5LMNC

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5lmnC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5lmnC02
4KHPC 2UXDC 1VLAA 4DV5C 1XMQC 1L2FA 3J81D 2ZM6C 1N36C 4DV2C 4DUYC 1XNRC 5FLXD 4MTNA 4DV6C 1N33C 4NOZA 4DR7C 4DR4C 2E7GA 2YCBA 3IEVA 1ML8A 1ZB9A 1IBLC 1QWIA 2JMPA 4NXNC 1I94C 4LF4C 4DCUA 3AF6A 2XR1A 3I07A 4X64C 3J7AD 2D7VA 4DR5C 2UU9C 4JI8C 4NXMC 4JI5C 3J80D 3LUSA 1MKYA 4DR3C 5IT9D 1J5EC 4DR2C 2ONFA 4DR1C 4X66C 1XNQC 2E8FA 4JI0C 1N34C 4DR6C 2DYJA 4DV3C 3EERA 1USPA 5LMUC 1HNZC 1UKKA 3JAMD 1N32C 4JI6C 4JV5C 4X65C 2E8CA 4DUZC 1USPB 5LMNC 4B3TC 3GKUA 1EGAA 2BJOA 4B3MC 3R9WA 1IBMC 2UUAC 2UUCC 1N2FA 4DCSA 1K0RA 4YY3C 4MH4A 4LF9C 4LFAC 2ATWA 2UXCC 4LF6C 4LF8C 2PN2A 4LFCC 4XX2A 4DCVA 3T1HC 4LF5C 5IWAC 3OTOC 1WF3A 2HJGA 2CXCA 4JI2C 4AQYC 3AF5A 1HNWC 3CJEA 1KKGA 2ASBA 2VQEC 1LQLA 1IBKC 4GKJC 4GKKC 4B3RC 2VQFC 4DV1C 3IEUA 4X62C 4JI7C 4OX9C 2E5LC 2KZFA 1PA4A 5BR8C 4DCTA 3T1YC 4JI1C 1FJGC 4K0KC 4JYAC 2UXBC 2HHHC 2UUBC 2E8EA 2CY1A 2EGTA 4BSZA 4LF7C 1WH9A 1HH2P 1HNXC 4JI3C 4JI4C 2QL8A 2OPLB 2PT7G 2F4VC 1XMOC 4LFBC 1ZB8A 3R9XA 1JOSA 1NYEA 2OPLA 4DV0C 1HR0C 5A2QD 4DV7C 4YHHC 4B3SC 4DV4C
chains in the Genus database with same CATH superfamily
4KHPC 3K6RA 4FTFA 2D27A 2Z51A 3A4IA 5A19A 5E7QA 4DUYC 2P2FA 2YWBA 3LNOA 3LNVA 4RM2A 4DR4C 3TQIA 3O2EA 4GS5A 1IBLC 2Y27A 4NDNA 4PUHA 1T5HX 2DPLA 3E7WA 5KYTA 4X64C 3J7AD 4JI8C 2MMAB 2MM9A 3UOWA 4DR3C 5IT9D 4DR2C 2ONFA 2KZ0A 2WP0C 4X66C 4OXIA 4DR6C 4DV3C 3R44A 1USPA 5LMUC 1N32C 2D1QA 4JI6C 3UX2A 4X65C 3DHVA 2E8CA 2QVZX 3UX3A 1PU1A 2P02A 5KYVA 1EGAA 4R0MA 3CQ1A 4G37A 1BA3A 3IMLA 5T8TA 1N2FA 5KEIA 3LAXA 4DCSA 1K0RA 4MH4A 1XDXA 4LF9C 3CQ3A 4LF6C 4LF8C 2PN2A 4LFCC 2OO4A 3ETCA 1O90A 2D1RA 3T1HC 4K0BA 3E7XA 4JI2C 1MDBA 4AQYC 3AF5A 1HNWC 1MXBA 3CJEA 4ODJA 4IZ6A 2ASBA 2NCLA 4GKJC 2PG1E 3RV2A 3CQ2A 1PA4A 3VNQA 2HHHC 2UUBC 4BSZA 2CY1A 2EGTA 4LF7C 4ZJZA 5BSTA 1XS3A 1YJ7A 4RVOA 4I9GA 3ETOA 2PT7G 3R9XA 2QVXX 2ZTBA 5CZVA 4DV0C 4DV7C 4YHHC 5BUQA 4B3SC 3A25A 5BSMA 3VNSA 4BC7A 4PUGA 1N36C 5ADZA 1M6XA 5IFIA 4GXRA 1N33C 5AE2A 3A26A 1ZB9A 2E0GA 4JM1A 3L95X 4NXNC 1I94C 1V26A 4LF4C 4DCUA 2XR1A 3I07A 1O93A 4RM3A 4NXMC 4RVNA 1J5EC 2P2BA 1WCJA 1FUGA 1MDFA 4DG8A 1N34C 1HNZC 4KTTA 4WV3A 4OYCA 4PHTA 1XRAA 3S82A 4JV5C 4ISBA 5LMNC 4B3TC 3GKUA 2M5OA 4WS9A 2BJOA 4D57A 1P4EC 2P2QA 2UUCC 5LCIA 3NI2A 3H2TA 2PROA 3FCCA 2UXCC 4R1LA 4DCVA 5IWAC 3CW9A 2CXCA 3LGXA 1KKGA 1XRCA 1LQLA 1IBKC 1PG4A 1T5DX 4DV1C 1RG9A 2MCQA 4RLQA 4OX9C 4TPSB 2Y4NA 4JI1C 3A9VA 1FJGC 1LCIA 2UXBC 4U5YD 2E8EA 4GXQA 1WH9A 3TDEA 1UWDA 2P2JA 4JI3C 1V25A 2F4VC 2BH1X 1P7LA 2D28C 2OPLA 4R1MA 4FUQA 5AE1A 3SO4A 2JNVA 1XMQC 4ZLPA 3IPLA 5CZXA 4EATA 2ZM6C 2Y4OA 3KXWA 1XNRC 5FLXD 4NOZA 4BBYA 4D4GA 2VZEA 2YCBA 3IEVA 5A1IA 2JMPA 1QWIA 3FM7A 5H9UA 3C5EA 2OBVA 4KTVA 3AF6A 2P2MA 2QW0X 2D7VA 4DR5C 1V60A 4D4IA 4JI5C 3J80D 2P20A 3LUSA 3VNRA 4PZPA 1XNQC 2E8FA 3NYRA 4JI0C 3GR0A 2DYJA 5BSWA 3N2QA 3B7WA 5JRHA 3N54B 4DUZC 1USPB 3PBKA 1XHJA 2UUAC 4BC9A 2KDNA 4IR7A 2WD9A 2ATWA 1QM4A 3OTOC 1WF3A 2HJGA 2D1TA 4L4QA 2VSQA 2VQEC 3NPDA 4GKKC 4B3RC 2VQFC 1XRBA 4I9FA 1IB8A 3IEUA 2E5LC 5BR8C 3T1YC 1MD9A 4JYAC 2ZZNA 1HH2P 3G7SA 1HNXC 4L2ZA 4LFBC 4HPVA 1JOSA 1VEHA 4LE5A 4DV4C 2UXDC 3AY0A 1VLAA 4DV5C 1L2FA 3J81D 1FLOA 3GR1A 4DV2C 4MTNA 4PROC 4DV6C 2ZZMA 4DR7C 2E7GA 3I08A 1ML8A 3DLPX 3GPCA 3EQ6A 1GPMA 1YGTA 1O92A 3PROC 3DAYA 3RG2A 2V7BA 5T8SA 1NY8A 2DHMA 2UU9C 1M6XC 5BSVA 1MKYA 4FUTA 4DG9A 4DR1C 5BUSA 5GTDA 3L8CA 3CW8X 5BSUA 3EERA 1UKKA 3JAMD 5DV9A 1PG3A 2YWCA 4RMNA 4RLFA 4BCAA 5AE3A 4B3MC 3R9WA 3A9UA 4L7IA 1IBMC 5K85A 2M5HA 1ULTA 4PUIA 1AMUA 1RY2A 4YY3C 4LFAC 2D1SA 4XX2A 2CU6A 3TUFA 4LF5C 1MXAA 1P4EA 3NYQA 4D56A 5BSRA 3PESA 1MXCA 2QVYX 2YX1A 4X62C 4JI7C 4G36A 2KZFA 4DCTA 4K0KC 3TR3A 1TH5A 4G1IA 5BURA 4JI4C 2QL8A 2OPLB 5K8FA 1XMOC 2AYAA 3UEBA 1O9TA 1ZB8A 1NYEA 3UZ0A 1HR0C 5A2QD 5A1GA 3FCEA
chains in the Genus database with same CATH topology
4KHPC 4FTFA 2D27A 3A4IA 5A19A 5E7QA 4DUYC 2P2FA 2YWBA 3LNVA 4RM2A 4DR4C 3TQIA 4GS5A 1IBLC 2Y27A 4NDNA 1T5HX 2DPLA 3E7WA 5KYTA 4X64C 3J7AD 4JI8C 3UOWA 4DR3C 5IT9D 4DR2C 2ONFA 2WP0C 4X66C 4OXIA 4DR6C 4DV3C 3R44A 1USPA 5LMUC 1N32C 2D1QA 4JI6C 4X65C 3DHVA 2E8CA 2QVZX 2P02A 5KYVA 1EGAA 4R0MA 4G37A 1BA3A 3IMLA 5T8TA 1N2FA 5KEIA 3LAXA 4DCSA 1K0RA 4MH4A 4LF9C 4LF6C 4LF8C 2PN2A 4LFCC 2OO4A 3ETCA 1O90A 2D1RA 3T1HC 4K0BA 3E7XA 4JI2C 1MDBA 4AQYC 3AF5A 1HNWC 1MXBA 3CJEA 4ODJA 4IZ6A 2ASBA 4GKJC 3RV2A 1PA4A 3VNQA 2UUBC 2HHHC 4BSZA 2CY1A 2EGTA 4LF7C 4ZJZA 5BSTA 1YJ7A 4RVOA 4I9GA 3ETOA 2PT7G 3R9XA 2QVXX 5CZVA 4DV0C 4DV7C 4YHHC 5BUQA 4B3SC 5BSMA 3VNSA 4BC7A 1N36C 5ADZA 5IFIA 4GXRA 1N33C 5AE2A 1ZB9A 2E0GA 4JM1A 3L95X 4NXNC 1I94C 1V26A 4LF4C 4DCUA 2XR1A 3I07A 1O93A 4RM3A 4NXMC 4RVNA 1J5EC 2P2BA 1FUGA 1MDFA 4DG8A 1N34C 1HNZC 4KTTA 4WV3A 4OYCA 4PHTA 1XRAA 3S82A 4JV5C 4ISBA 5LMNC 4B3TC 3GKUA 4WS9A 2BJOA 4D57A 2P2QA 2UUCC 3NI2A 3H2TA 2PROA 3FCCA 2UXCC 4R1LA 4DCVA 5IWAC 3CW9A 2CXCA 3LGXA 1KKGA 1XRCA 1LQLA 1IBKC 1PG4A 1T5DX 4DV1C 1RG9A 4RLQA 4OX9C 4TPSB 2Y4NA 4JI1C 3A9VA 1FJGC 1LCIA 2UXBC 4U5YD 2E8EA 4GXQA 1WH9A 3TDEA 2P2JA 4JI3C 1V25A 2F4VC 2BH1X 1P7LA 2D28C 2OPLA 4R1MA 4FUQA 5AE1A 3SO4A 1XMQC 4ZLPA 3IPLA 5CZXA 4EATA 2ZM6C 2Y4OA 3KXWA 1XNRC 5FLXD 4NOZA 4BBYA 4D4GA 2VZEA 2YCBA 3IEVA 5A1IA 2JMPA 1QWIA 5H9UA 3C5EA 2OBVA 4KTVA 3AF6A 2P2MA 2QW0X 2D7VA 4DR5C 4D4IA 4JI5C 3J80D 2P20A 3LUSA 3VNRA 4PZPA 1XNQC 2E8FA 3NYRA 4JI0C 3GR0A 2DYJA 5BSWA 3N2QA 3B7WA 5JRHA 3N54B 4DUZC 1USPB 3PBKA 2UUAC 4BC9A 4IR7A 2WD9A 2ATWA 1QM4A 3OTOC 1WF3A 2HJGA 2D1TA 4L4QA 2VSQA 2VQEC 3NPDA 4GKKC 4B3RC 2VQFC 1XRBA 4I9FA 3IEUA 2E5LC 5BR8C 3T1YC 1MD9A 4JYAC 1HH2P 3G7SA 1HNXC 4L2ZA 4LFBC 4HPVA 1JOSA 4LE5A 4DV4C 2UXDC 1VLAA 4DV5C 1L2FA 3J81D 3GR1A 4DV2C 4MTNA 4PROC 4DV6C 4DR7C 2E7GA 3I08A 1ML8A 3DLPX 3GPCA 3EQ6A 1GPMA 1O92A 3PROC 3DAYA 3RG2A 2V7BA 5T8SA 2UU9C 5BSVA 1MKYA 4FUTA 4DG9A 4DR1C 5BUSA 5GTDA 3L8CA 3CW8X 5BSUA 3EERA 1UKKA 3JAMD 5DV9A 1PG3A 2YWCA 4RMNA 4RLFA 4BCAA 5AE3A 4B3MC 3R9WA 3A9UA 4L7IA 1IBMC 5K85A 1ULTA 1AMUA 1RY2A 4YY3C 4LFAC 2D1SA 4XX2A 3TUFA 4LF5C 1MXAA 3NYQA 4D56A 5BSRA 3PESA 1MXCA 2QVYX 4X62C 4JI7C 4G36A 2KZFA 4DCTA 4K0KC 4G1IA 5BURA 4JI4C 2QL8A 2OPLB 5K8FA 1XMOC 2AYAA 1O9TA 1ZB8A 1NYEA 3UZ0A 1HR0C 5A2QD 5A1GA 3FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP C;  2UXD C;  1VLA A;  4DV5 C;  1XMQ C;  1L2F A;  3J81 D;  2ZM6 C;  1N36 C;  4DV2 C;  4DUY C;  1XNR C;  5FLX D;  4MTN A;  4DV6 C;  1N33 C;  4NOZ A;  4DR7 C;  4DR4 C;  2E7G A;  2YCB A;  3IEV A;  1ML8 A;  1ZB9 A;  1IBL C;  1QWI A;  2JMP A;  4NXN C;  1I94 C;  4LF4 C;  4DCU A;  3AF6 A;  2XR1 A;  3I07 A;  4X64 C;  3J7A D;  2D7V A;  4DR5 C;  2UU9 C;  4JI8 C;  4NXM C;  4JI5 C;  3J80 D;  3LUS A;  1MKY A;  4DR3 C;  5IT9 D;  1J5E C;  4DR2 C;  2ONF A;  4DR1 C;  4X66 C;  1XNQ C;  2E8F A;  4JI0 C;  1N34 C;  4DR6 C;  2DYJ A;  4DV3 C;  3EER A;  1USP A;  5LMU C;  1HNZ C;  1UKK A;  3JAM D;  1N32 C;  4JI6 C;  4JV5 C;  4X65 C;  2E8C A;  4DUZ C;  1USP B;  5LMN C;  4B3T C;  3GKU A;  1EGA A;  2BJO A;  4B3M C;  3R9W A;  1IBM C;  2UUA C;  2UUC C;  1N2F A;  4DCS A;  1K0R A;  4YY3 C;  4MH4 A;  4LF9 C;  4LFA C;  2ATW A;  2UXC C;  4LF6 C;  4LF8 C;  2PN2 A;  4LFC C;  4XX2 A;  4DCV A;  3T1H C;  4LF5 C;  5IWA C;  3OTO C;  1WF3 A;  2HJG A;  2CXC A;  4JI2 C;  4AQY C;  3AF5 A;  1HNW C;  3CJE A;  1KKG A;  2ASB A;  2VQE C;  1LQL A;  1IBK C;  4GKJ C;  4GKK C;  4B3R C;  2VQF C;  4DV1 C;  3IEU A;  4X62 C;  4JI7 C;  4OX9 C;  2E5L C;  2KZF A;  1PA4 A;  5BR8 C;  4DCT A;  3T1Y C;  4JI1 C;  1FJG C;  4K0K C;  4JYA C;  2UXB C;  2HHH C;  2UUB C;  2E8E A;  2CY1 A;  2EGT A;  4BSZ A;  4LF7 C;  1WH9 A;  1HH2 P;  1HNX C;  4JI3 C;  4JI4 C;  2QL8 A;  2OPL B;  2PT7 G;  2F4V C;  1XMO C;  4LFB C;  1ZB8 A;  3R9X A;  1JOS A;  1NYE A;  2OPL A;  4DV0 C;  1HR0 C;  5A2Q D;  4DV7 C;  4YHH C;  4B3S C;  4DV4 C; 
#chains in the Genus database with same CATH topology
 4KHP C;  3K6R A;  4FTF A;  2D27 A;  2Z51 A;  3A4I A;  5A19 A;  5E7Q A;  4DUY C;  2P2F A;  2YWB A;  3LNO A;  3LNV A;  4RM2 A;  4DR4 C;  3TQI A;  3O2E A;  4GS5 A;  1IBL C;  2Y27 A;  4NDN A;  4PUH A;  1T5H X;  2DPL A;  3E7W A;  5KYT A;  4X64 C;  3J7A D;  4JI8 C;  2MMA B;  2MM9 A;  3UOW A;  4DR3 C;  5IT9 D;  4DR2 C;  2ONF A;  2KZ0 A;  2WP0 C;  4X66 C;  4OXI A;  4DR6 C;  4DV3 C;  3R44 A;  1USP A;  5LMU C;  1N32 C;  2D1Q A;  4JI6 C;  3UX2 A;  4X65 C;  3DHV A;  2E8C A;  2QVZ X;  3UX3 A;  1PU1 A;  2P02 A;  5KYV A;  1EGA A;  4R0M A;  3CQ1 A;  4G37 A;  1BA3 A;  3IML A;  5T8T A;  1N2F A;  5KEI A;  3LAX A;  4DCS A;  1K0R A;  4MH4 A;  1XDX A;  4LF9 C;  3CQ3 A;  4LF6 C;  4LF8 C;  2PN2 A;  4LFC C;  2OO4 A;  3ETC A;  1O90 A;  2D1R A;  3T1H C;  4K0B A;  3E7X A;  4JI2 C;  1MDB A;  4AQY C;  3AF5 A;  1HNW C;  1MXB A;  3CJE A;  4ODJ A;  4IZ6 A;  2ASB A;  2NCL A;  4GKJ C;  2PG1 E;  3RV2 A;  3CQ2 A;  1PA4 A;  3VNQ A;  2HHH C;  2UUB C;  4BSZ A;  2CY1 A;  2EGT A;  4LF7 C;  4ZJZ A;  5BST A;  1XS3 A;  1YJ7 A;  4RVO A;  4I9G A;  3ETO A;  2PT7 G;  3R9X A;  2QVX X;  2ZTB A;  5CZV A;  4DV0 C;  4DV7 C;  4YHH C;  5BUQ A;  4B3S C;  3A25 A;  5BSM A;  3VNS A;  4BC7 A;  4PUG A;  1N36 C;  5ADZ A;  1M6X A;  5IFI A;  4GXR A;  1N33 C;  5AE2 A;  3A26 A;  1ZB9 A;  2E0G A;  4JM1 A;  3L95 X;  4NXN C;  1I94 C;  1V26 A;  4LF4 C;  4DCU A;  2XR1 A;  3I07 A;  1O93 A;  4RM3 A;  4NXM C;  4RVN A;  1J5E C;  2P2B A;  1WCJ A;  1FUG A;  1MDF A;  4DG8 A;  1N34 C;  1HNZ C;  4KTT A;  4WV3 A;  4OYC A;  4PHT A;  1XRA A;  3S82 A;  4JV5 C;  4ISB A;  5LMN C;  4B3T C;  3GKU A;  2M5O A;  4WS9 A;  2BJO A;  4D57 A;  1P4E C;  2P2Q A;  2UUC C;  5LCI A;  3NI2 A;  3H2T A;  2PRO A;  3FCC A;  2UXC C;  4R1L A;  4DCV A;  5IWA C;  3CW9 A;  2CXC A;  3LGX A;  1KKG A;  1XRC A;  1LQL A;  1IBK C;  1PG4 A;  1T5D X;  4DV1 C;  1RG9 A;  2MCQ A;  4RLQ A;  4OX9 C;  4TPS B;  2Y4N A;  4JI1 C;  3A9V A;  1FJG C;  1LCI A;  2UXB C;  4U5Y D;  2E8E A;  4GXQ A;  1WH9 A;  3TDE A;  1UWD A;  2P2J A;  4JI3 C;  1V25 A;  2F4V C;  2BH1 X;  1P7L A;  2D28 C;  2OPL A;  4R1M A;  4FUQ A;  5AE1 A;  3SO4 A;  2JNV A;  1XMQ C;  4ZLP A;  3IPL A;  5CZX A;  4EAT A;  2ZM6 C;  2Y4O A;  3KXW A;  1XNR C;  5FLX D;  4NOZ A;  4BBY A;  4D4G A;  2VZE A;  2YCB A;  3IEV A;  5A1I A;  2JMP A;  1QWI A;  3FM7 A;  5H9U A;  3C5E A;  2OBV A;  4KTV A;  3AF6 A;  2P2M A;  2QW0 X;  2D7V A;  4DR5 C;  1V60 A;  4D4I A;  4JI5 C;  3J80 D;  2P20 A;  3LUS A;  3VNR A;  4PZP A;  1XNQ C;  2E8F A;  3NYR A;  4JI0 C;  3GR0 A;  2DYJ A;  5BSW A;  3N2Q A;  3B7W A;  5JRH A;  3N54 B;  4DUZ C;  1USP B;  3PBK A;  1XHJ A;  2UUA C;  4BC9 A;  2KDN A;  4IR7 A;  2WD9 A;  2ATW A;  1QM4 A;  3OTO C;  1WF3 A;  2HJG A;  2D1T A;  4L4Q A;  2VSQ A;  2VQE C;  3NPD A;  4GKK C;  4B3R C;  2VQF C;  1XRB A;  4I9F A;  1IB8 A;  3IEU A;  2E5L C;  5BR8 C;  3T1Y C;  1MD9 A;  4JYA C;  2ZZN A;  1HH2 P;  3G7S A;  1HNX C;  4L2Z A;  4LFB C;  4HPV A;  1JOS A;  1VEH A;  4LE5 A;  4DV4 C;  2UXD C;  3AY0 A;  1VLA A;  4DV5 C;  1L2F A;  3J81 D;  1FLO A;  3GR1 A;  4DV2 C;  4MTN A;  4PRO C;  4DV6 C;  2ZZM A;  4DR7 C;  2E7G A;  3I08 A;  1ML8 A;  3DLP X;  3GPC A;  3EQ6 A;  1GPM A;  1YGT A;  1O92 A;  3PRO C;  3DAY A;  3RG2 A;  2V7B A;  5T8S A;  1NY8 A;  2DHM A;  2UU9 C;  1M6X C;  5BSV A;  1MKY A;  4FUT A;  4DG9 A;  4DR1 C;  5BUS A;  5GTD A;  3L8C A;  3CW8 X;  5BSU A;  3EER A;  1UKK A;  3JAM D;  5DV9 A;  1PG3 A;  2YWC A;  4RMN A;  4RLF A;  4BCA A;  5AE3 A;  4B3M C;  3R9W A;  3A9U A;  4L7I A;  1IBM C;  5K85 A;  2M5H A;  1ULT A;  4PUI A;  1AMU A;  1RY2 A;  4YY3 C;  4LFA C;  2D1S A;  4XX2 A;  2CU6 A;  3TUF A;  4LF5 C;  1MXA A;  1P4E A;  3NYQ A;  4D56 A;  5BSR A;  3PES A;  1MXC A;  2QVY X;  2YX1 A;  4X62 C;  4JI7 C;  4G36 A;  2KZF A;  4DCT A;  4K0K C;  3TR3 A;  1TH5 A;  4G1I A;  5BUR A;  4JI4 C;  2QL8 A;  2OPL B;  5K8F A;  1XMO C;  2AYA A;  3UEB A;  1O9T A;  1ZB8 A;  1NYE A;  3UZ0 A;  1HR0 C;  5A2Q D;  5A1G A;  3FCE A; 
#chains in the Genus database with same CATH homology
 4KHP C;  4FTF A;  2D27 A;  3A4I A;  5A19 A;  5E7Q A;  4DUY C;  2P2F A;  2YWB A;  3LNV A;  4RM2 A;  4DR4 C;  3TQI A;  4GS5 A;  1IBL C;  2Y27 A;  4NDN A;  1T5H X;  2DPL A;  3E7W A;  5KYT A;  4X64 C;  3J7A D;  4JI8 C;  3UOW A;  4DR3 C;  5IT9 D;  4DR2 C;  2ONF A;  2WP0 C;  4X66 C;  4OXI A;  4DR6 C;  4DV3 C;  3R44 A;  1USP A;  5LMU C;  1N32 C;  2D1Q A;  4JI6 C;  4X65 C;  3DHV A;  2E8C A;  2QVZ X;  2P02 A;  5KYV A;  1EGA A;  4R0M A;  4G37 A;  1BA3 A;  3IML A;  5T8T A;  1N2F A;  5KEI A;  3LAX A;  4DCS A;  1K0R A;  4MH4 A;  4LF9 C;  4LF6 C;  4LF8 C;  2PN2 A;  4LFC C;  2OO4 A;  3ETC A;  1O90 A;  2D1R A;  3T1H C;  4K0B A;  3E7X A;  4JI2 C;  1MDB A;  4AQY C;  3AF5 A;  1HNW C;  1MXB A;  3CJE A;  4ODJ A;  4IZ6 A;  2ASB A;  4GKJ C;  3RV2 A;  1PA4 A;  3VNQ A;  2UUB C;  2HHH C;  4BSZ A;  2CY1 A;  2EGT A;  4LF7 C;  4ZJZ A;  5BST A;  1YJ7 A;  4RVO A;  4I9G A;  3ETO A;  2PT7 G;  3R9X A;  2QVX X;  5CZV A;  4DV0 C;  4DV7 C;  4YHH C;  5BUQ A;  4B3S C;  5BSM A;  3VNS A;  4BC7 A;  1N36 C;  5ADZ A;  5IFI A;  4GXR A;  1N33 C;  5AE2 A;  1ZB9 A;  2E0G A;  4JM1 A;  3L95 X;  4NXN C;  1I94 C;  1V26 A;  4LF4 C;  4DCU A;  2XR1 A;  3I07 A;  1O93 A;  4RM3 A;  4NXM C;  4RVN A;  1J5E C;  2P2B A;  1FUG A;  1MDF A;  4DG8 A;  1N34 C;  1HNZ C;  4KTT A;  4WV3 A;  4OYC A;  4PHT A;  1XRA A;  3S82 A;  4JV5 C;  4ISB A;  5LMN C;  4B3T C;  3GKU A;  4WS9 A;  2BJO A;  4D57 A;  2P2Q A;  2UUC C;  3NI2 A;  3H2T A;  2PRO A;  3FCC A;  2UXC C;  4R1L A;  4DCV A;  5IWA C;  3CW9 A;  2CXC A;  3LGX A;  1KKG A;  1XRC A;  1LQL A;  1IBK C;  1PG4 A;  1T5D X;  4DV1 C;  1RG9 A;  4RLQ A;  4OX9 C;  4TPS B;  2Y4N A;  4JI1 C;  3A9V A;  1FJG C;  1LCI A;  2UXB C;  4U5Y D;  2E8E A;  4GXQ A;  1WH9 A;  3TDE A;  2P2J A;  4JI3 C;  1V25 A;  2F4V C;  2BH1 X;  1P7L A;  2D28 C;  2OPL A;  4R1M A;  4FUQ A;  5AE1 A;  3SO4 A;  1XMQ C;  4ZLP A;  3IPL A;  5CZX A;  4EAT A;  2ZM6 C;  2Y4O A;  3KXW A;  1XNR C;  5FLX D;  4NOZ A;  4BBY A;  4D4G A;  2VZE A;  2YCB A;  3IEV A;  5A1I A;  2JMP A;  1QWI A;  5H9U A;  3C5E A;  2OBV A;  4KTV A;  3AF6 A;  2P2M A;  2QW0 X;  2D7V A;  4DR5 C;  4D4I A;  4JI5 C;  3J80 D;  2P20 A;  3LUS A;  3VNR A;  4PZP A;  1XNQ C;  2E8F A;  3NYR A;  4JI0 C;  3GR0 A;  2DYJ A;  5BSW A;  3N2Q A;  3B7W A;  5JRH A;  3N54 B;  4DUZ C;  1USP B;  3PBK A;  2UUA C;  4BC9 A;  4IR7 A;  2WD9 A;  2ATW A;  1QM4 A;  3OTO C;  1WF3 A;  2HJG A;  2D1T A;  4L4Q A;  2VSQ A;  2VQE C;  3NPD A;  4GKK C;  4B3R C;  2VQF C;  1XRB A;  4I9F A;  3IEU A;  2E5L C;  5BR8 C;  3T1Y C;  1MD9 A;  4JYA C;  1HH2 P;  3G7S A;  1HNX C;  4L2Z A;  4LFB C;  4HPV A;  1JOS A;  4LE5 A;  4DV4 C;  2UXD C;  1VLA A;  4DV5 C;  1L2F A;  3J81 D;  3GR1 A;  4DV2 C;  4MTN A;  4PRO C;  4DV6 C;  4DR7 C;  2E7G A;  3I08 A;  1ML8 A;  3DLP X;  3GPC A;  3EQ6 A;  1GPM A;  1O92 A;  3PRO C;  3DAY A;  3RG2 A;  2V7B A;  5T8S A;  2UU9 C;  5BSV A;  1MKY A;  4FUT A;  4DG9 A;  4DR1 C;  5BUS A;  5GTD A;  3L8C A;  3CW8 X;  5BSU A;  3EER A;  1UKK A;  3JAM D;  5DV9 A;  1PG3 A;  2YWC A;  4RMN A;  4RLF A;  4BCA A;  5AE3 A;  4B3M C;  3R9W A;  3A9U A;  4L7I A;  1IBM C;  5K85 A;  1ULT A;  1AMU A;  1RY2 A;  4YY3 C;  4LFA C;  2D1S A;  4XX2 A;  3TUF A;  4LF5 C;  1MXA A;  3NYQ A;  4D56 A;  5BSR A;  3PES A;  1MXC A;  2QVY X;  4X62 C;  4JI7 C;  4G36 A;  2KZF A;  4DCT A;  4K0K C;  4G1I A;  5BUR A;  4JI4 C;  2QL8 A;  2OPL B;  5K8F A;  1XMO C;  2AYA A;  1O9T A;  1ZB8 A;  1NYE A;  3UZ0 A;  1HR0 C;  5A2Q D;  5A1G A;  3FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...