1N3JA

Structure and substrate of a histone h3 lysine methyltransferase from paramecium bursaria chlorella virus 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A dimeric viral SET domain methyltransferase specific to Lys27 of histone H3.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
molecule keywords Histone H3 Lysine Methyltransferase
total genus 8
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1n3jA00
2QPWA 5HQ8A 3F9ZA 3RU0A 3K5KA 4JLGA 3MO0A 1MVXA 1MUFA 3OPEA 1MVHA 2W5ZA 3RQ4A 5TEGA 5KJMA 1ML9A 3S7BA 3FPDA 4J83A 4QEPA 1H3IA 3DALA 1MT6A 5EX0A 5EG2A 3DB5A 3KMJA 4YPAA 3RAYA 3VUZA 5F59A 3EP0A 4BUPA 3IHXA 3OS5A 3MO2A 3M58A 4NJ5A 4QEOA 5JJ0A 2JV0A 1N6CA 1O9SA 5ARGA 4YNDA 3M54A 4YNMA 5JINA 3RIBA 3M56A 5ARFA 4FMUA 1XQHA 4MI0A 3QWWA 2R3AA 4C1QA 5JIYA 5CCLA 3SWCA 4J7FA 3QWPA 3CBPA 3S7FA 3TG5A 3N71A 1PEGA 4WUYA 3KMTA 3S7JA 2G46A 5CPRB 3MEKA 3S7DA 5T5GA 4J7IA 2W5YA 4H12A 4Z4PA 3F9YA 5JHNA 3F9XA 2RFIA 5CCMA 4O6FA 1N3JA 4IJ8A 4O30A 5T0MA 4RZ0A 3OXLA 5AYFA 4JDSA 3M59A 4LDGA 3F9WA 2IGQA 2BQZA 5F6KC 3MO5A 3M53A 4AU7A 3CBMA 4J8OA 1ZKKA 3BO5A 4QENA 2O8JA 3RJWA 3SW9A 2F69A 5TTFA 4NVQA 3KMAA 3OXGA 5LSXA 4YNPA 5HI7A 1N6AA 3M57A 3QWVA 5KJNA 5F5EA 4I51A 5EX3A 5TH7A 3HNAA 5LSZA 3M55A 3OXFA 3CBOA 4YPEA 3PDNA 4YPUA 4E47A 5KJKA 4IJDA 4MI5A 3S8PA 5F6LA 5KJLA 3OOIA 3TG4A 3M5AA 5T0KA 3VV0A
chains in the Genus database with same CATH superfamily
2QPWA 5HQ8A 3F9ZA 3RU0A 3K5KA 4JLGA 3MO0A 1MVXA 1MUFA 3OPEA 1MVHA 2W5ZA 3RQ4A 5TEGA 5KJMA 1ML9A 3S7BA 3FPDA 4J83A 4QEPA 1H3IA 3DALA 1MT6A 5EX0A 5EG2A 3DB5A 3KMJA 4YPAA 3RAYA 3VUZA 5F59A 3EP0A 4BUPA 3IHXA 3OS5A 3MO2A 3M58A 4NJ5A 4QEOA 5JJ0A 2JV0A 1N6CA 1O9SA 5ARGA 4YNDA 3M54A 4YNMA 5JINA 3RIBA 3M56A 5ARFA 4FMUA 1XQHA 4MI0A 3QWWA 2R3AA 4C1QA 5JIYA 5CCLA 3SWCA 4J7FA 3QWPA 3CBPA 3S7FA 3TG5A 3N71A 1PEGA 4WUYA 3KMTA 3S7JA 2G46A 5CPRB 3MEKA 3S7DA 5T5GA 4J7IA 2W5YA 4H12A 4Z4PA 3F9YA 5JHNA 3F9XA 2RFIA 5CCMA 4O6FA 1N3JA 4IJ8A 4O30A 5T0MA 4RZ0A 3OXLA 5AYFA 4JDSA 3M59A 4LDGA 3F9WA 2IGQA 2BQZA 5F6KC 3MO5A 3M53A 4AU7A 3CBMA 4J8OA 1ZKKA 3BO5A 4QENA 2O8JA 3RJWA 3SW9A 2F69A 5TTFA 4NVQA 3KMAA 3OXGA 5LSXA 4YNPA 5HI7A 1N6AA 3M57A 3QWVA 5KJNA 5F5EA 4I51A 5EX3A 5TH7A 3HNAA 5LSZA 3M55A 3OXFA 3CBOA 4YPEA 3PDNA 4YPUA 4E47A 5KJKA 4IJDA 4MI5A 3S8PA 5F6LA 5KJLA 3OOIA 3TG4A 3M5AA 5T0KA 3VV0A
chains in the Genus database with same CATH topology
2QPWA 5HQ8A 3F9ZA 3RU0A 3K5KA 4JLGA 3MO0A 1MVXA 1MUFA 3OPEA 1MVHA 2W5ZA 3RQ4A 5TEGA 5KJMA 1ML9A 3S7BA 3FPDA 4J83A 4QEPA 1H3IA 3DALA 1MT6A 5EX0A 5EG2A 3DB5A 3KMJA 4YPAA 3RAYA 3VUZA 5F59A 3EP0A 4BUPA 3IHXA 3OS5A 3MO2A 3M58A 4NJ5A 4QEOA 5JJ0A 2JV0A 1N6CA 1O9SA 5ARGA 4YNDA 3M54A 4YNMA 5JINA 3RIBA 3M56A 5ARFA 4FMUA 1XQHA 4MI0A 3QWWA 2R3AA 4C1QA 5JIYA 5CCLA 3SWCA 4J7FA 3QWPA 3CBPA 3S7FA 3TG5A 3N71A 1PEGA 4WUYA 3KMTA 3S7JA 2G46A 5CPRB 3MEKA 3S7DA 5T5GA 4J7IA 2W5YA 4H12A 4Z4PA 3F9YA 5JHNA 3F9XA 2RFIA 5CCMA 4O6FA 1N3JA 4IJ8A 4O30A 5T0MA 4RZ0A 3OXLA 5AYFA 4JDSA 3M59A 4LDGA 3F9WA 2IGQA 2BQZA 5F6KC 3MO5A 3M53A 4AU7A 3CBMA 4J8OA 1ZKKA 3BO5A 4QENA 2O8JA 3RJWA 3SW9A 2F69A 5TTFA 4NVQA 3KMAA 3OXGA 5LSXA 4YNPA 5HI7A 1N6AA 3M57A 3QWVA 5KJNA 5F5EA 4I51A 5EX3A 5TH7A 3HNAA 5LSZA 3M55A 3OXFA 3CBOA 4YPEA 3PDNA 4YPUA 4E47A 5KJKA 4IJDA 4MI5A 3S8PA 5F6LA 5KJLA 3OOIA 3TG4A 3M5AA 5T0KA 3VV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPW A;  5HQ8 A;  3F9Z A;  3RU0 A;  3K5K A;  4JLG A;  3MO0 A;  1MVX A;  1MUF A;  3OPE A;  1MVH A;  2W5Z A;  3RQ4 A;  5TEG A;  5KJM A;  1ML9 A;  3S7B A;  3FPD A;  4J83 A;  4QEP A;  1H3I A;  3DAL A;  1MT6 A;  5EX0 A;  5EG2 A;  3DB5 A;  3KMJ A;  4YPA A;  3RAY A;  3VUZ A;  5F59 A;  3EP0 A;  4BUP A;  3IHX A;  3OS5 A;  3MO2 A;  3M58 A;  4NJ5 A;  4QEO A;  5JJ0 A;  2JV0 A;  1N6C A;  1O9S A;  5ARG A;  4YND A;  3M54 A;  4YNM A;  5JIN A;  3RIB A;  3M56 A;  5ARF A;  4FMU A;  1XQH A;  4MI0 A;  3QWW A;  2R3A A;  4C1Q A;  5JIY A;  5CCL A;  3SWC A;  4J7F A;  3QWP A;  3CBP A;  3S7F A;  3TG5 A;  3N71 A;  1PEG A;  4WUY A;  3KMT A;  3S7J A;  2G46 A;  5CPR B;  3MEK A;  3S7D A;  5T5G A;  4J7I A;  2W5Y A;  4H12 A;  4Z4P A;  3F9Y A;  5JHN A;  3F9X A;  2RFI A;  5CCM A;  4O6F A;  1N3J A;  4IJ8 A;  4O30 A;  5T0M A;  4RZ0 A;  3OXL A;  5AYF A;  4JDS A;  3M59 A;  4LDG A;  3F9W A;  2IGQ A;  2BQZ A;  5F6K C;  3MO5 A;  3M53 A;  4AU7 A;  3CBM A;  4J8O A;  1ZKK A;  3BO5 A;  4QEN A;  2O8J A;  3RJW A;  3SW9 A;  2F69 A;  5TTF A;  4NVQ A;  3KMA A;  3OXG A;  5LSX A;  4YNP A;  5HI7 A;  1N6A A;  3M57 A;  3QWV A;  5KJN A;  5F5E A;  4I51 A;  5EX3 A;  5TH7 A;  3HNA A;  5LSZ A;  3M55 A;  3OXF A;  3CBO A;  4YPE A;  3PDN A;  4YPU A;  4E47 A;  5KJK A;  4IJD A;  4MI5 A;  3S8P A;  5F6L A;  5KJL A;  3OOI A;  3TG4 A;  3M5A A;  5T0K A;  3VV0 A; 
#chains in the Genus database with same CATH topology
 2QPW A;  5HQ8 A;  3F9Z A;  3RU0 A;  3K5K A;  4JLG A;  3MO0 A;  1MVX A;  1MUF A;  3OPE A;  1MVH A;  2W5Z A;  3RQ4 A;  5TEG A;  5KJM A;  1ML9 A;  3S7B A;  3FPD A;  4J83 A;  4QEP A;  1H3I A;  3DAL A;  1MT6 A;  5EX0 A;  5EG2 A;  3DB5 A;  3KMJ A;  4YPA A;  3RAY A;  3VUZ A;  5F59 A;  3EP0 A;  4BUP A;  3IHX A;  3OS5 A;  3MO2 A;  3M58 A;  4NJ5 A;  4QEO A;  5JJ0 A;  2JV0 A;  1N6C A;  1O9S A;  5ARG A;  4YND A;  3M54 A;  4YNM A;  5JIN A;  3RIB A;  3M56 A;  5ARF A;  4FMU A;  1XQH A;  4MI0 A;  3QWW A;  2R3A A;  4C1Q A;  5JIY A;  5CCL A;  3SWC A;  4J7F A;  3QWP A;  3CBP A;  3S7F A;  3TG5 A;  3N71 A;  1PEG A;  4WUY A;  3KMT A;  3S7J A;  2G46 A;  5CPR B;  3MEK A;  3S7D A;  5T5G A;  4J7I A;  2W5Y A;  4H12 A;  4Z4P A;  3F9Y A;  5JHN A;  3F9X A;  2RFI A;  5CCM A;  4O6F A;  1N3J A;  4IJ8 A;  4O30 A;  5T0M A;  4RZ0 A;  3OXL A;  5AYF A;  4JDS A;  3M59 A;  4LDG A;  3F9W A;  2IGQ A;  2BQZ A;  5F6K C;  3MO5 A;  3M53 A;  4AU7 A;  3CBM A;  4J8O A;  1ZKK A;  3BO5 A;  4QEN A;  2O8J A;  3RJW A;  3SW9 A;  2F69 A;  5TTF A;  4NVQ A;  3KMA A;  3OXG A;  5LSX A;  4YNP A;  5HI7 A;  1N6A A;  3M57 A;  3QWV A;  5KJN A;  5F5E A;  4I51 A;  5EX3 A;  5TH7 A;  3HNA A;  5LSZ A;  3M55 A;  3OXF A;  3CBO A;  4YPE A;  3PDN A;  4YPU A;  4E47 A;  5KJK A;  4IJD A;  4MI5 A;  3S8P A;  5F6L A;  5KJL A;  3OOI A;  3TG4 A;  3M5A A;  5T0K A;  3VV0 A; 
#chains in the Genus database with same CATH homology
 2QPW A;  5HQ8 A;  3F9Z A;  3RU0 A;  3K5K A;  4JLG A;  3MO0 A;  1MVX A;  1MUF A;  3OPE A;  1MVH A;  2W5Z A;  3RQ4 A;  5TEG A;  5KJM A;  1ML9 A;  3S7B A;  3FPD A;  4J83 A;  4QEP A;  1H3I A;  3DAL A;  1MT6 A;  5EX0 A;  5EG2 A;  3DB5 A;  3KMJ A;  4YPA A;  3RAY A;  3VUZ A;  5F59 A;  3EP0 A;  4BUP A;  3IHX A;  3OS5 A;  3MO2 A;  3M58 A;  4NJ5 A;  4QEO A;  5JJ0 A;  2JV0 A;  1N6C A;  1O9S A;  5ARG A;  4YND A;  3M54 A;  4YNM A;  5JIN A;  3RIB A;  3M56 A;  5ARF A;  4FMU A;  1XQH A;  4MI0 A;  3QWW A;  2R3A A;  4C1Q A;  5JIY A;  5CCL A;  3SWC A;  4J7F A;  3QWP A;  3CBP A;  3S7F A;  3TG5 A;  3N71 A;  1PEG A;  4WUY A;  3KMT A;  3S7J A;  2G46 A;  5CPR B;  3MEK A;  3S7D A;  5T5G A;  4J7I A;  2W5Y A;  4H12 A;  4Z4P A;  3F9Y A;  5JHN A;  3F9X A;  2RFI A;  5CCM A;  4O6F A;  1N3J A;  4IJ8 A;  4O30 A;  5T0M A;  4RZ0 A;  3OXL A;  5AYF A;  4JDS A;  3M59 A;  4LDG A;  3F9W A;  2IGQ A;  2BQZ A;  5F6K C;  3MO5 A;  3M53 A;  4AU7 A;  3CBM A;  4J8O A;  1ZKK A;  3BO5 A;  4QEN A;  2O8J A;  3RJW A;  3SW9 A;  2F69 A;  5TTF A;  4NVQ A;  3KMA A;  3OXG A;  5LSX A;  4YNP A;  5HI7 A;  1N6A A;  3M57 A;  3QWV A;  5KJN A;  5F5E A;  4I51 A;  5EX3 A;  5TH7 A;  3HNA A;  5LSZ A;  3M55 A;  3OXF A;  3CBO A;  4YPE A;  3PDN A;  4YPU A;  4E47 A;  5KJK A;  4IJD A;  4MI5 A;  3S8P A;  5F6L A;  5KJL A;  3OOI A;  3TG4 A;  3M5A A;  5T0K A;  3VV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...