1N3JA

Structure and substrate of a histone h3 lysine methyltransferase from paramecium bursaria chlorella virus 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3 Lysine Methyltransferase
publication title A dimeric viral SET domain methyltransferase specific to Lys27 of histone H3.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 8
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1n3jA00
5KJNA 3F9ZA 3S7JA 1N3JA 5F59A 1PEGA 5F6KC 4YPAA 2QPWA 3OXGA 5F6LA 4Z4PA 3F9YA 4LDGA 5ARFA 5LSXA 1ZKKA 2O8JA 5JJ0A 4O6FA 3CBPA 3MO2A 1XQHA 5F5EA 2R3AA 4J83A 5T0KA 4JLGA 5EX3A 3VV0A 3KMJA 3EP0A 3BO5A 3OOIA 2JV0A 4QEOA 2W5YA 2RFIA 5ARGA 3RQ4A 4NJ5A 2BQZA 3FPDA 2W5ZA 4JDSA 3S8PA 4WUYA 4BUPA 3TG5A 2IGQA 3SWCA 4MI0A 4AU7A 5JHNA 5CPRB 5KJMA 3S7BA 2G46A 3MO0A 4YNPA 5CCLA 3M54A 5T0MA 4O30A 3N71A 3DB5A 5AYFA 5KJLA 5T5GA 3M5AA 5TEGA 4J7IA 3QWPA 3DALA 4J7FA 4YNMA 3KMAA 3M55A 1MUFA 3M56A 3M57A 3MO5A 4YPEA 3OPEA 1N6CA 3CBOA 3S7FA 4MI5A 4YPUA 1O9SA 5LSZA 4NVQA 5CCMA 4E47A 1MVXA 2F69A 5TTFA 3IHXA 3K5KA 5JIYA 1H3IA 4FMUA 1MT6A 3RU0A 1MVHA 3QWVA 3CBMA 3HNAA 5HQ8A 4RZ0A 1ML9A 3F9XA 3M53A 3PDNA 5KJKA 4QEPA 3RJWA 5EX0A 4J8OA 3TG4A 3OS5A 5EG2A 4QENA 3MEKA 3SW9A 3RIBA 3VUZA 4YNDA 3F9WA 3RAYA 4C1QA 4H12A 3OXFA 5JINA 3S7DA 4IJ8A 5HI7A 4IJDA 5TH7A 3KMTA 4I51A 3M59A 1N6AA 3OXLA 3M58A 3QWWA
chains in the Genus database with same CATH superfamily
5KJNA 3F9ZA 3S7JA 1N3JA 5F59A 1PEGA 5F6KC 4YPAA 2QPWA 3OXGA 5F6LA 4Z4PA 3F9YA 4LDGA 5ARFA 5LSXA 1ZKKA 2O8JA 5JJ0A 4O6FA 3CBPA 3MO2A 1XQHA 5F5EA 2R3AA 4J83A 5T0KA 4JLGA 5EX3A 3VV0A 3KMJA 3EP0A 3BO5A 3OOIA 2JV0A 4QEOA 2W5YA 2RFIA 5ARGA 3RQ4A 4NJ5A 2BQZA 3FPDA 2W5ZA 4JDSA 3S8PA 4WUYA 4BUPA 3TG5A 2IGQA 3SWCA 4MI0A 4AU7A 5JHNA 5CPRB 5KJMA 3S7BA 2G46A 3MO0A 4YNPA 5CCLA 3M54A 5T0MA 4O30A 3N71A 3DB5A 5AYFA 5KJLA 5T5GA 3M5AA 5TEGA 4J7IA 3QWPA 3DALA 4J7FA 4YNMA 3KMAA 3M55A 1MUFA 3M56A 3M57A 3MO5A 4YPEA 3OPEA 1N6CA 3CBOA 3S7FA 4MI5A 4YPUA 1O9SA 5LSZA 4NVQA 5CCMA 4E47A 1MVXA 2F69A 5TTFA 3IHXA 3K5KA 5JIYA 1H3IA 4FMUA 1MT6A 3RU0A 1MVHA 3QWVA 3CBMA 3HNAA 5HQ8A 4RZ0A 1ML9A 3F9XA 3M53A 3PDNA 5KJKA 4QEPA 3RJWA 5EX0A 4J8OA 3TG4A 3OS5A 5EG2A 4QENA 3MEKA 3SW9A 3RIBA 3VUZA 4YNDA 3F9WA 3RAYA 4C1QA 4H12A 3OXFA 5JINA 3S7DA 4IJ8A 5HI7A 4IJDA 5TH7A 3KMTA 4I51A 3M59A 1N6AA 3OXLA 3M58A 3QWWA
chains in the Genus database with same CATH topology
5KJNA 3F9ZA 3S7JA 1N3JA 5F59A 1PEGA 5F6KC 4YPAA 2QPWA 3OXGA 5F6LA 4Z4PA 3F9YA 4LDGA 5ARFA 5LSXA 1ZKKA 2O8JA 5JJ0A 4O6FA 3CBPA 3MO2A 1XQHA 5F5EA 2R3AA 4J83A 5T0KA 4JLGA 5EX3A 3VV0A 3KMJA 3EP0A 3BO5A 3OOIA 2JV0A 4QEOA 2W5YA 2RFIA 5ARGA 3RQ4A 4NJ5A 2BQZA 3FPDA 2W5ZA 4JDSA 3S8PA 4WUYA 4BUPA 3TG5A 2IGQA 3SWCA 4MI0A 4AU7A 5JHNA 5CPRB 5KJMA 3S7BA 2G46A 3MO0A 4YNPA 5CCLA 3M54A 5T0MA 4O30A 3N71A 3DB5A 5AYFA 5KJLA 5T5GA 3M5AA 5TEGA 4J7IA 3QWPA 3DALA 4J7FA 4YNMA 3KMAA 3M55A 1MUFA 3M56A 3M57A 3MO5A 4YPEA 3OPEA 1N6CA 3CBOA 3S7FA 4MI5A 4YPUA 1O9SA 5LSZA 4NVQA 5CCMA 4E47A 1MVXA 2F69A 5TTFA 3IHXA 3K5KA 5JIYA 1H3IA 4FMUA 1MT6A 3RU0A 1MVHA 3QWVA 3CBMA 3HNAA 5HQ8A 4RZ0A 1ML9A 3F9XA 3M53A 3PDNA 5KJKA 4QEPA 3RJWA 5EX0A 4J8OA 3TG4A 3OS5A 5EG2A 4QENA 3MEKA 3SW9A 3RIBA 3VUZA 4YNDA 3F9WA 3RAYA 4C1QA 4H12A 3OXFA 5JINA 3S7DA 4IJ8A 5HI7A 4IJDA 5TH7A 3KMTA 4I51A 3M59A 1N6AA 3OXLA 3M58A 3QWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJN A;  3F9Z A;  3S7J A;  1N3J A;  5F59 A;  1PEG A;  5F6K C;  4YPA A;  2QPW A;  3OXG A;  5F6L A;  4Z4P A;  3F9Y A;  4LDG A;  5ARF A;  5LSX A;  1ZKK A;  2O8J A;  5JJ0 A;  4O6F A;  3CBP A;  3MO2 A;  1XQH A;  5F5E A;  2R3A A;  4J83 A;  5T0K A;  4JLG A;  5EX3 A;  3VV0 A;  3KMJ A;  3EP0 A;  3BO5 A;  3OOI A;  2JV0 A;  4QEO A;  2W5Y A;  2RFI A;  5ARG A;  3RQ4 A;  4NJ5 A;  2BQZ A;  3FPD A;  2W5Z A;  4JDS A;  3S8P A;  4WUY A;  4BUP A;  3TG5 A;  2IGQ A;  3SWC A;  4MI0 A;  4AU7 A;  5JHN A;  5CPR B;  5KJM A;  3S7B A;  2G46 A;  3MO0 A;  4YNP A;  5CCL A;  3M54 A;  5T0M A;  4O30 A;  3N71 A;  3DB5 A;  5AYF A;  5KJL A;  5T5G A;  3M5A A;  5TEG A;  4J7I A;  3QWP A;  3DAL A;  4J7F A;  4YNM A;  3KMA A;  3M55 A;  1MUF A;  3M56 A;  3M57 A;  3MO5 A;  4YPE A;  3OPE A;  1N6C A;  3CBO A;  3S7F A;  4MI5 A;  4YPU A;  1O9S A;  5LSZ A;  4NVQ A;  5CCM A;  4E47 A;  1MVX A;  2F69 A;  5TTF A;  3IHX A;  3K5K A;  5JIY A;  1H3I A;  4FMU A;  1MT6 A;  3RU0 A;  1MVH A;  3QWV A;  3CBM A;  3HNA A;  5HQ8 A;  4RZ0 A;  1ML9 A;  3F9X A;  3M53 A;  3PDN A;  5KJK A;  4QEP A;  3RJW A;  5EX0 A;  4J8O A;  3TG4 A;  3OS5 A;  5EG2 A;  4QEN A;  3MEK A;  3SW9 A;  3RIB A;  3VUZ A;  4YND A;  3F9W A;  3RAY A;  4C1Q A;  4H12 A;  3OXF A;  5JIN A;  3S7D A;  4IJ8 A;  5HI7 A;  4IJD A;  5TH7 A;  3KMT A;  4I51 A;  3M59 A;  1N6A A;  3OXL A;  3M58 A;  3QWW A; 
#chains in the Genus database with same CATH topology
 5KJN A;  3F9Z A;  3S7J A;  1N3J A;  5F59 A;  1PEG A;  5F6K C;  4YPA A;  2QPW A;  3OXG A;  5F6L A;  4Z4P A;  3F9Y A;  4LDG A;  5ARF A;  5LSX A;  1ZKK A;  2O8J A;  5JJ0 A;  4O6F A;  3CBP A;  3MO2 A;  1XQH A;  5F5E A;  2R3A A;  4J83 A;  5T0K A;  4JLG A;  5EX3 A;  3VV0 A;  3KMJ A;  3EP0 A;  3BO5 A;  3OOI A;  2JV0 A;  4QEO A;  2W5Y A;  2RFI A;  5ARG A;  3RQ4 A;  4NJ5 A;  2BQZ A;  3FPD A;  2W5Z A;  4JDS A;  3S8P A;  4WUY A;  4BUP A;  3TG5 A;  2IGQ A;  3SWC A;  4MI0 A;  4AU7 A;  5JHN A;  5CPR B;  5KJM A;  3S7B A;  2G46 A;  3MO0 A;  4YNP A;  5CCL A;  3M54 A;  5T0M A;  4O30 A;  3N71 A;  3DB5 A;  5AYF A;  5KJL A;  5T5G A;  3M5A A;  5TEG A;  4J7I A;  3QWP A;  3DAL A;  4J7F A;  4YNM A;  3KMA A;  3M55 A;  1MUF A;  3M56 A;  3M57 A;  3MO5 A;  4YPE A;  3OPE A;  1N6C A;  3CBO A;  3S7F A;  4MI5 A;  4YPU A;  1O9S A;  5LSZ A;  4NVQ A;  5CCM A;  4E47 A;  1MVX A;  2F69 A;  5TTF A;  3IHX A;  3K5K A;  5JIY A;  1H3I A;  4FMU A;  1MT6 A;  3RU0 A;  1MVH A;  3QWV A;  3CBM A;  3HNA A;  5HQ8 A;  4RZ0 A;  1ML9 A;  3F9X A;  3M53 A;  3PDN A;  5KJK A;  4QEP A;  3RJW A;  5EX0 A;  4J8O A;  3TG4 A;  3OS5 A;  5EG2 A;  4QEN A;  3MEK A;  3SW9 A;  3RIB A;  3VUZ A;  4YND A;  3F9W A;  3RAY A;  4C1Q A;  4H12 A;  3OXF A;  5JIN A;  3S7D A;  4IJ8 A;  5HI7 A;  4IJD A;  5TH7 A;  3KMT A;  4I51 A;  3M59 A;  1N6A A;  3OXL A;  3M58 A;  3QWW A; 
#chains in the Genus database with same CATH homology
 5KJN A;  3F9Z A;  3S7J A;  1N3J A;  5F59 A;  1PEG A;  5F6K C;  4YPA A;  2QPW A;  3OXG A;  5F6L A;  4Z4P A;  3F9Y A;  4LDG A;  5ARF A;  5LSX A;  1ZKK A;  2O8J A;  5JJ0 A;  4O6F A;  3CBP A;  3MO2 A;  1XQH A;  5F5E A;  2R3A A;  4J83 A;  5T0K A;  4JLG A;  5EX3 A;  3VV0 A;  3KMJ A;  3EP0 A;  3BO5 A;  3OOI A;  2JV0 A;  4QEO A;  2W5Y A;  2RFI A;  5ARG A;  3RQ4 A;  4NJ5 A;  2BQZ A;  3FPD A;  2W5Z A;  4JDS A;  3S8P A;  4WUY A;  4BUP A;  3TG5 A;  2IGQ A;  3SWC A;  4MI0 A;  4AU7 A;  5JHN A;  5CPR B;  5KJM A;  3S7B A;  2G46 A;  3MO0 A;  4YNP A;  5CCL A;  3M54 A;  5T0M A;  4O30 A;  3N71 A;  3DB5 A;  5AYF A;  5KJL A;  5T5G A;  3M5A A;  5TEG A;  4J7I A;  3QWP A;  3DAL A;  4J7F A;  4YNM A;  3KMA A;  3M55 A;  1MUF A;  3M56 A;  3M57 A;  3MO5 A;  4YPE A;  3OPE A;  1N6C A;  3CBO A;  3S7F A;  4MI5 A;  4YPU A;  1O9S A;  5LSZ A;  4NVQ A;  5CCM A;  4E47 A;  1MVX A;  2F69 A;  5TTF A;  3IHX A;  3K5K A;  5JIY A;  1H3I A;  4FMU A;  1MT6 A;  3RU0 A;  1MVH A;  3QWV A;  3CBM A;  3HNA A;  5HQ8 A;  4RZ0 A;  1ML9 A;  3F9X A;  3M53 A;  3PDN A;  5KJK A;  4QEP A;  3RJW A;  5EX0 A;  4J8O A;  3TG4 A;  3OS5 A;  5EG2 A;  4QEN A;  3MEK A;  3SW9 A;  3RIB A;  3VUZ A;  4YND A;  3F9W A;  3RAY A;  4C1Q A;  4H12 A;  3OXF A;  5JIN A;  3S7D A;  4IJ8 A;  5HI7 A;  4IJD A;  5TH7 A;  3KMT A;  4I51 A;  3M59 A;  1N6A A;  3OXL A;  3M58 A;  3QWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...