3S7BA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7bA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7bA01
1A17A 3TG4A 4GA2A 3CK9A 3PDNA 3QWWA 1QQEA 3OXGA 3VTYA 1ELRA 3SW9A 3K5KA 3F9YA 3MV3B 3PE3A 3M55A 3CBOA 4HOSA 5G04C 4NJ5A 4Y6CA 3M58A 4RZ0A 5CCLA 5TH7A 2XEVA 5FZQA 1N6CA 3QWPA 2C0MA 5KJKA 4J7FA 3HNAA 2XPIA 4H7XA 3ESKA 2PQRA 4E47A 3OXFA 3KMJA 5AYWD 3S7BA 5LSXA 2FEZA 5FJYA 1IYGA 2VQ2A 4I1AA 3RU0A 2JLBA 4J8FA 4BT9A 3URZA 2IGQA 5T0MA 3LY8A 2KCKA 3M57A 2IFUA 1ELWA 3CK8A 4I9CA 3RAYA 4GYWA 3CKCA 3KD7A 5LSZA 3RIBA 1XNFA 4ABNA 3Q4AB 1W3BA 4BTBA 3CBPA 5EG2A 1HXIA 3PE4A 4KYOB 3ASDA 3AS4A 1WAO1 3M5AA 3VUZA 3FFLA 2G46A 4RG6A 2VGYA 4UI9K 3MO2A 4IJ8A 2UY1B 2VSYA 3GW4A 4WNEA 5F59A 1HH8A 3ULQA 3QDNA 3LKUA 5C1DA 3U4TA 4I51A 5T5GA 3QOUA 4J0UA 4YNDA 2XGMA 4XIFA 5FZRA 3RJWA 5JJ6A 4H7YA 3ZGQA 4CGWA 3IHXA 5FTPA 1ZBPA 4U0UA 5M72A 3LPZA 3M53A 4GA0A 2L6JA 2FI7A 3LYAA 2IF4A 1N6AA 5JJTA 3GZ2A 2DBAA 4UI9J 2KATA 3EDTB 4Y6WA 4G25A 3Q47B 4HORA 4N3AA 3ASHA 3R9AB 4JLGA 3OOIA 2XGOA 1NA0A 2QPWA 2VGXB 4J83A 4APOA 4YPEA 3SF4A 4GCNA 4J8EA 1IHGA 4J8DA 4KXKB 3OXLA 3ZN3A 3HYMB 3LY7A 5HI7A 4HOTA 3TGOA 1FCHA 3OS5A 2Q7FA 3RQ4A 4J7IA 4JDSA 5AYFA 1HZ4A 1OUVA 4U07A 2BQZA 3AS5A 3QKYA 5EX0A 4YNMA 3GYZA 1O9SA 4AM9A 4XI9A 4W9RA 1ZKKA 5JHNA 3Q49B 3RO2A 4AIFA 4MI0A 1PEGA 5DBKA 2YHCA 5TTFA 3FPDA 3FWVA 4RG9A 5G05J 3UQ3A 4BT8A 3ZFWA 5D0OD 3GZ1A 2RFIA 4LDGA 5CCMA 2VGXA 1NZNA 2HR2A 4N3BA 3O48A 4WNGA 4G24A 4UI9C 5TEGA 3CKBA 5A6CA 3MA5A 4AY5A 3CVQA 3S7JA 2W5YA 4Z4PA 4CGVA 5HQ8A 5BNWA 3JYSA 4KBQA 3SWCA 3MV2B 4QEOA 3RJVA 2GW1A 5KJMA 2W5ZA 4MI5A 3CBMA 4GYOA 3S7DA 4NRHB 3LCAA 4U0SA 1QZ2A 2P58C 3CVLA 4UQXA 4BUPA 1P5QA 5ARFA 5JJ7A 3F9ZA 4N2QA 4GA1A 5F6LA 2HYZA 5BT1A 2WQHA 1WM5A 1MVHA 3OPEA 3TAXA 3CVPA 4YPUA 5JIYA 2VYIA 1KLXA 4I17A 5G05C 2Y4TA 2PQNA 3MEKA 4C1QA 4IJDA 4I2ZA 5JJ0A 4U04A 2LNIA 1MVXA 4YPAA 4WUYA 5EKQD 3ZPJA 4EQFA 3FP3A 3S7FA 1MT6A 4ME2A 4G23A 4G1TA 4BWRA 4O30A 4H12A 5DIZA 1H3IA 2FBNA 5LCWJ 2UWJG 4F3VA 3DALA 4QEPA 4N2SA 3MO0A 2C2LA 1N3JA 1MUFA 5BW8C 3LY9A 2MHKA 4AY6A 3ASGA 1KT0A 2I6HA 2WPVA 2KCLA 4NVQA 4JL0A 4GPKA 5LCWC 2PL2A 2QFCA 1NA3A 3QWVA 4NQ0A 2Y4UA 3VTXA 3M56A 3ZHEB 4CDRA 3MKRA 2OOEA 4G2VA 1E96B 1PC2A 5CPRB 3N71A 5EX3A 5T0KA 3Q15A 2VSNA 1Y8MA 4O6FA 1KT1A 3ZHEA 2LSVA 3RO3A 5CHEE 4N3CA 2J9QA 5KJLA 2NC9A 3U3WA 2UY1A 3M54A 4G26A 5ARGA 4GZ5A 5KJNA 2FF4A 3KAEA 4WNFA 4YVQC 3VV0A 4GZ6A 3UUXA 2YQ8A 3NF1A 3M59A 4GCOA 3UPVA 3Q5MA 4I9EA 3CK7A 5A7DB 4J8OA 2BUGA 2FO7A 3RKVA 3CVNA 2F69A 4JA9A 4IN3B 4UQYA 3KMTA 1ML9A 4HOQA 4BTAA 4YVOA 3SZ7A 4YNPA 5D0QD 2XGSA 4HOUA 3AS8A 4JA7A 4JHRA 3ASFA 3WXXA 2KC7A 2O8JA 5F5EA 3BEEA 2E2EA 3S8PA 4AU7A 4QENA 4A1SA 5F6KC 5JINA 4B94A 2KCVA 1XQHA 3IEGA 2XCCA 2HO1A 4FMUA 3MO5A 3F9WA 4N39A 3BO5A 4U0ZA 4GYYA 1ZU2A 2AVPA 2XCBA 2PZIA 4XI0A 2R3AA 3KMAA 2C0LA 3K9IA 5FT9A 2ONDA 2R5SA 2LSUA 1B89A 4UQZA 3CV0A 4WNDA 4GZ3A 2V5FA 3E4BA 5G04J 3TG5A 3KS2A 1TJCA 2JV0A 3DB5A 4LEUA 5FZSA 3EP0A 4N5CA 3F9XA 4I2WA 1YA0A 3CEQA
chains in the Genus database with same CATH superfamily
1A17A 2L6BA 4B8AA 2OEVA 3PUJA 3PDNA 4AVXA 1ELRA 2IEJA 1FVFA 4WWOA 3APCA 3F9YA 2P9LG 4BSXA 3JXJA 4HOSA 2FO1E 4XE0A 4NJ5A 4C9BB 4Y6CA 4RZ0A 2XS8A 3FTXA 5TH7A 2VJ8A 3CLJA 3QWPA 1QBQA 3OTNA 4H7XA 3DXKG 4E47A 3OXFA 3DEPA 4JEHA 1JCRA 4U8YD 5LSXA 3LXUX 2XRZA 1K8KG 5LFAA 4BT9A 2XENA 3Q75A 4U96D 1S63A 1U2VG 3CK8A 4KVMA 4J8SA 1HE8A 3KD7A 1U3CA 4GAAA 2I9CA 5FQ8A 3QC1A 4KYOB 3ASDA 3UX4A 2NYJA 2ZIRA 3AG3E 4GMJA 4RG6A 2VSYA 3GW4A 4WNEA 5F59A 3Q79A 5CBNA 3HXCA 3ULQA 5C1DA 4I51A 4DI4A 1S0PA 3WG7E 2QY7A 4XIFA 4H7YA 4AP2A 2GRRB 1H2UA 4CEMA 2B0OE 2WMOA 3LYAA 2IO3C 3GZ2A 2DBAA 3PZ4A 4GTQA 3SO8A 4Y6WA 4G25A 4FLHA 3UIPC 4PH4B 4WWNA 2GRPB 3R9AB 3QAQA 2XGOA 3W9FA 3RAUA 1D9SA 1HO8A 3IHVA 4GCNA 4J8EA 4J8DA 5HI7A 1FVHA 4BETA 2WMNA 1N0RA 4NACA 1FCHA 2GROB 4IRUA 3B7UX 4ACKA 3RQ4A 3AU4A 1N95A 2P9SG 3D9LA 3FUMA 2BQZA 4FC8A 5EX0A 3GYZA 2LXLA 3L08A 1ELKA 2LO6A 2KXPC 5JHNA 2VSXE 3RO2A 3QK0A 2WQ6A 5TTFA 3FPDA 5G05J 1IQRA 5E76A 1A5EA 3LVRE 4ANVA 5D0OD 3HXFA 4N3BA 3ABKE 2IO2C 4KMOA 4CYMD 5HRYA 4CCAA 4FA6A 4L23A 3JUIA 2R03A 1E8ZA 1MZCA 2A5UA 1N4RA 3UM3A 4XZ4A 3ZXPA 4Z4PA 5HQ8A 2NSZA 5BNWA 3JYSA 1E90A 3SWCA 4QEOA 3G2TA 5CEAA 3LJNA 2GW1A 4A1GA 2W5ZA 1GW6A 4L9PA 5CMWA 3TXNA 3NQPA 4GTRA 1DCEA 1TR4A 3UI2A 3F9ZA 4UWHA 2ZGDA 3CSTA 4G8LA 2DWZA 3BQOA 3FTSA 1N4QA 3FUHA 4YDWA 3NZSA 2BKKB 2HYZA 2WQHA 4GTMA 3OPEA 1OWMA 2BEDA 2AWIA 3TAXA 4XX5A 4EZKA 2WXRA 1KLXA 3T5XA 5T3RA 3PZ2A 3EU5A 2FULA 3SFZA 5KNGA 3AG2E 3APDA 1MVXA 1Q2ZA 4CT4A 3ML9A 4EQFA 1YYHA 3I4GA 4C0MA 4ME2A 5FQ6A 1JWFA 4G1TA 1Y6IA 4H12A 2DZNA 1O1SA 2UWJG 2DIWA 5EILA 1AWCB 4E6HA 3MO0A 4F1PA 1OWOA 3ZNGA 3EHQA 1N3JA 2AXVA 1SA4A 3LY9A 4AY6A 3ASGA 3CVVA 1KT0A 4U63A 4JL0A 4GPKA 1SZAA 4U7EB 2L0IA 3QWVA 3ZHEB 3FUNA 3FH8A 3ASOE 1E7UA 5CPRB 3N71A 5T0KA 4ATZD 3I3NA 3MX3A 1Y8MA 3AAAC 2XQ0A 1KT1A 2V0PA 2LSVA 3RO3A 1HU3A 1G3NB 4CDNA 5KJLA 2V8SE 2NC9A 2UY1A 2HE0A 5ARGA 4D10C 3CHOA 4GZ5A 4FLBA 4LSZE 3FTYA 1BD8A 3E34A 3KAEA 2LXMA 3CR3A 4GZ6A 4A63B 1E8YA 3DPYA 1ZB1A 4GTPA 4GCOA 3F6QA 3ENEA 4FP7A 4GU5A 3E33A 4I6GA 4RSYA 4ZHBA 2EIME 1INZA 3KMTA 3C3QA 3UT4A 4HOQA 1Z6TA 4YVOA 3D9KA 3R9MA 4APFA 3ASFA 3G2VA 5F5EA 3BEEA 3S8PA 4QENA 4A1SA 3ABLE 2DYRE 4B94A 3FUIA 5ENPD 4PDXA 1RW2A 2RG8A 4CZ2D 2CFZA 4HFGA 1UG3A 1OWLA 3MO5A 3C98A 4OYSA 3FU3A 4U0ZA 1ZU2A 1OY3D 2XCBA 4HB5A 3MCXA 2ETAA 4DX7D 4L2YA 2LSUA 4GZ3A 5ENNA 5G04J 3TG5A 1HX8A 5JHBA 3ZIMA 2GRMA 5FZSA 4DX5D 5ITZF 3C5RA 3CEQA 2QYUA 1N0QA 1MJ0A 3B95A 2P2CP 3LJ3A 5LOZA 4DK5A 5D66A 2GRNB 1D8DA 2A5EA 2J4DA 4K5BA 5G2NA 3OXGA 3DSVA 5LP0A 2WXGA 1Z3YA 5BV1A 2F8XK 3UXGA 2H6IA 3UT7A 5BV0A 5FZQA 4MLPA 4U8VD 3DSUA 3ESKA 2PQRA 2H6HA 5T4YA 2X6IA 4URKA 5AYWD 3S7BA 3TWTA 5CRUA 3T8KA 2FEZA 2VGEA 1IYGA 2VQ2A 1N4SA 4LCTA 2JLBA 4J8FA 4HVBA 5T0MA 2KCKA 5FIOA 3LS8A 4TXPA 1EPUA 4I9CA 3T9KA 3CVXA 5LSZA 3DBSA 3B7TA 1W3BA 3T5VA 5BPPA 2J08A 2E0IA 3V2OA 1HXIA 2ZISA 3I5PA 2RKKA 3J5PA 3NZUA 3JQ1A 4ILHB 5EYPF 4JZYA 4UI9K 4EBAA 3MO2A 4N5QA 3TWXA 1TNZA 2WXHA 3QDNA 5JA4D 1JPLA 3U4TA 2CHXA 2V5QC 3SFXA 3RJWA 3PZ3A 4JC8A 1JWGA 3V31A 4CGWA 3IHXA 3FU0A 3V30A 3LPZA 4KZ0A 4HNAD 2L6JA 2P9NG 4QQIA 1H2TC 1FPPA 4UI9J 4HORA 2P9PG 2WXLA 5KCMA 3ZKJA 4JLGA 1NA0A 1S64A 5BUZA 2VGXB 4APOA 3EHRA 4YPEA 4LNUD 5AQAA 4KXKB 3OXLA 3ZN3A 5FINA 5C2YA 3HYMB 2PM7A 3APFA 5B1AE 3TJPA 3TGOA 3C72A 3PUKA 2Y0BG 3KSLA 3UM2A 3DSTA 4XEIG 4DX2A 3RSEG 3L82A 4YDYA 2Q7FA 3ABME 3ZVVA 3ZW3A 4J7IA 4JDSA 1HZ4A 1HS6A 1OUVA 1TN6A 3TL5A 5ANLA 1IQUA 2WXOA 4W9RA 1ZKKA 2ETBA 4B93B 3Q49B 4AIFA 3D9IA 2XEHA 4MI0A 3D3MA 4HRMB 5BXOA 2P9IG 3ZFWA 2XPYA 3D9PA 3QB2A 4GTVA 2LUHA 4G24A 5TEGA 4DUIA 1H6PA 4AJWA 4AY5A 3CVQA 1K3ZD 2KBXA 5ENSD 3TWWA 4EECA 2W5YA 4DLOA 3PNTB 5EDSA 4GTOA 4IULA 2R02A 3KSQA 3PZ1A 3B7RL 3MKQB 3FTUA 3PZDA 3MV2B 5H7PA 2LAIA 5KJMA 4KVOA 1N54A 4EZLA 1O1RA 5F6LA 1MX4A 3DSSA 2ETCA 3FUEA 3IBEA 1MX6A 4U95D 1HFAA 2CHWA 2DVWA 5HS0A 1IKND 4ANXA 2VYIA 5G05C 1D8EA 5J90A 4AV7A 4I2ZA 5JJ0A 3ISMC 3V79K 4YPAA 3VLEA 3FUFA 4WUYA 2QC9A 1TNUA 3FP3A 3AU5A 1MT6A 5LCWJ 3IV0A 1SZ9A 3FU5A 3PEVB 2B6CA 4BY6A 2I2OA 2EIJE 3TWSA 4O1PA 3BG0B 4L2LA 4TRQA 2I6HA 4GTSA 2XHEA 5AQBA 5LCWC 3CSFA 3LEWA 1LD7A 1NA3A 4NQ0A 4TXQA 2V4LA 1DC2A 3MKRA 4IYPA 1E96B 1NP7A 5EX3A 3FULA 2OEWA 3CIAA 5FQ7A 4GB9A 4JD2G 2VSNA 3SI5A 3ZRHA 1Z3XA 3B13A 3UM0A 4U8HA 3DPDA 1MHQA 4N3CA 4AOFA 1DNPA 2DYSE 1UJJA 1SA5A 3U3WA 2X6KA 3JXIA 3M54A 3EJNA 1QYMA 2IONA 5T8IA 4DRXE 5J08A 3NF1A 4JHKA 2JEKA 4ANUA 3CVYA 2YHEA 3UPVA 4I9EA 2WXNA 3RKVA 1TN8A 4Q69A 1NI1A 3EUVA 3GZSA 1N94A 4UQYA 4DLQA 1XGWA 3QJZA 3SZ7A 4ANWA 4YNPA 2X6HA 5D0QD 3ZYKA 4JA7A 3IKOB 4JHRA 1MX2A 2KC7A 2O8JA 2DCPA 2E2EA 4AU7A 1LD8A 4BEPA 5EN5D 2MOWA 3PVLA 4YDEA 2YNQA 2OV8A 2V4HC 2X6JA 3F9WA 4N39A 3CHMA 3CQCB 1JUQA 3D9OA 1Z5SC 2PZIA 5KNHD 3D9JA 2R3AA 3FDHA 3SQVA 2ONDA 2QYJA 1N11A 3TWQA 4EPZA 3HXDA 3CV0A 4WNDA 2RD0A 5AIJA 1L5JA 3E4BA 3KS2A 1TJCA 4Q94A 2WXJA 4LEUA 4JW1A 3EP0A 2GRLA 1E8XA 2NXPA 4HI8A 1YA0A 3UM1A 3L22A 3U66A 3ZYMA 3E37A 3ESLA 3TG4A 4GA2A 5G55A 4J7WA 4PS3A 4I6JA 3UKUG 4B0ZA 3VTYA 3D9MA 1KZOA 4GZCA 3ZYLA 3MV3B 3M55A 2AXZA 3DWLG 2P9KG 3M58A 3FUKA 2XEVA 3NB2A 1N6CA 3CGHA 5KJKA 1TEZA 3HNAA 4FU3A 1IHBA 3RRNB 3KMJA 2L9BA 3CHQA 3SY2A 2DZOA 2WXFA 1BI8B 2CFUA 3Q7FA 4MS6A 5CBOA 1TN7A 3URZA 3U64A 2IGQA 3LY8A 4ILIA 3M57A 3EU9A 5ENRD 2J09A 1ELWA 2Y1LE 1JCSA 3RAYA 4GYWA 3PH0C 2Y3AA 3CKCA 2IU1A 5ENOD 3RIBA 1XNFA 5EG2A 3O4ZA 3PE4A 3MZLB 2BF0X 3AS4A 1WAO1 3M5AA 3FFLA 4HXIA 2G46A 3HVEB 4IJ8A 3SBTB 4M7CA 1PAQA 1DCQA 4LG6A 2EIKE 3LKUA 4RQIA 3QOUA 5E75A 5T5GA 4F53A 1YMPA 3C3RA 2RFAA 2XGMA 2X38A 4YNDA 4BESA 1UN8A 5B3SE 5CECB 5JJ6A 3ZEFA 3ZGQA 4A55A 5FTPA 1ZBPA 2J49A 2WXPA 4FJYA 3M53A 4GA0A 3HG0D 5HKPA 4JXTA 2FI7A 1N6AA 2I1KA 3U9WA 3ZU7B 2J07A 2KATA 3EDTB 3Q47B 4N3AA 5AJLA 2A4ZA 4UUCA 2R17C 1IHGA 3FHEA 3LVQE 3VLDA 3B7SA 2R2LA 3P2BA 3RRUA 4DX6D 3LY7A 4GMRA 4CT0A 4Z68A 3OS5A 3FTWA 2IJGX 3L54A 3AS5A 4LRZA 3QKYA 1HG2A 4BX9A 4AM9A 1WG0A 4XI9A 4WAFA 2F0YA 3FU6A 1X5BA 1SW6A 4GPMA 4CDMA 1PY1A 4JEUA 5DBKA 2J4BA 2YHCA 3FH5A 3SBSA 4RG9A 3UQ3A 4F1SA 4ATGA 3I4RB 4FULA 4BT8A 2RFIA 2VTBB 1NZNA 4BFRA 3O48A 4UI9C 3NOGD 3MA5A 4EHMA 4MBGA 3S7JA 1OT8A 4HLLA 1WY6A 3PEUB 2PNNA 2GRQB 1OXJA 2MYOA 3RJVA 4GYOA 4NRHB 3LCAA 1NL4A 4U0SA 2P58C 3CVLA 4BUPA 3ULYA 3TWRA 4A3TA 4FHKA 2YINA 5JJ7A 3DSWA 3LDZA 3SGHA 3AG4E 4FADA 2KZTA 5FWQA 4GA1A 1JCQA 2IOSA 5BT1A 1MVHA 2WXMA 1YCSB 3CVPA 4YPUA 4GZDA 2Y4TA 5FQ4A 2PQNA 3KEAA 4IJDA 3QNKA 2LNIA 1SQMA 2CG2A 4UWFA 3FUDA 3L9TA 4BERA 2CG3A 4TUUA 5DIZA 1H3IA 2FBNA 4DX1A 2JABA 4K03A 3DALA 2IY0C 3FY4A 3AG1E 4N2SA 4QEPA 2C2LA 2BTDA 4PS8A 1MUFA 4I1MA 3ZXSA 3DXMG 2WPVA 2KCLA 2PL2A 2AW6A 2Y4UA 3M56A 2R59A 3KEZA 1MQSA 2OOEA 3CQGB 4L1BA 4DPRA 1PC2A 4A3VA 3ZHEA 5EIDA 3DSXA 1MYOA 5CHEE 2J9QA 2XZTG 3ONKA 3EHMA 4G26A 3HVEA 4PUCA 4OVVA 5KJNA 2FF4A 3VV0A 2WXKA 4M3OA 4UWLA 3M59A 3FTZA 5A7DB 4J8OA 2BUGA 3CVNA 4R7LA 1ML9A 2OVBA 1O5MA 4KZCA 4BTAA 2HM8A 4TXRA 5EYLA 4OAUC 4RVBA 2XGSA 4HOUA 3CHSA 4BSZB 3WXXA 3CVWA 2XPZA 1FT2A 3FTVA 3Q78A 5JINA 3DEOA 1UJKA 2KCVA 1XQHA 5A23A 3TWUA 4UWKA 3BO5A 1U3DA 3RK6A 2H6GA 3VLFA 1FT1A 4NURA 5ENTD 3SFYA 4I1OB 4E85A 4JPSA 2C0LA 3ZUVB 4J6IA 4EBAG 4UWGA 4G8KA 1B89A 4XKBA 3IXEA 4HLEA 4JVSA 1E7VA 1OWPA 4FJZA 1QNFA 4GMLA 3DB5A 4N5CA 4I2WA 2RFMA 5D2MC 4XKCA 4RLYA 3EHNA 4HQDA 3CK9A 5JMND 5ANRA 4L7TA 3QWWA 4HBDA 3MGBA 1QQEA 3SW9A 3K5KA 3L17A 3PE3A 2EQXA 2R05A 4B89A 3CBOA 5G04C 4C48B 3HRAA 5CCLA 4K5AB 2WB2A 1EYHA 2C0MA 4J7FA 3SHFA 1IXVA 2XPIA 4JHJA 4X8QA 1OCOE 1UN9A 3D9HA 1N52A 1HG5A 2ZU6B 4ACLA 4QFVA 3RRMB 3V2XA 3W9GA 3L6AA 5FJYA 1SVXA 3Q9UC 2LAHA 4I1AA 3RU0A 4YDOA 3Q73A 2IFUA 3Q7AA 3HHMA 2ZXWE 4ABNA 3Q4AB 4BTBA 2OVFA 3CBPA 4LUNU 1KPSB 1K1AA 2H6FA 3QARA 3VUZA 2MRIA 2VGYA 2UY1B 1HH8A 4ILGA 4B8CB 1NFIE 3FEXA 3P1UA 2F8YA 4J0UA 2AXUA 1EF1C 5FZRA 5ENQD 2WXQA 4HI9A 2KM4A 4U0UA 2WVIA 4HRNA 5M72A 5AJDA 1S70B 3OAWA 4O60A 5AENA 3JUEA 4I6EA 2WM9A 3UINC 2IF4A 5JJTA 3BG1B 3ASHA 1H19A 4K5CA 3OOIA 3UTMA 2QPWA 4J83A 3S2AA 1OCZE 2J8SD 3SF4A 1BU9A 4ZFHA 3E30A 3DRAA 4HOTA 4MRUA 3EIJA 1OCCE 2XS1A 5AYFA 4U07A 2XZDG 4YNMA 1TJFA 2P9UG 3SNXA 1O9SA 3X2QE 2EINE 3MKQA 4EZJA 4Q96A 4O1OA 1BPOA 2M63A 4LERA 1PEGA 5KWDA 3BUAA 3FWVA 3JCKC 1DVPA 3Q9NC 2VTBA 1VDYA 4V3IA 1HF8A 5B1BE 4LNBA 3GZ1A 4LDGA 5CCMA 2VGXA 2HR2A 1V54E 3FH7A 4WNGA 3CKBA 2CHZA 5A6CA 1K1BA 3NBNB 1TNYA 2X6FA 2XRYA 4GTTA 4CGVA 4OVUA 2IOLA 1N9AA 3PREA 1EDUA 3FUJA 3ZYQA 4KBQA 5AQ9A 3ONLA 4FHJA 4MI5A 3CBMA 3S7DA 1QZ2A 4G11A 3UMVA 4UQXA 1P5QA 2ZGGA 5ARFA 1H6KA 3PNLB 3UKRG 4N2QA 3R7QA 3IHYA 4P29A 3PS6A 1TNOA 4WWPA 2GGFA 3T8MA 1WM5A 4TUMA 1LTXA 5JIYA 3G2UA 4I17A 4AEZC 1LF8A 2EILE 3MEKA 4C1QA 3FEYA 1UOHA 3TWVA 4U04A 4HS2A 2X3MA 5EKQD 3ZPJA 5AQ7A 2AJAA 1AP7A 5EIBE 3S7FA 4HRLA 4G23A 4BWRA 4O30A 3UT8A 5AAOA 5CEDB 4F3VA 1BLXB 1TYQG 2IQCA 4LNGA 3BU8A 4MKTA 1WDYA 5AARA 5BW8C 3TXMA 4DI3A 1TNBA 2F37A 2MHKA 2OCCE 4NVQA 2QFCA 3HIZA 3UIOC 3VTXA 4CDRA 1H0AA 2Y69E 3AJIA 3JQ0A 5KBAA 1N4PA 4PS7A 1E8WA 1H6OA 1X81A 4G2VA 1OCRE 3MYVA 3Q15A 4F7AA 2PM6A 4O6FA 3E32A 1OWNA 1O1TA 3ULEG 3ML8A 1UW4B 3CHPA 4DJAA 3B7BA 4WNFA 4YVQC 5IY5E 4CRWA 3CHRA 2L0TB 3UUXA 2YQ8A 5CRVA 3PRZA 4C0EA 5JHAA 2WQ7A 3HDXA 4KT6B 4BX8A 3Q5MA 3CK7A 4AXHA 1V55E 2FO7A 2F69A 4JA9A 2BKGA 2ILRA 3NAWA 4IN3B 5LX8A 4OAVB 3R7RA 3SD5A 4K0RA 3ASNE 1H2VC 3MJWA 3AS8A 3NOCD 4NIKA 2I1JA 3HXBA 1RZ4A 5F6KC 4TV3A 3IEGA 3L13A 1BI7B 3CVUA 2XCCA 5AN8A 5CMYA 2HO1A 3G2SA 4FMUA 4J8YA 4JB8P 3HXEA 2KZTB 4GYYA 2AVPA 2WXIA 3EIQC 4XI0A 3KMAA 2XEEA 3J5QB 2QZAA 5BXUA 1KZPA 3K9IA 5FT9A 3L16A 2VSOE 2R5SA 3C3OA 4UQZA 4I43A 3G2WA 2V5FA 3D9NA 2JV0A 4F6RD 5CERB 3F9XA
chains in the Genus database with same CATH topology
3U66A 4XKCA 3ZYMA 3EHNA 1A17A 3ESLA 3TG4A 4GA2A 5G55A 3CK9A 5ANRA 4PS3A 3LJ3A 4L7TA 5LOZA 4DK5A 4B8AA 4I6JA 3PUJA 3PDNA 4AVXA 3QWWA 3MGBA 1QQEA 2J4DA 5G2NA 4B0ZA 3OXGA 3VTYA 1ELRA 3D9MA 3SW9A 3K5KA 1FVFA 4WWOA 3APCA 5LP0A 2WXGA 3L17A 4GZCA 3F9YA 3ZYLA 4BSXA 3MV3B 3PE3A 1Z3YA 2EQXA 2AXZA 4B89A 5BV1A 3CBOA 4HOSA 3M55A 5G04C 4XE0A 4NJ5A 4C9BB 4Y6CA 3M58A 4RZ0A 3FTXA 5CCLA 3UT7A 5BV0A 3FUKA 5TH7A 2XEVA 5FZQA 2VJ8A 1N6CA 3CLJA 4MLPA 2WB2A 1EYHA 3QWPA 2C0MA 3CGHA 5KJKA 4J7FA 1TEZA 3HNAA 3OTNA 4FU3A 3SHFA 4JHJA 2XPIA 4H7XA 3ESKA 1UN9A 2PQRA 1N52A 4E47A 5T4YA 3OXFA 1HG5A 2X6IA 4JEHA 4URKA 2ZU6B 3RRNB 3KMJA 2L9BA 5AYWD 4ACLA 3S7BA 5LSXA 4QFVA 3CHQA 2FEZA 3RRMB 2WXFA 3L6AA 2CFUA 3LXUX 5FJYA 1IYGA 2XRZA 4MS6A 2VQ2A 5LFAA 2LAHA 4I1AA 4LCTA 3RU0A 2JLBA 4J8FA 4BT9A 3URZA 4HVBA 3U64A 2IGQA 3LY8A 2KCKA 4ILIA 5T0MA 3M57A 3LS8A 2J09A 2IFUA 1ELWA 3CK8A 1EPUA 4KVMA 4I9CA 3RAYA 4GYWA 3CVXA 3HHMA 2Y3AA 3PH0C 3CKCA 1HE8A 2IU1A 4J8SA 3KD7A 1U3CA 4GAAA 3DBSA 3RIBA 5LSZA 1XNFA 3B7TA 4ABNA 3Q4AB 1W3BA 4BTBA 2OVFA 3T5VA 5BPPA 3CBPA 2J08A 2I9CA 2E0IA 5EG2A 1HXIA 3O4ZA 3PE4A 5FQ8A 3QC1A 4KYOB 4LUNU 3I5PA 3ASDA 3UX4A 3MZLB 2BF0X 3AS4A 1WAO1 3NZUA 3QARA 3M5AA 3VUZA 3FFLA 4GMJA 2MRIA 4HXIA 2G46A 3HVEB 3JQ1A 4ILHB 4RG6A 2VGYA 4JZYA 4UI9K 4EBAA 3MO2A 4IJ8A 2UY1B 2VSYA 3GW4A 3SBTB 4WNEA 5F59A 1HH8A 4ILGA 4B8CB 1PAQA 3ULQA 2WXHA 3FEXA 3P1UA 3QDNA 3LKUA 5C1DA 1JPLA 3U4TA 2CHXA 4I51A 4DI4A 3QOUA 4J0UA 1S0PA 5E75A 5T5GA 4F53A 4YNDA 2QY7A 2AXUA 2XGMA 1EF1C 2X38A 4XIFA 1UN8A 5FZRA 3RJWA 4JC8A 1JWGA 5JJ6A 4H7YA 3ZEFA 2WXQA 3ZGQA 4CGWA 3IHXA 3FU0A 4A55A 2KM4A 5FTPA 1ZBPA 4AP2A 4U0UA 2J49A 2WVIA 2WXPA 4FJYA 3LPZA 5M72A 3M53A 4GA0A 4KZ0A 1H2UA 5AJDA 4CEMA 2L6JA 4JXTA 3OAWA 2FI7A 5AENA 2WMOA 4I6EA 2WM9A 3LYAA 2IF4A 1H2TC 1N6AA 2I1KA 3GZ2A 2DBAA 3U9WA 5JJTA 4UI9J 2J07A 2KATA 3EDTB 4Y6WA 4G25A 4FLHA 3BG1B 3Q47B 4HORA 4N3AA 2WXLA 3ASHA 4PH4B 4WWNA 5KCMA 3R9AB 1H19A 3QAQA 4JLGA 5AJLA 3OOIA 2XGOA 1NA0A 2A4ZA 2QPWA 2R17C 5BUZA 2VGXB 4J83A 3S2AA 4APOA 1HO8A 3IHVA 4YPEA 3SF4A 4GCNA 4J8EA 1IHGA 3FHEA 4J8DA 4KXKB 3LVQE 3OXLA 3VLDA 3ZN3A 3B7SA 5C2YA 3P2BA 3RRUA 3HYMB 2PM7A 3APFA 3LY7A 5HI7A 1FVHA 4HOTA 2WMNA 4MRUA 3TJPA 3TGOA 3PUKA 4NACA 4CT0A 1FCHA 4IRUA 3B7UX 3EIJA 4ACKA 3OS5A 3FTWA 2Q7FA 3RQ4A 2IJGX 3L54A 3AU4A 3ZVVA 3ZW3A 4J7IA 4JDSA 5AYFA 1HZ4A 1OUVA 1HS6A 3D9LA 3FUMA 3AS5A 4FC8A 4U07A 2BQZA 4LRZA 3TL5A 3QKYA 5ANLA 5EX0A 1HG2A 1TJFA 3GYZA 1IQUA 4YNMA 3SNXA 1O9SA 4BX9A 2WXOA 3L08A 3MKQA 1ELKA 2LO6A 4AM9A 4EZJA 4XI9A 4W9RA 4WAFA 4Q96A 1ZKKA 3FU6A 5JHNA 3Q49B 2VSXE 1X5BA 1BPOA 3RO2A 3QK0A 2M63A 4LERA 4AIFA 3D9IA 4MI0A 4CDMA 1PEGA 1PY1A 4JEUA 5DBKA 2J4BA 2YHCA 3FH5A 3D3MA 2WQ6A 5TTFA 3FPDA 3FWVA 4RG9A 5G05J 3SBSA 3JCKC 1DVPA 3UQ3A 4F1SA 1IQRA 2VTBA 1VDYA 3I4RB 5E76A 4V3IA 3LVRE 4FULA 4ATGA 1HF8A 4BT8A 3ZFWA 4ANVA 5D0OD 3GZ1A 2XPYA 2RFIA 4LDGA 2VTBB 5CCMA 2VGXA 3D9PA 1NZNA 2HR2A 4N3BA 3FH7A 3QB2A 4BFRA 3O48A 4WNGA 4KMOA 4G24A 4UI9C 5TEGA 3CKBA 2CHZA 4CCAA 4FA6A 5A6CA 4L23A 3JUIA 3MA5A 4AJWA 4AY5A 1E8ZA 2A5UA 2X6FA 3CVQA 4XZ4A 2XRYA 4EECA 3S7JA 2W5YA 4DLOA 4Z4PA 4CGVA 3PNTB 4OVUA 5EDSA 5HQ8A 2NSZA 2IOLA 1WY6A 3PEUB 3PREA 4IULA 3B7RL 1EDUA 3MKQB 5BNWA 3FUJA 3ZYQA 3JYSA 3FTUA 4KBQA 1E90A 3SWCA 3PZDA 3MV2B 4QEOA 3ONLA 3G2TA 2LAIA 2GW1A 3RJVA 5KJMA 4FHJA 4A1GA 2W5ZA 4MI5A 4KVOA 4GYOA 3CBMA 1GW6A 3S7DA 4NRHB 3LCAA 4U0SA 1QZ2A 5CMWA 4G11A 3NQPA 3TXNA 3UMVA 2P58C 3CVLA 4UQXA 4BUPA 1P5QA 1N54A 4A3TA 4FHKA 2YINA 5ARFA 5JJ7A 1H6KA 3F9ZA 4UWHA 3PNLB 3LDZA 3SGHA 3CSTA 4N2QA 3R7QA 4EZLA 4FADA 3IHYA 4P29A 3FTSA 2KZTA 5FWQA 3FUHA 4GA1A 5F6LA 3NZSA 3PS6A 3FUEA 2HYZA 4WWPA 2IOSA 2GGFA 2WQHA 3IBEA 3T8MA 5BT1A 1WM5A 1MVHA 3OPEA 1OWMA 2WXMA 2AWIA 3TAXA 1HFAA 3CVPA 4YPUA 4XX5A 4EZKA 2CHWA 4GZDA 2WXRA 5JIYA 4ANXA 3G2UA 2VYIA 1KLXA 4I17A 5G05C 1LF8A 2Y4TA 5T3RA 5FQ4A 3T5XA 4AEZC 2PQNA 5J90A 3MEKA 4AV7A 4C1QA 2FULA 3FEYA 4IJDA 3QNKA 3SFZA 4I2ZA 5JJ0A 3APDA 4U04A 2LNIA 1MVXA 4YPAA 4HS2A 1SQMA 3VLEA 3FUFA 2X3MA 2CG2A 4WUYA 5EKQD 3ML9A 3ZPJA 4CT4A 4UWFA 4EQFA 3FUDA 3FP3A 3I4GA 4C0MA 3S7FA 3AU5A 1MT6A 2CG3A 4ME2A 5FQ6A 4G23A 1JWFA 4G1TA 4TUUA 4BWRA 1Y6IA 4O30A 4H12A 5DIZA 1H3IA 3UT8A 2FBNA 5LCWJ 3IV0A 1SZ9A 2UWJG 3FU5A 3PEVB 2DIWA 4F3VA 4K03A 4BY6A 3DALA 2I2OA 3FY4A 4QEPA 4N2SA 3MO0A 4E6HA 3L22A 2C2LA 2BTDA 1OWOA 2IQCA 4MKTA 4PS8A 1N3JA 2AXVA 1MUFA 4I1MA 3LY9A 5BW8C 3BG0B 4L2LA 2MHKA 4TRQA 3TXMA 3ZXSA 3ASGA 4DI3A 3CVVA 1KT0A 4AY6A 2I6HA 2WPVA 2KCLA 4U63A 4NVQA 4JL0A 2XHEA 4GPKA 1SZAA 2PL2A 3CSFA 3LEWA 5LCWC 2L0IA 2QFCA 3HIZA 1NA3A 3QWVA 4NQ0A 2AW6A 2Y4UA 3VTXA 3M56A 2R59A 2V4LA 3KEZA 3ZHEB 1MQSA 4CDRA 3FUNA 1H0AA 3MKRA 3JQ0A 2OOEA 4IYPA 4PS7A 1E8WA 3CQGB 3FH8A 4G2VA 4L1BA 1E96B 4DPRA 1NP7A 1E7UA 1PC2A 3MYVA 5CPRB 3N71A 5EX3A 3FULA 5T0KA 3Q15A 3CIAA 5FQ7A 3I3NA 3MX3A 4GB9A 3SI5A 2VSNA 4F7AA 1Y8MA 2PM6A 3ZRHA 4A3VA 1Z3XA 3B13A 2XQ0A 2V0PA 1KT1A 4O6FA 3ZHEA 4U8HA 3DPDA 2LSVA 3RO3A 1OWNA 1HU3A 1MHQA 5CHEE 4N3CA 4AOFA 4CDNA 1DNPA 2J9QA 5KJLA 1UJJA 2V8SE 3ONKA 2NC9A 3U3WA 2X6KA 2UY1A 3M54A 3EHMA 4G26A 3ML8A 5ARGA 4D10C 3HVEA 3CHOA 3EJNA 4GZ5A 2IONA 4PUCA 4FLBA 4OVVA 1UW4B 2FF4A 5KJNA 3CHPA 3FTYA 5T8IA 4DJAA 3KAEA 4WNFA 4YVQC 3VV0A 3CR3A 4GZ6A 4CRWA 2WXKA 3CHRA 2L0TB 4M3OA 3UUXA 1E8YA 2YQ8A 5J08A 3NF1A 4JHKA 2JEKA 4UWLA 4ANUA 3M59A 3PRZA 4GCOA 4C0EA 5JHAA 2WQ7A 2YHEA 3HDXA 3CVYA 3FTZA 3ENEA 4KT6B 4BX8A 3Q5MA 3UPVA 4I9EA 4FP7A 4GU5A 3CK7A 4AXHA 5A7DB 4J8OA 2BUGA 2WXNA 4I6GA 2FO7A 3RKVA 3CVNA 4R7LA 2F69A 4Q69A 4JA9A 4RSYA 3GZSA 2ILRA 4IN3B 1INZA 4UQYA 3KMTA 4DLQA 1ML9A 5LX8A 2OVBA 3UT4A 4HOQA 1XGWA 3QJZA 4KZCA 1Z6TA 3R7RA 4BTAA 4YVOA 3SD5A 2HM8A 3SZ7A 4ANWA 3D9KA 4K0RA 4YNPA 4RVBA 2X6HA 2XGSA 4HOUA 5D0QD 3ZYKA 1H2VC 3CHSA 3AS8A 3MJWA 4JA7A 3IKOB 2I1JA 4APFA 4JHRA 3ASFA 3G2VA 3WXXA 2KC7A 2O8JA 5F5EA 2DCPA 3BEEA 3CVWA 2XPZA 2E2EA 3S8PA 4AU7A 4QENA 4A1SA 3FTVA 5F6KC 5JINA 2MOWA 3PVLA 4TV3A 4B94A 3FUIA 1UJKA 2KCVA 1XQHA 3IEGA 4PDXA 2RG8A 2CFZA 4HFGA 5A23A 3L13A 3CVUA 2XCCA 2YNQA 5CMYA 1UG3A 2OV8A 2HO1A 3G2SA 1OWLA 4FMUA 3MO5A 3C98A 4OYSA 2X6JA 3FU3A 4UWKA 4N39A 2KZTB 3BO5A 3F9WA 3CHMA 4U0ZA 3CQCB 1U3DA 1JUQA 4GYYA 3RK6A 1ZU2A 2AVPA 2XCBA 3VLFA 3D9OA 2WXIA 3EIQC 3MCXA 2PZIA 4NURA 4XI0A 4I1OB 3D9JA 2R3AA 4E85A 3FDHA 4JPSA 3KMAA 2C0LA 3K9IA 5FT9A 2ONDA 3L16A 4J6IA 2VSOE 4L2YA 2R5SA 2LSUA 4UWGA 4EBAG 1B89A 4EPZA 4UQZA 3CV0A 4XKBA 4WNDA 4HLEA 4JVSA 2RD0A 4GZ3A 1E7VA 1OWPA 4FJZA 4I43A 3G2WA 2V5FA 5AIJA 1L5JA 3E4BA 5ENNA 5G04J 1HX8A 3KS2A 3TG5A 1TJCA 1QNFA 3D9NA 4Q94A 5JHBA 2JV0A 4GMLA 3DB5A 3ZIMA 2WXJA 4LEUA 4JW1A 2GRMA 5FZSA 3EP0A 2GRLA 1E8XA 4N5CA 2NXPA 3F9XA 4I2WA 1YA0A 3CEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A17 A;  3TG4 A;  4GA2 A;  3CK9 A;  3PDN A;  3QWW A;  1QQE A;  3OXG A;  3VTY A;  1ELR A;  3SW9 A;  3K5K A;  3F9Y A;  3MV3 B;  3PE3 A;  3M55 A;  3CBO A;  4HOS A;  5G04 C;  4NJ5 A;  4Y6C A;  3M58 A;  4RZ0 A;  5CCL A;  5TH7 A;  2XEV A;  5FZQ A;  1N6C A;  3QWP A;  2C0M A;  5KJK A;  4J7F A;  3HNA A;  2XPI A;  4H7X A;  3ESK A;  2PQR A;  4E47 A;  3OXF A;  3KMJ A;  5AYW D;  3S7B A;  5LSX A;  2FEZ A;  5FJY A;  1IYG A;  2VQ2 A;  4I1A A;  3RU0 A;  2JLB A;  4J8F A;  4BT9 A;  3URZ A;  2IGQ A;  5T0M A;  3LY8 A;  2KCK A;  3M57 A;  2IFU A;  1ELW A;  3CK8 A;  4I9C A;  3RAY A;  4GYW A;  3CKC A;  3KD7 A;  5LSZ A;  3RIB A;  1XNF A;  4ABN A;  3Q4A B;  1W3B A;  4BTB A;  3CBP A;  5EG2 A;  1HXI A;  3PE4 A;  4KYO B;  3ASD A;  3AS4 A;  1WAO 1;  3M5A A;  3VUZ A;  3FFL A;  2G46 A;  4RG6 A;  2VGY A;  4UI9 K;  3MO2 A;  4IJ8 A;  2UY1 B;  2VSY A;  3GW4 A;  4WNE A;  5F59 A;  1HH8 A;  3ULQ A;  3QDN A;  3LKU A;  5C1D A;  3U4T A;  4I51 A;  5T5G A;  3QOU A;  4J0U A;  4YND A;  2XGM A;  4XIF A;  5FZR A;  3RJW A;  5JJ6 A;  4H7Y A;  3ZGQ A;  4CGW A;  3IHX A;  5FTP A;  1ZBP A;  4U0U A;  5M72 A;  3LPZ A;  3M53 A;  4GA0 A;  2L6J A;  2FI7 A;  3LYA A;  2IF4 A;  1N6A A;  5JJT A;  3GZ2 A;  2DBA A;  4UI9 J;  2KAT A;  3EDT B;  4Y6W A;  4G25 A;  3Q47 B;  4HOR A;  4N3A A;  3ASH A;  3R9A B;  4JLG A;  3OOI A;  2XGO A;  1NA0 A;  2QPW A;  2VGX B;  4J83 A;  4APO A;  4YPE A;  3SF4 A;  4GCN A;  4J8E A;  1IHG A;  4J8D A;  4KXK B;  3OXL A;  3ZN3 A;  3HYM B;  3LY7 A;  5HI7 A;  4HOT A;  3TGO A;  1FCH A;  3OS5 A;  2Q7F A;  3RQ4 A;  4J7I A;  4JDS A;  5AYF A;  1HZ4 A;  1OUV A;  4U07 A;  2BQZ A;  3AS5 A;  3QKY A;  5EX0 A;  4YNM A;  3GYZ A;  1O9S A;  4AM9 A;  4XI9 A;  4W9R A;  1ZKK A;  5JHN A;  3Q49 B;  3RO2 A;  4AIF A;  4MI0 A;  1PEG A;  5DBK A;  2YHC A;  5TTF A;  3FPD A;  3FWV A;  4RG9 A;  5G05 J;  3UQ3 A;  4BT8 A;  3ZFW A;  5D0O D;  3GZ1 A;  2RFI A;  4LDG A;  5CCM A;  2VGX A;  1NZN A;  2HR2 A;  4N3B A;  3O48 A;  4WNG A;  4G24 A;  4UI9 C;  5TEG A;  3CKB A;  5A6C A;  3MA5 A;  4AY5 A;  3CVQ A;  3S7J A;  2W5Y A;  4Z4P A;  4CGV A;  5HQ8 A;  5BNW A;  3JYS A;  4KBQ A;  3SWC A;  3MV2 B;  4QEO A;  3RJV A;  2GW1 A;  5KJM A;  2W5Z A;  4MI5 A;  3CBM A;  4GYO A;  3S7D A;  4NRH B;  3LCA A;  4U0S A;  1QZ2 A;  2P58 C;  3CVL A;  4UQX A;  4BUP A;  1P5Q A;  5ARF A;  5JJ7 A;  3F9Z A;  4N2Q A;  4GA1 A;  5F6L A;  2HYZ A;  5BT1 A;  2WQH A;  1WM5 A;  1MVH A;  3OPE A;  3TAX A;  3CVP A;  4YPU A;  5JIY A;  2VYI A;  1KLX A;  4I17 A;  5G05 C;  2Y4T A;  2PQN A;  3MEK A;  4C1Q A;  4IJD A;  4I2Z A;  5JJ0 A;  4U04 A;  2LNI A;  1MVX A;  4YPA A;  4WUY A;  5EKQ D;  3ZPJ A;  4EQF A;  3FP3 A;  3S7F A;  1MT6 A;  4ME2 A;  4G23 A;  4G1T A;  4BWR A;  4O30 A;  4H12 A;  5DIZ A;  1H3I A;  2FBN A;  5LCW J;  2UWJ G;  4F3V A;  3DAL A;  4QEP A;  4N2S A;  3MO0 A;  2C2L A;  1N3J A;  1MUF A;  5BW8 C;  3LY9 A;  2MHK A;  4AY6 A;  3ASG A;  1KT0 A;  2I6H A;  2WPV A;  2KCL A;  4NVQ A;  4JL0 A;  4GPK A;  5LCW C;  2PL2 A;  2QFC A;  1NA3 A;  3QWV A;  4NQ0 A;  2Y4U A;  3VTX A;  3M56 A;  3ZHE B;  4CDR A;  3MKR A;  2OOE A;  4G2V A;  1E96 B;  1PC2 A;  5CPR B;  3N71 A;  5EX3 A;  5T0K A;  3Q15 A;  2VSN A;  1Y8M A;  4O6F A;  1KT1 A;  3ZHE A;  2LSV A;  3RO3 A;  5CHE E;  4N3C A;  2J9Q A;  5KJL A;  2NC9 A;  3U3W A;  2UY1 A;  3M54 A;  4G26 A;  5ARG A;  4GZ5 A;  5KJN A;  2FF4 A;  3KAE A;  4WNF A;  4YVQ C;  3VV0 A;  4GZ6 A;  3UUX A;  2YQ8 A;  3NF1 A;  3M59 A;  4GCO A;  3UPV A;  3Q5M A;  4I9E A;  3CK7 A;  5A7D B;  4J8O A;  2BUG A;  2FO7 A;  3RKV A;  3CVN A;  2F69 A;  4JA9 A;  4IN3 B;  4UQY A;  3KMT A;  1ML9 A;  4HOQ A;  4BTA A;  4YVO A;  3SZ7 A;  4YNP A;  5D0Q D;  2XGS A;  4HOU A;  3AS8 A;  4JA7 A;  4JHR A;  3ASF A;  3WXX A;  2KC7 A;  2O8J A;  5F5E A;  3BEE A;  2E2E A;  3S8P A;  4AU7 A;  4QEN A;  4A1S A;  5F6K C;  5JIN A;  4B94 A;  2KCV A;  1XQH A;  3IEG A;  2XCC A;  2HO1 A;  4FMU A;  3MO5 A;  3F9W A;  4N39 A;  3BO5 A;  4U0Z A;  4GYY A;  1ZU2 A;  2AVP A;  2XCB A;  2PZI A;  4XI0 A;  2R3A A;  3KMA A;  2C0L A;  3K9I A;  5FT9 A;  2OND A;  2R5S A;  2LSU A;  1B89 A;  4UQZ A;  3CV0 A;  4WND A;  4GZ3 A;  2V5F A;  3E4B A;  5G04 J;  3TG5 A;  3KS2 A;  1TJC A;  2JV0 A;  3DB5 A;  4LEU A;  5FZS A;  3EP0 A;  4N5C A;  3F9X A;  4I2W A;  1YA0 A;  3CEQ A; 
#chains in the Genus database with same CATH topology
 1A17 A;  2L6B A;  4B8A A;  2OEV A;  3PUJ A;  3PDN A;  4AVX A;  1ELR A;  2IEJ A;  1FVF A;  4WWO A;  3APC A;  3F9Y A;  2P9L G;  4BSX A;  3JXJ A;  4HOS A;  2FO1 E;  4XE0 A;  4NJ5 A;  4C9B B;  4Y6C A;  4RZ0 A;  2XS8 A;  3FTX A;  5TH7 A;  2VJ8 A;  3CLJ A;  3QWP A;  1QBQ A;  3OTN A;  4H7X A;  3DXK G;  4E47 A;  3OXF A;  3DEP A;  4JEH A;  1JCR A;  4U8Y D;  5LSX A;  3LXU X;  2XRZ A;  1K8K G;  5LFA A;  4BT9 A;  2XEN A;  3Q75 A;  4U96 D;  1S63 A;  1U2V G;  3CK8 A;  4KVM A;  4J8S A;  1HE8 A;  3KD7 A;  1U3C A;  4GAA A;  2I9C A;  5FQ8 A;  3QC1 A;  4KYO B;  3ASD A;  3UX4 A;  2NYJ A;  2ZIR A;  3AG3 E;  4GMJ A;  4RG6 A;  2VSY A;  3GW4 A;  4WNE A;  5F59 A;  3Q79 A;  5CBN A;  3HXC A;  3ULQ A;  5C1D A;  4I51 A;  4DI4 A;  1S0P A;  3WG7 E;  2QY7 A;  4XIF A;  4H7Y A;  4AP2 A;  2GRR B;  1H2U A;  4CEM A;  2B0O E;  2WMO A;  3LYA A;  2IO3 C;  3GZ2 A;  2DBA A;  3PZ4 A;  4GTQ A;  3SO8 A;  4Y6W A;  4G25 A;  4FLH A;  3UIP C;  4PH4 B;  4WWN A;  2GRP B;  3R9A B;  3QAQ A;  2XGO A;  3W9F A;  3RAU A;  1D9S A;  1HO8 A;  3IHV A;  4GCN A;  4J8E A;  4J8D A;  5HI7 A;  1FVH A;  4BET A;  2WMN A;  1N0R A;  4NAC A;  1FCH A;  2GRO B;  4IRU A;  3B7U X;  4ACK A;  3RQ4 A;  3AU4 A;  1N95 A;  2P9S G;  3D9L A;  3FUM A;  2BQZ A;  4FC8 A;  5EX0 A;  3GYZ A;  2LXL A;  3L08 A;  1ELK A;  2LO6 A;  2KXP C;  5JHN A;  2VSX E;  3RO2 A;  3QK0 A;  2WQ6 A;  5TTF A;  3FPD A;  5G05 J;  1IQR A;  5E76 A;  1A5E A;  3LVR E;  4ANV A;  5D0O D;  3HXF A;  4N3B A;  3ABK E;  2IO2 C;  4KMO A;  4CYM D;  5HRY A;  4CCA A;  4FA6 A;  4L23 A;  3JUI A;  2R03 A;  1E8Z A;  1MZC A;  2A5U A;  1N4R A;  3UM3 A;  4XZ4 A;  3ZXP A;  4Z4P A;  5HQ8 A;  2NSZ A;  5BNW A;  3JYS A;  1E90 A;  3SWC A;  4QEO A;  3G2T A;  5CEA A;  3LJN A;  2GW1 A;  4A1G A;  2W5Z A;  1GW6 A;  4L9P A;  5CMW A;  3TXN A;  3NQP A;  4GTR A;  1DCE A;  1TR4 A;  3UI2 A;  3F9Z A;  4UWH A;  2ZGD A;  3CST A;  4G8L A;  2DWZ A;  3BQO A;  3FTS A;  1N4Q A;  3FUH A;  4YDW A;  3NZS A;  2BKK B;  2HYZ A;  2WQH A;  4GTM A;  3OPE A;  1OWM A;  2BED A;  2AWI A;  3TAX A;  4XX5 A;  4EZK A;  2WXR A;  1KLX A;  3T5X A;  5T3R A;  3PZ2 A;  3EU5 A;  2FUL A;  3SFZ A;  5KNG A;  3AG2 E;  3APD A;  1MVX A;  1Q2Z A;  4CT4 A;  3ML9 A;  4EQF A;  1YYH A;  3I4G A;  4C0M A;  4ME2 A;  5FQ6 A;  1JWF A;  4G1T A;  1Y6I A;  4H12 A;  2DZN A;  1O1S A;  2UWJ G;  2DIW A;  5EIL A;  1AWC B;  4E6H A;  3MO0 A;  4F1P A;  1OWO A;  3ZNG A;  3EHQ A;  1N3J A;  2AXV A;  1SA4 A;  3LY9 A;  4AY6 A;  3ASG A;  3CVV A;  1KT0 A;  4U63 A;  4JL0 A;  4GPK A;  1SZA A;  4U7E B;  2L0I A;  3QWV A;  3ZHE B;  3FUN A;  3FH8 A;  3ASO E;  1E7U A;  5CPR B;  3N71 A;  5T0K A;  4ATZ D;  3I3N A;  3MX3 A;  1Y8M A;  3AAA C;  2XQ0 A;  1KT1 A;  2V0P A;  2LSV A;  3RO3 A;  1HU3 A;  1G3N B;  4CDN A;  5KJL A;  2V8S E;  2NC9 A;  2UY1 A;  2HE0 A;  5ARG A;  4D10 C;  3CHO A;  4GZ5 A;  4FLB A;  4LSZ E;  3FTY A;  1BD8 A;  3E34 A;  3KAE A;  2LXM A;  3CR3 A;  4GZ6 A;  4A63 B;  1E8Y A;  3DPY A;  1ZB1 A;  4GTP A;  4GCO A;  3F6Q A;  3ENE A;  4FP7 A;  4GU5 A;  3E33 A;  4I6G A;  4RSY A;  4ZHB A;  2EIM E;  1INZ A;  3KMT A;  3C3Q A;  3UT4 A;  4HOQ A;  1Z6T A;  4YVO A;  3D9K A;  3R9M A;  4APF A;  3ASF A;  3G2V A;  5F5E A;  3BEE A;  3S8P A;  4QEN A;  4A1S A;  3ABL E;  2DYR E;  4B94 A;  3FUI A;  5ENP D;  4PDX A;  1RW2 A;  2RG8 A;  4CZ2 D;  2CFZ A;  4HFG A;  1UG3 A;  1OWL A;  3MO5 A;  3C98 A;  4OYS A;  3FU3 A;  4U0Z A;  1ZU2 A;  1OY3 D;  2XCB A;  4HB5 A;  3MCX A;  2ETA A;  4DX7 D;  4L2Y A;  2LSU A;  4GZ3 A;  5ENN A;  5G04 J;  3TG5 A;  1HX8 A;  5JHB A;  3ZIM A;  2GRM A;  5FZS A;  4DX5 D;  5ITZ F;  3C5R A;  3CEQ A;  2QYU A;  1N0Q A;  1MJ0 A;  3B95 A;  2P2C P;  3LJ3 A;  5LOZ A;  4DK5 A;  5D66 A;  2GRN B;  1D8D A;  2A5E A;  2J4D A;  4K5B A;  5G2N A;  3OXG A;  3DSV A;  5LP0 A;  2WXG A;  1Z3Y A;  5BV1 A;  2F8X K;  3UXG A;  2H6I A;  3UT7 A;  5BV0 A;  5FZQ A;  4MLP A;  4U8V D;  3DSU A;  3ESK A;  2PQR A;  2H6H A;  5T4Y A;  2X6I A;  4URK A;  5AYW D;  3S7B A;  3TWT A;  5CRU A;  3T8K A;  2FEZ A;  2VGE A;  1IYG A;  2VQ2 A;  1N4S A;  4LCT A;  2JLB A;  4J8F A;  4HVB A;  5T0M A;  2KCK A;  5FIO A;  3LS8 A;  4TXP A;  1EPU A;  4I9C A;  3T9K A;  3CVX A;  5LSZ A;  3DBS A;  3B7T A;  1W3B A;  3T5V A;  5BPP A;  2J08 A;  2E0I A;  3V2O A;  1HXI A;  2ZIS A;  3I5P A;  2RKK A;  3J5P A;  3NZU A;  3JQ1 A;  4ILH B;  5EYP F;  4JZY A;  4UI9 K;  4EBA A;  3MO2 A;  4N5Q A;  3TWX A;  1TNZ A;  2WXH A;  3QDN A;  5JA4 D;  1JPL A;  3U4T A;  2CHX A;  2V5Q C;  3SFX A;  3RJW A;  3PZ3 A;  4JC8 A;  1JWG A;  3V31 A;  4CGW A;  3IHX A;  3FU0 A;  3V30 A;  3LPZ A;  4KZ0 A;  4HNA D;  2L6J A;  2P9N G;  4QQI A;  1H2T C;  1FPP A;  4UI9 J;  4HOR A;  2P9P G;  2WXL A;  5KCM A;  3ZKJ A;  4JLG A;  1NA0 A;  1S64 A;  5BUZ A;  2VGX B;  4APO A;  3EHR A;  4YPE A;  4LNU D;  5AQA A;  4KXK B;  3OXL A;  3ZN3 A;  5FIN A;  5C2Y A;  3HYM B;  2PM7 A;  3APF A;  5B1A E;  3TJP A;  3TGO A;  3C72 A;  3PUK A;  2Y0B G;  3KSL A;  3UM2 A;  3DST A;  4XEI G;  4DX2 A;  3RSE G;  3L82 A;  4YDY A;  2Q7F A;  3ABM E;  3ZVV A;  3ZW3 A;  4J7I A;  4JDS A;  1HZ4 A;  1HS6 A;  1OUV A;  1TN6 A;  3TL5 A;  5ANL A;  1IQU A;  2WXO A;  4W9R A;  1ZKK A;  2ETB A;  4B93 B;  3Q49 B;  4AIF A;  3D9I A;  2XEH A;  4MI0 A;  3D3M A;  4HRM B;  5BXO A;  2P9I G;  3ZFW A;  2XPY A;  3D9P A;  3QB2 A;  4GTV A;  2LUH A;  4G24 A;  5TEG A;  4DUI A;  1H6P A;  4AJW A;  4AY5 A;  3CVQ A;  1K3Z D;  2KBX A;  5ENS D;  3TWW A;  4EEC A;  2W5Y A;  4DLO A;  3PNT B;  5EDS A;  4GTO A;  4IUL A;  2R02 A;  3KSQ A;  3PZ1 A;  3B7R L;  3MKQ B;  3FTU A;  3PZD A;  3MV2 B;  5H7P A;  2LAI A;  5KJM A;  4KVO A;  1N54 A;  4EZL A;  1O1R A;  5F6L A;  1MX4 A;  3DSS A;  2ETC A;  3FUE A;  3IBE A;  1MX6 A;  4U95 D;  1HFA A;  2CHW A;  2DVW A;  5HS0 A;  1IKN D;  4ANX A;  2VYI A;  5G05 C;  1D8E A;  5J90 A;  4AV7 A;  4I2Z A;  5JJ0 A;  3ISM C;  3V79 K;  4YPA A;  3VLE A;  3FUF A;  4WUY A;  2QC9 A;  1TNU A;  3FP3 A;  3AU5 A;  1MT6 A;  5LCW J;  3IV0 A;  1SZ9 A;  3FU5 A;  3PEV B;  2B6C A;  4BY6 A;  2I2O A;  2EIJ E;  3TWS A;  4O1P A;  3BG0 B;  4L2L A;  4TRQ A;  2I6H A;  4GTS A;  2XHE A;  5AQB A;  5LCW C;  3CSF A;  3LEW A;  1LD7 A;  1NA3 A;  4NQ0 A;  4TXQ A;  2V4L A;  1DC2 A;  3MKR A;  4IYP A;  1E96 B;  1NP7 A;  5EX3 A;  3FUL A;  2OEW A;  3CIA A;  5FQ7 A;  4GB9 A;  4JD2 G;  2VSN A;  3SI5 A;  3ZRH A;  1Z3X A;  3B13 A;  3UM0 A;  4U8H A;  3DPD A;  1MHQ A;  4N3C A;  4AOF A;  1DNP A;  2DYS E;  1UJJ A;  1SA5 A;  3U3W A;  2X6K A;  3JXI A;  3M54 A;  3EJN A;  1QYM A;  2ION A;  5T8I A;  4DRX E;  5J08 A;  3NF1 A;  4JHK A;  2JEK A;  4ANU A;  3CVY A;  2YHE A;  3UPV A;  4I9E A;  2WXN A;  3RKV A;  1TN8 A;  4Q69 A;  1NI1 A;  3EUV A;  3GZS A;  1N94 A;  4UQY A;  4DLQ A;  1XGW A;  3QJZ A;  3SZ7 A;  4ANW A;  4YNP A;  2X6H A;  5D0Q D;  3ZYK A;  4JA7 A;  3IKO B;  4JHR A;  1MX2 A;  2KC7 A;  2O8J A;  2DCP A;  2E2E A;  4AU7 A;  1LD8 A;  4BEP A;  5EN5 D;  2MOW A;  3PVL A;  4YDE A;  2YNQ A;  2OV8 A;  2V4H C;  2X6J A;  3F9W A;  4N39 A;  3CHM A;  3CQC B;  1JUQ A;  3D9O A;  1Z5S C;  2PZI A;  5KNH D;  3D9J A;  2R3A A;  3FDH A;  3SQV A;  2OND A;  2QYJ A;  1N11 A;  3TWQ A;  4EPZ A;  3HXD A;  3CV0 A;  4WND A;  2RD0 A;  5AIJ A;  1L5J A;  3E4B A;  3KS2 A;  1TJC A;  4Q94 A;  2WXJ A;  4LEU A;  4JW1 A;  3EP0 A;  2GRL A;  1E8X A;  2NXP A;  4HI8 A;  1YA0 A;  3UM1 A;  3L22 A;  3U66 A;  3ZYM A;  3E37 A;  3ESL A;  3TG4 A;  4GA2 A;  5G55 A;  4J7W A;  4PS3 A;  4I6J A;  3UKU G;  4B0Z A;  3VTY A;  3D9M A;  1KZO A;  4GZC A;  3ZYL A;  3MV3 B;  3M55 A;  2AXZ A;  3DWL G;  2P9K G;  3M58 A;  3FUK A;  2XEV A;  3NB2 A;  1N6C A;  3CGH A;  5KJK A;  1TEZ A;  3HNA A;  4FU3 A;  1IHB A;  3RRN B;  3KMJ A;  2L9B A;  3CHQ A;  3SY2 A;  2DZO A;  2WXF A;  1BI8 B;  2CFU A;  3Q7F A;  4MS6 A;  5CBO A;  1TN7 A;  3URZ A;  3U64 A;  2IGQ A;  3LY8 A;  4ILI A;  3M57 A;  3EU9 A;  5ENR D;  2J09 A;  1ELW A;  2Y1L E;  1JCS A;  3RAY A;  4GYW A;  3PH0 C;  2Y3A A;  3CKC A;  2IU1 A;  5ENO D;  3RIB A;  1XNF A;  5EG2 A;  3O4Z A;  3PE4 A;  3MZL B;  2BF0 X;  3AS4 A;  1WAO 1;  3M5A A;  3FFL A;  4HXI A;  2G46 A;  3HVE B;  4IJ8 A;  3SBT B;  4M7C A;  1PAQ A;  1DCQ A;  4LG6 A;  2EIK E;  3LKU A;  4RQI A;  3QOU A;  5E75 A;  5T5G A;  4F53 A;  1YMP A;  3C3R A;  2RFA A;  2XGM A;  2X38 A;  4YND A;  4BES A;  1UN8 A;  5B3S E;  5CEC B;  5JJ6 A;  3ZEF A;  3ZGQ A;  4A55 A;  5FTP A;  1ZBP A;  2J49 A;  2WXP A;  4FJY A;  3M53 A;  4GA0 A;  3HG0 D;  5HKP A;  4JXT A;  2FI7 A;  1N6A A;  2I1K A;  3U9W A;  3ZU7 B;  2J07 A;  2KAT A;  3EDT B;  3Q47 B;  4N3A A;  5AJL A;  2A4Z A;  4UUC A;  2R17 C;  1IHG A;  3FHE A;  3LVQ E;  3VLD A;  3B7S A;  2R2L A;  3P2B A;  3RRU A;  4DX6 D;  3LY7 A;  4GMR A;  4CT0 A;  4Z68 A;  3OS5 A;  3FTW A;  2IJG X;  3L54 A;  3AS5 A;  4LRZ A;  3QKY A;  1HG2 A;  4BX9 A;  4AM9 A;  1WG0 A;  4XI9 A;  4WAF A;  2F0Y A;  3FU6 A;  1X5B A;  1SW6 A;  4GPM A;  4CDM A;  1PY1 A;  4JEU A;  5DBK A;  2J4B A;  2YHC A;  3FH5 A;  3SBS A;  4RG9 A;  3UQ3 A;  4F1S A;  4ATG A;  3I4R B;  4FUL A;  4BT8 A;  2RFI A;  2VTB B;  1NZN A;  4BFR A;  3O48 A;  4UI9 C;  3NOG D;  3MA5 A;  4EHM A;  4MBG A;  3S7J A;  1OT8 A;  4HLL A;  1WY6 A;  3PEU B;  2PNN A;  2GRQ B;  1OXJ A;  2MYO A;  3RJV A;  4GYO A;  4NRH B;  3LCA A;  1NL4 A;  4U0S A;  2P58 C;  3CVL A;  4BUP A;  3ULY A;  3TWR A;  4A3T A;  4FHK A;  2YIN A;  5JJ7 A;  3DSW A;  3LDZ A;  3SGH A;  3AG4 E;  4FAD A;  2KZT A;  5FWQ A;  4GA1 A;  1JCQ A;  2IOS A;  5BT1 A;  1MVH A;  2WXM A;  1YCS B;  3CVP A;  4YPU A;  4GZD A;  2Y4T A;  5FQ4 A;  2PQN A;  3KEA A;  4IJD A;  3QNK A;  2LNI A;  1SQM A;  2CG2 A;  4UWF A;  3FUD A;  3L9T A;  4BER A;  2CG3 A;  4TUU A;  5DIZ A;  1H3I A;  2FBN A;  4DX1 A;  2JAB A;  4K03 A;  3DAL A;  2IY0 C;  3FY4 A;  3AG1 E;  4N2S A;  4QEP A;  2C2L A;  2BTD A;  4PS8 A;  1MUF A;  4I1M A;  3ZXS A;  3DXM G;  2WPV A;  2KCL A;  2PL2 A;  2AW6 A;  2Y4U A;  3M56 A;  2R59 A;  3KEZ A;  1MQS A;  2OOE A;  3CQG B;  4L1B A;  4DPR A;  1PC2 A;  4A3V A;  3ZHE A;  5EID A;  3DSX A;  1MYO A;  5CHE E;  2J9Q A;  2XZT G;  3ONK A;  3EHM A;  4G26 A;  3HVE A;  4PUC A;  4OVV A;  5KJN A;  2FF4 A;  3VV0 A;  2WXK A;  4M3O A;  4UWL A;  3M59 A;  3FTZ A;  5A7D B;  4J8O A;  2BUG A;  3CVN A;  4R7L A;  1ML9 A;  2OVB A;  1O5M A;  4KZC A;  4BTA A;  2HM8 A;  4TXR A;  5EYL A;  4OAU C;  4RVB A;  2XGS A;  4HOU A;  3CHS A;  4BSZ B;  3WXX A;  3CVW A;  2XPZ A;  1FT2 A;  3FTV A;  3Q78 A;  5JIN A;  3DEO A;  1UJK A;  2KCV A;  1XQH A;  5A23 A;  3TWU A;  4UWK A;  3BO5 A;  1U3D A;  3RK6 A;  2H6G A;  3VLF A;  1FT1 A;  4NUR A;  5ENT D;  3SFY A;  4I1O B;  4E85 A;  4JPS A;  2C0L A;  3ZUV B;  4J6I A;  4EBA G;  4UWG A;  4G8K A;  1B89 A;  4XKB A;  3IXE A;  4HLE A;  4JVS A;  1E7V A;  1OWP A;  4FJZ A;  1QNF A;  4GML A;  3DB5 A;  4N5C A;  4I2W A;  2RFM A;  5D2M C;  4XKC A;  4RLY A;  3EHN A;  4HQD A;  3CK9 A;  5JMN D;  5ANR A;  4L7T A;  3QWW A;  4HBD A;  3MGB A;  1QQE A;  3SW9 A;  3K5K A;  3L17 A;  3PE3 A;  2EQX A;  2R05 A;  4B89 A;  3CBO A;  5G04 C;  4C48 B;  3HRA A;  5CCL A;  4K5A B;  2WB2 A;  1EYH A;  2C0M A;  4J7F A;  3SHF A;  1IXV A;  2XPI A;  4JHJ A;  4X8Q A;  1OCO E;  1UN9 A;  3D9H A;  1N52 A;  1HG5 A;  2ZU6 B;  4ACL A;  4QFV A;  3RRM B;  3V2X A;  3W9G A;  3L6A A;  5FJY A;  1SVX A;  3Q9U C;  2LAH A;  4I1A A;  3RU0 A;  4YDO A;  3Q73 A;  2IFU A;  3Q7A A;  3HHM A;  2ZXW E;  4ABN A;  3Q4A B;  4BTB A;  2OVF A;  3CBP A;  4LUN U;  1KPS B;  1K1A A;  2H6F A;  3QAR A;  3VUZ A;  2MRI A;  2VGY A;  2UY1 B;  1HH8 A;  4ILG A;  4B8C B;  1NFI E;  3FEX A;  3P1U A;  2F8Y A;  4J0U A;  2AXU A;  1EF1 C;  5FZR A;  5ENQ D;  2WXQ A;  4HI9 A;  2KM4 A;  4U0U A;  2WVI A;  4HRN A;  5M72 A;  5AJD A;  1S70 B;  3OAW A;  4O60 A;  5AEN A;  3JUE A;  4I6E A;  2WM9 A;  3UIN C;  2IF4 A;  5JJT A;  3BG1 B;  3ASH A;  1H19 A;  4K5C A;  3OOI A;  3UTM A;  2QPW A;  4J83 A;  3S2A A;  1OCZ E;  2J8S D;  3SF4 A;  1BU9 A;  4ZFH A;  3E30 A;  3DRA A;  4HOT A;  4MRU A;  3EIJ A;  1OCC E;  2XS1 A;  5AYF A;  4U07 A;  2XZD G;  4YNM A;  1TJF A;  2P9U G;  3SNX A;  1O9S A;  3X2Q E;  2EIN E;  3MKQ A;  4EZJ A;  4Q96 A;  4O1O A;  1BPO A;  2M63 A;  4LER A;  1PEG A;  5KWD A;  3BUA A;  3FWV A;  3JCK C;  1DVP A;  3Q9N C;  2VTB A;  1VDY A;  4V3I A;  1HF8 A;  5B1B E;  4LNB A;  3GZ1 A;  4LDG A;  5CCM A;  2VGX A;  2HR2 A;  1V54 E;  3FH7 A;  4WNG A;  3CKB A;  2CHZ A;  5A6C A;  1K1B A;  3NBN B;  1TNY A;  2X6F A;  2XRY A;  4GTT A;  4CGV A;  4OVU A;  2IOL A;  1N9A A;  3PRE A;  1EDU A;  3FUJ A;  3ZYQ A;  4KBQ A;  5AQ9 A;  3ONL A;  4FHJ A;  4MI5 A;  3CBM A;  3S7D A;  1QZ2 A;  4G11 A;  3UMV A;  4UQX A;  1P5Q A;  2ZGG A;  5ARF A;  1H6K A;  3PNL B;  3UKR G;  4N2Q A;  3R7Q A;  3IHY A;  4P29 A;  3PS6 A;  1TNO A;  4WWP A;  2GGF A;  3T8M A;  1WM5 A;  4TUM A;  1LTX A;  5JIY A;  3G2U A;  4I17 A;  4AEZ C;  1LF8 A;  2EIL E;  3MEK A;  4C1Q A;  3FEY A;  1UOH A;  3TWV A;  4U04 A;  4HS2 A;  2X3M A;  5EKQ D;  3ZPJ A;  5AQ7 A;  2AJA A;  1AP7 A;  5EIB E;  3S7F A;  4HRL A;  4G23 A;  4BWR A;  4O30 A;  3UT8 A;  5AAO A;  5CED B;  4F3V A;  1BLX B;  1TYQ G;  2IQC A;  4LNG A;  3BU8 A;  4MKT A;  1WDY A;  5AAR A;  5BW8 C;  3TXM A;  4DI3 A;  1TNB A;  2F37 A;  2MHK A;  2OCC E;  4NVQ A;  2QFC A;  3HIZ A;  3UIO C;  3VTX A;  4CDR A;  1H0A A;  2Y69 E;  3AJI A;  3JQ0 A;  5KBA A;  1N4P A;  4PS7 A;  1E8W A;  1H6O A;  1X81 A;  4G2V A;  1OCR E;  3MYV A;  3Q15 A;  4F7A A;  2PM6 A;  4O6F A;  3E32 A;  1OWN A;  1O1T A;  3ULE G;  3ML8 A;  1UW4 B;  3CHP A;  4DJA A;  3B7B A;  4WNF A;  4YVQ C;  5IY5 E;  4CRW A;  3CHR A;  2L0T B;  3UUX A;  2YQ8 A;  5CRV A;  3PRZ A;  4C0E A;  5JHA A;  2WQ7 A;  3HDX A;  4KT6 B;  4BX8 A;  3Q5M A;  3CK7 A;  4AXH A;  1V55 E;  2FO7 A;  2F69 A;  4JA9 A;  2BKG A;  2ILR A;  3NAW A;  4IN3 B;  5LX8 A;  4OAV B;  3R7R A;  3SD5 A;  4K0R A;  3ASN E;  1H2V C;  3MJW A;  3AS8 A;  3NOC D;  4NIK A;  2I1J A;  3HXB A;  1RZ4 A;  5F6K C;  4TV3 A;  3IEG A;  3L13 A;  1BI7 B;  3CVU A;  2XCC A;  5AN8 A;  5CMY A;  2HO1 A;  3G2S A;  4FMU A;  4J8Y A;  4JB8 P;  3HXE A;  2KZT B;  4GYY A;  2AVP A;  2WXI A;  3EIQ C;  4XI0 A;  3KMA A;  2XEE A;  3J5Q B;  2QZA A;  5BXU A;  1KZP A;  3K9I A;  5FT9 A;  3L16 A;  2VSO E;  2R5S A;  3C3O A;  4UQZ A;  4I43 A;  3G2W A;  2V5F A;  3D9N A;  2JV0 A;  4F6R D;  5CER B;  3F9X A; 
#chains in the Genus database with same CATH homology
 3U66 A;  4XKC A;  3ZYM A;  3EHN A;  1A17 A;  3ESL A;  3TG4 A;  4GA2 A;  5G55 A;  3CK9 A;  5ANR A;  4PS3 A;  3LJ3 A;  4L7T A;  5LOZ A;  4DK5 A;  4B8A A;  4I6J A;  3PUJ A;  3PDN A;  4AVX A;  3QWW A;  3MGB A;  1QQE A;  2J4D A;  5G2N A;  4B0Z A;  3OXG A;  3VTY A;  1ELR A;  3D9M A;  3SW9 A;  3K5K A;  1FVF A;  4WWO A;  3APC A;  5LP0 A;  2WXG A;  3L17 A;  4GZC A;  3F9Y A;  3ZYL A;  4BSX A;  3MV3 B;  3PE3 A;  1Z3Y A;  2EQX A;  2AXZ A;  4B89 A;  5BV1 A;  3CBO A;  4HOS A;  3M55 A;  5G04 C;  4XE0 A;  4NJ5 A;  4C9B B;  4Y6C A;  3M58 A;  4RZ0 A;  3FTX A;  5CCL A;  3UT7 A;  5BV0 A;  3FUK A;  5TH7 A;  2XEV A;  5FZQ A;  2VJ8 A;  1N6C A;  3CLJ A;  4MLP A;  2WB2 A;  1EYH A;  3QWP A;  2C0M A;  3CGH A;  5KJK A;  4J7F A;  1TEZ A;  3HNA A;  3OTN A;  4FU3 A;  3SHF A;  4JHJ A;  2XPI A;  4H7X A;  3ESK A;  1UN9 A;  2PQR A;  1N52 A;  4E47 A;  5T4Y A;  3OXF A;  1HG5 A;  2X6I A;  4JEH A;  4URK A;  2ZU6 B;  3RRN B;  3KMJ A;  2L9B A;  5AYW D;  4ACL A;  3S7B A;  5LSX A;  4QFV A;  3CHQ A;  2FEZ A;  3RRM B;  2WXF A;  3L6A A;  2CFU A;  3LXU X;  5FJY A;  1IYG A;  2XRZ A;  4MS6 A;  2VQ2 A;  5LFA A;  2LAH A;  4I1A A;  4LCT A;  3RU0 A;  2JLB A;  4J8F A;  4BT9 A;  3URZ A;  4HVB A;  3U64 A;  2IGQ A;  3LY8 A;  2KCK A;  4ILI A;  5T0M A;  3M57 A;  3LS8 A;  2J09 A;  2IFU A;  1ELW A;  3CK8 A;  1EPU A;  4KVM A;  4I9C A;  3RAY A;  4GYW A;  3CVX A;  3HHM A;  2Y3A A;  3PH0 C;  3CKC A;  1HE8 A;  2IU1 A;  4J8S A;  3KD7 A;  1U3C A;  4GAA A;  3DBS A;  3RIB A;  5LSZ A;  1XNF A;  3B7T A;  4ABN A;  3Q4A B;  1W3B A;  4BTB A;  2OVF A;  3T5V A;  5BPP A;  3CBP A;  2J08 A;  2I9C A;  2E0I A;  5EG2 A;  1HXI A;  3O4Z A;  3PE4 A;  5FQ8 A;  3QC1 A;  4KYO B;  4LUN U;  3I5P A;  3ASD A;  3UX4 A;  3MZL B;  2BF0 X;  3AS4 A;  1WAO 1;  3NZU A;  3QAR A;  3M5A A;  3VUZ A;  3FFL A;  4GMJ A;  2MRI A;  4HXI A;  2G46 A;  3HVE B;  3JQ1 A;  4ILH B;  4RG6 A;  2VGY A;  4JZY A;  4UI9 K;  4EBA A;  3MO2 A;  4IJ8 A;  2UY1 B;  2VSY A;  3GW4 A;  3SBT B;  4WNE A;  5F59 A;  1HH8 A;  4ILG A;  4B8C B;  1PAQ A;  3ULQ A;  2WXH A;  3FEX A;  3P1U A;  3QDN A;  3LKU A;  5C1D A;  1JPL A;  3U4T A;  2CHX A;  4I51 A;  4DI4 A;  3QOU A;  4J0U A;  1S0P A;  5E75 A;  5T5G A;  4F53 A;  4YND A;  2QY7 A;  2AXU A;  2XGM A;  1EF1 C;  2X38 A;  4XIF A;  1UN8 A;  5FZR A;  3RJW A;  4JC8 A;  1JWG A;  5JJ6 A;  4H7Y A;  3ZEF A;  2WXQ A;  3ZGQ A;  4CGW A;  3IHX A;  3FU0 A;  4A55 A;  2KM4 A;  5FTP A;  1ZBP A;  4AP2 A;  4U0U A;  2J49 A;  2WVI A;  2WXP A;  4FJY A;  3LPZ A;  5M72 A;  3M53 A;  4GA0 A;  4KZ0 A;  1H2U A;  5AJD A;  4CEM A;  2L6J A;  4JXT A;  3OAW A;  2FI7 A;  5AEN A;  2WMO A;  4I6E A;  2WM9 A;  3LYA A;  2IF4 A;  1H2T C;  1N6A A;  2I1K A;  3GZ2 A;  2DBA A;  3U9W A;  5JJT A;  4UI9 J;  2J07 A;  2KAT A;  3EDT B;  4Y6W A;  4G25 A;  4FLH A;  3BG1 B;  3Q47 B;  4HOR A;  4N3A A;  2WXL A;  3ASH A;  4PH4 B;  4WWN A;  5KCM A;  3R9A B;  1H19 A;  3QAQ A;  4JLG A;  5AJL A;  3OOI A;  2XGO A;  1NA0 A;  2A4Z A;  2QPW A;  2R17 C;  5BUZ A;  2VGX B;  4J83 A;  3S2A A;  4APO A;  1HO8 A;  3IHV A;  4YPE A;  3SF4 A;  4GCN A;  4J8E A;  1IHG A;  3FHE A;  4J8D A;  4KXK B;  3LVQ E;  3OXL A;  3VLD A;  3ZN3 A;  3B7S A;  5C2Y A;  3P2B A;  3RRU A;  3HYM B;  2PM7 A;  3APF A;  3LY7 A;  5HI7 A;  1FVH A;  4HOT A;  2WMN A;  4MRU A;  3TJP A;  3TGO A;  3PUK A;  4NAC A;  4CT0 A;  1FCH A;  4IRU A;  3B7U X;  3EIJ A;  4ACK A;  3OS5 A;  3FTW A;  2Q7F A;  3RQ4 A;  2IJG X;  3L54 A;  3AU4 A;  3ZVV A;  3ZW3 A;  4J7I A;  4JDS A;  5AYF A;  1HZ4 A;  1OUV A;  1HS6 A;  3D9L A;  3FUM A;  3AS5 A;  4FC8 A;  4U07 A;  2BQZ A;  4LRZ A;  3TL5 A;  3QKY A;  5ANL A;  5EX0 A;  1HG2 A;  1TJF A;  3GYZ A;  1IQU A;  4YNM A;  3SNX A;  1O9S A;  4BX9 A;  2WXO A;  3L08 A;  3MKQ A;  1ELK A;  2LO6 A;  4AM9 A;  4EZJ A;  4XI9 A;  4W9R A;  4WAF A;  4Q96 A;  1ZKK A;  3FU6 A;  5JHN A;  3Q49 B;  2VSX E;  1X5B A;  1BPO A;  3RO2 A;  3QK0 A;  2M63 A;  4LER A;  4AIF A;  3D9I A;  4MI0 A;  4CDM A;  1PEG A;  1PY1 A;  4JEU A;  5DBK A;  2J4B A;  2YHC A;  3FH5 A;  3D3M A;  2WQ6 A;  5TTF A;  3FPD A;  3FWV A;  4RG9 A;  5G05 J;  3SBS A;  3JCK C;  1DVP A;  3UQ3 A;  4F1S A;  1IQR A;  2VTB A;  1VDY A;  3I4R B;  5E76 A;  4V3I A;  3LVR E;  4FUL A;  4ATG A;  1HF8 A;  4BT8 A;  3ZFW A;  4ANV A;  5D0O D;  3GZ1 A;  2XPY A;  2RFI A;  4LDG A;  2VTB B;  5CCM A;  2VGX A;  3D9P A;  1NZN A;  2HR2 A;  4N3B A;  3FH7 A;  3QB2 A;  4BFR A;  3O48 A;  4WNG A;  4KMO A;  4G24 A;  4UI9 C;  5TEG A;  3CKB A;  2CHZ A;  4CCA A;  4FA6 A;  5A6C A;  4L23 A;  3JUI A;  3MA5 A;  4AJW A;  4AY5 A;  1E8Z A;  2A5U A;  2X6F A;  3CVQ A;  4XZ4 A;  2XRY A;  4EEC A;  3S7J A;  2W5Y A;  4DLO A;  4Z4P A;  4CGV A;  3PNT B;  4OVU A;  5EDS A;  5HQ8 A;  2NSZ A;  2IOL A;  1WY6 A;  3PEU B;  3PRE A;  4IUL A;  3B7R L;  1EDU A;  3MKQ B;  5BNW A;  3FUJ A;  3ZYQ A;  3JYS A;  3FTU A;  4KBQ A;  1E90 A;  3SWC A;  3PZD A;  3MV2 B;  4QEO A;  3ONL A;  3G2T A;  2LAI A;  2GW1 A;  3RJV A;  5KJM A;  4FHJ A;  4A1G A;  2W5Z A;  4MI5 A;  4KVO A;  4GYO A;  3CBM A;  1GW6 A;  3S7D A;  4NRH B;  3LCA A;  4U0S A;  1QZ2 A;  5CMW A;  4G11 A;  3NQP A;  3TXN A;  3UMV A;  2P58 C;  3CVL A;  4UQX A;  4BUP A;  1P5Q A;  1N54 A;  4A3T A;  4FHK A;  2YIN A;  5ARF A;  5JJ7 A;  1H6K A;  3F9Z A;  4UWH A;  3PNL B;  3LDZ A;  3SGH A;  3CST A;  4N2Q A;  3R7Q A;  4EZL A;  4FAD A;  3IHY A;  4P29 A;  3FTS A;  2KZT A;  5FWQ A;  3FUH A;  4GA1 A;  5F6L A;  3NZS A;  3PS6 A;  3FUE A;  2HYZ A;  4WWP A;  2IOS A;  2GGF A;  2WQH A;  3IBE A;  3T8M A;  5BT1 A;  1WM5 A;  1MVH A;  3OPE A;  1OWM A;  2WXM A;  2AWI A;  3TAX A;  1HFA A;  3CVP A;  4YPU A;  4XX5 A;  4EZK A;  2CHW A;  4GZD A;  2WXR A;  5JIY A;  4ANX A;  3G2U A;  2VYI A;  1KLX A;  4I17 A;  5G05 C;  1LF8 A;  2Y4T A;  5T3R A;  5FQ4 A;  3T5X A;  4AEZ C;  2PQN A;  5J90 A;  3MEK A;  4AV7 A;  4C1Q A;  2FUL A;  3FEY A;  4IJD A;  3QNK A;  3SFZ A;  4I2Z A;  5JJ0 A;  3APD A;  4U04 A;  2LNI A;  1MVX A;  4YPA A;  4HS2 A;  1SQM A;  3VLE A;  3FUF A;  2X3M A;  2CG2 A;  4WUY A;  5EKQ D;  3ML9 A;  3ZPJ A;  4CT4 A;  4UWF A;  4EQF A;  3FUD A;  3FP3 A;  3I4G A;  4C0M A;  3S7F A;  3AU5 A;  1MT6 A;  2CG3 A;  4ME2 A;  5FQ6 A;  4G23 A;  1JWF A;  4G1T A;  4TUU A;  4BWR A;  1Y6I A;  4O30 A;  4H12 A;  5DIZ A;  1H3I A;  3UT8 A;  2FBN A;  5LCW J;  3IV0 A;  1SZ9 A;  2UWJ G;  3FU5 A;  3PEV B;  2DIW A;  4F3V A;  4K03 A;  4BY6 A;  3DAL A;  2I2O A;  3FY4 A;  4QEP A;  4N2S A;  3MO0 A;  4E6H A;  3L22 A;  2C2L A;  2BTD A;  1OWO A;  2IQC A;  4MKT A;  4PS8 A;  1N3J A;  2AXV A;  1MUF A;  4I1M A;  3LY9 A;  5BW8 C;  3BG0 B;  4L2L A;  2MHK A;  4TRQ A;  3TXM A;  3ZXS A;  3ASG A;  4DI3 A;  3CVV A;  1KT0 A;  4AY6 A;  2I6H A;  2WPV A;  2KCL A;  4U63 A;  4NVQ A;  4JL0 A;  2XHE A;  4GPK A;  1SZA A;  2PL2 A;  3CSF A;  3LEW A;  5LCW C;  2L0I A;  2QFC A;  3HIZ A;  1NA3 A;  3QWV A;  4NQ0 A;  2AW6 A;  2Y4U A;  3VTX A;  3M56 A;  2R59 A;  2V4L A;  3KEZ A;  3ZHE B;  1MQS A;  4CDR A;  3FUN A;  1H0A A;  3MKR A;  3JQ0 A;  2OOE A;  4IYP A;  4PS7 A;  1E8W A;  3CQG B;  3FH8 A;  4G2V A;  4L1B A;  1E96 B;  4DPR A;  1NP7 A;  1E7U A;  1PC2 A;  3MYV A;  5CPR B;  3N71 A;  5EX3 A;  3FUL A;  5T0K A;  3Q15 A;  3CIA A;  5FQ7 A;  3I3N A;  3MX3 A;  4GB9 A;  3SI5 A;  2VSN A;  4F7A A;  1Y8M A;  2PM6 A;  3ZRH A;  4A3V A;  1Z3X A;  3B13 A;  2XQ0 A;  2V0P A;  1KT1 A;  4O6F A;  3ZHE A;  4U8H A;  3DPD A;  2LSV A;  3RO3 A;  1OWN A;  1HU3 A;  1MHQ A;  5CHE E;  4N3C A;  4AOF A;  4CDN A;  1DNP A;  2J9Q A;  5KJL A;  1UJJ A;  2V8S E;  3ONK A;  2NC9 A;  3U3W A;  2X6K A;  2UY1 A;  3M54 A;  3EHM A;  4G26 A;  3ML8 A;  5ARG A;  4D10 C;  3HVE A;  3CHO A;  3EJN A;  4GZ5 A;  2ION A;  4PUC A;  4FLB A;  4OVV A;  1UW4 B;  2FF4 A;  5KJN A;  3CHP A;  3FTY A;  5T8I A;  4DJA A;  3KAE A;  4WNF A;  4YVQ C;  3VV0 A;  3CR3 A;  4GZ6 A;  4CRW A;  2WXK A;  3CHR A;  2L0T B;  4M3O A;  3UUX A;  1E8Y A;  2YQ8 A;  5J08 A;  3NF1 A;  4JHK A;  2JEK A;  4UWL A;  4ANU A;  3M59 A;  3PRZ A;  4GCO A;  4C0E A;  5JHA A;  2WQ7 A;  2YHE A;  3HDX A;  3CVY A;  3FTZ A;  3ENE A;  4KT6 B;  4BX8 A;  3Q5M A;  3UPV A;  4I9E A;  4FP7 A;  4GU5 A;  3CK7 A;  4AXH A;  5A7D B;  4J8O A;  2BUG A;  2WXN A;  4I6G A;  2FO7 A;  3RKV A;  3CVN A;  4R7L A;  2F69 A;  4Q69 A;  4JA9 A;  4RSY A;  3GZS A;  2ILR A;  4IN3 B;  1INZ A;  4UQY A;  3KMT A;  4DLQ A;  1ML9 A;  5LX8 A;  2OVB A;  3UT4 A;  4HOQ A;  1XGW A;  3QJZ A;  4KZC A;  1Z6T A;  3R7R A;  4BTA A;  4YVO A;  3SD5 A;  2HM8 A;  3SZ7 A;  4ANW A;  3D9K A;  4K0R A;  4YNP A;  4RVB A;  2X6H A;  2XGS A;  4HOU A;  5D0Q D;  3ZYK A;  1H2V C;  3CHS A;  3AS8 A;  3MJW A;  4JA7 A;  3IKO B;  2I1J A;  4APF A;  4JHR A;  3ASF A;  3G2V A;  3WXX A;  2KC7 A;  2O8J A;  5F5E A;  2DCP A;  3BEE A;  3CVW A;  2XPZ A;  2E2E A;  3S8P A;  4AU7 A;  4QEN A;  4A1S A;  3FTV A;  5F6K C;  5JIN A;  2MOW A;  3PVL A;  4TV3 A;  4B94 A;  3FUI A;  1UJK A;  2KCV A;  1XQH A;  3IEG A;  4PDX A;  2RG8 A;  2CFZ A;  4HFG A;  5A23 A;  3L13 A;  3CVU A;  2XCC A;  2YNQ A;  5CMY A;  1UG3 A;  2OV8 A;  2HO1 A;  3G2S A;  1OWL A;  4FMU A;  3MO5 A;  3C98 A;  4OYS A;  2X6J A;  3FU3 A;  4UWK A;  4N39 A;  2KZT B;  3BO5 A;  3F9W A;  3CHM A;  4U0Z A;  3CQC B;  1U3D A;  1JUQ A;  4GYY A;  3RK6 A;  1ZU2 A;  2AVP A;  2XCB A;  3VLF A;  3D9O A;  2WXI A;  3EIQ C;  3MCX A;  2PZI A;  4NUR A;  4XI0 A;  4I1O B;  3D9J A;  2R3A A;  4E85 A;  3FDH A;  4JPS A;  3KMA A;  2C0L A;  3K9I A;  5FT9 A;  2OND A;  3L16 A;  4J6I A;  2VSO E;  4L2Y A;  2R5S A;  2LSU A;  4UWG A;  4EBA G;  1B89 A;  4EPZ A;  4UQZ A;  3CV0 A;  4XKB A;  4WND A;  4HLE A;  4JVS A;  2RD0 A;  4GZ3 A;  1E7V A;  1OWP A;  4FJZ A;  4I43 A;  3G2W A;  2V5F A;  5AIJ A;  1L5J A;  3E4B A;  5ENN A;  5G04 J;  1HX8 A;  3KS2 A;  3TG5 A;  1TJC A;  1QNF A;  3D9N A;  4Q94 A;  5JHB A;  2JV0 A;  4GML A;  3DB5 A;  3ZIM A;  2WXJ A;  4LEU A;  4JW1 A;  2GRM A;  5FZS A;  3EP0 A;  2GRL A;  1E8X A;  4N5C A;  2NXP A;  3F9X A;  4I2W A;  1YA0 A;  3CEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...