3SO4A 2PG1E 4FTFA 4D4GA 4RM2A 4PUGA 4GKJC 5AE1A 1MD9A 2VSQA 4DV5C 1XDXA 4X65C 3NYQA 3H2TA 4NXMC 5DV9A 3J7AD 1UWDA 5CZXA 4RM3A 2D7VA 2ONFA 4GXQA 4DG9A 3LNVA 3VNRA 2WD9A 1PG3A 5T8SA 4X64C 4DR4C 3L8CA 4MH4A 5H9UA 1BA3A 4X62C 4JM1A 3T1HC 4RLFA 3GKUA 4BBYA 2Z51A 1XNRC 5A19A 3L95X 2UXDC 5BSTA 3B7WA 4OX9C 1HNZC 5A1IA 3G7SA 4DV3C 2JMPA 3UOWA 1N2FA 1LCIA 3R44A 1YJ7A 2D1TA 3AF6A 4HPVA 3ETCA 4MTNA 2AYAA 1FUGA 2P2JA 1LQLA 3NYRA 1UKKA 3C5EA 5A2QD 3FCEA 3RV2A 3EQ6A 4LFCC 1USPA 3N54B 1XHJA 1EGAA 4ODJA 4R1LA 2UUAC 5BSRA 3PESA 3S82A 5JRHA 2QVZX 3GR1A 5ADZA 4B3SC 3LGXA 4TPSB 2QW0X 1USPB 2OPLA 3DAYA 2XR1A 4KHPC 3JAMD 3TUFA 4B3RC 2P02A 3I07A 1V25A 3OTOC 2Y27A 3A26A 2F4VC 4JV5C 3TR3A 4RLQA 4JI1C 1O90A 4L2ZA 4RVOA 2VQFC 5T8TA 4KTTA 2P2FA 3TQIA 4GKKC 2OPLB 4AQYC 1P4EC 3UX2A 4JI0C 3GPCA 2P20A 4IR7A 4DCUA 3IPLA 4PUHA 2E0GA 3VNQA 1N33C 1IBLC 4K0KC 4U5YD 4ISBA 4DR2C 1NYEA 1NY8A 4DV0C 2DHMA 2CXCA 4JI5C 2UUBC 4G37A 2E7GA 3CW9A 1IB8A 4DV6C 2E8EA 4JYAC 3TDEA 2E8FA 4JI6C 2EGTA 4DR6C 3DLPX 1PA4A 4XX2A 1XMQC 5KEIA 1XS3A 4DCVA 5BR8C 2E8CA 1V60A 3O2EA 4K0BA 2UU9C 2DPLA 3FCCA 3T1YC 1AMUA 2UXCC 2PN2A 2JNVA 1WH9A 1XNQC 3LUSA 5BSWA 4G36A 4B3MC 2HHHC 5IFIA 1N32C 2D1SA 5IT9D 3A25A 1MKYA 2UXBC 3A9VA 3VNSA 4FUTA 1RY2A 4JI8C 4LF4C 3E7XA 4YHHC 3CQ3A 4DV4C 2D1RA 2Y4NA 1N36C 2WP0C 2ZM6C 3R9WA 4JI4C 4JI2C 4D4IA 1O9TA 2CU6A 2P2BA 4LF6C 4NXNC 4BC9A 5AE3A 4PROC 2CY1A 2BJOA 2PT7G 4GS5A 1MDFA 5A1GA 1VEHA 4X66C 3IEUA
chains in the Genus database with same CATH topology
5BURA 1ULTA 3IEVA 1QWIA 1I94C 2PROA 5GTDA 4LF9C 2YCBA 4DCSA 5LMNC 2QVYX 3CJEA 1KKGA 4JI7C 3AF5A 5BSMA 4LFAC 4DUZC 4KTVA 4RVNA 1JOSA 5K85A 4I9FA 4EATA 1RG9A 4DV1C 4DR1C 1V26A 4DCTA 1HH2P 4LE5A 4G1IA 5FLXD 1WF3A 1HNWC 3NPDA 3CW8X 5BSVA 4GXRA 1XMOC 4OYCA 5KYTA 2D1QA 4WS9A 3E7WA 4LF5C 2QL8A 2E5LC 4ZJZA 1J5EC 4ZLPA 1FJGC 3IMLA 1VLAA 3N2QA 2P2MA 2D27A 4FUQA 3LAXA 4BCAA 4DV7C 3DHVA 4IZ6A 3J80D 4JI3C 1T5HX 4DV2C 4DR5C 2KZFA 4YY3C 1GPMA 4DR3C 2ASBA 4DR7C 3PBKA 4RMNA 1P7LA 5E7QA 5IWAC 5AE2A 2VQEC 1L2FA 4D57A 4LFBC 5CZVA 2OBVA 2D28C 2OO4A 4BSZA 1MXBA 1T5DX 1XRAA 4L4QA 5BSUA 4PHTA 1N34C 5K8FA 3GR0A 3J81D 2BH1X 2VZEA 1MXAA 2YWBA 4BC7A 4B3TC 2QVXX 3A4IA 1XRBA 3RG2A 3ETOA 3KXWA 4I9GA 2P2QA 2YWCA 4R1MA 4OXIA 1HR0C 4WV3A 2HJGA 4NDNA 2ATWA 1IBMC 1K0RA 1PG4A 5KYVA 1MXCA 4R0MA 3EERA 1O93A 4NOZA 1XRCA 1IBKC 1ZB9A 1ZB8A 1O92A 5LMUC 4L7IA 4D56A 4DG8A 4LF8C 2UUCC 5BUSA 2V7BA 5BUQA 4LF7C 3UZ0A 3R9XA 3I08A 1MDBA 1QM4A 1ML8A 4DUYC 4PZPA 2DYJA 3PROC 3NI2A 1HNXC 3A9UA 2Y4OA 3SO4A 4FTFA 4D4GA 4RM2A 4GKJC 5AE1A 1MD9A 2VSQA 4DV5C 4X65C 3NYQA 3H2TA 4NXMC 5DV9A 3J7AD 5CZXA 4RM3A 2D7VA 2ONFA 4GXQA 4DG9A 3LNVA 3VNRA 2WD9A 1PG3A 5T8SA 4X64C 4DR4C 3L8CA 4MH4A 5H9UA 1BA3A 4X62C 4JM1A 3T1HC 4RLFA 3GKUA 4BBYA 1XNRC 5A19A 3L95X 2UXDC 5BSTA 3B7WA 4OX9C 1HNZC 5A1IA 3G7SA 4DV3C 2JMPA 3UOWA 1N2FA 1LCIA 3R44A 1YJ7A 2D1TA 3AF6A 4HPVA 3ETCA 4MTNA 2AYAA 1FUGA 2P2JA 1LQLA 3NYRA 5A2QD 1UKKA 3C5EA 3FCEA 3RV2A 3EQ6A 4LFCC 1USPA 3N54B 1EGAA 4ODJA 4R1LA 2UUAC 5BSRA 3PESA 3S82A 5JRHA 2QVZX 3GR1A 5ADZA 4B3SC 3LGXA 4TPSB 2QW0X 1USPB 2OPLA 3DAYA 2XR1A 4KHPC 3JAMD 3TUFA 4B3RC 2P02A 3I07A 1V25A 3OTOC 2Y27A 2F4VC 4JV5C 4RLQA 4JI1C 1O90A 4L2ZA 4RVOA 2VQFC 5T8TA 4KTTA 2P2FA 3TQIA 4GKKC 2OPLB 4AQYC 4JI0C 3GPCA 2P20A 4IR7A 4DCUA 3IPLA 1N33C 2E0GA 3VNQA 1IBLC 4K0KC 4U5YD 4ISBA 4DR2C 1NYEA 4DV0C 2CXCA 4JI5C 2UUBC 4G37A 2E7GA 3CW9A 4DV6C 2E8EA 4JYAC 3TDEA 2E8FA 4JI6C 2EGTA 4DR6C 3DLPX 1PA4A 4XX2A 1XMQC 5KEIA 4DCVA 5BR8C 2E8CA 4K0BA 2UU9C 2DPLA 3FCCA 3T1YC 1AMUA 2UXCC 2PN2A 1WH9A 1XNQC 3LUSA 5BSWA 4G36A 4B3MC 2HHHC 5IFIA 1N32C 2D1SA 5IT9D 1MKYA 2UXBC 3A9VA 3VNSA 4FUTA 1RY2A 4JI8C 4LF4C 3E7XA 4YHHC 4DV4C 2D1RA 2Y4NA 1N36C 2WP0C 2ZM6C 3R9WA 4JI4C 4JI2C 4D4IA 1O9TA 2P2BA 4LF6C 4NXNC 4BC9A 5AE3A 4PROC 2CY1A 2BJOA 2PT7G 4GS5A 1MDFA 5A1GA 4X66C 3IEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY C;  4BSZ A;  3IEV A;  1QWI A;  1I94 C;  2D7V A;  2ONF A;  4JI0 C;  4DCU A;  4LF9 C;  2YCB A;  4DCS A;  5LMN C;  1N33 C;  4X64 C;  1IBL C;  3CJE A;  1N34 C;  4DR4 C;  4K0K C;  4MH4 A;  1KKG A;  3J81 D;  4X62 C;  3AF5 A;  4JI7 C;  4DR2 C;  4LFA C;  4DUZ C;  1NYE A;  4DV0 C;  1JOS A;  3T1H C;  2CXC A;  4JI5 C;  3GKU A;  4DV1 C;  4B3T C;  2UUB C;  1XNR C;  4DR1 C;  2UXD C;  2E7G A;  4DCT A;  4DV6 C;  2E8E A;  1HH2 P;  4JYA C;  5FLX D;  4OX9 C;  2E8F A;  4JI6 C;  2EGT A;  1WF3 A;  1HR0 C;  2HJG A;  4DR6 C;  2ATW A;  1PA4 A;  1HNZ C;  1HNW C;  1IBM C;  1K0R A;  4XX2 A;  4DV3 C;  1XMQ C;  2JMP A;  5BR8 C;  4DCV A;  1XMO C;  2E8C A;  1N2F A;  2UU9 C;  4LF5 C;  3EER A;  2QL8 A;  3T1Y C;  2UXC C;  4NOZ A;  2E5L C;  1J5E C;  1FJG C;  1IBK C;  2PN2 A;  3AF6 A;  1WH9 A;  1XNQ C;  3LUS A;  4MTN A;  1VLA A;  1ZB9 A;  4B3M C;  2HHH C;  1LQL A;  1N32 C;  1ZB8 A;  5IT9 D;  5LMU C;  1MKY A;  2UXB C;  1UKK A;  5A2Q D;  4LF8 C;  4DV7 C;  2UUC C;  4LFC C;  1USP A;  3J80 D;  4JI3 C;  1EGA A;  4LF7 C;  3R9X A;  4DV2 C;  2UUA C;  4JI8 C;  4LF4 C;  4DR5 C;  4YHH C;  1ML8 A;  4DUY C;  2KZF A;  2DYJ A;  4YY3 C;  4DV4 C;  1HNX C;  4B3S C;  1N36 C;  1USP B;  4DR3 C;  2OPL A;  2OPL B;  2ASB A;  2XR1 A;  2ZM6 C;  3R9W A;  4DR7 C;  4KHP C;  4JI4 C;  3JAM D;  4JI2 C;  4B3R C;  5IWA C;  3I07 A;  4LF6 C;  4NXN C;  4GKJ C;  3OTO C;  2F4V C;  4JV5 C;  4DV5 C;  2CY1 A;  4JI1 C;  4X65 C;  2BJO A;  2VQE C;  1L2F A;  2VQF C;  4NXM C;  2PT7 G;  3J7A D;  4LFB C;  4GKK C;  4X66 C;  3IEU A; 
#chains in the Genus database with same CATH topology
 5BUR A;  1ULT A;  3IEV A;  1QWI A;  1I94 C;  2PRO A;  5GTD A;  4LF9 C;  2YCB A;  4DCS A;  5LMN C;  2QVY X;  3CJE A;  1KKG A;  4JI7 C;  3AF5 A;  5BSM A;  1TH5 A;  4LFA C;  4DUZ C;  4KTV A;  4RVN A;  1JOS A;  5K85 A;  4I9F A;  4EAT A;  1RG9 A;  4DV1 C;  4DR1 C;  1V26 A;  4DCT A;  1HH2 P;  4LE5 A;  4G1I A;  5FLX D;  3UEB A;  1WF3 A;  4PUI A;  3K6R A;  1HNW C;  3NPD A;  2ZTB A;  3CW8 X;  2KZ0 A;  5BSV A;  1YGT A;  4GXR A;  1XMO C;  4OYC A;  5KYT A;  2D1Q A;  4WS9 A;  3E7W A;  1PU1 A;  4LF5 C;  2QL8 A;  2ZZM A;  2E5L C;  4ZJZ A;  1J5E C;  4ZLP A;  1FJG C;  2NCL A;  3IML A;  1VLA A;  3N2Q A;  2P2M A;  2D27 A;  4FUQ A;  3LAX A;  4BCA A;  4DV7 C;  3DHV A;  4IZ6 A;  3J80 D;  4JI3 C;  1T5H X;  4DV2 C;  1M6X C;  1P4E A;  4DR5 C;  2KZF A;  2MMA B;  4YY3 C;  1GPM A;  1WCJ A;  4DR3 C;  2ASB A;  4DR7 C;  3PBK A;  4RMN A;  1P7L A;  5E7Q A;  5IWA C;  5LCI A;  3CQ1 A;  5AE2 A;  2M5H A;  2VQE C;  1L2F A;  4D57 A;  4LFB C;  5CZV A;  2OBV A;  2D28 C;  2OO4 A;  4BSZ A;  1MXB A;  1T5D X;  1XRA A;  4L4Q A;  5BSU A;  4PHT A;  1N34 C;  5K8F A;  3UX3 A;  3GR0 A;  3J81 D;  2BH1 X;  2VZE A;  1MXA A;  1M6X A;  2YWB A;  4BC7 A;  2MCQ A;  4B3T C;  2QVX X;  3A4I A;  1XRB A;  2ZZN A;  3RG2 A;  3ETO A;  2MM9 A;  3KXW A;  4I9G A;  3FM7 A;  2P2Q A;  2YWC A;  4R1M A;  4OXI A;  1HR0 C;  4WV3 A;  2HJG A;  4NDN A;  2ATW A;  3CQ2 A;  1IBM C;  1FLO A;  2M5O A;  1K0R A;  1PG4 A;  5KYV A;  1MXC A;  4R0M A;  3EER A;  2KDN A;  1O93 A;  4NOZ A;  1XRC A;  1IBK C;  1ZB9 A;  1ZB8 A;  1O92 A;  5LMU C;  4L7I A;  4D56 A;  4DG8 A;  4LF8 C;  2UUC C;  5BUS A;  2V7B A;  5BUQ A;  4LF7 C;  3UZ0 A;  3R9X A;  3I08 A;  2YX1 A;  1MDB A;  1QM4 A;  1ML8 A;  4DUY C;  4PZP A;  2DYJ A;  3PRO C;  3NI2 A;  1HNX C;  3A9U A;  2Y4O A;  3AY0 A;  3LNO A;  3SO4 A;  2PG1 E;  4FTF A;  4D4G A;  4RM2 A;  4PUG A;  4GKJ C;  5AE1 A;  1MD9 A;  2VSQ A;  4DV5 C;  1XDX A;  4X65 C;  3NYQ A;  3H2T A;  4NXM C;  5DV9 A;  3J7A D;  1UWD A;  5CZX A;  4RM3 A;  2D7V A;  2ONF A;  4GXQ A;  4DG9 A;  3LNV A;  3VNR A;  2WD9 A;  1PG3 A;  5T8S A;  4X64 C;  4DR4 C;  3L8C A;  4MH4 A;  5H9U A;  1BA3 A;  4X62 C;  4JM1 A;  3T1H C;  4RLF A;  3GKU A;  4BBY A;  2Z51 A;  1XNR C;  5A19 A;  3L95 X;  2UXD C;  5BST A;  3B7W A;  4OX9 C;  1HNZ C;  5A1I A;  3G7S A;  4DV3 C;  2JMP A;  3UOW A;  1N2F A;  1LCI A;  3R44 A;  1YJ7 A;  2D1T A;  3AF6 A;  4HPV A;  3ETC A;  4MTN A;  2AYA A;  1FUG A;  2P2J A;  1LQL A;  3NYR A;  1UKK A;  3C5E A;  5A2Q D;  3FCE A;  3RV2 A;  3EQ6 A;  4LFC C;  1USP A;  3N54 B;  1XHJ A;  1EGA A;  4ODJ A;  4R1L A;  2UUA C;  5BSR A;  3PES A;  3S82 A;  5JRH A;  2QVZ X;  3GR1 A;  5ADZ A;  4B3S C;  3LGX A;  4TPS B;  2QW0 X;  1USP B;  2OPL A;  3DAY A;  2XR1 A;  4KHP C;  3JAM D;  3TUF A;  4B3R C;  2P02 A;  3I07 A;  1V25 A;  3OTO C;  2Y27 A;  3A26 A;  2F4V C;  4JV5 C;  3TR3 A;  4RLQ A;  4JI1 C;  1O90 A;  4L2Z A;  4RVO A;  2VQF C;  5T8T A;  4KTT A;  2P2F A;  3TQI A;  4GKK C;  2OPL B;  4AQY C;  1P4E C;  3UX2 A;  4JI0 C;  3GPC A;  2P20 A;  4IR7 A;  4DCU A;  3IPL A;  4PUH A;  2E0G A;  3VNQ A;  1N33 C;  1IBL C;  4K0K C;  4U5Y D;  4ISB A;  4DR2 C;  1NYE A;  1NY8 A;  4DV0 C;  2DHM A;  2CXC A;  4JI5 C;  2UUB C;  4G37 A;  2E7G A;  3CW9 A;  1IB8 A;  4DV6 C;  2E8E A;  4JYA C;  3TDE A;  2E8F A;  4JI6 C;  2EGT A;  4DR6 C;  3DLP X;  1PA4 A;  4XX2 A;  1XMQ C;  5KEI A;  1XS3 A;  4DCV A;  5BR8 C;  2E8C A;  1V60 A;  3O2E A;  4K0B A;  2UU9 C;  2DPL A;  3FCC A;  3T1Y C;  1AMU A;  2UXC C;  2PN2 A;  2JNV A;  1WH9 A;  1XNQ C;  3LUS A;  5BSW A;  4G36 A;  4B3M C;  2HHH C;  5IFI A;  1N32 C;  2D1S A;  5IT9 D;  3A25 A;  1MKY A;  2UXB C;  3A9V A;  3VNS A;  4FUT A;  1RY2 A;  4JI8 C;  4LF4 C;  3E7X A;  4YHH C;  3CQ3 A;  4DV4 C;  2D1R A;  2Y4N A;  1N36 C;  2WP0 C;  2ZM6 C;  3R9W A;  4JI4 C;  4JI2 C;  4D4I A;  1O9T A;  2CU6 A;  2P2B A;  4LF6 C;  4NXN C;  4BC9 A;  5AE3 A;  4PRO C;  2CY1 A;  2BJO A;  2PT7 G;  4GS5 A;  1MDF A;  5A1G A;  1VEH A;  4X66 C;  3IEU A; 
#chains in the Genus database with same CATH homology
 5BUR A;  1ULT A;  3IEV A;  1QWI A;  1I94 C;  2PRO A;  5GTD A;  4LF9 C;  2YCB A;  4DCS A;  5LMN C;  2QVY X;  3CJE A;  1KKG A;  4JI7 C;  3AF5 A;  5BSM A;  4LFA C;  4DUZ C;  4KTV A;  4RVN A;  1JOS A;  5K85 A;  4I9F A;  4EAT A;  1RG9 A;  4DV1 C;  4DR1 C;  1V26 A;  4DCT A;  1HH2 P;  4LE5 A;  4G1I A;  5FLX D;  1WF3 A;  1HNW C;  3NPD A;  3CW8 X;  5BSV A;  4GXR A;  1XMO C;  4OYC A;  5KYT A;  2D1Q A;  4WS9 A;  3E7W A;  4LF5 C;  2QL8 A;  2E5L C;  4ZJZ A;  1J5E C;  4ZLP A;  1FJG C;  3IML A;  1VLA A;  3N2Q A;  2P2M A;  2D27 A;  4FUQ A;  3LAX A;  4BCA A;  4DV7 C;  3DHV A;  4IZ6 A;  3J80 D;  4JI3 C;  1T5H X;  4DV2 C;  4DR5 C;  2KZF A;  4YY3 C;  1GPM A;  4DR3 C;  2ASB A;  4DR7 C;  3PBK A;  4RMN A;  1P7L A;  5E7Q A;  5IWA C;  5AE2 A;  2VQE C;  1L2F A;  4D57 A;  4LFB C;  5CZV A;  2OBV A;  2D28 C;  2OO4 A;  4BSZ A;  1MXB A;  1T5D X;  1XRA A;  4L4Q A;  5BSU A;  4PHT A;  1N34 C;  5K8F A;  3GR0 A;  3J81 D;  2BH1 X;  2VZE A;  1MXA A;  2YWB A;  4BC7 A;  4B3T C;  2QVX X;  3A4I A;  1XRB A;  3RG2 A;  3ETO A;  3KXW A;  4I9G A;  2P2Q A;  2YWC A;  4R1M A;  4OXI A;  1HR0 C;  4WV3 A;  2HJG A;  4NDN A;  2ATW A;  1IBM C;  1K0R A;  1PG4 A;  5KYV A;  1MXC A;  4R0M A;  3EER A;  1O93 A;  4NOZ A;  1XRC A;  1IBK C;  1ZB9 A;  1ZB8 A;  1O92 A;  5LMU C;  4L7I A;  4D56 A;  4DG8 A;  4LF8 C;  2UUC C;  5BUS A;  2V7B A;  5BUQ A;  4LF7 C;  3UZ0 A;  3R9X A;  3I08 A;  1MDB A;  1QM4 A;  1ML8 A;  4DUY C;  4PZP A;  2DYJ A;  3PRO C;  3NI2 A;  1HNX C;  3A9U A;  2Y4O A;  3SO4 A;  4FTF A;  4D4G A;  4RM2 A;  4GKJ C;  5AE1 A;  1MD9 A;  2VSQ A;  4DV5 C;  4X65 C;  3NYQ A;  3H2T A;  4NXM C;  5DV9 A;  3J7A D;  5CZX A;  4RM3 A;  2D7V A;  2ONF A;  4GXQ A;  4DG9 A;  3LNV A;  3VNR A;  2WD9 A;  1PG3 A;  5T8S A;  4X64 C;  4DR4 C;  3L8C A;  4MH4 A;  5H9U A;  1BA3 A;  4X62 C;  4JM1 A;  3T1H C;  4RLF A;  3GKU A;  4BBY A;  1XNR C;  5A19 A;  3L95 X;  2UXD C;  5BST A;  3B7W A;  4OX9 C;  1HNZ C;  5A1I A;  3G7S A;  4DV3 C;  2JMP A;  3UOW A;  1N2F A;  1LCI A;  3R44 A;  1YJ7 A;  2D1T A;  3AF6 A;  4HPV A;  3ETC A;  4MTN A;  2AYA A;  1FUG A;  2P2J A;  1LQL A;  3NYR A;  5A2Q D;  1UKK A;  3C5E A;  3FCE A;  3RV2 A;  3EQ6 A;  4LFC C;  1USP A;  3N54 B;  1EGA A;  4ODJ A;  4R1L A;  2UUA C;  5BSR A;  3PES A;  3S82 A;  5JRH A;  2QVZ X;  3GR1 A;  5ADZ A;  4B3S C;  3LGX A;  4TPS B;  2QW0 X;  1USP B;  2OPL A;  3DAY A;  2XR1 A;  4KHP C;  3JAM D;  3TUF A;  4B3R C;  2P02 A;  3I07 A;  1V25 A;  3OTO C;  2Y27 A;  2F4V C;  4JV5 C;  4RLQ A;  4JI1 C;  1O90 A;  4L2Z A;  4RVO A;  2VQF C;  5T8T A;  4KTT A;  2P2F A;  3TQI A;  4GKK C;  2OPL B;  4AQY C;  4JI0 C;  3GPC A;  2P20 A;  4IR7 A;  4DCU A;  3IPL A;  1N33 C;  2E0G A;  3VNQ A;  1IBL C;  4K0K C;  4U5Y D;  4ISB A;  4DR2 C;  1NYE A;  4DV0 C;  2CXC A;  4JI5 C;  2UUB C;  4G37 A;  2E7G A;  3CW9 A;  4DV6 C;  2E8E A;  4JYA C;  3TDE A;  2E8F A;  4JI6 C;  2EGT A;  4DR6 C;  3DLP X;  1PA4 A;  4XX2 A;  1XMQ C;  5KEI A;  4DCV A;  5BR8 C;  2E8C A;  4K0B A;  2UU9 C;  2DPL A;  3FCC A;  3T1Y C;  1AMU A;  2UXC C;  2PN2 A;  1WH9 A;  1XNQ C;  3LUS A;  5BSW A;  4G36 A;  4B3M C;  2HHH C;  5IFI A;  1N32 C;  2D1S A;  5IT9 D;  1MKY A;  2UXB C;  3A9V A;  3VNS A;  4FUT A;  1RY2 A;  4JI8 C;  4LF4 C;  3E7X A;  4YHH C;  4DV4 C;  2D1R A;  2Y4N A;  1N36 C;  2WP0 C;  2ZM6 C;  3R9W A;  4JI4 C;  4JI2 C;  4D4I A;  1O9T A;  2P2B A;  4LF6 C;  4NXN C;  4BC9 A;  5AE3 A;  4PRO C;  2CY1 A;  2BJO A;  2PT7 G;  4GS5 A;  1MDF A;  5A1G A;  4X66 C;  3IEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...