The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
103
|
structure length |
103
|
Chain Sequence |
QFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Multivalency in the assembly of intrinsically disordered Dynein intermediate chain.
pubmed doi rcsb |
| molecule tags |
Contractile protein
|
| source organism |
Drosophila melanogaster
|
| molecule keywords |
Dynein light chain Tctex-type
|
| total genus |
19
|
| structure length |
103
|
| sequence length |
103
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2008-12-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03645 | Tctex-1 | Tctex-1 family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Ribosomal protein S3 C-terminal domain | Ribosomal protein S3 C-terminal domain |
#chains in the Genus database with same CATH superfamily 1YGT A; 1XDX A; 2PG1 E; 3FM7 A; #chains in the Genus database with same CATH topology 4B3T C; 2UUA C; 1N33 C; 4NXM C; 4DR3 C; 4AQY C; 2ZTB A; 3T1Y C; 1XDX A; 4LF5 C; 5LMU C; 1HNZ C; 4DR7 C; 4DV3 C; 4LF7 C; 1J5E C; 3OTO C; 1IBK C; 4X66 C; 4B3R C; 2VQE C; 4LFC C; 5A2Q D; 5LMN C; 4B3S C; 2UXD C; 1HNX C; 4DV2 C; 2PG1 E; 3J81 D; 2F4V C; 2VQF C; 4JI7 C; 1N36 C; 4NXN C; 3J80 D; 1XMO C; 4DV7 C; 3JAM D; 1XMQ C; 1HR0 C; 4JI8 C; 1IBM C; 4B3M C; 4YY3 C; 2UU9 C; 4LFB C; 3T1H C; 4JV5 C; 4JI6 C; 1FJG C; 4KHP C; 4LF8 C; 4JI1 C; 4LF9 C; 2E5L C; 4LF6 C; 1HNW C; 2HHH C; 3J7A D; 4DR4 C; 4JI5 C; 4DR6 C; 4K0K C; 1XNQ C; 4X65 C; 4DR5 C; 5IT9 D; 1I94 C; 4LFA C; 4JI3 C; 2UXB C; 4DR2 C; 4OX9 C; 1N34 C; 4BSZ A; 2UUB C; 2UUC C; 1IBL C; 2ZM6 C; 4DV4 C; 2UXC C; 4DV6 C; 1YGT A; 4JI4 C; 3FM7 A; 4JYA C; 5FLX D; 1N32 C; 4DR1 C; 4DUZ C; 4JI0 C; 4DV5 C; 4LF4 C; 4GKK C; 4DUY C; 5BR8 C; 4X62 C; 4DV0 C; 4JI2 C; 4GKJ C; 4DV1 C; 4X64 C; 5IWA C; 1XNR C; 4YHH C; #chains in the Genus database with same CATH homology 1XDX A; 1YGT A; 2PG1 E; 2ZTB A; 3FM7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
