5LMNC

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5lmnC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5lmnC02
2E5LC 3AF5A 1XMOC 2OPLB 1FJGC 1WH9A 3EERA 2UUCC 2UXCC 4JI1C 1ML8A 1ZB9A 2UUBC 1N32C 2ATWA 4LF4C 2HJGA 3JAMD 4DCUA 4B3TC 4B3RC 1IBMC 1NYEA 2BJOA 2YCBA 4DCSA 4X65C 1L2FA 1PA4A 2CXCA 1XMQC 1N2FA 2VQFC 3T1HC 2ZM6C 4OX9C 3R9XA 4DV7C 2ASBA 1UKKA 4NXNC 4JI8C 4X66C 3CJEA 4DR2C 4LF8C 3J80D 4DR7C 5LMUC 4DUZC 1N33C 4B3SC 4XX2A 4JYAC 2QL8A 4LFBC 5FLXD 4GKJC 4JI6C 4DR5C 4MH4A 3T1YC 4DCTA 1J5EC 2E8CA 4DV3C 2E7GA 3OTOC 2PN2A 2UXDC 1HR0C 1EGAA 4JI2C 2PT7G 4NOZA 3IEUA 1I94C 1HH2P 5IT9D 2E8FA 1HNWC 3J7AD 4LF7C 4LF6C 4YHHC 3GKUA 2DYJA 4DV4C 1IBKC 3IEVA 1MKYA 4DR1C 3J81D 4DR6C 2ONFA 4DV1C 1XNRC 4K0KC 4DR4C 1VLAA 4KHPC 2VQEC 1WF3A 1LQLA 4LF5C 4GKKC 2JMPA 1HNXC 2HHHC 2UU9C 2OPLA 1ZB8A 2CY1A 4YY3C 4X64C 4BSZA 4AQYC 4JI3C 4DV6C 5LMNC 5IWAC 4JI4C 5BR8C 2XR1A 4DUYC 4LFAC 2E8EA 4DV0C 1N36C 1JOSA 4DR3C 4DCVA 4DV2C 4LF9C 4JV5C 4NXMC 1USPB 4X62C 1XNQC 2F4VC 2UXBC 2KZFA 1N34C 4LFCC 4JI0C 4JI5C 3AF6A 1K0RA 3I07A 1USPA 1HNZC 4B3MC 4JI7C 4DV5C 4MTNA 1IBLC 3R9WA 1KKGA 2D7VA 2UUAC 1QWIA 3LUSA 5A2QD 2EGTA
chains in the Genus database with same CATH superfamily
2E5LC 1M6XC 3A26A 1GPMA 1FJGC 4FUTA 3K6RA 4FUQA 2ATWA 3E7WA 3TQIA 3JAMD 4DCUA 3KXWA 1P7LA 3IMLA 4DG8A 1V26A 2YCBA 4DCSA 2P2MA 4X65C 1L2FA 1RG9A 2YX1A 4G1IA 3S82A 3L8CA 2ZM6C 4OX9C 3R9XA 5LMUC 5BUQA 1XRBA 1NY8A 1MXBA 2KZ0A 4JI6C 4L4QA 2QW0X 4GS5A 5T8TA 3TR3A 4NDNA 4ISBA 2E7GA 1HR0C 2ZZNA 3FM7A 1HH2P 2E8FA 1HNWC 4LF7C 5K85A 3A9VA 4DV4C 1IBKC 4PROC 3VNSA 3J81D 2PROA 3A4IA 3H2TA 5A1GA 4KHPC 2MCQA 5AE1A 5A1IA 5A19A 1ZB8A 4GXQA 4OXIA 5BUSA 2PG1E 4DV6C 5LMNC 4DUYC 2E8EA 1IB8A 4DR3C 2Y4OA 5DV9A 1RY2A 4X62C 2F4VC 4RLFA 4JI0C 3NPDA 3GPCA 3I07A 1HNZC 2MMAB 4JI7C 5K8FA 2WD9A 1KKGA 2D7VA 3FCCA 4PUIA 4RM2A 5BSRA 4HPVA 2UXCC 3I08A 3DLPX 2VSQA 4KTVA 4LF4C 3AY0A 5BSMA 4GXRA 1IBMC 2BJOA 4LE5A 4R1LA 1PA4A 2CU6A 2CXCA 1XRAA 1XMQC 3NI2A 3LAXA 1XDXA 1LCIA 4JI8C 3J80D 4DR7C 1N33C 1AMUA 4RLQA 2QVYX 4LFBC 4GKJC 4BCAA 3N54B 2E0GA 4MH4A 1J5EC 1PG4A 3SO4A 3OTOC 2AYAA 2NCLA 3CQ3A 4JI2C 4WV3A 4I9FA 4KTTA 3GKUA 3IEVA 3TDEA 1MKYA 4DR1C 1O90A 4R1MA 4ODJA 1XNRC 2VZEA 3UX3A 1T5HX 5GTDA 4DR4C 4ZJZA 1LQLA 1VEHA 4GKKC 4K0BA 5BSVA 2MM9A 1YGTA 4YY3C 4X64C 3L95X 3PESA 4G37A 2ZZMA 2D1RA 4JI3C 1XHJA 4L7IA 4JI4C 5BR8C 2P2FA 4BC7A 4RVOA 4DV0C 4IR7A 5CZXA 2D27A 1PG3A 3LGXA 2UXBC 1N34C 4LFCC 3IPLA 5ADZA 4JI5C 3AF6A 2YWCA 4B3MC 4MTNA 2YWBA 5BSTA 2UUAC 1QWIA 3LUSA 3ETOA 1FLOA 3DHVA 5KYTA 3CW9A 1XMOC 2OPLB 1WH9A 3EERA 2UUCC 1ML8A 3C5EA 2UUBC 4D4GA 4D57A 2OBVA 1T5DX 5AE3A 4RM3A 3CQ2A 4B3TC 1NYEA 5IFIA 2P02A 3NYQA 1WCJA 2KDNA 3T1HC 4DV7C 1QM4A 4X66C 3CJEA 4DR2C 3PBKA 4LF8C 4BBYA 4XX2A 4JYAC 2QL8A 2QVXX 4JM1A 1PU1A 4DR5C 3T1YC 1MXCA 4DCTA 5E7QA 1P4EC 2E8CA 2PN2A 3ETCA 2M5HA 2UXDC 1EGAA 5KEIA 2PT7G 4NOZA 3A25A 2Y4NA 4PZPA 1I94C 5IT9D 3FCEA 3J7AD 4YHHC 2DYJA 1V60A 2OO4A 1MDBA 5CZVA 2ONFA 3NYRA 3TUFA 2P2QA 4K0KC 1VLAA 4BC9A 2VQEC 3CQ1A 4LF5C 2JMPA 1HNXC 2HHHC 2UU9C 2OPLA 4R0MA 4PUGA 2JNVA 4BSZA 4AQYC 4DG9A 5IWAC 3DAYA 2Y27A 1V25A 1TH5A 3LNVA 1N36C 4DCVA 3EQ6A 1USPB 1XNQC 3B7WA 3R44A 5BURA 2D1SA 1MD9A 2EGTA 1ULTA 3AF5A 4ZLPA 4EATA 1P4EA 3CW8X 4JI1C 4PHTA 1MXAA 1ZB9A 1N32C 3UEBA 4IZ6A 2HJGA 1BA3A 3N2QA 4B3RC 3LNOA 4FTFA 2Z51A 5JRHA 3RV2A 1N2FA 2VQFC 4L2ZA 4WS9A 5KYVA 1MDFA 2V7BA 2QVZX 2ASBA 1UKKA 4NXNC 2D1TA 4D4IA 5LCIA 4DUZC 4B3SC 5T8SA 3O2EA 5FLXD 4I9GA 2P20A 1M6XA 4TPSB 2BH1X 1UWDA 2D1QA 4DV3C 1O92A 1O9TA 2DHMA 4RVNA 2DPLA 1FUGA 3IEUA 3GR0A 4LF6C 1YJ7A 3UZ0A 3UX2A 3A9UA 3GR1A 4RMNA 5BSUA 4DR6C 2ZTBA 4DV1C 2P2BA 3VNRA 1XS3A 5BSWA 4OYCA 4PUHA 3UOWA 1WF3A 4U5YD 2P2JA 2D28C 2CY1A 3PROC 3E7XA 3RG2A 2XR1A 4LFAC 1JOSA 4G36A 4DV2C 4D56A 4LF9C 4JV5C 2WP0C 4NXMC 2M5OA 2KZFA 5AE2A 1K0RA 1USPA 4DV5C 5H9UA 1IBLC 3VNQA 3R9WA 1XRCA 3G7SA 5A2QD 1O93A
chains in the Genus database with same CATH topology
2E5LC 1GPMA 1FJGC 4FUTA 4FUQA 2ATWA 3E7WA 3TQIA 3JAMD 4DCUA 3KXWA 1P7LA 3IMLA 4DG8A 1V26A 2YCBA 4DCSA 2P2MA 4X65C 1L2FA 1RG9A 4G1IA 3S82A 3L8CA 2ZM6C 4OX9C 3R9XA 5LMUC 5BUQA 1XRBA 1MXBA 4JI6C 4L4QA 2QW0X 4GS5A 5T8TA 4NDNA 4ISBA 2E7GA 1HR0C 1HH2P 2E8FA 1HNWC 4LF7C 5K85A 3A9VA 4DV4C 1IBKC 4PROC 3VNSA 3J81D 2PROA 3A4IA 3H2TA 5A1GA 4KHPC 5AE1A 5A1IA 5A19A 1ZB8A 4GXQA 4OXIA 5BUSA 4DV6C 5LMNC 4DUYC 2E8EA 4DR3C 2Y4OA 5DV9A 1RY2A 4X62C 2F4VC 4RLFA 4JI0C 3NPDA 3GPCA 3I07A 1HNZC 4JI7C 5K8FA 2WD9A 1KKGA 2D7VA 3FCCA 4RM2A 5BSRA 4HPVA 2UXCC 3I08A 3DLPX 2VSQA 4KTVA 4LF4C 5BSMA 4GXRA 1IBMC 2BJOA 4LE5A 4R1LA 1PA4A 2CXCA 1XRAA 1XMQC 3NI2A 3LAXA 1LCIA 4JI8C 3J80D 4DR7C 1N33C 1AMUA 4RLQA 2QVYX 4LFBC 4GKJC 4BCAA 3N54B 2E0GA 4MH4A 1J5EC 1PG4A 3SO4A 3OTOC 2AYAA 4JI2C 4WV3A 4I9FA 4KTTA 3GKUA 3IEVA 3TDEA 1MKYA 4DR1C 1O90A 4R1MA 4ODJA 1XNRC 2VZEA 1T5HX 5GTDA 4DR4C 4ZJZA 1LQLA 4GKKC 4K0BA 5BSVA 4YY3C 4X64C 3L95X 3PESA 4G37A 2D1RA 4JI3C 4L7IA 4JI4C 5BR8C 2P2FA 4BC7A 4RVOA 4DV0C 4IR7A 5CZXA 2D27A 1PG3A 3LGXA 2UXBC 1N34C 4LFCC 3IPLA 5ADZA 4JI5C 3AF6A 2YWCA 4B3MC 4MTNA 2YWBA 5BSTA 2UUAC 1QWIA 3LUSA 3ETOA 3DHVA 5KYTA 3CW9A 1XMOC 2OPLB 1WH9A 3EERA 2UUCC 1ML8A 3C5EA 2UUBC 4D4GA 4D57A 2OBVA 1T5DX 5AE3A 4RM3A 4B3TC 1NYEA 5IFIA 2P02A 3NYQA 3T1HC 4DV7C 1QM4A 4X66C 3CJEA 4DR2C 3PBKA 4LF8C 4BBYA 4XX2A 4JYAC 2QL8A 2QVXX 4JM1A 4DR5C 3T1YC 1MXCA 4DCTA 5E7QA 2E8CA 2PN2A 3ETCA 2UXDC 1EGAA 5KEIA 2PT7G 4NOZA 2Y4NA 4PZPA 1I94C 5IT9D 3FCEA 3J7AD 4YHHC 2DYJA 2OO4A 5CZVA 1MDBA 2ONFA 3NYRA 3TUFA 2P2QA 4K0KC 1VLAA 4BC9A 2VQEC 4LF5C 2JMPA 1HNXC 2HHHC 2UU9C 2OPLA 4R0MA 4BSZA 4AQYC 4DG9A 5IWAC 3DAYA 2Y27A 1V25A 3LNVA 1N36C 4DCVA 3EQ6A 1USPB 1XNQC 3B7WA 3R44A 5BURA 2D1SA 1MD9A 2EGTA 1ULTA 3AF5A 4ZLPA 4EATA 3CW8X 4JI1C 4PHTA 1MXAA 1ZB9A 1N32C 4IZ6A 2HJGA 1BA3A 3N2QA 4B3RC 4FTFA 5JRHA 3RV2A 1N2FA 2VQFC 4L2ZA 4WS9A 5KYVA 1MDFA 2V7BA 2QVZX 2ASBA 1UKKA 4NXNC 2D1TA 4D4IA 4DUZC 4B3SC 5T8SA 5FLXD 4I9GA 2P20A 4TPSB 2BH1X 2D1QA 4DV3C 1O92A 1O9TA 4RVNA 2DPLA 1FUGA 3IEUA 3GR0A 4LF6C 1YJ7A 3UZ0A 3A9UA 3GR1A 4RMNA 5BSUA 4DR6C 4DV1C 2P2BA 3VNRA 5BSWA 4OYCA 3UOWA 1WF3A 4U5YD 2P2JA 2D28C 2CY1A 3PROC 3E7XA 3RG2A 2XR1A 4LFAC 1JOSA 4G36A 4DV2C 4D56A 4LF9C 4JV5C 2WP0C 4NXMC 2KZFA 5AE2A 1K0RA 1USPA 4DV5C 5H9UA 1IBLC 3VNQA 3R9WA 1XRCA 3G7SA 5A2QD 1O93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L C;  3AF5 A;  1XMO C;  2OPL B;  1FJG C;  1WH9 A;  3EER A;  2UUC C;  2UXC C;  4JI1 C;  1ML8 A;  1ZB9 A;  2UUB C;  1N32 C;  2ATW A;  4LF4 C;  2HJG A;  3JAM D;  4DCU A;  4B3T C;  4B3R C;  1IBM C;  1NYE A;  2BJO A;  2YCB A;  4DCS A;  4X65 C;  1L2F A;  1PA4 A;  2CXC A;  1XMQ C;  1N2F A;  2VQF C;  3T1H C;  2ZM6 C;  4OX9 C;  3R9X A;  4DV7 C;  2ASB A;  1UKK A;  4NXN C;  4JI8 C;  4X66 C;  3CJE A;  4DR2 C;  4LF8 C;  3J80 D;  4DR7 C;  5LMU C;  4DUZ C;  1N33 C;  4B3S C;  4XX2 A;  4JYA C;  2QL8 A;  4LFB C;  5FLX D;  4GKJ C;  4JI6 C;  4DR5 C;  4MH4 A;  3T1Y C;  4DCT A;  1J5E C;  2E8C A;  4DV3 C;  2E7G A;  3OTO C;  2PN2 A;  2UXD C;  1HR0 C;  1EGA A;  4JI2 C;  2PT7 G;  4NOZ A;  3IEU A;  1I94 C;  1HH2 P;  5IT9 D;  2E8F A;  1HNW C;  3J7A D;  4LF7 C;  4LF6 C;  4YHH C;  3GKU A;  2DYJ A;  4DV4 C;  1IBK C;  3IEV A;  1MKY A;  4DR1 C;  3J81 D;  4DR6 C;  2ONF A;  4DV1 C;  1XNR C;  4K0K C;  4DR4 C;  1VLA A;  4KHP C;  2VQE C;  1WF3 A;  1LQL A;  4LF5 C;  4GKK C;  2JMP A;  1HNX C;  2HHH C;  2UU9 C;  2OPL A;  1ZB8 A;  2CY1 A;  4YY3 C;  4X64 C;  4BSZ A;  4AQY C;  4JI3 C;  4DV6 C;  5LMN C;  5IWA C;  4JI4 C;  5BR8 C;  2XR1 A;  4DUY C;  4LFA C;  2E8E A;  4DV0 C;  1N36 C;  1JOS A;  4DR3 C;  4DCV A;  4DV2 C;  4LF9 C;  4JV5 C;  4NXM C;  1USP B;  4X62 C;  1XNQ C;  2F4V C;  2UXB C;  2KZF A;  1N34 C;  4LFC C;  4JI0 C;  4JI5 C;  3AF6 A;  1K0R A;  3I07 A;  1USP A;  1HNZ C;  4B3M C;  4JI7 C;  4DV5 C;  4MTN A;  1IBL C;  3R9W A;  1KKG A;  2D7V A;  2UUA C;  1QWI A;  3LUS A;  5A2Q D;  2EGT A; 
#chains in the Genus database with same CATH topology
 2E5L C;  1M6X C;  3A26 A;  1GPM A;  1FJG C;  4FUT A;  3K6R A;  4FUQ A;  2ATW A;  3E7W A;  3TQI A;  3JAM D;  4DCU A;  3KXW A;  1P7L A;  3IML A;  4DG8 A;  1V26 A;  2YCB A;  4DCS A;  2P2M A;  4X65 C;  1L2F A;  1RG9 A;  2YX1 A;  4G1I A;  3S82 A;  3L8C A;  2ZM6 C;  4OX9 C;  3R9X A;  5LMU C;  5BUQ A;  1XRB A;  1NY8 A;  1MXB A;  2KZ0 A;  4JI6 C;  4L4Q A;  2QW0 X;  4GS5 A;  5T8T A;  3TR3 A;  4NDN A;  4ISB A;  2E7G A;  1HR0 C;  2ZZN A;  3FM7 A;  1HH2 P;  2E8F A;  1HNW C;  4LF7 C;  5K85 A;  3A9V A;  4DV4 C;  1IBK C;  4PRO C;  3VNS A;  3J81 D;  2PRO A;  3A4I A;  3H2T A;  5A1G A;  4KHP C;  2MCQ A;  5AE1 A;  5A1I A;  5A19 A;  1ZB8 A;  4GXQ A;  4OXI A;  5BUS A;  2PG1 E;  4DV6 C;  5LMN C;  4DUY C;  2E8E A;  1IB8 A;  4DR3 C;  2Y4O A;  5DV9 A;  1RY2 A;  4X62 C;  2F4V C;  4RLF A;  4JI0 C;  3NPD A;  3GPC A;  3I07 A;  1HNZ C;  2MMA B;  4JI7 C;  5K8F A;  2WD9 A;  1KKG A;  2D7V A;  3FCC A;  4PUI A;  4RM2 A;  5BSR A;  4HPV A;  2UXC C;  3I08 A;  3DLP X;  2VSQ A;  4KTV A;  4LF4 C;  3AY0 A;  5BSM A;  4GXR A;  1IBM C;  2BJO A;  4LE5 A;  4R1L A;  1PA4 A;  2CU6 A;  2CXC A;  1XRA A;  1XMQ C;  3NI2 A;  3LAX A;  1XDX A;  1LCI A;  4JI8 C;  3J80 D;  4DR7 C;  1N33 C;  1AMU A;  4RLQ A;  2QVY X;  4LFB C;  4GKJ C;  4BCA A;  3N54 B;  2E0G A;  4MH4 A;  1J5E C;  1PG4 A;  3SO4 A;  3OTO C;  2AYA A;  2NCL A;  3CQ3 A;  4JI2 C;  4WV3 A;  4I9F A;  4KTT A;  3GKU A;  3IEV A;  3TDE A;  1MKY A;  4DR1 C;  1O90 A;  4R1M A;  4ODJ A;  1XNR C;  2VZE A;  3UX3 A;  1T5H X;  5GTD A;  4DR4 C;  4ZJZ A;  1LQL A;  1VEH A;  4GKK C;  4K0B A;  5BSV A;  2MM9 A;  1YGT A;  4YY3 C;  4X64 C;  3L95 X;  3PES A;  4G37 A;  2ZZM A;  2D1R A;  4JI3 C;  1XHJ A;  4L7I A;  4JI4 C;  5BR8 C;  2P2F A;  4BC7 A;  4RVO A;  4DV0 C;  4IR7 A;  5CZX A;  2D27 A;  1PG3 A;  3LGX A;  2UXB C;  1N34 C;  4LFC C;  3IPL A;  5ADZ A;  4JI5 C;  3AF6 A;  2YWC A;  4B3M C;  4MTN A;  2YWB A;  5BST A;  2UUA C;  1QWI A;  3LUS A;  3ETO A;  1FLO A;  3DHV A;  5KYT A;  3CW9 A;  1XMO C;  2OPL B;  1WH9 A;  3EER A;  2UUC C;  1ML8 A;  3C5E A;  2UUB C;  4D4G A;  4D57 A;  2OBV A;  1T5D X;  5AE3 A;  4RM3 A;  3CQ2 A;  4B3T C;  1NYE A;  5IFI A;  2P02 A;  3NYQ A;  1WCJ A;  2KDN A;  3T1H C;  4DV7 C;  1QM4 A;  4X66 C;  3CJE A;  4DR2 C;  3PBK A;  4LF8 C;  4BBY A;  4XX2 A;  4JYA C;  2QL8 A;  2QVX X;  4JM1 A;  1PU1 A;  4DR5 C;  3T1Y C;  1MXC A;  4DCT A;  5E7Q A;  1P4E C;  2E8C A;  2PN2 A;  3ETC A;  2M5H A;  2UXD C;  1EGA A;  5KEI A;  2PT7 G;  4NOZ A;  3A25 A;  2Y4N A;  4PZP A;  1I94 C;  5IT9 D;  3FCE A;  3J7A D;  4YHH C;  2DYJ A;  1V60 A;  2OO4 A;  1MDB A;  5CZV A;  2ONF A;  3NYR A;  3TUF A;  2P2Q A;  4K0K C;  1VLA A;  4BC9 A;  2VQE C;  3CQ1 A;  4LF5 C;  2JMP A;  1HNX C;  2HHH C;  2UU9 C;  2OPL A;  4R0M A;  4PUG A;  2JNV A;  4BSZ A;  4AQY C;  4DG9 A;  5IWA C;  3DAY A;  2Y27 A;  1V25 A;  1TH5 A;  3LNV A;  1N36 C;  4DCV A;  3EQ6 A;  1USP B;  1XNQ C;  3B7W A;  3R44 A;  5BUR A;  2D1S A;  1MD9 A;  2EGT A;  1ULT A;  3AF5 A;  4ZLP A;  4EAT A;  1P4E A;  3CW8 X;  4JI1 C;  4PHT A;  1MXA A;  1ZB9 A;  1N32 C;  3UEB A;  4IZ6 A;  2HJG A;  1BA3 A;  3N2Q A;  4B3R C;  3LNO A;  4FTF A;  2Z51 A;  5JRH A;  3RV2 A;  1N2F A;  2VQF C;  4L2Z A;  4WS9 A;  5KYV A;  1MDF A;  2V7B A;  2QVZ X;  2ASB A;  1UKK A;  4NXN C;  2D1T A;  4D4I A;  5LCI A;  4DUZ C;  4B3S C;  5T8S A;  3O2E A;  5FLX D;  4I9G A;  2P20 A;  1M6X A;  4TPS B;  2BH1 X;  1UWD A;  2D1Q A;  4DV3 C;  1O92 A;  1O9T A;  2DHM A;  4RVN A;  2DPL A;  1FUG A;  3IEU A;  3GR0 A;  4LF6 C;  1YJ7 A;  3UZ0 A;  3UX2 A;  3A9U A;  3GR1 A;  4RMN A;  5BSU A;  4DR6 C;  2ZTB A;  4DV1 C;  2P2B A;  3VNR A;  1XS3 A;  5BSW A;  4OYC A;  4PUH A;  3UOW A;  1WF3 A;  4U5Y D;  2P2J A;  2D28 C;  2CY1 A;  3PRO C;  3E7X A;  3RG2 A;  2XR1 A;  4LFA C;  1JOS A;  4G36 A;  4DV2 C;  4D56 A;  4LF9 C;  4JV5 C;  2WP0 C;  4NXM C;  2M5O A;  2KZF A;  5AE2 A;  1K0R A;  1USP A;  4DV5 C;  5H9U A;  1IBL C;  3VNQ A;  3R9W A;  1XRC A;  3G7S A;  5A2Q D;  1O93 A; 
#chains in the Genus database with same CATH homology
 2E5L C;  1GPM A;  1FJG C;  4FUT A;  4FUQ A;  2ATW A;  3E7W A;  3TQI A;  3JAM D;  4DCU A;  3KXW A;  1P7L A;  3IML A;  4DG8 A;  1V26 A;  2YCB A;  4DCS A;  2P2M A;  4X65 C;  1L2F A;  1RG9 A;  4G1I A;  3S82 A;  3L8C A;  2ZM6 C;  4OX9 C;  3R9X A;  5LMU C;  5BUQ A;  1XRB A;  1MXB A;  4JI6 C;  4L4Q A;  2QW0 X;  4GS5 A;  5T8T A;  4NDN A;  4ISB A;  2E7G A;  1HR0 C;  1HH2 P;  2E8F A;  1HNW C;  4LF7 C;  5K85 A;  3A9V A;  4DV4 C;  1IBK C;  4PRO C;  3VNS A;  3J81 D;  2PRO A;  3A4I A;  3H2T A;  5A1G A;  4KHP C;  5AE1 A;  5A1I A;  5A19 A;  1ZB8 A;  4GXQ A;  4OXI A;  5BUS A;  4DV6 C;  5LMN C;  4DUY C;  2E8E A;  4DR3 C;  2Y4O A;  5DV9 A;  1RY2 A;  4X62 C;  2F4V C;  4RLF A;  4JI0 C;  3NPD A;  3GPC A;  3I07 A;  1HNZ C;  4JI7 C;  5K8F A;  2WD9 A;  1KKG A;  2D7V A;  3FCC A;  4RM2 A;  5BSR A;  4HPV A;  2UXC C;  3I08 A;  3DLP X;  2VSQ A;  4KTV A;  4LF4 C;  5BSM A;  4GXR A;  1IBM C;  2BJO A;  4LE5 A;  4R1L A;  1PA4 A;  2CXC A;  1XRA A;  1XMQ C;  3NI2 A;  3LAX A;  1LCI A;  4JI8 C;  3J80 D;  4DR7 C;  1N33 C;  1AMU A;  4RLQ A;  2QVY X;  4LFB C;  4GKJ C;  4BCA A;  3N54 B;  2E0G A;  4MH4 A;  1J5E C;  1PG4 A;  3SO4 A;  3OTO C;  2AYA A;  4JI2 C;  4WV3 A;  4I9F A;  4KTT A;  3GKU A;  3IEV A;  3TDE A;  1MKY A;  4DR1 C;  1O90 A;  4R1M A;  4ODJ A;  1XNR C;  2VZE A;  1T5H X;  5GTD A;  4DR4 C;  4ZJZ A;  1LQL A;  4GKK C;  4K0B A;  5BSV A;  4YY3 C;  4X64 C;  3L95 X;  3PES A;  4G37 A;  2D1R A;  4JI3 C;  4L7I A;  4JI4 C;  5BR8 C;  2P2F A;  4BC7 A;  4RVO A;  4DV0 C;  4IR7 A;  5CZX A;  2D27 A;  1PG3 A;  3LGX A;  2UXB C;  1N34 C;  4LFC C;  3IPL A;  5ADZ A;  4JI5 C;  3AF6 A;  2YWC A;  4B3M C;  4MTN A;  2YWB A;  5BST A;  2UUA C;  1QWI A;  3LUS A;  3ETO A;  3DHV A;  5KYT A;  3CW9 A;  1XMO C;  2OPL B;  1WH9 A;  3EER A;  2UUC C;  1ML8 A;  3C5E A;  2UUB C;  4D4G A;  4D57 A;  2OBV A;  1T5D X;  5AE3 A;  4RM3 A;  4B3T C;  1NYE A;  5IFI A;  2P02 A;  3NYQ A;  3T1H C;  4DV7 C;  1QM4 A;  4X66 C;  3CJE A;  4DR2 C;  3PBK A;  4LF8 C;  4BBY A;  4XX2 A;  4JYA C;  2QL8 A;  2QVX X;  4JM1 A;  4DR5 C;  3T1Y C;  1MXC A;  4DCT A;  5E7Q A;  2E8C A;  2PN2 A;  3ETC A;  2UXD C;  1EGA A;  5KEI A;  2PT7 G;  4NOZ A;  2Y4N A;  4PZP A;  1I94 C;  5IT9 D;  3FCE A;  3J7A D;  4YHH C;  2DYJ A;  2OO4 A;  5CZV A;  1MDB A;  2ONF A;  3NYR A;  3TUF A;  2P2Q A;  4K0K C;  1VLA A;  4BC9 A;  2VQE C;  4LF5 C;  2JMP A;  1HNX C;  2HHH C;  2UU9 C;  2OPL A;  4R0M A;  4BSZ A;  4AQY C;  4DG9 A;  5IWA C;  3DAY A;  2Y27 A;  1V25 A;  3LNV A;  1N36 C;  4DCV A;  3EQ6 A;  1USP B;  1XNQ C;  3B7W A;  3R44 A;  5BUR A;  2D1S A;  1MD9 A;  2EGT A;  1ULT A;  3AF5 A;  4ZLP A;  4EAT A;  3CW8 X;  4JI1 C;  4PHT A;  1MXA A;  1ZB9 A;  1N32 C;  4IZ6 A;  2HJG A;  1BA3 A;  3N2Q A;  4B3R C;  4FTF A;  5JRH A;  3RV2 A;  1N2F A;  2VQF C;  4L2Z A;  4WS9 A;  5KYV A;  1MDF A;  2V7B A;  2QVZ X;  2ASB A;  1UKK A;  4NXN C;  2D1T A;  4D4I A;  4DUZ C;  4B3S C;  5T8S A;  5FLX D;  4I9G A;  2P20 A;  4TPS B;  2BH1 X;  2D1Q A;  4DV3 C;  1O92 A;  1O9T A;  4RVN A;  2DPL A;  1FUG A;  3IEU A;  3GR0 A;  4LF6 C;  1YJ7 A;  3UZ0 A;  3A9U A;  3GR1 A;  4RMN A;  5BSU A;  4DR6 C;  4DV1 C;  2P2B A;  3VNR A;  5BSW A;  4OYC A;  3UOW A;  1WF3 A;  4U5Y D;  2P2J A;  2D28 C;  2CY1 A;  3PRO C;  3E7X A;  3RG2 A;  2XR1 A;  4LFA C;  1JOS A;  4G36 A;  4DV2 C;  4D56 A;  4LF9 C;  4JV5 C;  2WP0 C;  4NXM C;  2KZF A;  5AE2 A;  1K0R A;  1USP A;  4DV5 C;  5H9U A;  1IBL C;  3VNQ A;  3R9W A;  1XRC A;  3G7S A;  5A2Q D;  1O93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...