1N3JA

Structure and substrate of a histone h3 lysine methyltransferase from paramecium bursaria chlorella virus 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
b'MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3 Lysine Methyltransferase
publication title A dimeric viral SET domain methyltransferase specific to Lys27 of histone H3.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 8
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1n3jA00
3S7JA 3CBOA 5T5GA 2IGQA 1MT6A 4NJ5A 3VV0A 4IJ8A 2W5YA 3F9WA 4YPAA 3M55A 3RIBA 1ZKKA 1PEGA 5LSXA 5CCLA 4J83A 5EX0A 4YNMA 5EG2A 3TG4A 2JV0A 3CBMA 3FPDA 5CPRB 5ARFA 3M5AA 4I51A 1MVXA 3OXFA 5ARGA 4YPUA 3DALA 3MO2A 3KMTA 3S7DA 4AU7A 4O30A 5JHNA 4J8OA 4FMUA 3M54A 3N71A 3EP0A 4E47A 3CBPA 3M59A 3RU0A 5TH7A 2W5ZA 4LDGA 3M58A 5HI7A 3RQ4A 4YNPA 5TEGA 5KJMA 4JDSA 3MO0A 4YPEA 3OXLA 5T0MA 3TG5A 4J7FA 5F5EA 2R3AA 5CCMA 1N6AA 3OS5A 3S7FA 4H12A 1MVHA 3RJWA 5JJ0A 3QWPA 3MO5A 3M56A 3RAYA 3SWCA 5KJKA 4QEOA 4C1QA 3OXGA 4JLGA 2O8JA 5JIYA 5HQ8A 1N6CA 1N3JA 2F69A 5KJNA 5LSZA 5JINA 4QEPA 4MI5A 4QENA 3KMAA 3M57A 5TTFA 4WUYA 3VUZA 3QWWA 1O9SA 2G46A 5F6KC 1MUFA 3OPEA 4RZ0A 1ML9A 4O6FA 3MEKA 3PDNA 2BQZA 5F59A 3HNAA 4YNDA 4IJDA 3KMJA 3F9ZA 3OOIA 5KJLA 4Z4PA 4BUPA 5T0KA 3F9XA 3S7BA 5EX3A 3IHXA 3F9YA 4MI0A 5AYFA 3K5KA 1H3IA 4NVQA 2RFIA 2QPWA 3QWVA 3M53A 3DB5A 3S8PA 4J7IA 3BO5A 5F6LA 3SW9A 1XQHA
chains in the Genus database with same CATH superfamily
3S7JA 3CBOA 5T5GA 2IGQA 1MT6A 4NJ5A 3VV0A 4IJ8A 2W5YA 3F9WA 4YPAA 3M55A 3RIBA 1ZKKA 1PEGA 5LSXA 5CCLA 4J83A 5EX0A 4YNMA 5EG2A 3TG4A 2JV0A 3CBMA 3FPDA 5CPRB 5ARFA 3M5AA 4I51A 1MVXA 3OXFA 5ARGA 4YPUA 3DALA 3MO2A 3KMTA 3S7DA 4AU7A 4O30A 5JHNA 4J8OA 4FMUA 3M54A 3N71A 3EP0A 4E47A 3CBPA 3M59A 3RU0A 5TH7A 2W5ZA 4LDGA 3M58A 5HI7A 3RQ4A 4YNPA 5TEGA 5KJMA 4JDSA 3MO0A 4YPEA 3OXLA 5T0MA 3TG5A 4J7FA 5F5EA 2R3AA 5CCMA 1N6AA 3OS5A 3S7FA 4H12A 1MVHA 3RJWA 5JJ0A 3QWPA 3MO5A 3M56A 3RAYA 3SWCA 5KJKA 4QEOA 4C1QA 3OXGA 4JLGA 2O8JA 5JIYA 5HQ8A 1N6CA 1N3JA 2F69A 5KJNA 5LSZA 5JINA 4QEPA 4MI5A 4QENA 3KMAA 3M57A 5TTFA 4WUYA 3VUZA 3QWWA 1O9SA 2G46A 5F6KC 1MUFA 3OPEA 4RZ0A 1ML9A 4O6FA 3MEKA 3PDNA 2BQZA 5F59A 3HNAA 4YNDA 4IJDA 3KMJA 3F9ZA 3OOIA 5KJLA 4Z4PA 4BUPA 5T0KA 3F9XA 3S7BA 5EX3A 3IHXA 3F9YA 4MI0A 5AYFA 3K5KA 1H3IA 4NVQA 2RFIA 2QPWA 3QWVA 3M53A 3DB5A 3S8PA 4J7IA 3BO5A 5F6LA 3SW9A 1XQHA
chains in the Genus database with same CATH topology
3S7JA 3CBOA 5T5GA 2IGQA 1MT6A 4NJ5A 3VV0A 4IJ8A 2W5YA 3F9WA 4YPAA 3M55A 3RIBA 1ZKKA 1PEGA 5LSXA 5CCLA 4J83A 5EX0A 4YNMA 5EG2A 3TG4A 2JV0A 3CBMA 3FPDA 5CPRB 5ARFA 3M5AA 4I51A 1MVXA 3OXFA 5ARGA 4YPUA 3DALA 3MO2A 3KMTA 3S7DA 4AU7A 4O30A 5JHNA 4J8OA 4FMUA 3M54A 3N71A 3EP0A 4E47A 3CBPA 3M59A 3RU0A 5TH7A 2W5ZA 4LDGA 3M58A 5HI7A 3RQ4A 4YNPA 5TEGA 5KJMA 4JDSA 3MO0A 4YPEA 3OXLA 5T0MA 3TG5A 4J7FA 5F5EA 2R3AA 5CCMA 1N6AA 3OS5A 3S7FA 4H12A 1MVHA 3RJWA 5JJ0A 3QWPA 3MO5A 3M56A 3RAYA 3SWCA 5KJKA 4QEOA 4C1QA 3OXGA 4JLGA 2O8JA 5JIYA 5HQ8A 1N6CA 1N3JA 2F69A 5KJNA 5LSZA 5JINA 4QEPA 4MI5A 4QENA 3KMAA 3M57A 5TTFA 4WUYA 3VUZA 3QWWA 1O9SA 2G46A 5F6KC 1MUFA 3OPEA 4RZ0A 1ML9A 4O6FA 3MEKA 3PDNA 2BQZA 5F59A 3HNAA 4YNDA 4IJDA 3KMJA 3F9ZA 3OOIA 5KJLA 4Z4PA 4BUPA 5T0KA 3F9XA 3S7BA 5EX3A 3IHXA 3F9YA 4MI0A 5AYFA 3K5KA 1H3IA 4NVQA 2RFIA 2QPWA 3QWVA 3M53A 3DB5A 3S8PA 4J7IA 3BO5A 5F6LA 3SW9A 1XQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7J A;  3CBO A;  5T5G A;  2IGQ A;  1MT6 A;  4NJ5 A;  3VV0 A;  4IJ8 A;  2W5Y A;  3F9W A;  4YPA A;  3M55 A;  3RIB A;  1ZKK A;  1PEG A;  5LSX A;  5CCL A;  4J83 A;  5EX0 A;  4YNM A;  5EG2 A;  3TG4 A;  2JV0 A;  3CBM A;  3FPD A;  5CPR B;  5ARF A;  3M5A A;  4I51 A;  1MVX A;  3OXF A;  5ARG A;  4YPU A;  3DAL A;  3MO2 A;  3KMT A;  3S7D A;  4AU7 A;  4O30 A;  5JHN A;  4J8O A;  4FMU A;  3M54 A;  3N71 A;  3EP0 A;  4E47 A;  3CBP A;  3M59 A;  3RU0 A;  5TH7 A;  2W5Z A;  4LDG A;  3M58 A;  5HI7 A;  3RQ4 A;  4YNP A;  5TEG A;  5KJM A;  4JDS A;  3MO0 A;  4YPE A;  3OXL A;  5T0M A;  3TG5 A;  4J7F A;  5F5E A;  2R3A A;  5CCM A;  1N6A A;  3OS5 A;  3S7F A;  4H12 A;  1MVH A;  3RJW A;  5JJ0 A;  3QWP A;  3MO5 A;  3M56 A;  3RAY A;  3SWC A;  5KJK A;  4QEO A;  4C1Q A;  3OXG A;  4JLG A;  2O8J A;  5JIY A;  5HQ8 A;  1N6C A;  1N3J A;  2F69 A;  5KJN A;  5LSZ A;  5JIN A;  4QEP A;  4MI5 A;  4QEN A;  3KMA A;  3M57 A;  5TTF A;  4WUY A;  3VUZ A;  3QWW A;  1O9S A;  2G46 A;  5F6K C;  1MUF A;  3OPE A;  4RZ0 A;  1ML9 A;  4O6F A;  3MEK A;  3PDN A;  2BQZ A;  5F59 A;  3HNA A;  4YND A;  4IJD A;  3KMJ A;  3F9Z A;  3OOI A;  5KJL A;  4Z4P A;  4BUP A;  5T0K A;  3F9X A;  3S7B A;  5EX3 A;  3IHX A;  3F9Y A;  4MI0 A;  5AYF A;  3K5K A;  1H3I A;  4NVQ A;  2RFI A;  2QPW A;  3QWV A;  3M53 A;  3DB5 A;  3S8P A;  4J7I A;  3BO5 A;  5F6L A;  3SW9 A;  1XQH A; 
#chains in the Genus database with same CATH topology
 3S7J A;  3CBO A;  5T5G A;  2IGQ A;  1MT6 A;  4NJ5 A;  3VV0 A;  4IJ8 A;  2W5Y A;  3F9W A;  4YPA A;  3M55 A;  3RIB A;  1ZKK A;  1PEG A;  5LSX A;  5CCL A;  4J83 A;  5EX0 A;  4YNM A;  5EG2 A;  3TG4 A;  2JV0 A;  3CBM A;  3FPD A;  5CPR B;  5ARF A;  3M5A A;  4I51 A;  1MVX A;  3OXF A;  5ARG A;  4YPU A;  3DAL A;  3MO2 A;  3KMT A;  3S7D A;  4AU7 A;  4O30 A;  5JHN A;  4J8O A;  4FMU A;  3M54 A;  3N71 A;  3EP0 A;  4E47 A;  3CBP A;  3M59 A;  3RU0 A;  5TH7 A;  2W5Z A;  4LDG A;  3M58 A;  5HI7 A;  3RQ4 A;  4YNP A;  5TEG A;  5KJM A;  4JDS A;  3MO0 A;  4YPE A;  3OXL A;  5T0M A;  3TG5 A;  4J7F A;  5F5E A;  2R3A A;  5CCM A;  1N6A A;  3OS5 A;  3S7F A;  4H12 A;  1MVH A;  3RJW A;  5JJ0 A;  3QWP A;  3MO5 A;  3M56 A;  3RAY A;  3SWC A;  5KJK A;  4QEO A;  4C1Q A;  3OXG A;  4JLG A;  2O8J A;  5JIY A;  5HQ8 A;  1N6C A;  1N3J A;  2F69 A;  5KJN A;  5LSZ A;  5JIN A;  4QEP A;  4MI5 A;  4QEN A;  3KMA A;  3M57 A;  5TTF A;  4WUY A;  3VUZ A;  3QWW A;  1O9S A;  2G46 A;  5F6K C;  1MUF A;  3OPE A;  4RZ0 A;  1ML9 A;  4O6F A;  3MEK A;  3PDN A;  2BQZ A;  5F59 A;  3HNA A;  4YND A;  4IJD A;  3KMJ A;  3F9Z A;  3OOI A;  5KJL A;  4Z4P A;  4BUP A;  5T0K A;  3F9X A;  3S7B A;  5EX3 A;  3IHX A;  3F9Y A;  4MI0 A;  5AYF A;  3K5K A;  1H3I A;  4NVQ A;  2RFI A;  2QPW A;  3QWV A;  3M53 A;  3DB5 A;  3S8P A;  4J7I A;  3BO5 A;  5F6L A;  3SW9 A;  1XQH A; 
#chains in the Genus database with same CATH homology
 3S7J A;  3CBO A;  5T5G A;  2IGQ A;  1MT6 A;  4NJ5 A;  3VV0 A;  4IJ8 A;  2W5Y A;  3F9W A;  4YPA A;  3M55 A;  3RIB A;  1ZKK A;  1PEG A;  5LSX A;  5CCL A;  4J83 A;  5EX0 A;  4YNM A;  5EG2 A;  3TG4 A;  2JV0 A;  3CBM A;  3FPD A;  5CPR B;  5ARF A;  3M5A A;  4I51 A;  1MVX A;  3OXF A;  5ARG A;  4YPU A;  3DAL A;  3MO2 A;  3KMT A;  3S7D A;  4AU7 A;  4O30 A;  5JHN A;  4J8O A;  4FMU A;  3M54 A;  3N71 A;  3EP0 A;  4E47 A;  3CBP A;  3M59 A;  3RU0 A;  5TH7 A;  2W5Z A;  4LDG A;  3M58 A;  5HI7 A;  3RQ4 A;  4YNP A;  5TEG A;  5KJM A;  4JDS A;  3MO0 A;  4YPE A;  3OXL A;  5T0M A;  3TG5 A;  4J7F A;  5F5E A;  2R3A A;  5CCM A;  1N6A A;  3OS5 A;  3S7F A;  4H12 A;  1MVH A;  3RJW A;  5JJ0 A;  3QWP A;  3MO5 A;  3M56 A;  3RAY A;  3SWC A;  5KJK A;  4QEO A;  4C1Q A;  3OXG A;  4JLG A;  2O8J A;  5JIY A;  5HQ8 A;  1N6C A;  1N3J A;  2F69 A;  5KJN A;  5LSZ A;  5JIN A;  4QEP A;  4MI5 A;  4QEN A;  3KMA A;  3M57 A;  5TTF A;  4WUY A;  3VUZ A;  3QWW A;  1O9S A;  2G46 A;  5F6K C;  1MUF A;  3OPE A;  4RZ0 A;  1ML9 A;  4O6F A;  3MEK A;  3PDN A;  2BQZ A;  5F59 A;  3HNA A;  4YND A;  4IJD A;  3KMJ A;  3F9Z A;  3OOI A;  5KJL A;  4Z4P A;  4BUP A;  5T0K A;  3F9X A;  3S7B A;  5EX3 A;  3IHX A;  3F9Y A;  4MI0 A;  5AYF A;  3K5K A;  1H3I A;  4NVQ A;  2RFI A;  2QPW A;  3QWV A;  3M53 A;  3DB5 A;  3S8P A;  4J7I A;  3BO5 A;  5F6L A;  3SW9 A;  1XQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...