1N3JA

Structure and substrate of a histone h3 lysine methyltransferase from paramecium bursaria chlorella virus 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone H3 Lysine Methyltransferase
publication title A dimeric viral SET domain methyltransferase specific to Lys27 of histone H3.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
total genus 8
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1n3jA00
4O30A 3CBOA 5F59A 1ZKKA 3M5AA 1MUFA 4E47A 4QEPA 3K5KA 3MO2A 4YPEA 3M53A 5HQ8A 4YPUA 1O9SA 1N6AA 1MVXA 3S7FA 4I51A 5KJLA 5ARGA 3CBPA 5TEGA 5JJ0A 3RQ4A 3IHXA 3CBMA 3VUZA 5KJNA 3M57A 5CPRB 4O6FA 4J7FA 4WUYA 3DALA 5T5GA 3F9YA 5TTFA 3RIBA 3HNAA 5F5EA 5T0KA 4BUPA 1XQHA 4C1QA 5HI7A 3TG4A 3M56A 2BQZA 4YPAA 3QWPA 3VV0A 3F9WA 4FMUA 4IJDA 4Z4PA 5EG2A 1N6CA 4NVQA 3KMAA 5JIYA 3RAYA 2W5ZA 3S7BA 3PDNA 3RU0A 2O8JA 2QPWA 5T0MA 3MO0A 4RZ0A 3OPEA 4YNMA 4J83A 2IGQA 3MO5A 3KMTA 3M58A 4YNDA 4IJ8A 4JLGA 2JV0A 4MI0A 5CCMA 4LDGA 4J7IA 3M55A 5EX3A 1H3IA 3S8PA 3OXFA 3SW9A 5JINA 2R3AA 2RFIA 5KJMA 4J8OA 3S7DA 2G46A 4H12A 1N3JA 4NJ5A 3S7JA 3F9ZA 3M54A 3OOIA 3RJWA 3DB5A 3EP0A 1ML9A 4QEOA 1MT6A 3N71A 5F6KC 5ARFA 3TG5A 5F6LA 2W5YA 5KJKA 3QWVA 5CCLA 4YNPA 5EX0A 3OS5A 3FPDA 1MVHA 4AU7A 2F69A 1PEGA 3F9XA 5JHNA 3BO5A 5LSXA 5LSZA 5TH7A 3KMJA 5AYFA 3SWCA 3QWWA 4JDSA 3OXLA 3M59A 4MI5A 4QENA 3OXGA 3MEKA
chains in the Genus database with same CATH superfamily
4O30A 3CBOA 5F59A 1ZKKA 3M5AA 1MUFA 4E47A 4QEPA 3K5KA 3MO2A 4YPEA 3M53A 5HQ8A 4YPUA 1O9SA 1N6AA 1MVXA 3S7FA 4I51A 5KJLA 5ARGA 3CBPA 5TEGA 5JJ0A 3RQ4A 3IHXA 3CBMA 3VUZA 5KJNA 3M57A 5CPRB 4O6FA 4J7FA 4WUYA 3DALA 5T5GA 3F9YA 5TTFA 3RIBA 3HNAA 5F5EA 5T0KA 4BUPA 1XQHA 4C1QA 5HI7A 3TG4A 3M56A 2BQZA 4YPAA 3QWPA 3VV0A 3F9WA 4FMUA 4IJDA 4Z4PA 5EG2A 1N6CA 4NVQA 3KMAA 5JIYA 3RAYA 2W5ZA 3S7BA 3PDNA 3RU0A 2O8JA 2QPWA 5T0MA 3MO0A 4RZ0A 3OPEA 4YNMA 4J83A 2IGQA 3MO5A 3KMTA 3M58A 4YNDA 4IJ8A 4JLGA 2JV0A 4MI0A 5CCMA 4LDGA 4J7IA 3M55A 5EX3A 1H3IA 3S8PA 3OXFA 3SW9A 5JINA 2R3AA 2RFIA 5KJMA 4J8OA 3S7DA 2G46A 4H12A 1N3JA 4NJ5A 3S7JA 3F9ZA 3M54A 3OOIA 3RJWA 3DB5A 3EP0A 1ML9A 4QEOA 1MT6A 3N71A 5F6KC 5ARFA 3TG5A 5F6LA 2W5YA 5KJKA 3QWVA 5CCLA 4YNPA 5EX0A 3OS5A 3FPDA 1MVHA 4AU7A 2F69A 1PEGA 3F9XA 5JHNA 3BO5A 5LSXA 5LSZA 5TH7A 3KMJA 5AYFA 3SWCA 3QWWA 4JDSA 3OXLA 3M59A 4MI5A 4QENA 3OXGA 3MEKA
chains in the Genus database with same CATH topology
4O30A 3CBOA 5F59A 1ZKKA 3M5AA 1MUFA 4E47A 4QEPA 3K5KA 3MO2A 4YPEA 3M53A 5HQ8A 4YPUA 1O9SA 1N6AA 1MVXA 3S7FA 4I51A 5KJLA 5ARGA 3CBPA 5TEGA 5JJ0A 3RQ4A 3IHXA 3CBMA 3VUZA 5KJNA 3M57A 5CPRB 4O6FA 4J7FA 4WUYA 3DALA 5T5GA 3F9YA 5TTFA 3RIBA 3HNAA 5F5EA 5T0KA 4BUPA 1XQHA 4C1QA 5HI7A 3TG4A 3M56A 2BQZA 4YPAA 3QWPA 3VV0A 3F9WA 4FMUA 4IJDA 4Z4PA 5EG2A 1N6CA 4NVQA 3KMAA 5JIYA 3RAYA 2W5ZA 3S7BA 3PDNA 3RU0A 2O8JA 2QPWA 5T0MA 3MO0A 4RZ0A 3OPEA 4YNMA 4J83A 2IGQA 3MO5A 3KMTA 3M58A 4YNDA 4IJ8A 4JLGA 2JV0A 4MI0A 5CCMA 4LDGA 4J7IA 3M55A 5EX3A 1H3IA 3S8PA 3OXFA 3SW9A 5JINA 2R3AA 2RFIA 5KJMA 4J8OA 3S7DA 2G46A 4H12A 1N3JA 4NJ5A 3S7JA 3F9ZA 3M54A 3OOIA 3RJWA 3DB5A 3EP0A 1ML9A 4QEOA 1MT6A 3N71A 5F6KC 5ARFA 3TG5A 5F6LA 2W5YA 5KJKA 3QWVA 5CCLA 4YNPA 5EX0A 3OS5A 3FPDA 1MVHA 4AU7A 2F69A 1PEGA 3F9XA 5JHNA 3BO5A 5LSXA 5LSZA 5TH7A 3KMJA 5AYFA 3SWCA 3QWWA 4JDSA 3OXLA 3M59A 4MI5A 4QENA 3OXGA 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O30 A;  3CBO A;  5F59 A;  1ZKK A;  3M5A A;  1MUF A;  4E47 A;  4QEP A;  3K5K A;  3MO2 A;  4YPE A;  3M53 A;  5HQ8 A;  4YPU A;  1O9S A;  1N6A A;  1MVX A;  3S7F A;  4I51 A;  5KJL A;  5ARG A;  3CBP A;  5TEG A;  5JJ0 A;  3RQ4 A;  3IHX A;  3CBM A;  3VUZ A;  5KJN A;  3M57 A;  5CPR B;  4O6F A;  4J7F A;  4WUY A;  3DAL A;  5T5G A;  3F9Y A;  5TTF A;  3RIB A;  3HNA A;  5F5E A;  5T0K A;  4BUP A;  1XQH A;  4C1Q A;  5HI7 A;  3TG4 A;  3M56 A;  2BQZ A;  4YPA A;  3QWP A;  3VV0 A;  3F9W A;  4FMU A;  4IJD A;  4Z4P A;  5EG2 A;  1N6C A;  4NVQ A;  3KMA A;  5JIY A;  3RAY A;  2W5Z A;  3S7B A;  3PDN A;  3RU0 A;  2O8J A;  2QPW A;  5T0M A;  3MO0 A;  4RZ0 A;  3OPE A;  4YNM A;  4J83 A;  2IGQ A;  3MO5 A;  3KMT A;  3M58 A;  4YND A;  4IJ8 A;  4JLG A;  2JV0 A;  4MI0 A;  5CCM A;  4LDG A;  4J7I A;  3M55 A;  5EX3 A;  1H3I A;  3S8P A;  3OXF A;  3SW9 A;  5JIN A;  2R3A A;  2RFI A;  5KJM A;  4J8O A;  3S7D A;  2G46 A;  4H12 A;  1N3J A;  4NJ5 A;  3S7J A;  3F9Z A;  3M54 A;  3OOI A;  3RJW A;  3DB5 A;  3EP0 A;  1ML9 A;  4QEO A;  1MT6 A;  3N71 A;  5F6K C;  5ARF A;  3TG5 A;  5F6L A;  2W5Y A;  5KJK A;  3QWV A;  5CCL A;  4YNP A;  5EX0 A;  3OS5 A;  3FPD A;  1MVH A;  4AU7 A;  2F69 A;  1PEG A;  3F9X A;  5JHN A;  3BO5 A;  5LSX A;  5LSZ A;  5TH7 A;  3KMJ A;  5AYF A;  3SWC A;  3QWW A;  4JDS A;  3OXL A;  3M59 A;  4MI5 A;  4QEN A;  3OXG A;  3MEK A; 
#chains in the Genus database with same CATH topology
 4O30 A;  3CBO A;  5F59 A;  1ZKK A;  3M5A A;  1MUF A;  4E47 A;  4QEP A;  3K5K A;  3MO2 A;  4YPE A;  3M53 A;  5HQ8 A;  4YPU A;  1O9S A;  1N6A A;  1MVX A;  3S7F A;  4I51 A;  5KJL A;  5ARG A;  3CBP A;  5TEG A;  5JJ0 A;  3RQ4 A;  3IHX A;  3CBM A;  3VUZ A;  5KJN A;  3M57 A;  5CPR B;  4O6F A;  4J7F A;  4WUY A;  3DAL A;  5T5G A;  3F9Y A;  5TTF A;  3RIB A;  3HNA A;  5F5E A;  5T0K A;  4BUP A;  1XQH A;  4C1Q A;  5HI7 A;  3TG4 A;  3M56 A;  2BQZ A;  4YPA A;  3QWP A;  3VV0 A;  3F9W A;  4FMU A;  4IJD A;  4Z4P A;  5EG2 A;  1N6C A;  4NVQ A;  3KMA A;  5JIY A;  3RAY A;  2W5Z A;  3S7B A;  3PDN A;  3RU0 A;  2O8J A;  2QPW A;  5T0M A;  3MO0 A;  4RZ0 A;  3OPE A;  4YNM A;  4J83 A;  2IGQ A;  3MO5 A;  3KMT A;  3M58 A;  4YND A;  4IJ8 A;  4JLG A;  2JV0 A;  4MI0 A;  5CCM A;  4LDG A;  4J7I A;  3M55 A;  5EX3 A;  1H3I A;  3S8P A;  3OXF A;  3SW9 A;  5JIN A;  2R3A A;  2RFI A;  5KJM A;  4J8O A;  3S7D A;  2G46 A;  4H12 A;  1N3J A;  4NJ5 A;  3S7J A;  3F9Z A;  3M54 A;  3OOI A;  3RJW A;  3DB5 A;  3EP0 A;  1ML9 A;  4QEO A;  1MT6 A;  3N71 A;  5F6K C;  5ARF A;  3TG5 A;  5F6L A;  2W5Y A;  5KJK A;  3QWV A;  5CCL A;  4YNP A;  5EX0 A;  3OS5 A;  3FPD A;  1MVH A;  4AU7 A;  2F69 A;  1PEG A;  3F9X A;  5JHN A;  3BO5 A;  5LSX A;  5LSZ A;  5TH7 A;  3KMJ A;  5AYF A;  3SWC A;  3QWW A;  4JDS A;  3OXL A;  3M59 A;  4MI5 A;  4QEN A;  3OXG A;  3MEK A; 
#chains in the Genus database with same CATH homology
 4O30 A;  3CBO A;  5F59 A;  1ZKK A;  3M5A A;  1MUF A;  4E47 A;  4QEP A;  3K5K A;  3MO2 A;  4YPE A;  3M53 A;  5HQ8 A;  4YPU A;  1O9S A;  1N6A A;  1MVX A;  3S7F A;  4I51 A;  5KJL A;  5ARG A;  3CBP A;  5TEG A;  5JJ0 A;  3RQ4 A;  3IHX A;  3CBM A;  3VUZ A;  5KJN A;  3M57 A;  5CPR B;  4O6F A;  4J7F A;  4WUY A;  3DAL A;  5T5G A;  3F9Y A;  5TTF A;  3RIB A;  3HNA A;  5F5E A;  5T0K A;  4BUP A;  1XQH A;  4C1Q A;  5HI7 A;  3TG4 A;  3M56 A;  2BQZ A;  4YPA A;  3QWP A;  3VV0 A;  3F9W A;  4FMU A;  4IJD A;  4Z4P A;  5EG2 A;  1N6C A;  4NVQ A;  3KMA A;  5JIY A;  3RAY A;  2W5Z A;  3S7B A;  3PDN A;  3RU0 A;  2O8J A;  2QPW A;  5T0M A;  3MO0 A;  4RZ0 A;  3OPE A;  4YNM A;  4J83 A;  2IGQ A;  3MO5 A;  3KMT A;  3M58 A;  4YND A;  4IJ8 A;  4JLG A;  2JV0 A;  4MI0 A;  5CCM A;  4LDG A;  4J7I A;  3M55 A;  5EX3 A;  1H3I A;  3S8P A;  3OXF A;  3SW9 A;  5JIN A;  2R3A A;  2RFI A;  5KJM A;  4J8O A;  3S7D A;  2G46 A;  4H12 A;  1N3J A;  4NJ5 A;  3S7J A;  3F9Z A;  3M54 A;  3OOI A;  3RJW A;  3DB5 A;  3EP0 A;  1ML9 A;  4QEO A;  1MT6 A;  3N71 A;  5F6K C;  5ARF A;  3TG5 A;  5F6L A;  2W5Y A;  5KJK A;  3QWV A;  5CCL A;  4YNP A;  5EX0 A;  3OS5 A;  3FPD A;  1MVH A;  4AU7 A;  2F69 A;  1PEG A;  3F9X A;  5JHN A;  3BO5 A;  5LSX A;  5LSZ A;  5TH7 A;  3KMJ A;  5AYF A;  3SWC A;  3QWW A;  4JDS A;  3OXL A;  3M59 A;  4MI5 A;  4QEN A;  3OXG A;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...