1N3JA

Structure and substrate of a histone h3 lysine methyltransferase from paramecium bursaria chlorella virus 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3 Lysine Methyltransferase
publication title A dimeric viral SET domain methyltransferase specific to Lys27 of histone H3.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 8
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1n3jA00
1MT6A 3FPDA 4NJ5A 4I51A 5LSXA 4FMUA 3TG4A 3M54A 4BUPA 3F9WA 5T5GA 3S7FA 4YNPA 3CBOA 3M56A 3S7DA 3S7JA 5KJKA 3BO5A 5EG2A 3F9XA 5JJ0A 3EP0A 2BQZA 4YNDA 1PEGA 4QENA 3CBPA 4O6FA 2W5ZA 4JLGA 4H12A 4RZ0A 2RFIA 3OOIA 4J7FA 3SW9A 5ARFA 3OPEA 3VUZA 5T0KA 5KJMA 4E47A 1MVXA 3M59A 2JV0A 5KJNA 5JINA 5KJLA 4AU7A 3S8PA 5EX0A 1N6CA 5CCLA 3DB5A 2W5YA 5F5EA 4O30A 5TTFA 3RU0A 4J7IA 5HI7A 3TG5A 4QEPA 5HQ8A 3M58A 1N6AA 3HNAA 3K5KA 5F59A 2G46A 3KMAA 3RIBA 3M57A 4MI0A 5F6KC 2R3AA 3QWPA 3PDNA 4LDGA 1O9SA 3QWWA 4MI5A 5TEGA 2QPWA 4YPUA 3MEKA 3F9ZA 3N71A 3S7BA 2IGQA 3IHXA 3VV0A 3SWCA 1ML9A 3M53A 1N3JA 4IJDA 3M5AA 2F69A 3RJWA 4J8OA 5T0MA 3DALA 4YPEA 3M55A 4C1QA 3KMJA 4YNMA 1ZKKA 2O8JA 3QWVA 3OS5A 3RQ4A 3KMTA 4Z4PA 1MVHA 3MO2A 3RAYA 3OXLA 4YPAA 4QEOA 5JHNA 3F9YA 5EX3A 5CCMA 4IJ8A 3OXGA 5LSZA 4JDSA 3MO5A 3CBMA 1MUFA 5TH7A 3MO0A 4WUYA 5CPRB 5ARGA 4NVQA 5F6LA 1H3IA 5AYFA 3OXFA 5JIYA 1XQHA 4J83A
chains in the Genus database with same CATH superfamily
1MT6A 3FPDA 4NJ5A 4I51A 5LSXA 4FMUA 3TG4A 3M54A 4BUPA 3F9WA 5T5GA 3S7FA 4YNPA 3CBOA 3M56A 3S7DA 3S7JA 5KJKA 3BO5A 5EG2A 3F9XA 5JJ0A 3EP0A 2BQZA 4YNDA 1PEGA 4QENA 3CBPA 4O6FA 2W5ZA 4JLGA 4H12A 4RZ0A 2RFIA 3OOIA 4J7FA 3SW9A 5ARFA 3OPEA 3VUZA 5T0KA 5KJMA 4E47A 1MVXA 3M59A 2JV0A 5KJNA 5JINA 5KJLA 4AU7A 3S8PA 5EX0A 1N6CA 5CCLA 3DB5A 2W5YA 5F5EA 4O30A 5TTFA 3RU0A 4J7IA 5HI7A 3TG5A 4QEPA 5HQ8A 3M58A 1N6AA 3HNAA 3K5KA 5F59A 2G46A 3KMAA 3RIBA 3M57A 4MI0A 5F6KC 2R3AA 3QWPA 3PDNA 4LDGA 1O9SA 3QWWA 4MI5A 5TEGA 2QPWA 4YPUA 3MEKA 3F9ZA 3N71A 3S7BA 2IGQA 3IHXA 3VV0A 3SWCA 1ML9A 3M53A 1N3JA 4IJDA 3M5AA 2F69A 3RJWA 4J8OA 5T0MA 3DALA 4YPEA 3M55A 4C1QA 3KMJA 4YNMA 1ZKKA 2O8JA 3QWVA 3OS5A 3RQ4A 3KMTA 4Z4PA 1MVHA 3MO2A 3RAYA 3OXLA 4YPAA 4QEOA 5JHNA 3F9YA 5EX3A 5CCMA 4IJ8A 3OXGA 5LSZA 4JDSA 3MO5A 3CBMA 1MUFA 5TH7A 3MO0A 4WUYA 5CPRB 5ARGA 4NVQA 5F6LA 1H3IA 5AYFA 3OXFA 5JIYA 1XQHA 4J83A
chains in the Genus database with same CATH topology
1MT6A 3FPDA 4NJ5A 4I51A 5LSXA 4FMUA 3TG4A 3M54A 4BUPA 3F9WA 5T5GA 3S7FA 4YNPA 3CBOA 3M56A 3S7DA 3S7JA 5KJKA 3BO5A 5EG2A 3F9XA 5JJ0A 3EP0A 2BQZA 4YNDA 1PEGA 4QENA 3CBPA 4O6FA 2W5ZA 4JLGA 4H12A 4RZ0A 2RFIA 3OOIA 4J7FA 3SW9A 5ARFA 3OPEA 3VUZA 5T0KA 5KJMA 4E47A 1MVXA 3M59A 2JV0A 5KJNA 5JINA 5KJLA 4AU7A 3S8PA 5EX0A 1N6CA 5CCLA 3DB5A 2W5YA 5F5EA 4O30A 5TTFA 3RU0A 4J7IA 5HI7A 3TG5A 4QEPA 5HQ8A 3M58A 1N6AA 3HNAA 3K5KA 5F59A 2G46A 3KMAA 3RIBA 3M57A 4MI0A 5F6KC 2R3AA 3QWPA 3PDNA 4LDGA 1O9SA 3QWWA 4MI5A 5TEGA 2QPWA 4YPUA 3MEKA 3F9ZA 3N71A 3S7BA 2IGQA 3IHXA 3VV0A 3SWCA 1ML9A 3M53A 1N3JA 4IJDA 3M5AA 2F69A 3RJWA 4J8OA 5T0MA 3DALA 4YPEA 3M55A 4C1QA 3KMJA 4YNMA 1ZKKA 2O8JA 3QWVA 3OS5A 3RQ4A 3KMTA 4Z4PA 1MVHA 3MO2A 3RAYA 3OXLA 4YPAA 4QEOA 5JHNA 3F9YA 5EX3A 5CCMA 4IJ8A 3OXGA 5LSZA 4JDSA 3MO5A 3CBMA 1MUFA 5TH7A 3MO0A 4WUYA 5CPRB 5ARGA 4NVQA 5F6LA 1H3IA 5AYFA 3OXFA 5JIYA 1XQHA 4J83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MT6 A;  3FPD A;  4NJ5 A;  4I51 A;  5LSX A;  4FMU A;  3TG4 A;  3M54 A;  4BUP A;  3F9W A;  5T5G A;  3S7F A;  4YNP A;  3CBO A;  3M56 A;  3S7D A;  3S7J A;  5KJK A;  3BO5 A;  5EG2 A;  3F9X A;  5JJ0 A;  3EP0 A;  2BQZ A;  4YND A;  1PEG A;  4QEN A;  3CBP A;  4O6F A;  2W5Z A;  4JLG A;  4H12 A;  4RZ0 A;  2RFI A;  3OOI A;  4J7F A;  3SW9 A;  5ARF A;  3OPE A;  3VUZ A;  5T0K A;  5KJM A;  4E47 A;  1MVX A;  3M59 A;  2JV0 A;  5KJN A;  5JIN A;  5KJL A;  4AU7 A;  3S8P A;  5EX0 A;  1N6C A;  5CCL A;  3DB5 A;  2W5Y A;  5F5E A;  4O30 A;  5TTF A;  3RU0 A;  4J7I A;  5HI7 A;  3TG5 A;  4QEP A;  5HQ8 A;  3M58 A;  1N6A A;  3HNA A;  3K5K A;  5F59 A;  2G46 A;  3KMA A;  3RIB A;  3M57 A;  4MI0 A;  5F6K C;  2R3A A;  3QWP A;  3PDN A;  4LDG A;  1O9S A;  3QWW A;  4MI5 A;  5TEG A;  2QPW A;  4YPU A;  3MEK A;  3F9Z A;  3N71 A;  3S7B A;  2IGQ A;  3IHX A;  3VV0 A;  3SWC A;  1ML9 A;  3M53 A;  1N3J A;  4IJD A;  3M5A A;  2F69 A;  3RJW A;  4J8O A;  5T0M A;  3DAL A;  4YPE A;  3M55 A;  4C1Q A;  3KMJ A;  4YNM A;  1ZKK A;  2O8J A;  3QWV A;  3OS5 A;  3RQ4 A;  3KMT A;  4Z4P A;  1MVH A;  3MO2 A;  3RAY A;  3OXL A;  4YPA A;  4QEO A;  5JHN A;  3F9Y A;  5EX3 A;  5CCM A;  4IJ8 A;  3OXG A;  5LSZ A;  4JDS A;  3MO5 A;  3CBM A;  1MUF A;  5TH7 A;  3MO0 A;  4WUY A;  5CPR B;  5ARG A;  4NVQ A;  5F6L A;  1H3I A;  5AYF A;  3OXF A;  5JIY A;  1XQH A;  4J83 A; 
#chains in the Genus database with same CATH topology
 1MT6 A;  3FPD A;  4NJ5 A;  4I51 A;  5LSX A;  4FMU A;  3TG4 A;  3M54 A;  4BUP A;  3F9W A;  5T5G A;  3S7F A;  4YNP A;  3CBO A;  3M56 A;  3S7D A;  3S7J A;  5KJK A;  3BO5 A;  5EG2 A;  3F9X A;  5JJ0 A;  3EP0 A;  2BQZ A;  4YND A;  1PEG A;  4QEN A;  3CBP A;  4O6F A;  2W5Z A;  4JLG A;  4H12 A;  4RZ0 A;  2RFI A;  3OOI A;  4J7F A;  3SW9 A;  5ARF A;  3OPE A;  3VUZ A;  5T0K A;  5KJM A;  4E47 A;  1MVX A;  3M59 A;  2JV0 A;  5KJN A;  5JIN A;  5KJL A;  4AU7 A;  3S8P A;  5EX0 A;  1N6C A;  5CCL A;  3DB5 A;  2W5Y A;  5F5E A;  4O30 A;  5TTF A;  3RU0 A;  4J7I A;  5HI7 A;  3TG5 A;  4QEP A;  5HQ8 A;  3M58 A;  1N6A A;  3HNA A;  3K5K A;  5F59 A;  2G46 A;  3KMA A;  3RIB A;  3M57 A;  4MI0 A;  5F6K C;  2R3A A;  3QWP A;  3PDN A;  4LDG A;  1O9S A;  3QWW A;  4MI5 A;  5TEG A;  2QPW A;  4YPU A;  3MEK A;  3F9Z A;  3N71 A;  3S7B A;  2IGQ A;  3IHX A;  3VV0 A;  3SWC A;  1ML9 A;  3M53 A;  1N3J A;  4IJD A;  3M5A A;  2F69 A;  3RJW A;  4J8O A;  5T0M A;  3DAL A;  4YPE A;  3M55 A;  4C1Q A;  3KMJ A;  4YNM A;  1ZKK A;  2O8J A;  3QWV A;  3OS5 A;  3RQ4 A;  3KMT A;  4Z4P A;  1MVH A;  3MO2 A;  3RAY A;  3OXL A;  4YPA A;  4QEO A;  5JHN A;  3F9Y A;  5EX3 A;  5CCM A;  4IJ8 A;  3OXG A;  5LSZ A;  4JDS A;  3MO5 A;  3CBM A;  1MUF A;  5TH7 A;  3MO0 A;  4WUY A;  5CPR B;  5ARG A;  4NVQ A;  5F6L A;  1H3I A;  5AYF A;  3OXF A;  5JIY A;  1XQH A;  4J83 A; 
#chains in the Genus database with same CATH homology
 1MT6 A;  3FPD A;  4NJ5 A;  4I51 A;  5LSX A;  4FMU A;  3TG4 A;  3M54 A;  4BUP A;  3F9W A;  5T5G A;  3S7F A;  4YNP A;  3CBO A;  3M56 A;  3S7D A;  3S7J A;  5KJK A;  3BO5 A;  5EG2 A;  3F9X A;  5JJ0 A;  3EP0 A;  2BQZ A;  4YND A;  1PEG A;  4QEN A;  3CBP A;  4O6F A;  2W5Z A;  4JLG A;  4H12 A;  4RZ0 A;  2RFI A;  3OOI A;  4J7F A;  3SW9 A;  5ARF A;  3OPE A;  3VUZ A;  5T0K A;  5KJM A;  4E47 A;  1MVX A;  3M59 A;  2JV0 A;  5KJN A;  5JIN A;  5KJL A;  4AU7 A;  3S8P A;  5EX0 A;  1N6C A;  5CCL A;  3DB5 A;  2W5Y A;  5F5E A;  4O30 A;  5TTF A;  3RU0 A;  4J7I A;  5HI7 A;  3TG5 A;  4QEP A;  5HQ8 A;  3M58 A;  1N6A A;  3HNA A;  3K5K A;  5F59 A;  2G46 A;  3KMA A;  3RIB A;  3M57 A;  4MI0 A;  5F6K C;  2R3A A;  3QWP A;  3PDN A;  4LDG A;  1O9S A;  3QWW A;  4MI5 A;  5TEG A;  2QPW A;  4YPU A;  3MEK A;  3F9Z A;  3N71 A;  3S7B A;  2IGQ A;  3IHX A;  3VV0 A;  3SWC A;  1ML9 A;  3M53 A;  1N3J A;  4IJD A;  3M5A A;  2F69 A;  3RJW A;  4J8O A;  5T0M A;  3DAL A;  4YPE A;  3M55 A;  4C1Q A;  3KMJ A;  4YNM A;  1ZKK A;  2O8J A;  3QWV A;  3OS5 A;  3RQ4 A;  3KMT A;  4Z4P A;  1MVH A;  3MO2 A;  3RAY A;  3OXL A;  4YPA A;  4QEO A;  5JHN A;  3F9Y A;  5EX3 A;  5CCM A;  4IJ8 A;  3OXG A;  5LSZ A;  4JDS A;  3MO5 A;  3CBM A;  1MUF A;  5TH7 A;  3MO0 A;  4WUY A;  5CPR B;  5ARG A;  4NVQ A;  5F6L A;  1H3I A;  5AYF A;  3OXF A;  5JIY A;  1XQH A;  4J83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...