3S7BA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7bA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7bA01
2VGYA 5LSXA 5T0KA 2QPWA 4I2WA 4XI9A 3OPEA 1IYGA 1MVHA 4KXKB 1MT6A 4J8OA 5TEGA 4G2VA 4LDGA 3UUXA 2UY1B 2C0LA 3GZ2A 3U3WA 3HNAA 4CGWA 4J0UA 3K5KA 3CBMA 1P5QA 4E47A 3LCAA 2O8JA 4G23A 3MEKA 4CGVA 5A7DB 4N3CA 5G04J 3GZ1A 4KBQA 3RU0A 4N39A 3GYZA 4JA9A 3KMJA 3F9YA 1IHGA 4CDRA 1YA0A 2UY1A 3LY7A 4GYOA 3KS2A 3LKUA 5BW8C 2FBNA 4Y6WA 4GZ5A 5JJ6A 2FO7A 1Y8MA 4G1TA 4NVQA 1XNFA 3KD7A 3M58A 3NF1A 3S7BA 2XGOA 3VTXA 3RKVA 1HH8A 3CKBA 2HR2A 4WNEA 2P58C 5JJTA 4YPAA 5KJMA 1OUVA 1HZ4A 5BNWA 4BUPA 2VSYA 4QEOA 4MI0A 4JA7A 1ZBPA 5G04C 5JJ7A 5TTFA 3OXFA 3GW4A 3JYSA 4KYOB 4RG9A 2HO1A 4YPUA 1N6AA 3BO5A 4J8FA 3CKCA 1KT1A 3SZ7A 3Q4AB 2C2LA 2IF4A 3S7DA 3MV3B 2RFIA 3ZPJA 3M55A 4IJDA 2Y4TA 3KMTA 1NA0A 1H3IA 3QKYA 2J9QA 3DB5A 4H7XA 3ZHEB 5CCLA 3TGOA 3PDNA 4UI9J 2FF4A 3RO2A 2XPIA 5HQ8A 4UQXA 5ARGA 5C1DA 4JL0A 3CK8A 2L6JA 4B94A 4WNDA 3CVPA 4J8EA 4J7IA 4YVOA 4GA2A 1HXIA 3RQ4A 1NZNA 3E4BA 3ZHEA 3VUZA 5JHNA 2NC9A 4W9RA 2BQZA 1KT0A 4O6FA 4QENA 5HI7A 3SF4A 3M57A 3M59A 3K9IA 3ZN3A 3VV0A 4Z4PA 4UI9C 2XGSA 4GPKA 3M5AA 3LPZA 4U0UA 3RIBA 1N6CA 3S8PA 4G26A 4N5CA 4YNMA 5AYFA 3AS5A 5FZRA 5F5EA 5F6LA 5D0QD 4HOSA 5CPRB 3IEGA 4HOTA 1WAO1 2BUGA 2ONDA 3M56A 5JINA 3CK7A 4I51A 1NA3A 5EG2A 5FT9A 3R9AB 3AS4A 3HYMB 2WQHA 1XQHA 4BT9A 5LCWJ 5CHEE 2JV0A 4Y6CA 3FWVA 2Y4UA 1N3JA 2KCKA 4N3BA 4UQZA 4WNGA 2I6HA 3CBPA 5JIYA 4XI0A 3CVNA 4A1SA 3LY9A 4IN3B 5EX0A 2WPVA 5FJYA 5EX3A 4GCNA 3F9WA 3RAYA 3KAEA 3OXGA 3EP0A 5D0OD 3FFLA 4GCOA 3DALA 3FP3A 2YQ8A 2XCBA 5T0MA 5JJ0A 5AYWD 2HYZA 5LCWC 4ABNA 1ZU2A 3PE3A 3ESKA 4BTBA 4H12A 2LSUA 5F6KC 4I2ZA 5LSZA 3ASHA 3MV2B 2XCCA 1QQEA 4UQYA 4O30A 4WUYA 3SW9A 2LNIA 3TAXA 3WXXA 1PC2A 2R3AA 3ZFWA 2KCLA 3ASGA 2R5SA 2KCVA 3IHXA 3BEEA 4RZ0A 4H7YA 2XGMA 4U0ZA 2AVPA 5DIZA 4FMUA 1QZ2A 3Q15A 2FEZA 3CVQA 2V5FA 4I1AA 4C1QA 5FZSA 4N2SA 2W5YA 1MVXA 2C0MA 3M54A 1ZKKA 3S7JA 5BT1A 2PL2A 3CK9A 3ULQA 3FPDA 4J83A 3MO5A 3QOUA 1ELRA 4GYYA 2XEVA 3S7FA 4YNPA 4G25A 2QFCA 3MA5A 3UPVA 4EQFA 4ME2A 3RJWA 3OS5A 4F3VA 4J8DA 5FTPA 1O9SA 3PE4A 5KJKA 3ZGQA 1PEGA 3F9ZA 2F69A 5F59A 4HORA 3Q49B 1KLXA 5KJLA 3F9XA 3TG5A 4GZ6A 1MUFA 4GZ3A 2IGQA 4U04A 3ASFA 5DBKA 4WNFA 2GW1A 3VTYA 1B89A 1ELWA 3CVLA 4GA1A 4G24A 3TG4A 4AU7A 3LYAA 4AY5A 2W5ZA 4IJ8A 2OOEA 5ARFA 3URZA 4HOUA 4BTAA 4I9EA 3MKRA 3M53A 2PQRA 4U0SA 4YNDA 4JHRA 5A6CA 4J7FA 2UWJG 4N3AA 4NJ5A 2VYIA 1A17A 2IFUA 4BT8A 1FCHA 3ASDA 2PQNA 3AS8A 3CBOA 4APOA 4JLGA 4YVQC 3LY8A 4RG6A 1TJCA 4LEUA 4I17A 3KMAA 5CCMA 2KC7A 5G05J 4GA0A 5M72A 4JDSA 3QDNA 3OXLA 2KATA 3CEQA 2YHCA 4MI5A 2E2EA 2VSNA 5T5GA 3Q47B 4HOQA 4NQ0A 4QEPA 3UQ3A 2VGXB 2G46A 2FI7A 4I9CA 2PZIA 1E96B 4AM9A 4GYWA 2JLBA 3OOIA 3SWCA 3RJVA 2Q7FA 3O48A 3U4TA 3Q5MA 2VQ2A 4UI9K 3CV0A 3QWVA 5EKQD 3MO2A 5KJNA 3RO3A 5FZQA 5G05C 3QWPA 2LSVA 2VGXA 4AY6A 3QWWA 3N71A 5TH7A 1ML9A 2MHKA 3EDTB 4BWRA 2DBAA 4AIFA 1WM5A 4XIFA 4N2QA 3MO0A 4YPEA 4NRHB 4U07A 1W3BA
chains in the Genus database with same CATH superfamily
3QB2A 2WXRA 2VGYA 3KEZA 2GRRB 4FADA 4J8SA 3CVUA 3C3RA 1MVHA 3BU8A 3CGHA 2P9KG 4Q69A 4LDGA 4L1BA 3NOGD 5KWDA 3PH0C 2ETBA 3ZEFA 4J0UA 3FY4A 4FA6A 3SNXA 3CBMA 4FHJA 1P5QA 4E47A 2LAHA 2DZNA 4DLOA 1BPOA 2J49A 2KZTA 4DX7D 3FH8A 3CHOA 2PM7A 5BXUA 3FTUA 5FWQA 5CMWA 1EF1C 4CDRA 3LY7A 2UY1A 2DZOA 1BU9A 3X2QE 1Y8MA 3T8MA 4GMJA 3VTXA 3PNLB 3RKVA 3DSVA 3CKBA 3JUEA 5FQ7A 5G55A 3UM3A 4BETA 5KJMA 4IRUA 4EBAA 3NB2A 4BUPA 3AG4E 3PUKA 2I9CA 1E90A 4KZ0A 1OT8A 2E0IA 1ZBPA 5B1BE 5G04C 5JJ7A 1U3DA 3OXFA 5TTFA 1JPLA 4FJZA 4UWHA 4DPRA 2HO1A 2WB2A 3ABKE 3EIQC 2WXJA 4ZFHA 4HNAD 4ANWA 2GRMA 2IONA 4U8YD 2YHEA 3M55A 4IJDA 1NA0A 1HU3A 1H3IA 4I6JA 2IEJA 3TGOA 4UI9J 2J07A 3RO2A 3E32A 3SI5A 3BUAA 4DI3A 4XE0A 1YMPA 2WXGA 3UKUG 3CK8A 4B94A 1E7VA 5ENQD 4WNDA 4J7IA 4YVOA 3EHQA 3RQ4A 3SFXA 5C2YA 3ZHEA 3VUZA 4LNBA 4DX5D 4HQDA 5AQBA 4O6FA 4C0EA 4JXTA 4QENA 5HI7A 3M57A 3K9IA 5CECB 3ZN3A 4ILIA 3NBNB 2XGSA 4I1MA 4GPKA 1UOHA 4JZYA 4U0UA 4EBAG 1FT2A 2ZU6B 2VSOE 4YNMA 5AYFA 3UIPC 3FTSA 2BUGA 3M56A 2ZXWE 5JINA 3EU5A 3CHRA 3R7QA 3T8KA 5EILA 3R9AB 3AS4A 1XQHA 4BT9A 1O1SA 4RLYA 1N3JA 3D9JA 4LUNU 4UQZA 4J8YA 4WNGA 3ISMC 2I6HA 3RAUA 1IKND 3HVEA 1N95A 3TL5A 3CVNA 4ANXA 3CIAA 3FU6A 1S0PA 3UT7A 4HLLA 4K0RA 5EX0A 4DJAA 5EX3A 4GCNA 3F9WA 3KAEA 1IXVA 4GCOA 2X3MA 3FP3A 3LDZA 4BTBA 1TR4A 4DX6D 4U8HA 1WG0A 3QJZA 1TN7A 4LCTA 2R17C 4PS7A 3L9TA 3MV2B 1JCSA 4BX8A 3AG3E 4MS6A 4A1GA 2NYJA 3WXXA 4LG6A 4KZCA 2F8YA 4PUCA 1SQMA 2KCLA 2R5SA 4EZJA 3BEEA 4HS2A 3D9NA 3UM1A 1VDYA 1BD8A 1OWPA 4FMUA 4JHKA 3U64A 3CVQA 1FPPA 4I1AA 4C1QA 4Q96A 5ENOD 3FTZA 3FUNA 5CBNA 3M54A 3S7JA 2PL2A 2EIKE 4J83A 3ZYLA 1DVPA 2DVWA 2XEVA 3S7FA 5EIBE 5IY5E 3L6AA 3PNTB 2Y0BG 4G25A 1U2VG 2OCCE 3UPVA 3RJWA 4EZLA 3ASOE 3ZGQA 3D9KA 3Q9NC 2V0PA 2F69A 3F9ZA 1KLXA 1UG3A 5AJLA 5KJLA 2EILE 4GZ6A 5FQ4A 5CMYA 1B89A 1ELWA 3ML9A 4GA1A 3TG4A 3LYAA 4AY5A 3L82A 5EDSA 4JEUA 3ZXSA 4A3VA 3DPYA 1OCOE 2WXLA 4HOUA 3IHYA 2IQCA 2PQRA 4U0SA 1WY6A 1N0QA 4CDMA 4J7FA 2UWJG 3IHVA 3MKQA 2JABA 3CR3A 2IFUA 3PVLA 2ILRA 4AV7A 5T4YA 4TXPA 5EIDA 2XPZA 4NURA 4JLGA 3SFZA 4XKBA 3L17A 4FULA 3ZUVB 2JEKA 1FVFA 5JHAA 2V8SE 4I17A 2WXPA 3I5PA 4DK5A 5CCMA 5BV0A 3G2UA 4U7EB 4GMRA 3UM2A 2KATA 1TYQG 4TXRA 1K8KG 2X6IA 4ANUA 1O5MA 4GZCA 2PNNA 4GTQA 3QK0A 4APFA 2EQXA 4RQIA 2G46A 3MCXA 4I9CA 3L22A 1UN9A 3RJVA 3O48A 4TXQA 3Q5MA 2VQ2A 4I6EA 5EKQD 3RO3A 3QWWA 3N71A 2I1JA 2R2LA 2MHKA 4K5CA 4WAFA 4ATGA 2QY7A 4OAVB 4BWRA 4XEIG 1H2VC 4N2QA 3MO0A 3ML8A 2KZTB 4U07A 4IULA 1O1RA 5LSXA 4HRLA 2DYSE 4XI9A 1HG5A 3KEAA 4KXKB 3PS6A 2ZGDA 3UUXA 2UY1B 2C0LA 4XX5A 3ASNE 4AEZC 5BUZA 4CGWA 1MX6A 4JVSA 4TV3A 4M3OA 3PUJA 3MEKA 3TWUA 2IU1A 3D9OA 3FUIA 3ZVVA 4CGVA 4N3CA 4HI9A 5AAOA 4CYMD 4N39A 4JA9A 2R59A 3KMJA 3F9YA 1YA0A 3FTVA 2M63A 5HRYA 3LKUA 1OCZE 2FBNA 2VSXE 5JJ6A 1NL4A 4G1TA 3ZYQA 4I6GA 3KD7A 3S7BA 1IHBA 4WNEA 5D2MC 4URKA 4YPAA 3ONKA 1HZ4A 2LUHA 5BNWA 2P9LG 4TRQA 4QEOA 4DUIA 4JC8A 3GW4A 1E7UA 4C0MA 3HIZA 1Y6IA 3JYSA 1TN8A 4GMLA 2EINE 3AJIA 4J8FA 3BO5A 3CKCA 4LERA 2WXMA 1SVXA 2VGEA 3LS8A 2HM8A 2Y4TA 3TJPA 1N4PA 3TWVA 4G11A 2J9QA 3FH7A 4O60A 4H7XA 3ZHEB 4ANVA 2FF4A 2P9SG 1TNYA 2XPIA 5HQ8A 3UINC 4HFGA 3BG0B 3VLEA 1BI8B 3D3MA 3CHPA 3EJNA 1HFAA 1KZPA 4GA2A 1HXIA 3EUVA 3E4BA 4W9RA 4HRNA 2R03A 4KMOA 4WWOA 1X81A 2J09A 3PZ3A 4LRZA 3VV0A 3HXDA 4TUMA 2QZAA 3RIBA 3S8PA 4GTSA 3L54A 5ENNA 4FLHA 1N9AA 5EYPF 2GROB 3V79K 5F6LA 3HVEB 4FHKA 1PAQA 4HOTA 1WAO1 3HXEA 4AXHA 4HLEA 2MYOA 5FT9A 4IYPA 1YYHA 4Z68A 3HYMB 5LCWJ 5CEAA 3OAWA 3Q78A 2JV0A 1JCQA 3T5XA 4BFRA 5CBOA 3ZYKA 2KBXA 3CBPA 4I1OB 1MX4A 2OVBA 3B7SA 3W9GA 4A1SA 2CHWA 2WXQA 4IN3B 5FINA 3G2VA 1TNOA 4KVOA 3SQVA 4JB8P 3CQCB 5FJYA 2WPVA 4KVMA 4Q94A 2RD0A 3CLJA 3Q73A 5HKPA 2AXVA 5AQ7A 2XS8A 3HXFA 1DNPA 2GRLA 3NZSA 3DEPA 4HB5A 2YQ8A 5T0MA 1EYHA 5G2NA 3SBTB 4QFVA 5AYWD 1DCQA 3E37A 4ABNA 1ZU2A 3PE3A 2J08A 1KZOA 4YDEA 2CFZA 1A5EA 3JQ1A 1BLXB 2X6HA 3UI2A 1H2UA 4U63A 2FULA 3E34A 4O30A 2GGFA 3PZ1A 3L13A 2R3AA 2Y1LE 3ZRHA 3ABME 3ULYA 2WXNA 5AIJA 2XGMA 4U0ZA 3FU5A 4BY6A 1D8DA 2FEZA 2P9PG 3JCKC 5FZSA 4N2SA 4U95D 2A5UA 4V3IA 2DCPA 5ANLA 5LP0A 3FPDA 4JW1A 3QOUA 1ELRA 4HBDA 3DSUA 3FTYA 3MA5A 3FH5A 3OS5A 4F3VA 5KCMA 5FTPA 1AP7A 4AP2A 5F59A 4JPSA 4EZKA 2L9BA 2XZTG 5J90A 4FLBA 3F9XA 3TG5A 3ABLE 4BX9A 5CRVA 3MKQB 4BSXA 1H19A 2GW1A 3VTYA 1MJ0A 3CVLA 3FUEA 4G24A 2J8SD 2W5ZA 2H6HA 4CDNA 2IOLA 3P2BA 3MYVA 4ZHBA 1N4QA 3TWTA 5ARFA 3P1UA 3D9MA 4I9EA 3MKRA 2EIME 2VJ8A 3Q7FA 3ZNGA 4LSZE 5LFAA 5A6CA 3Q9UC 3ZKJA 1A17A 3RSEG 3ASDA 5T3RA 4F53A 4APOA 1H6KA 3FUKA 4LEUA 3HRAA 4GTRA 1Q2ZA 2KC7A 4CT0A 5M72A 3UXGA 4JDSA 1O1TA 1H0AA 1Z6TA 3FU3A 1N11A 1SZAA 1JWGA 1K1BA 3DSSA 3HG0D 4MI5A 2VSNA 3C98A 4RVBA 1LD7A 4PH4B 3UQ3A 3DXKG 2F0YA 3QC1A 5AENA 2RFAA 3ZU7B 4ILHB 3MX3A 4UI9K 4GPMA 3HDXA 5G05C 5LOZA 4GTMA 4HI8A 4FJYA 3FEYA 5BXOA 2VGXA 3QARA 1SW6A 3Q7AA 1BI7B 1TNZA 1N52A 2MOWA 3JQ0A 3L08A 4E6HA 2I2OA 4EHMA 4F1SA 3B7BA 3VLFA 3AU4A 1W3BA 4BESA 3FU0A 5T0KA 2OV8A 2QPWA 2XEEA 4I2WA 2Y69E 3OPEA 1IYGA 3E30A 4FU3A 4J7WA 2ZISA 1JWFA 4UUCA 1E8ZA 5KNGA 3GZ2A 5ENSD 3OTNA 3HNAA 2WMNA 3K5KA 2H6GA 3UX4A 2NSZA 4GTVA 2O8JA 1H6OA 1HF8A 1LD8A 1IQUA 1SZ9A 5G04J 3TWWA 3GZ1A 3NAWA 1L5JA 4ACKA 3RU0A 4JEHA 2I1KA 3V30A 4GYOA 3KS2A 5BW8C 4Y6WA 1ZB1A 1X5BA 1XNFA 2PM6A 3V2OA 1MZCA 3W9FA 1N4RA 3LVQE 1HH8A 3EU9A 2HR2A 3CHQA 2IOSA 2P58C 3FTXA 3FDHA 1D8EA 3PZ2A 4HVBA 2OVFA 4JA7A 4KYOB 1HO8A 4RG9A 3VLDA 3ZYMA 5AQAA 4YPUA 2AXUA 1N6AA 4O1OA 3SGHA 3BQOA 2LO6A 2B0OE 3B7UX 1KT1A 3SZ7A 1IQRA 3CVYA 3S7DA 3ZPJA 4BERA 3KMTA 3ULEG 3DB5A 5CCLA 3RRMB 4BSZB 3BG1B 1YCSB 4AOFA 5ARGA 5C1DA 3PRZA 2L6JA 4ACLA 3CVPA 4J8EA 5E75A 3ESLA 2WXIA 3Q79A 1QNFA 5AARA 5JHNA 2NC9A 3DEOA 1KT0A 3SF4A 3M59A 4U96D 4B8AA 3Q75A 4Z4PA 4UI9C 4EPZA 4DX1A 5HS0A 4RSYA 3LPZA 3I3NA 2XHEA 4N5CA 4JHJA 3R9MA 1HG2A 2CG2A 3G2SA 4A63B 2WXHA 5FZRA 2P9NG 5F5EA 4HOSA 3IEGA 4CT4A 2ONDA 3AU5A 3LJ3A 1NA3A 2AW6A 1OWOA 4L2LA 3CSFA 3TWRA 3D9HA 4GTOA 2Y4UA 1UJJA 3MZLB 2KCKA 4N3BA 3UT8A 3DBSA 5KBAA 3L16A 1SA4A 4XI0A 3TWSA 5B3SE 5J08A 1INZA 3CHSA 3RAYA 2FO1E 2WM9A 3OXGA 5ENRD 1GW6A 2CFUA 3FFLA 1TNUA 4YDWA 3C5RA 2XCBA 4TUUA 4J6IA 5JJ0A 2HYZA 4GTPA 3ESKA 4B89A 2VTBA 2H6FA 5CEDB 5F6KC 2HE0A 5LSZA 3ASHA 5AQ9A 4LNGA 3C3QA 3RK6A 5EYLA 3SD5A 4GAAA 2L6BA 1OCCE 3SW9A 2LNIA 1DC2A 1PC2A 3FULA 4G8LA 3ZFWA 4XKCA 2KCVA 3IHXA 2RKKA 3I4RB 4RZ0A 2AVPA 4ILGA 4AJWA 3Q15A 3T9KA 1MX2A 2V5FA 1OWNA 1MVXA 2GRQB 2YINA 5BT1A 1HS6A 2V4LA 2QYUA 4CRWA 4D10C 3WG7E 3ULQA 5T8IA 4OVUA 1MYOA 3PEUB 4YNPA 2P9UG 2QFCA 1H6PA 1S70B 2X38A 4EQFA 4ME2A 4EECA 4L2YA 3TWQA 3DSXA 1H2TC 3PE4A 2F37A 5KJKA 1NP7A 4UWFA 4HORA 4HRMB 1MHQA 2LXMA 1MUFA 3DPDA 4E85A 2OEWA 3ENEA 2IGQA 1G3NB 5ENPD 4AU7A 4UWLA 2ZGGA 1ELKA 2OOEA 2RG8A 3PZDA 3URZA 2EIJE 3HXCA 4XZ4A 2GRPB 1FVHA 2LXLA 4YNDA 3DWLG 3F6QA 3G2TA 5A23A 4NJ5A 2VYIA 3EHNA 4FC8A 3ONLA 4BT8A 1FCHA 1Z5SC 2PQNA 3AAAC 2XS1A 4YVQC 4U8VD 3MJWA 3TWXA 3J5QB 4DI4A 3EHMA 5AJDA 2IJGX 4GA0A 2XEHA 3QDNA 2CHXA 2WQ7A 1PY1A 2E2EA 4HOQA 4QEPA 2VGXB 1K1AA 2XPYA 4X8QA 2YNQA 1E96B 4AM9A 4GYWA 3OOIA 2KM4A 3SWCA 3FUMA 2Q7FA 3U4TA 1QBQA 3CV0A 3KSQA 1N0RA 3MO2A 5KJNA 2LAIA 2ETAA 5FZQA 3QWPA 2LSVA 3SBSA 2DYRE 2IO2C 4LNUD 3CVVA 4AY6A 3DSWA 5TH7A 1UN8A 3EDTB 2XRZA 2DBAA 1WM5A 1OY3D 4FP7A 5BPPA 1OCRE 2J4DA 3R7RA 5KNHD 1MT6A 3B95A 4QQIA 1S64A 2BF0X 3JXIA 4J8OA 2QYJA 5TEGA 2ETCA 4G2VA 3U66A 1RW2A 3C72A 3U3WA 3NOCD 1N54A 3T5VA 3APCA 3LCAA 4L23A 4KT6B 4G23A 3EIJA 1TEZA 1D9SA 2A5EA 5A7DB 3D9PA 4KBQA 3B13A 3QAQA 3SHFA 2X6FA 3LJNA 1Z3YA 3GYZA 2DWZA 3PREA 5AN8A 1IHGA 1EPUA 1HE8A 4GZ5A 4K5AB 3FEXA 3FUJA 2FO7A 4NVQA 3RRNB 3LEWA 3M58A 3NF1A 3V31A 2XGOA 3FHEA 1XGWA 5JJTA 3FUDA 3GZSA 5JMND 1OUVA 2R02A 1U3CA 2VSYA 4M7CA 1NFIE 2OEVA 4MI0A 1OWLA 3D9LA 4WWNA 3MGBA 5LX8A 4MBGA 1TNBA 3UKRG 1N4SA 1TJFA 3Q4AB 2C2LA 2IF4A 2RFIA 3MV3B 1AWCB 1E8WA 3DRAA 2WVIA 1OWMA 3QKYA 5FIOA 3PDNA 5E76A 4F6RD 3UT4A 4HXIA 2MRIA 1S63A 2R05A 3AG2E 4G8KA 4UQXA 4JL0A 4F7AA 5JA4D 3LXUX 2L0TB 2Y3AA 4F1PA 3QNKA 3U9WA 4CZ2D 3EHRA 1NZNA 2IO3C 2BQZA 2XRYA 2AJAA 3D9IA 3UM0A 4AVXA 2WXKA 3B7RL 1TN6A 4B93B 5D66A 5JHBA 5BV1A 4ATZD 3M5AA 3SFYA 3CQGB 3FTWA 2KXPC 4C48B 2CG3A 4GZDA 1N6CA 4G26A 2DIWA 3C3OA 3ZW3A 2P9IG 3AS5A 4CEMA 5D0QD 2A4ZA 4DLQA 5CPRB 3CK7A 3CVWA 4I51A 2WXFA 4L7TA 5EG2A 2WQHA 3J5PA 5CHEE 3RRUA 4Y6CA 3IXEA 3FWVA 4PDXA 4I43A 2GRNB 5JIYA 3LY9A 2WQ6A 2VTBB 2NXPA 1V55E 2XQ0A 1N94A 3CVXA 2QC9A 2XZDG 4MKTA 3EP0A 1E8YA 1RZ4A 5D0OD 3CHMA 3DALA 3IV0A 5ITZF 3E33A 5CERB 1K3ZD 5LCWC 2AXZA 4O1PA 4H12A 2LSUA 4OYSA 4I2ZA 4GU5A 3JXJA 4GB9A 3AG1E 3I4GA 2P2CP 2XCCA 3NQPA 4DX2A 1QQEA 4UQYA 2WMOA 3APFA 4WUYA 3KSLA 3TAXA 4R7LA 3HHMA 1FT1A 3ASGA 3LVRE 4P29A 4H7YA 4K03A 4L9PA 2BKGA 2CHZA 5DIZA 4NACA 1QZ2A 4WWPA 2L0IA 4K5BA 2W5YA 1UW4B 4C9BB 1HX8A 2C0MA 4UWGA 3TXNA 3B7TA 3ZXPA 2F8XK 1ZKKA 4NIKA 3PZ4A 3CK9A 3MO5A 5ENTD 4GYYA 5H7PA 4OAUC 2H6IA 4OVVA 1MQSA 1LTXA 4J8DA 3FUHA 1O9SA 2IY0C 3HXBA 3DSTA 1PEGA 1JCRA 1Z3XA 3Q49B 1QYMA 3S2AA 4CCAA 3IKOB 2J4BA 3APDA 3IBEA 4GZ3A 3UTMA 4U04A 3ASFA 5DBKA 5EN5D 2V5QC 4WNFA 3SO8A 2B6CA 2XENA 2BKKB 4IJ8A 3PEVB 2X6KA 3G2WA 5ANRA 1LF8A 3FUFA 5B1AE 3V2XA 4BTAA 4YDYA 3M53A 1EDUA 1NI1A 4JHRA 4N3AA 4UWKA 4JD2G 2AWIA 2RFMA 3CBOA 3AS8A 4MRUA 2BEDA 1SA5A 3LY8A 4RG6A 3O4ZA 1TJCA 1OXJA 3KMAA 3NZUA 1JUQA 5G05J 3TXMA 4PS3A 3UIOC 3OXLA 4A3TA 3CSTA 1E8XA 4DRXE 3CEQA 4B0ZA 2YHCA 2ZIRA 1WDYA 5T5GA 3Q47B 3ZIMA 4NQ0A 5FQ8A 2FI7A 2WXOA 2BTDA 1UJKA 2PZIA 3UMVA 2JLBA 4A55A 2V4HC 4MLPA 3JUIA 3SY2A 3QWVA 1DCEA 4BEPA 2X6JA 4B8CB 4GTTA 5CRUA 4PS8A 5FQ6A 1ML9A 1V54E 4AIFA 4XIFA 3DXMG 1KPSB 4N5QA 4YDOA 4YPEA 4NRHB
chains in the Genus database with same CATH topology
3QB2A 5BPPA 2WXRA 3FU0A 2VGYA 5LSXA 2J4DA 2OV8A 3KEZA 2QPWA 5T0KA 3R7RA 4I2WA 4XI9A 4FADA 1IYGA 4J8SA 3OPEA 3CVUA 4FU3A 1MVHA 1HG5A 3CGHA 1JWFA 4KXKB 1MT6A 2BF0X 4J8OA 1E8ZA 4Q69A 5TEGA 3PS6A 4G2VA 4LDGA 4L1BA 3UUXA 2UY1B 2C0LA 3U66A 3GZ2A 4XX5A 3PH0C 3U3WA 3OTNA 4AEZC 5BUZA 3ZEFA 4CGWA 3HNAA 4JVSA 1N54A 2WMNA 3FY4A 4J0UA 4TV3A 3SNXA 4FA6A 3UX4A 3CBMA 4FHJA 3K5KA 3T5VA 1P5QA 4M3OA 4E47A 3APCA 3LCAA 2LAHA 2NSZA 3PUJA 4KT6B 4L23A 2O8JA 4G23A 4DLOA 3EIJA 1HF8A 3MEKA 1BPOA 2J49A 1TEZA 2KZTA 2IU1A 3FH8A 3D9OA 3FUIA 1IQUA 1SZ9A 3ZVVA 4CGVA 5A7DB 4N3CA 3CHOA 5G04J 3GZ1A 3D9PA 2PM7A 3B13A 1L5JA 3QAQA 4KBQA 3SHFA 4ACKA 3FTUA 5FWQA 3F9ZA 2X6FA 3RU0A 1Z3YA 4N39A 3GYZA 4JA9A 4JEHA 5CMWA 3PREA 2R59A 3KMJA 1EF1C 2I1KA 3F9YA 1IHGA 4CDRA 1YA0A 2UY1A 3FTVA 1EPUA 3LY7A 4GYOA 2M63A 3KS2A 1HE8A 3LKUA 5BW8C 2FBNA 4Y6WA 2VSXE 4GZ5A 3FEXA 3FUJA 5JJ6A 1X5BA 2FO7A 1Y8MA 4G1TA 4NVQA 3ZYQA 1XNFA 5BV0A 3RRNB 4I6GA 2PM6A 3KD7A 3LEWA 3NF1A 3M58A 3S7BA 3T8MA 4GMJA 2XGOA 3VTXA 3PNLB 3RKVA 3LVQE 1HH8A 3CKBA 3FHEA 2HR2A 4WNEA 1XGWA 5FQ7A 5G55A 3CHQA 2IOSA 4URKA 2P58C 3FTXA 5JJTA 3FDHA 3FUDA 3GZSA 4YPAA 3ONKA 5KJMA 4IRUA 1HZ4A 1OUVA 5BNWA 4EBAA 1U3CA 4HVBA 2VSYA 2OVFA 4BUPA 4TRQA 3PUKA 4QEOA 2I9CA 1E90A 4KZ0A 4MI0A 1OWLA 2E0IA 4JA7A 1ZBPA 4JC8A 5G04C 5JJ7A 1U3DA 3OXFA 5TTFA 3GW4A 3D9LA 1E7UA 4C0MA 3HIZA 1JPLA 4FJZA 4UWHA 1Y6IA 3JYSA 4KYOB 4WWNA 1HO8A 3MGBA 4RG9A 3VLDA 3ZYMA 4DPRA 2HO1A 5LX8A 2WB2A 4GMLA 4YPUA 1TJFA 2AXUA 3EIQC 2WXJA 1N6AA 3BO5A 4J8FA 3SGHA 4ANWA 2LO6A 3CKCA 2GRMA 3B7UX 1KT1A 2F69A 3SZ7A 1IQRA 3Q4AB 2C2LA 3CVYA 2IONA 2IF4A 3S7DA 3MV3B 4LERA 2WXMA 3ZPJA 2RFIA 2YHEA 3LS8A 3M55A 4IJDA 2HM8A 1E8WA 2Y4TA 2WVIA 3TJPA 1NA0A 1OWMA 1HU3A 4G11A 3QKYA 4I6JA 1H3IA 3KMTA 2J9QA 3DB5A 3FH7A 4H7XA 3RRMB 3ZHEB 5CCLA 3TGOA 3PDNA 2J07A 4UI9J 5E76A 4ANVA 2FF4A 3UT4A 3RO2A 4HXIA 2XPIA 3BG1B 3SI5A 2MRIA 5HQ8A 4DI3A 4HFGA 4XE0A 4UQXA 5ARGA 4AOFA 5C1DA 3BG0B 2WXGA 4JL0A 3CK8A 3PRZA 4F7AA 2L6JA 3VLEA 4ACLA 4B94A 3LXUX 1E7VA 2L0TB 3D3MA 2Y3AA 3CHPA 4WNDA 3CVPA 3QNKA 4J8EA 4J7IA 5E75A 3EJNA 1HFAA 4YVOA 3U9WA 3ESLA 2WXIA 1HXIA 4GA2A 3RQ4A 5C2YA 1NZNA 1QNFA 3E4BA 3ZHEA 3VUZA 5JHNA 2NC9A 4W9RA 2BQZA 2XRYA 3D9IA 1KT0A 1W3BA 4O6FA 4C0EA 4KMOA 4JXTA 4QENA 5HI7A 3SF4A 3M57A 4WWOA 2J09A 3M59A 4AVXA 4B8AA 2WXKA 4LRZA 3K9IA 3B7RL 3ZN3A 3VV0A 4ILIA 4Z4PA 4UI9C 4EPZA 5JHBA 2XGSA 4I1MA 5BV1A 4JZYA 4RSYA 4GPKA 3M5AA 3LPZA 3CQGB 3FTWA 4U0UA 2CG3A 3I3NA 3RIBA 4GZDA 1N6CA 3S8PA 4EBAG 4G26A 5F59A 2ZU6B 2VSOE 3L54A 2XHEA 4FLHA 4N5CA 5ENNA 2DIWA 4YNMA 4JHJA 1HG2A 2CG2A 3G2SA 3ZW3A 2WXHA 5AYFA 3AS5A 5FZRA 5F5EA 5F6LA 3HVEB 4FHKA 4CEMA 5D0QD 2A4ZA 4DLQA 1PAQA 4HOSA 3IEGA 3FTSA 5CPRB 4HOTA 1WAO1 2BUGA 2ONDA 3AU5A 4AXHA 4CT4A 3M56A 5JINA 3CK7A 3CVWA 4I51A 3LJ3A 4HLEA 1NA3A 3CHRA 3R7QA 2WXFA 4U07A 4L7TA 2AW6A 1OWOA 5EG2A 5FT9A 3R9AB 4IYPA 4L2LA 3AS4A 3CSFA 3HYMB 2WQHA 1XQHA 4BT9A 5LCWJ 5CHEE 3OAWA 3RRUA 2JV0A 4Y6CA 3FWVA 3T5XA 2Y4UA 4BFRA 3D9JA 1N3JA 1UJJA 3ZYKA 4PDXA 3MZLB 2KCKA 4I43A 4N3BA 3DBSA 3UT8A 4LUNU 4UQZA 4WNGA 2I6HA 3CBPA 3L16A 4I1OB 2OVBA 3HVEA 5JIYA 4XI0A 3B7SA 3TL5A 3CVNA 4ANXA 4A1SA 2CHWA 3CIAA 3FU6A 3LY9A 2WXQA 4IN3B 2WQ6A 3G2VA 4KVOA 1S0PA 3UT7A 2VTBB 2NXPA 5J08A 3CQCB 1INZA 4K0RA 5EX0A 2WPVA 3CHSA 5FJYA 5EX3A 4DJAA 2XQ0A 4GCNA 4KVMA 4Q94A 2RD0A 3CLJA 3F9WA 3RAYA 2AXVA 3KAEA 2WM9A 3OXGA 4MKTA 3CVXA 1GW6A 3EP0A 1E8YA 5D0OD 2CFUA 1DNPA 2GRLA 3FFLA 3NZSA 4GCOA 2X3MA 3CHMA 3FP3A 3DALA 2YQ8A 2XCBA 5T0MA 4TUUA 3IV0A 1EYHA 4J6IA 5G2NA 5JJ0A 4IJ8A 3SBTB 4QFVA 5AYWD 2HYZA 5LCWC 3LDZA 4ABNA 1ZU2A 3PE3A 2AXZA 3ESKA 4BTBA 2J08A 4H12A 4B89A 2LSUA 2VTBA 4OYSA 2CFZA 4U8HA 5F6KC 4I2ZA 4GU5A 5LSZA 3JQ1A 3ASHA 3QJZA 4GB9A 4LCTA 2R17C 4PS7A 3I4GA 3RK6A 2X6HA 3MV2B 2XCCA 1H2UA 3SD5A 4U63A 3NQPA 2FULA 4GAAA 4BX8A 1QQEA 4UQYA 4O30A 2GGFA 2WMOA 3APFA 4MS6A 4WUYA 4A1GA 3SW9A 2LNIA 3TAXA 3L13A 4R7LA 3WXXA 1PC2A 3FULA 3HHMA 4KZCA 3ZFWA 2R3AA 4PUCA 1SQMA 2KCLA 3ASGA 2R5SA 3ZRHA 4EZJA 3LVRE 4XKCA 2KCVA 3IHXA 3BEEA 4HS2A 4P29A 2WXNA 4RZ0A 3I4RB 4H7YA 3D9NA 5AIJA 2XGMA 4K03A 1VDYA 4U0ZA 3FU5A 2CHZA 2AVPA 1OWPA 5DIZA 4BY6A 4ILGA 4NACA 4FMUA 4JHKA 1QZ2A 4WWPA 3U64A 4AJWA 3Q15A 2FEZA 2L0IA 3CVQA 2V5FA 3JCKC 4I1AA 4C1QA 5FZSA 4N2SA 2W5YA 1OWNA 1UW4B 4Q96A 4C9BB 1HX8A 3FTZA 2A5UA 2C0MA 1MVXA 4UWGA 3TXNA 3B7TA 3FUNA 3M54A 1ZKKA 2YINA 4V3IA 3S7JA 2DCPA 1HS6A 2PL2A 2V4LA 4CRWA 5ANLA 4D10C 5BT1A 3CK9A 5LP0A 3ULQA 3FPDA 4JW1A 5T8IA 3ZYLA 1DVPA 3MO5A 3QOUA 1ELRA 4J83A 4OVUA 4GYYA 2XEVA 3PEUB 3S7FA 4YNPA 3L6AA 3PNTB 4G25A 2X38A 2QFCA 3FTYA 3MA5A 3UPVA 4EQFA 4ME2A 3FH5A 4EECA 3RJWA 4L2YA 3OS5A 4F3VA 4EZLA 4OVVA 1MQSA 5KCMA 4J8DA 1H2TC 3FUHA 5FTPA 1O9SA 3PE4A 5KJKA 1NP7A 3ZGQA 3D9KA 4UWFA 1PEGA 4AP2A 1Z3XA 2V0PA 4JPSA 4HORA 3Q49B 1KLXA 2L9BA 4EZKA 1UG3A 5AJLA 3S2AA 1MHQA 5KJLA 4FLBA 5J90A 4CCAA 3F9XA 3TG5A 3IKOB 2J4BA 3APDA 4GZ6A 3DPDA 4E85A 3IBEA 1MUFA 4BX9A 5FQ4A 4GZ3A 3ENEA 2IGQA 4U04A 3ASFA 3MKQB 5DBKA 1H19A 4WNFA 2GW1A 5CMYA 3VTYA 4BSXA 1B89A 1ELWA 3CVLA 3ML9A 4GA1A 3FUEA 4G24A 3TG4A 4AU7A 3LYAA 4UWLA 4AY5A 2W5ZA 5EDSA 1ELKA 3PEVB 4JEUA 2OOEA 2X6KA 3ZXSA 4A3VA 3G2WA 2IOLA 2RG8A 3PZDA 5ANRA 4CDNA 1LF8A 3P2BA 3MYVA 3FUFA 5ARFA 2WXLA 3P1UA 3URZA 4HOUA 3IHYA 4BTAA 3D9MA 4I9EA 3MKRA 4XZ4A 2IQCA 3M53A 2PQRA 2VJ8A 1FVHA 1EDUA 4U0SA 4YNDA 1WY6A 4CDMA 5LFAA 4JHRA 5A6CA 4J7FA 2UWJG 3G2TA 3IHVA 3MKQA 4N3AA 5A23A 4NJ5A 2VYIA 4UWKA 3CR3A 1A17A 2IFUA 3EHNA 4FC8A 3ONLA 2AWIA 3PVLA 4BT8A 1FCHA 2ILRA 4AV7A 3ASDA 2PQNA 3AS8A 5T4YA 5T3RA 3CBOA 4MRUA 2XPZA 4F53A 4NURA 4APOA 4JLGA 1H6KA 3SFZA 4YVQC 4XKBA 3L17A 3LY8A 4FULA 4RG6A 2JEKA 3FUKA 1FVFA 1TJCA 3O4ZA 2V8SE 4LEUA 5JHAA 3MJWA 4I17A 3KMAA 2WXPA 3I5PA 4DK5A 5CCMA 4DI4A 2KC7A 1JUQA 3EHMA 3NZUA 5G05J 3G2UA 4PS3A 5AJDA 2IJGX 3TXMA 4CT0A 4GA0A 5M72A 4JDSA 3QDNA 2CHXA 3OXLA 4A3TA 2KATA 3CSTA 2WQ7A 1E8XA 3CEQA 4B0ZA 2YHCA 1PY1A 1H0AA 1Z6TA 3FU3A 2X6IA 4ANUA 1SZAA 1JWGA 4MI5A 2E2EA 4GZCA 2VSNA 3C98A 3Q47B 4HOQA 5T5GA 4RVBA 3ZIMA 4PH4B 3QK0A 4NQ0A 2EQXA 4APFA 3UQ3A 4QEPA 2VGXB 5FQ8A 2G46A 2FI7A 3QC1A 2WXOA 3MCXA 5AENA 2BTDA 2XPYA 4I9CA 1UJKA 2PZIA 2YNQA 1E96B 4AM9A 3L22A 1UN9A 2JLBA 4GYWA 4ILHB 3UMVA 4A55A 2KM4A 3OOIA 3SWCA 3MX3A 3RJVA 3FUMA 2Q7FA 3O48A 3U4TA 3Q5MA 4MLPA 3JUIA 2VQ2A 4UI9K 3CV0A 3QWVA 4I6EA 3HDXA 5EKQD 3MO2A 5KJNA 2LAIA 2X6JA 3RO3A 4B8CB 5FZQA 5G05C 5LOZA 3QWPA 4FJYA 3FEYA 2LSVA 3SBSA 2VGXA 3CVVA 4PS8A 4AY6A 3QWWA 3N71A 5FQ6A 2I1JA 3QARA 5TH7A 1ML9A 2MHKA 1UN8A 4WAFA 4ATGA 1N52A 3EDTB 2MOWA 2XRZA 2QY7A 4BWRA 2DBAA 3JQ0A 4AIFA 3L08A 1WM5A 4E6HA 4XIFA 1H2VC 4N2QA 3MO0A 2I2OA 4FP7A 4F1SA 3ML8A 2KZTB 3VLFA 4YPEA 4NRHB 4IULA 3AU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGY A;  5LSX A;  5T0K A;  2QPW A;  4I2W A;  4XI9 A;  3OPE A;  1IYG A;  1MVH A;  4KXK B;  1MT6 A;  4J8O A;  5TEG A;  4G2V A;  4LDG A;  3UUX A;  2UY1 B;  2C0L A;  3GZ2 A;  3U3W A;  3HNA A;  4CGW A;  4J0U A;  3K5K A;  3CBM A;  1P5Q A;  4E47 A;  3LCA A;  2O8J A;  4G23 A;  3MEK A;  4CGV A;  5A7D B;  4N3C A;  5G04 J;  3GZ1 A;  4KBQ A;  3RU0 A;  4N39 A;  3GYZ A;  4JA9 A;  3KMJ A;  3F9Y A;  1IHG A;  4CDR A;  1YA0 A;  2UY1 A;  3LY7 A;  4GYO A;  3KS2 A;  3LKU A;  5BW8 C;  2FBN A;  4Y6W A;  4GZ5 A;  5JJ6 A;  2FO7 A;  1Y8M A;  4G1T A;  4NVQ A;  1XNF A;  3KD7 A;  3M58 A;  3NF1 A;  3S7B A;  2XGO A;  3VTX A;  3RKV A;  1HH8 A;  3CKB A;  2HR2 A;  4WNE A;  2P58 C;  5JJT A;  4YPA A;  5KJM A;  1OUV A;  1HZ4 A;  5BNW A;  4BUP A;  2VSY A;  4QEO A;  4MI0 A;  4JA7 A;  1ZBP A;  5G04 C;  5JJ7 A;  5TTF A;  3OXF A;  3GW4 A;  3JYS A;  4KYO B;  4RG9 A;  2HO1 A;  4YPU A;  1N6A A;  3BO5 A;  4J8F A;  3CKC A;  1KT1 A;  3SZ7 A;  3Q4A B;  2C2L A;  2IF4 A;  3S7D A;  3MV3 B;  2RFI A;  3ZPJ A;  3M55 A;  4IJD A;  2Y4T A;  3KMT A;  1NA0 A;  1H3I A;  3QKY A;  2J9Q A;  3DB5 A;  4H7X A;  3ZHE B;  5CCL A;  3TGO A;  3PDN A;  4UI9 J;  2FF4 A;  3RO2 A;  2XPI A;  5HQ8 A;  4UQX A;  5ARG A;  5C1D A;  4JL0 A;  3CK8 A;  2L6J A;  4B94 A;  4WND A;  3CVP A;  4J8E A;  4J7I A;  4YVO A;  4GA2 A;  1HXI A;  3RQ4 A;  1NZN A;  3E4B A;  3ZHE A;  3VUZ A;  5JHN A;  2NC9 A;  4W9R A;  2BQZ A;  1KT0 A;  4O6F A;  4QEN A;  5HI7 A;  3SF4 A;  3M57 A;  3M59 A;  3K9I A;  3ZN3 A;  3VV0 A;  4Z4P A;  4UI9 C;  2XGS A;  4GPK A;  3M5A A;  3LPZ A;  4U0U A;  3RIB A;  1N6C A;  3S8P A;  4G26 A;  4N5C A;  4YNM A;  5AYF A;  3AS5 A;  5FZR A;  5F5E A;  5F6L A;  5D0Q D;  4HOS A;  5CPR B;  3IEG A;  4HOT A;  1WAO 1;  2BUG A;  2OND A;  3M56 A;  5JIN A;  3CK7 A;  4I51 A;  1NA3 A;  5EG2 A;  5FT9 A;  3R9A B;  3AS4 A;  3HYM B;  2WQH A;  1XQH A;  4BT9 A;  5LCW J;  5CHE E;  2JV0 A;  4Y6C A;  3FWV A;  2Y4U A;  1N3J A;  2KCK A;  4N3B A;  4UQZ A;  4WNG A;  2I6H A;  3CBP A;  5JIY A;  4XI0 A;  3CVN A;  4A1S A;  3LY9 A;  4IN3 B;  5EX0 A;  2WPV A;  5FJY A;  5EX3 A;  4GCN A;  3F9W A;  3RAY A;  3KAE A;  3OXG A;  3EP0 A;  5D0O D;  3FFL A;  4GCO A;  3DAL A;  3FP3 A;  2YQ8 A;  2XCB A;  5T0M A;  5JJ0 A;  5AYW D;  2HYZ A;  5LCW C;  4ABN A;  1ZU2 A;  3PE3 A;  3ESK A;  4BTB A;  4H12 A;  2LSU A;  5F6K C;  4I2Z A;  5LSZ A;  3ASH A;  3MV2 B;  2XCC A;  1QQE A;  4UQY A;  4O30 A;  4WUY A;  3SW9 A;  2LNI A;  3TAX A;  3WXX A;  1PC2 A;  2R3A A;  3ZFW A;  2KCL A;  3ASG A;  2R5S A;  2KCV A;  3IHX A;  3BEE A;  4RZ0 A;  4H7Y A;  2XGM A;  4U0Z A;  2AVP A;  5DIZ A;  4FMU A;  1QZ2 A;  3Q15 A;  2FEZ A;  3CVQ A;  2V5F A;  4I1A A;  4C1Q A;  5FZS A;  4N2S A;  2W5Y A;  1MVX A;  2C0M A;  3M54 A;  1ZKK A;  3S7J A;  5BT1 A;  2PL2 A;  3CK9 A;  3ULQ A;  3FPD A;  4J83 A;  3MO5 A;  3QOU A;  1ELR A;  4GYY A;  2XEV A;  3S7F A;  4YNP A;  4G25 A;  2QFC A;  3MA5 A;  3UPV A;  4EQF A;  4ME2 A;  3RJW A;  3OS5 A;  4F3V A;  4J8D A;  5FTP A;  1O9S A;  3PE4 A;  5KJK A;  3ZGQ A;  1PEG A;  3F9Z A;  2F69 A;  5F59 A;  4HOR A;  3Q49 B;  1KLX A;  5KJL A;  3F9X A;  3TG5 A;  4GZ6 A;  1MUF A;  4GZ3 A;  2IGQ A;  4U04 A;  3ASF A;  5DBK A;  4WNF A;  2GW1 A;  3VTY A;  1B89 A;  1ELW A;  3CVL A;  4GA1 A;  4G24 A;  3TG4 A;  4AU7 A;  3LYA A;  4AY5 A;  2W5Z A;  4IJ8 A;  2OOE A;  5ARF A;  3URZ A;  4HOU A;  4BTA A;  4I9E A;  3MKR A;  3M53 A;  2PQR A;  4U0S A;  4YND A;  4JHR A;  5A6C A;  4J7F A;  2UWJ G;  4N3A A;  4NJ5 A;  2VYI A;  1A17 A;  2IFU A;  4BT8 A;  1FCH A;  3ASD A;  2PQN A;  3AS8 A;  3CBO A;  4APO A;  4JLG A;  4YVQ C;  3LY8 A;  4RG6 A;  1TJC A;  4LEU A;  4I17 A;  3KMA A;  5CCM A;  2KC7 A;  5G05 J;  4GA0 A;  5M72 A;  4JDS A;  3QDN A;  3OXL A;  2KAT A;  3CEQ A;  2YHC A;  4MI5 A;  2E2E A;  2VSN A;  5T5G A;  3Q47 B;  4HOQ A;  4NQ0 A;  4QEP A;  3UQ3 A;  2VGX B;  2G46 A;  2FI7 A;  4I9C A;  2PZI A;  1E96 B;  4AM9 A;  4GYW A;  2JLB A;  3OOI A;  3SWC A;  3RJV A;  2Q7F A;  3O48 A;  3U4T A;  3Q5M A;  2VQ2 A;  4UI9 K;  3CV0 A;  3QWV A;  5EKQ D;  3MO2 A;  5KJN A;  3RO3 A;  5FZQ A;  5G05 C;  3QWP A;  2LSV A;  2VGX A;  4AY6 A;  3QWW A;  3N71 A;  5TH7 A;  1ML9 A;  2MHK A;  3EDT B;  4BWR A;  2DBA A;  4AIF A;  1WM5 A;  4XIF A;  4N2Q A;  3MO0 A;  4YPE A;  4NRH B;  4U07 A;  1W3B A; 
#chains in the Genus database with same CATH topology
 3QB2 A;  2WXR A;  2VGY A;  3KEZ A;  2GRR B;  4FAD A;  4J8S A;  3CVU A;  3C3R A;  1MVH A;  3BU8 A;  3CGH A;  2P9K G;  4Q69 A;  4LDG A;  4L1B A;  3NOG D;  5KWD A;  3PH0 C;  2ETB A;  3ZEF A;  4J0U A;  3FY4 A;  4FA6 A;  3SNX A;  3CBM A;  4FHJ A;  1P5Q A;  4E47 A;  2LAH A;  2DZN A;  4DLO A;  1BPO A;  2J49 A;  2KZT A;  4DX7 D;  3FH8 A;  3CHO A;  2PM7 A;  5BXU A;  3FTU A;  5FWQ A;  5CMW A;  1EF1 C;  4CDR A;  3LY7 A;  2UY1 A;  2DZO A;  1BU9 A;  3X2Q E;  1Y8M A;  3T8M A;  4GMJ A;  3VTX A;  3PNL B;  3RKV A;  3DSV A;  3CKB A;  3JUE A;  5FQ7 A;  5G55 A;  3UM3 A;  4BET A;  5KJM A;  4IRU A;  4EBA A;  3NB2 A;  4BUP A;  3AG4 E;  3PUK A;  2I9C A;  1E90 A;  4KZ0 A;  1OT8 A;  2E0I A;  1ZBP A;  5B1B E;  5G04 C;  5JJ7 A;  1U3D A;  3OXF A;  5TTF A;  1JPL A;  4FJZ A;  4UWH A;  4DPR A;  2HO1 A;  2WB2 A;  3ABK E;  3EIQ C;  2WXJ A;  4ZFH A;  4HNA D;  4ANW A;  2GRM A;  2ION A;  4U8Y D;  2YHE A;  3M55 A;  4IJD A;  1NA0 A;  1HU3 A;  1H3I A;  4I6J A;  2IEJ A;  3TGO A;  4UI9 J;  2J07 A;  3RO2 A;  3E32 A;  3SI5 A;  3BUA A;  4DI3 A;  4XE0 A;  1YMP A;  2WXG A;  3UKU G;  3CK8 A;  4B94 A;  1E7V A;  5ENQ D;  4WND A;  4J7I A;  4YVO A;  3EHQ A;  3RQ4 A;  3SFX A;  5C2Y A;  3ZHE A;  3VUZ A;  4LNB A;  4DX5 D;  4HQD A;  5AQB A;  4O6F A;  4C0E A;  4JXT A;  4QEN A;  5HI7 A;  3M57 A;  3K9I A;  5CEC B;  3ZN3 A;  4ILI A;  3NBN B;  2XGS A;  4I1M A;  4GPK A;  1UOH A;  4JZY A;  4U0U A;  4EBA G;  1FT2 A;  2ZU6 B;  2VSO E;  4YNM A;  5AYF A;  3UIP C;  3FTS A;  2BUG A;  3M56 A;  2ZXW E;  5JIN A;  3EU5 A;  3CHR A;  3R7Q A;  3T8K A;  5EIL A;  3R9A B;  3AS4 A;  1XQH A;  4BT9 A;  1O1S A;  4RLY A;  1N3J A;  3D9J A;  4LUN U;  4UQZ A;  4J8Y A;  4WNG A;  3ISM C;  2I6H A;  3RAU A;  1IKN D;  3HVE A;  1N95 A;  3TL5 A;  3CVN A;  4ANX A;  3CIA A;  3FU6 A;  1S0P A;  3UT7 A;  4HLL A;  4K0R A;  5EX0 A;  4DJA A;  5EX3 A;  4GCN A;  3F9W A;  3KAE A;  1IXV A;  4GCO A;  2X3M A;  3FP3 A;  3LDZ A;  4BTB A;  1TR4 A;  4DX6 D;  4U8H A;  1WG0 A;  3QJZ A;  1TN7 A;  4LCT A;  2R17 C;  4PS7 A;  3L9T A;  3MV2 B;  1JCS A;  4BX8 A;  3AG3 E;  4MS6 A;  4A1G A;  2NYJ A;  3WXX A;  4LG6 A;  4KZC A;  2F8Y A;  4PUC A;  1SQM A;  2KCL A;  2R5S A;  4EZJ A;  3BEE A;  4HS2 A;  3D9N A;  3UM1 A;  1VDY A;  1BD8 A;  1OWP A;  4FMU A;  4JHK A;  3U64 A;  3CVQ A;  1FPP A;  4I1A A;  4C1Q A;  4Q96 A;  5ENO D;  3FTZ A;  3FUN A;  5CBN A;  3M54 A;  3S7J A;  2PL2 A;  2EIK E;  4J83 A;  3ZYL A;  1DVP A;  2DVW A;  2XEV A;  3S7F A;  5EIB E;  5IY5 E;  3L6A A;  3PNT B;  2Y0B G;  4G25 A;  1U2V G;  2OCC E;  3UPV A;  3RJW A;  4EZL A;  3ASO E;  3ZGQ A;  3D9K A;  3Q9N C;  2V0P A;  2F69 A;  3F9Z A;  1KLX A;  1UG3 A;  5AJL A;  5KJL A;  2EIL E;  4GZ6 A;  5FQ4 A;  5CMY A;  1B89 A;  1ELW A;  3ML9 A;  4GA1 A;  3TG4 A;  3LYA A;  4AY5 A;  3L82 A;  5EDS A;  4JEU A;  3ZXS A;  4A3V A;  3DPY A;  1OCO E;  2WXL A;  4HOU A;  3IHY A;  2IQC A;  2PQR A;  4U0S A;  1WY6 A;  1N0Q A;  4CDM A;  4J7F A;  2UWJ G;  3IHV A;  3MKQ A;  2JAB A;  3CR3 A;  2IFU A;  3PVL A;  2ILR A;  4AV7 A;  5T4Y A;  4TXP A;  5EID A;  2XPZ A;  4NUR A;  4JLG A;  3SFZ A;  4XKB A;  3L17 A;  4FUL A;  3ZUV B;  2JEK A;  1FVF A;  5JHA A;  2V8S E;  4I17 A;  2WXP A;  3I5P A;  4DK5 A;  5CCM A;  5BV0 A;  3G2U A;  4U7E B;  4GMR A;  3UM2 A;  2KAT A;  1TYQ G;  4TXR A;  1K8K G;  2X6I A;  4ANU A;  1O5M A;  4GZC A;  2PNN A;  4GTQ A;  3QK0 A;  4APF A;  2EQX A;  4RQI A;  2G46 A;  3MCX A;  4I9C A;  3L22 A;  1UN9 A;  3RJV A;  3O48 A;  4TXQ A;  3Q5M A;  2VQ2 A;  4I6E A;  5EKQ D;  3RO3 A;  3QWW A;  3N71 A;  2I1J A;  2R2L A;  2MHK A;  4K5C A;  4WAF A;  4ATG A;  2QY7 A;  4OAV B;  4BWR A;  4XEI G;  1H2V C;  4N2Q A;  3MO0 A;  3ML8 A;  2KZT B;  4U07 A;  4IUL A;  1O1R A;  5LSX A;  4HRL A;  2DYS E;  4XI9 A;  1HG5 A;  3KEA A;  4KXK B;  3PS6 A;  2ZGD A;  3UUX A;  2UY1 B;  2C0L A;  4XX5 A;  3ASN E;  4AEZ C;  5BUZ A;  4CGW A;  1MX6 A;  4JVS A;  4TV3 A;  4M3O A;  3PUJ A;  3MEK A;  3TWU A;  2IU1 A;  3D9O A;  3FUI A;  3ZVV A;  4CGV A;  4N3C A;  4HI9 A;  5AAO A;  4CYM D;  4N39 A;  4JA9 A;  2R59 A;  3KMJ A;  3F9Y A;  1YA0 A;  3FTV A;  2M63 A;  5HRY A;  3LKU A;  1OCZ E;  2FBN A;  2VSX E;  5JJ6 A;  1NL4 A;  4G1T A;  3ZYQ A;  4I6G A;  3KD7 A;  3S7B A;  1IHB A;  4WNE A;  5D2M C;  4URK A;  4YPA A;  3ONK A;  1HZ4 A;  2LUH A;  5BNW A;  2P9L G;  4TRQ A;  4QEO A;  4DUI A;  4JC8 A;  3GW4 A;  1E7U A;  4C0M A;  3HIZ A;  1Y6I A;  3JYS A;  1TN8 A;  4GML A;  2EIN E;  3AJI A;  4J8F A;  3BO5 A;  3CKC A;  4LER A;  2WXM A;  1SVX A;  2VGE A;  3LS8 A;  2HM8 A;  2Y4T A;  3TJP A;  1N4P A;  3TWV A;  4G11 A;  2J9Q A;  3FH7 A;  4O60 A;  4H7X A;  3ZHE B;  4ANV A;  2FF4 A;  2P9S G;  1TNY A;  2XPI A;  5HQ8 A;  3UIN C;  4HFG A;  3BG0 B;  3VLE A;  1BI8 B;  3D3M A;  3CHP A;  3EJN A;  1HFA A;  1KZP A;  4GA2 A;  1HXI A;  3EUV A;  3E4B A;  4W9R A;  4HRN A;  2R03 A;  4KMO A;  4WWO A;  1X81 A;  2J09 A;  3PZ3 A;  4LRZ A;  3VV0 A;  3HXD A;  4TUM A;  2QZA A;  3RIB A;  3S8P A;  4GTS A;  3L54 A;  5ENN A;  4FLH A;  1N9A A;  5EYP F;  2GRO B;  3V79 K;  5F6L A;  3HVE B;  4FHK A;  1PAQ A;  4HOT A;  1WAO 1;  3HXE A;  4AXH A;  4HLE A;  2MYO A;  5FT9 A;  4IYP A;  1YYH A;  4Z68 A;  3HYM B;  5LCW J;  5CEA A;  3OAW A;  3Q78 A;  2JV0 A;  1JCQ A;  3T5X A;  4BFR A;  5CBO A;  3ZYK A;  2KBX A;  3CBP A;  4I1O B;  1MX4 A;  2OVB A;  3B7S A;  3W9G A;  4A1S A;  2CHW A;  2WXQ A;  4IN3 B;  5FIN A;  3G2V A;  1TNO A;  4KVO A;  3SQV A;  4JB8 P;  3CQC B;  5FJY A;  2WPV A;  4KVM A;  4Q94 A;  2RD0 A;  3CLJ A;  3Q73 A;  5HKP A;  2AXV A;  5AQ7 A;  2XS8 A;  3HXF A;  1DNP A;  2GRL A;  3NZS A;  3DEP A;  4HB5 A;  2YQ8 A;  5T0M A;  1EYH A;  5G2N A;  3SBT B;  4QFV A;  5AYW D;  1DCQ A;  3E37 A;  4ABN A;  1ZU2 A;  3PE3 A;  2J08 A;  1KZO A;  4YDE A;  2CFZ A;  1A5E A;  3JQ1 A;  1BLX B;  2X6H A;  3UI2 A;  1H2U A;  4U63 A;  2FUL A;  3E34 A;  4O30 A;  2GGF A;  3PZ1 A;  3L13 A;  2R3A A;  2Y1L E;  3ZRH A;  3ABM E;  3ULY A;  2WXN A;  5AIJ A;  2XGM A;  4U0Z A;  3FU5 A;  4BY6 A;  1D8D A;  2FEZ A;  2P9P G;  3JCK C;  5FZS A;  4N2S A;  4U95 D;  2A5U A;  4V3I A;  2DCP A;  5ANL A;  5LP0 A;  3FPD A;  4JW1 A;  3QOU A;  1ELR A;  4HBD A;  3DSU A;  3FTY A;  3MA5 A;  3FH5 A;  3OS5 A;  4F3V A;  5KCM A;  5FTP A;  1AP7 A;  4AP2 A;  5F59 A;  4JPS A;  4EZK A;  2L9B A;  2XZT G;  5J90 A;  4FLB A;  3F9X A;  3TG5 A;  3ABL E;  4BX9 A;  5CRV A;  3MKQ B;  4BSX A;  1H19 A;  2GW1 A;  3VTY A;  1MJ0 A;  3CVL A;  3FUE A;  4G24 A;  2J8S D;  2W5Z A;  2H6H A;  4CDN A;  2IOL A;  3P2B A;  3MYV A;  4ZHB A;  1N4Q A;  3TWT A;  5ARF A;  3P1U A;  3D9M A;  4I9E A;  3MKR A;  2EIM E;  2VJ8 A;  3Q7F A;  3ZNG A;  4LSZ E;  5LFA A;  5A6C A;  3Q9U C;  3ZKJ A;  1A17 A;  3RSE G;  3ASD A;  5T3R A;  4F53 A;  4APO A;  1H6K A;  3FUK A;  4LEU A;  3HRA A;  4GTR A;  1Q2Z A;  2KC7 A;  4CT0 A;  5M72 A;  3UXG A;  4JDS A;  1O1T A;  1H0A A;  1Z6T A;  3FU3 A;  1N11 A;  1SZA A;  1JWG A;  1K1B A;  3DSS A;  3HG0 D;  4MI5 A;  2VSN A;  3C98 A;  4RVB A;  1LD7 A;  4PH4 B;  3UQ3 A;  3DXK G;  2F0Y A;  3QC1 A;  5AEN A;  2RFA A;  3ZU7 B;  4ILH B;  3MX3 A;  4UI9 K;  4GPM A;  3HDX A;  5G05 C;  5LOZ A;  4GTM A;  4HI8 A;  4FJY A;  3FEY A;  5BXO A;  2VGX A;  3QAR A;  1SW6 A;  3Q7A A;  1BI7 B;  1TNZ A;  1N52 A;  2MOW A;  3JQ0 A;  3L08 A;  4E6H A;  2I2O A;  4EHM A;  4F1S A;  3B7B A;  3VLF A;  3AU4 A;  1W3B A;  4BES A;  3FU0 A;  5T0K A;  2OV8 A;  2QPW A;  2XEE A;  4I2W A;  2Y69 E;  3OPE A;  1IYG A;  3E30 A;  4FU3 A;  4J7W A;  2ZIS A;  1JWF A;  4UUC A;  1E8Z A;  5KNG A;  3GZ2 A;  5ENS D;  3OTN A;  3HNA A;  2WMN A;  3K5K A;  2H6G A;  3UX4 A;  2NSZ A;  4GTV A;  2O8J A;  1H6O A;  1HF8 A;  1LD8 A;  1IQU A;  1SZ9 A;  5G04 J;  3TWW A;  3GZ1 A;  3NAW A;  1L5J A;  4ACK A;  3RU0 A;  4JEH A;  2I1K A;  3V30 A;  4GYO A;  3KS2 A;  5BW8 C;  4Y6W A;  1ZB1 A;  1X5B A;  1XNF A;  2PM6 A;  3V2O A;  1MZC A;  3W9F A;  1N4R A;  3LVQ E;  1HH8 A;  3EU9 A;  2HR2 A;  3CHQ A;  2IOS A;  2P58 C;  3FTX A;  3FDH A;  1D8E A;  3PZ2 A;  4HVB A;  2OVF A;  4JA7 A;  4KYO B;  1HO8 A;  4RG9 A;  3VLD A;  3ZYM A;  5AQA A;  4YPU A;  2AXU A;  1N6A A;  4O1O A;  3SGH A;  3BQO A;  2LO6 A;  2B0O E;  3B7U X;  1KT1 A;  3SZ7 A;  1IQR A;  3CVY A;  3S7D A;  3ZPJ A;  4BER A;  3KMT A;  3ULE G;  3DB5 A;  5CCL A;  3RRM B;  4BSZ B;  3BG1 B;  1YCS B;  4AOF A;  5ARG A;  5C1D A;  3PRZ A;  2L6J A;  4ACL A;  3CVP A;  4J8E A;  5E75 A;  3ESL A;  2WXI A;  3Q79 A;  1QNF A;  5AAR A;  5JHN A;  2NC9 A;  3DEO A;  1KT0 A;  3SF4 A;  3M59 A;  4U96 D;  4B8A A;  3Q75 A;  4Z4P A;  4UI9 C;  4EPZ A;  4DX1 A;  5HS0 A;  4RSY A;  3LPZ A;  3I3N A;  2XHE A;  4N5C A;  4JHJ A;  3R9M A;  1HG2 A;  2CG2 A;  3G2S A;  4A63 B;  2WXH A;  5FZR A;  2P9N G;  5F5E A;  4HOS A;  3IEG A;  4CT4 A;  2OND A;  3AU5 A;  3LJ3 A;  1NA3 A;  2AW6 A;  1OWO A;  4L2L A;  3CSF A;  3TWR A;  3D9H A;  4GTO A;  2Y4U A;  1UJJ A;  3MZL B;  2KCK A;  4N3B A;  3UT8 A;  3DBS A;  5KBA A;  3L16 A;  1SA4 A;  4XI0 A;  3TWS A;  5B3S E;  5J08 A;  1INZ A;  3CHS A;  3RAY A;  2FO1 E;  2WM9 A;  3OXG A;  5ENR D;  1GW6 A;  2CFU A;  3FFL A;  1TNU A;  4YDW A;  3C5R A;  2XCB A;  4TUU A;  4J6I A;  5JJ0 A;  2HYZ A;  4GTP A;  3ESK A;  4B89 A;  2VTB A;  2H6F A;  5CED B;  5F6K C;  2HE0 A;  5LSZ A;  3ASH A;  5AQ9 A;  4LNG A;  3C3Q A;  3RK6 A;  5EYL A;  3SD5 A;  4GAA A;  2L6B A;  1OCC E;  3SW9 A;  2LNI A;  1DC2 A;  1PC2 A;  3FUL A;  4G8L A;  3ZFW A;  4XKC A;  2KCV A;  3IHX A;  2RKK A;  3I4R B;  4RZ0 A;  2AVP A;  4ILG A;  4AJW A;  3Q15 A;  3T9K A;  1MX2 A;  2V5F A;  1OWN A;  1MVX A;  2GRQ B;  2YIN A;  5BT1 A;  1HS6 A;  2V4L A;  2QYU A;  4CRW A;  4D10 C;  3WG7 E;  3ULQ A;  5T8I A;  4OVU A;  1MYO A;  3PEU B;  4YNP A;  2P9U G;  2QFC A;  1H6P A;  1S70 B;  2X38 A;  4EQF A;  4ME2 A;  4EEC A;  4L2Y A;  3TWQ A;  3DSX A;  1H2T C;  3PE4 A;  2F37 A;  5KJK A;  1NP7 A;  4UWF A;  4HOR A;  4HRM B;  1MHQ A;  2LXM A;  1MUF A;  3DPD A;  4E85 A;  2OEW A;  3ENE A;  2IGQ A;  1G3N B;  5ENP D;  4AU7 A;  4UWL A;  2ZGG A;  1ELK A;  2OOE A;  2RG8 A;  3PZD A;  3URZ A;  2EIJ E;  3HXC A;  4XZ4 A;  2GRP B;  1FVH A;  2LXL A;  4YND A;  3DWL G;  3F6Q A;  3G2T A;  5A23 A;  4NJ5 A;  2VYI A;  3EHN A;  4FC8 A;  3ONL A;  4BT8 A;  1FCH A;  1Z5S C;  2PQN A;  3AAA C;  2XS1 A;  4YVQ C;  4U8V D;  3MJW A;  3TWX A;  3J5Q B;  4DI4 A;  3EHM A;  5AJD A;  2IJG X;  4GA0 A;  2XEH A;  3QDN A;  2CHX A;  2WQ7 A;  1PY1 A;  2E2E A;  4HOQ A;  4QEP A;  2VGX B;  1K1A A;  2XPY A;  4X8Q A;  2YNQ A;  1E96 B;  4AM9 A;  4GYW A;  3OOI A;  2KM4 A;  3SWC A;  3FUM A;  2Q7F A;  3U4T A;  1QBQ A;  3CV0 A;  3KSQ A;  1N0R A;  3MO2 A;  5KJN A;  2LAI A;  2ETA A;  5FZQ A;  3QWP A;  2LSV A;  3SBS A;  2DYR E;  2IO2 C;  4LNU D;  3CVV A;  4AY6 A;  3DSW A;  5TH7 A;  1UN8 A;  3EDT B;  2XRZ A;  2DBA A;  1WM5 A;  1OY3 D;  4FP7 A;  5BPP A;  1OCR E;  2J4D A;  3R7R A;  5KNH D;  1MT6 A;  3B95 A;  4QQI A;  1S64 A;  2BF0 X;  3JXI A;  4J8O A;  2QYJ A;  5TEG A;  2ETC A;  4G2V A;  3U66 A;  1RW2 A;  3C72 A;  3U3W A;  3NOC D;  1N54 A;  3T5V A;  3APC A;  3LCA A;  4L23 A;  4KT6 B;  4G23 A;  3EIJ A;  1TEZ A;  1D9S A;  2A5E A;  5A7D B;  3D9P A;  4KBQ A;  3B13 A;  3QAQ A;  3SHF A;  2X6F A;  3LJN A;  1Z3Y A;  3GYZ A;  2DWZ A;  3PRE A;  5AN8 A;  1IHG A;  1EPU A;  1HE8 A;  4GZ5 A;  4K5A B;  3FEX A;  3FUJ A;  2FO7 A;  4NVQ A;  3RRN B;  3LEW A;  3M58 A;  3NF1 A;  3V31 A;  2XGO A;  3FHE A;  1XGW A;  5JJT A;  3FUD A;  3GZS A;  5JMN D;  1OUV A;  2R02 A;  1U3C A;  2VSY A;  4M7C A;  1NFI E;  2OEV A;  4MI0 A;  1OWL A;  3D9L A;  4WWN A;  3MGB A;  5LX8 A;  4MBG A;  1TNB A;  3UKR G;  1N4S A;  1TJF A;  3Q4A B;  2C2L A;  2IF4 A;  2RFI A;  3MV3 B;  1AWC B;  1E8W A;  3DRA A;  2WVI A;  1OWM A;  3QKY A;  5FIO A;  3PDN A;  5E76 A;  4F6R D;  3UT4 A;  4HXI A;  2MRI A;  1S63 A;  2R05 A;  3AG2 E;  4G8K A;  4UQX A;  4JL0 A;  4F7A A;  5JA4 D;  3LXU X;  2L0T B;  2Y3A A;  4F1P A;  3QNK A;  3U9W A;  4CZ2 D;  3EHR A;  1NZN A;  2IO3 C;  2BQZ A;  2XRY A;  2AJA A;  3D9I A;  3UM0 A;  4AVX A;  2WXK A;  3B7R L;  1TN6 A;  4B93 B;  5D66 A;  5JHB A;  5BV1 A;  4ATZ D;  3M5A A;  3SFY A;  3CQG B;  3FTW A;  2KXP C;  4C48 B;  2CG3 A;  4GZD A;  1N6C A;  4G26 A;  2DIW A;  3C3O A;  3ZW3 A;  2P9I G;  3AS5 A;  4CEM A;  5D0Q D;  2A4Z A;  4DLQ A;  5CPR B;  3CK7 A;  3CVW A;  4I51 A;  2WXF A;  4L7T A;  5EG2 A;  2WQH A;  3J5P A;  5CHE E;  3RRU A;  4Y6C A;  3IXE A;  3FWV A;  4PDX A;  4I43 A;  2GRN B;  5JIY A;  3LY9 A;  2WQ6 A;  2VTB B;  2NXP A;  1V55 E;  2XQ0 A;  1N94 A;  3CVX A;  2QC9 A;  2XZD G;  4MKT A;  3EP0 A;  1E8Y A;  1RZ4 A;  5D0O D;  3CHM A;  3DAL A;  3IV0 A;  5ITZ F;  3E33 A;  5CER B;  1K3Z D;  5LCW C;  2AXZ A;  4O1P A;  4H12 A;  2LSU A;  4OYS A;  4I2Z A;  4GU5 A;  3JXJ A;  4GB9 A;  3AG1 E;  3I4G A;  2P2C P;  2XCC A;  3NQP A;  4DX2 A;  1QQE A;  4UQY A;  2WMO A;  3APF A;  4WUY A;  3KSL A;  3TAX A;  4R7L A;  3HHM A;  1FT1 A;  3ASG A;  3LVR E;  4P29 A;  4H7Y A;  4K03 A;  4L9P A;  2BKG A;  2CHZ A;  5DIZ A;  4NAC A;  1QZ2 A;  4WWP A;  2L0I A;  4K5B A;  2W5Y A;  1UW4 B;  4C9B B;  1HX8 A;  2C0M A;  4UWG A;  3TXN A;  3B7T A;  3ZXP A;  2F8X K;  1ZKK A;  4NIK A;  3PZ4 A;  3CK9 A;  3MO5 A;  5ENT D;  4GYY A;  5H7P A;  4OAU C;  2H6I A;  4OVV A;  1MQS A;  1LTX A;  4J8D A;  3FUH A;  1O9S A;  2IY0 C;  3HXB A;  3DST A;  1PEG A;  1JCR A;  1Z3X A;  3Q49 B;  1QYM A;  3S2A A;  4CCA A;  3IKO B;  2J4B A;  3APD A;  3IBE A;  4GZ3 A;  3UTM A;  4U04 A;  3ASF A;  5DBK A;  5EN5 D;  2V5Q C;  4WNF A;  3SO8 A;  2B6C A;  2XEN A;  2BKK B;  4IJ8 A;  3PEV B;  2X6K A;  3G2W A;  5ANR A;  1LF8 A;  3FUF A;  5B1A E;  3V2X A;  4BTA A;  4YDY A;  3M53 A;  1EDU A;  1NI1 A;  4JHR A;  4N3A A;  4UWK A;  4JD2 G;  2AWI A;  2RFM A;  3CBO A;  3AS8 A;  4MRU A;  2BED A;  1SA5 A;  3LY8 A;  4RG6 A;  3O4Z A;  1TJC A;  1OXJ A;  3KMA A;  3NZU A;  1JUQ A;  5G05 J;  3TXM A;  4PS3 A;  3UIO C;  3OXL A;  4A3T A;  3CST A;  1E8X A;  4DRX E;  3CEQ A;  4B0Z A;  2YHC A;  2ZIR A;  1WDY A;  5T5G A;  3Q47 B;  3ZIM A;  4NQ0 A;  5FQ8 A;  2FI7 A;  2WXO A;  2BTD A;  1UJK A;  2PZI A;  3UMV A;  2JLB A;  4A55 A;  2V4H C;  4MLP A;  3JUI A;  3SY2 A;  3QWV A;  1DCE A;  4BEP A;  2X6J A;  4B8C B;  4GTT A;  5CRU A;  4PS8 A;  5FQ6 A;  1ML9 A;  1V54 E;  4AIF A;  4XIF A;  3DXM G;  1KPS B;  4N5Q A;  4YDO A;  4YPE A;  4NRH B; 
#chains in the Genus database with same CATH homology
 3QB2 A;  5BPP A;  2WXR A;  3FU0 A;  2VGY A;  5LSX A;  2J4D A;  2OV8 A;  3KEZ A;  2QPW A;  5T0K A;  3R7R A;  4I2W A;  4XI9 A;  4FAD A;  1IYG A;  4J8S A;  3OPE A;  3CVU A;  4FU3 A;  1MVH A;  1HG5 A;  3CGH A;  1JWF A;  4KXK B;  1MT6 A;  2BF0 X;  4J8O A;  1E8Z A;  4Q69 A;  5TEG A;  3PS6 A;  4G2V A;  4LDG A;  4L1B A;  3UUX A;  2UY1 B;  2C0L A;  3U66 A;  3GZ2 A;  4XX5 A;  3PH0 C;  3U3W A;  3OTN A;  4AEZ C;  5BUZ A;  3ZEF A;  4CGW A;  3HNA A;  4JVS A;  1N54 A;  2WMN A;  3FY4 A;  4J0U A;  4TV3 A;  3SNX A;  4FA6 A;  3UX4 A;  3CBM A;  4FHJ A;  3K5K A;  3T5V A;  1P5Q A;  4M3O A;  4E47 A;  3APC A;  3LCA A;  2LAH A;  2NSZ A;  3PUJ A;  4KT6 B;  4L23 A;  2O8J A;  4G23 A;  4DLO A;  3EIJ A;  1HF8 A;  3MEK A;  1BPO A;  2J49 A;  1TEZ A;  2KZT A;  2IU1 A;  3FH8 A;  3D9O A;  3FUI A;  1IQU A;  1SZ9 A;  3ZVV A;  4CGV A;  5A7D B;  4N3C A;  3CHO A;  5G04 J;  3GZ1 A;  3D9P A;  2PM7 A;  3B13 A;  1L5J A;  3QAQ A;  4KBQ A;  3SHF A;  4ACK A;  3FTU A;  5FWQ A;  3F9Z A;  2X6F A;  3RU0 A;  1Z3Y A;  4N39 A;  3GYZ A;  4JA9 A;  4JEH A;  5CMW A;  3PRE A;  2R59 A;  3KMJ A;  1EF1 C;  2I1K A;  3F9Y A;  1IHG A;  4CDR A;  1YA0 A;  2UY1 A;  3FTV A;  1EPU A;  3LY7 A;  4GYO A;  2M63 A;  3KS2 A;  1HE8 A;  3LKU A;  5BW8 C;  2FBN A;  4Y6W A;  2VSX E;  4GZ5 A;  3FEX A;  3FUJ A;  5JJ6 A;  1X5B A;  2FO7 A;  1Y8M A;  4G1T A;  4NVQ A;  3ZYQ A;  1XNF A;  5BV0 A;  3RRN B;  4I6G A;  2PM6 A;  3KD7 A;  3LEW A;  3NF1 A;  3M58 A;  3S7B A;  3T8M A;  4GMJ A;  2XGO A;  3VTX A;  3PNL B;  3RKV A;  3LVQ E;  1HH8 A;  3CKB A;  3FHE A;  2HR2 A;  4WNE A;  1XGW A;  5FQ7 A;  5G55 A;  3CHQ A;  2IOS A;  4URK A;  2P58 C;  3FTX A;  5JJT A;  3FDH A;  3FUD A;  3GZS A;  4YPA A;  3ONK A;  5KJM A;  4IRU A;  1HZ4 A;  1OUV A;  5BNW A;  4EBA A;  1U3C A;  4HVB A;  2VSY A;  2OVF A;  4BUP A;  4TRQ A;  3PUK A;  4QEO A;  2I9C A;  1E90 A;  4KZ0 A;  4MI0 A;  1OWL A;  2E0I A;  4JA7 A;  1ZBP A;  4JC8 A;  5G04 C;  5JJ7 A;  1U3D A;  3OXF A;  5TTF A;  3GW4 A;  3D9L A;  1E7U A;  4C0M A;  3HIZ A;  1JPL A;  4FJZ A;  4UWH A;  1Y6I A;  3JYS A;  4KYO B;  4WWN A;  1HO8 A;  3MGB A;  4RG9 A;  3VLD A;  3ZYM A;  4DPR A;  2HO1 A;  5LX8 A;  2WB2 A;  4GML A;  4YPU A;  1TJF A;  2AXU A;  3EIQ C;  2WXJ A;  1N6A A;  3BO5 A;  4J8F A;  3SGH A;  4ANW A;  2LO6 A;  3CKC A;  2GRM A;  3B7U X;  1KT1 A;  2F69 A;  3SZ7 A;  1IQR A;  3Q4A B;  2C2L A;  3CVY A;  2ION A;  2IF4 A;  3S7D A;  3MV3 B;  4LER A;  2WXM A;  3ZPJ A;  2RFI A;  2YHE A;  3LS8 A;  3M55 A;  4IJD A;  2HM8 A;  1E8W A;  2Y4T A;  2WVI A;  3TJP A;  1NA0 A;  1OWM A;  1HU3 A;  4G11 A;  3QKY A;  4I6J A;  1H3I A;  3KMT A;  2J9Q A;  3DB5 A;  3FH7 A;  4H7X A;  3RRM B;  3ZHE B;  5CCL A;  3TGO A;  3PDN A;  2J07 A;  4UI9 J;  5E76 A;  4ANV A;  2FF4 A;  3UT4 A;  3RO2 A;  4HXI A;  2XPI A;  3BG1 B;  3SI5 A;  2MRI A;  5HQ8 A;  4DI3 A;  4HFG A;  4XE0 A;  4UQX A;  5ARG A;  4AOF A;  5C1D A;  3BG0 B;  2WXG A;  4JL0 A;  3CK8 A;  3PRZ A;  4F7A A;  2L6J A;  3VLE A;  4ACL A;  4B94 A;  3LXU X;  1E7V A;  2L0T B;  3D3M A;  2Y3A A;  3CHP A;  4WND A;  3CVP A;  3QNK A;  4J8E A;  4J7I A;  5E75 A;  3EJN A;  1HFA A;  4YVO A;  3U9W A;  3ESL A;  2WXI A;  1HXI A;  4GA2 A;  3RQ4 A;  5C2Y A;  1NZN A;  1QNF A;  3E4B A;  3ZHE A;  3VUZ A;  5JHN A;  2NC9 A;  4W9R A;  2BQZ A;  2XRY A;  3D9I A;  1KT0 A;  1W3B A;  4O6F A;  4C0E A;  4KMO A;  4JXT A;  4QEN A;  5HI7 A;  3SF4 A;  3M57 A;  4WWO A;  2J09 A;  3M59 A;  4AVX A;  4B8A A;  2WXK A;  4LRZ A;  3K9I A;  3B7R L;  3ZN3 A;  3VV0 A;  4ILI A;  4Z4P A;  4UI9 C;  4EPZ A;  5JHB A;  2XGS A;  4I1M A;  5BV1 A;  4JZY A;  4RSY A;  4GPK A;  3M5A A;  3LPZ A;  3CQG B;  3FTW A;  4U0U A;  2CG3 A;  3I3N A;  3RIB A;  4GZD A;  1N6C A;  3S8P A;  4EBA G;  4G26 A;  5F59 A;  2ZU6 B;  2VSO E;  3L54 A;  2XHE A;  4FLH A;  4N5C A;  5ENN A;  2DIW A;  4YNM A;  4JHJ A;  1HG2 A;  2CG2 A;  3G2S A;  3ZW3 A;  2WXH A;  5AYF A;  3AS5 A;  5FZR A;  5F5E A;  5F6L A;  3HVE B;  4FHK A;  4CEM A;  5D0Q D;  2A4Z A;  4DLQ A;  1PAQ A;  4HOS A;  3IEG A;  3FTS A;  5CPR B;  4HOT A;  1WAO 1;  2BUG A;  2OND A;  3AU5 A;  4AXH A;  4CT4 A;  3M56 A;  5JIN A;  3CK7 A;  3CVW A;  4I51 A;  3LJ3 A;  4HLE A;  1NA3 A;  3CHR A;  3R7Q A;  2WXF A;  4U07 A;  4L7T A;  2AW6 A;  1OWO A;  5EG2 A;  5FT9 A;  3R9A B;  4IYP A;  4L2L A;  3AS4 A;  3CSF A;  3HYM B;  2WQH A;  1XQH A;  4BT9 A;  5LCW J;  5CHE E;  3OAW A;  3RRU A;  2JV0 A;  4Y6C A;  3FWV A;  3T5X A;  2Y4U A;  4BFR A;  3D9J A;  1N3J A;  1UJJ A;  3ZYK A;  4PDX A;  3MZL B;  2KCK A;  4I43 A;  4N3B A;  3DBS A;  3UT8 A;  4LUN U;  4UQZ A;  4WNG A;  2I6H A;  3CBP A;  3L16 A;  4I1O B;  2OVB A;  3HVE A;  5JIY A;  4XI0 A;  3B7S A;  3TL5 A;  3CVN A;  4ANX A;  4A1S A;  2CHW A;  3CIA A;  3FU6 A;  3LY9 A;  2WXQ A;  4IN3 B;  2WQ6 A;  3G2V A;  4KVO A;  1S0P A;  3UT7 A;  2VTB B;  2NXP A;  5J08 A;  3CQC B;  1INZ A;  4K0R A;  5EX0 A;  2WPV A;  3CHS A;  5FJY A;  5EX3 A;  4DJA A;  2XQ0 A;  4GCN A;  4KVM A;  4Q94 A;  2RD0 A;  3CLJ A;  3F9W A;  3RAY A;  2AXV A;  3KAE A;  2WM9 A;  3OXG A;  4MKT A;  3CVX A;  1GW6 A;  3EP0 A;  1E8Y A;  5D0O D;  2CFU A;  1DNP A;  2GRL A;  3FFL A;  3NZS A;  4GCO A;  2X3M A;  3CHM A;  3FP3 A;  3DAL A;  2YQ8 A;  2XCB A;  5T0M A;  4TUU A;  3IV0 A;  1EYH A;  4J6I A;  5G2N A;  5JJ0 A;  4IJ8 A;  3SBT B;  4QFV A;  5AYW D;  2HYZ A;  5LCW C;  3LDZ A;  4ABN A;  1ZU2 A;  3PE3 A;  2AXZ A;  3ESK A;  4BTB A;  2J08 A;  4H12 A;  4B89 A;  2LSU A;  2VTB A;  4OYS A;  2CFZ A;  4U8H A;  5F6K C;  4I2Z A;  4GU5 A;  5LSZ A;  3JQ1 A;  3ASH A;  3QJZ A;  4GB9 A;  4LCT A;  2R17 C;  4PS7 A;  3I4G A;  3RK6 A;  2X6H A;  3MV2 B;  2XCC A;  1H2U A;  3SD5 A;  4U63 A;  3NQP A;  2FUL A;  4GAA A;  4BX8 A;  1QQE A;  4UQY A;  4O30 A;  2GGF A;  2WMO A;  3APF A;  4MS6 A;  4WUY A;  4A1G A;  3SW9 A;  2LNI A;  3TAX A;  3L13 A;  4R7L A;  3WXX A;  1PC2 A;  3FUL A;  3HHM A;  4KZC A;  3ZFW A;  2R3A A;  4PUC A;  1SQM A;  2KCL A;  3ASG A;  2R5S A;  3ZRH A;  4EZJ A;  3LVR E;  4XKC A;  2KCV A;  3IHX A;  3BEE A;  4HS2 A;  4P29 A;  2WXN A;  4RZ0 A;  3I4R B;  4H7Y A;  3D9N A;  5AIJ A;  2XGM A;  4K03 A;  1VDY A;  4U0Z A;  3FU5 A;  2CHZ A;  2AVP A;  1OWP A;  5DIZ A;  4BY6 A;  4ILG A;  4NAC A;  4FMU A;  4JHK A;  1QZ2 A;  4WWP A;  3U64 A;  4AJW A;  3Q15 A;  2FEZ A;  2L0I A;  3CVQ A;  2V5F A;  3JCK C;  4I1A A;  4C1Q A;  5FZS A;  4N2S A;  2W5Y A;  1OWN A;  1UW4 B;  4Q96 A;  4C9B B;  1HX8 A;  3FTZ A;  2A5U A;  2C0M A;  1MVX A;  4UWG A;  3TXN A;  3B7T A;  3FUN A;  3M54 A;  1ZKK A;  2YIN A;  4V3I A;  3S7J A;  2DCP A;  1HS6 A;  2PL2 A;  2V4L A;  4CRW A;  5ANL A;  4D10 C;  5BT1 A;  3CK9 A;  5LP0 A;  3ULQ A;  3FPD A;  4JW1 A;  5T8I A;  3ZYL A;  1DVP A;  3MO5 A;  3QOU A;  1ELR A;  4J83 A;  4OVU A;  4GYY A;  2XEV A;  3PEU B;  3S7F A;  4YNP A;  3L6A A;  3PNT B;  4G25 A;  2X38 A;  2QFC A;  3FTY A;  3MA5 A;  3UPV A;  4EQF A;  4ME2 A;  3FH5 A;  4EEC A;  3RJW A;  4L2Y A;  3OS5 A;  4F3V A;  4EZL A;  4OVV A;  1MQS A;  5KCM A;  4J8D A;  1H2T C;  3FUH A;  5FTP A;  1O9S A;  3PE4 A;  5KJK A;  1NP7 A;  3ZGQ A;  3D9K A;  4UWF A;  1PEG A;  4AP2 A;  1Z3X A;  2V0P A;  4JPS A;  4HOR A;  3Q49 B;  1KLX A;  2L9B A;  4EZK A;  1UG3 A;  5AJL A;  3S2A A;  1MHQ A;  5KJL A;  4FLB A;  5J90 A;  4CCA A;  3F9X A;  3TG5 A;  3IKO B;  2J4B A;  3APD A;  4GZ6 A;  3DPD A;  4E85 A;  3IBE A;  1MUF A;  4BX9 A;  5FQ4 A;  4GZ3 A;  3ENE A;  2IGQ A;  4U04 A;  3ASF A;  3MKQ B;  5DBK A;  1H19 A;  4WNF A;  2GW1 A;  5CMY A;  3VTY A;  4BSX A;  1B89 A;  1ELW A;  3CVL A;  3ML9 A;  4GA1 A;  3FUE A;  4G24 A;  3TG4 A;  4AU7 A;  3LYA A;  4UWL A;  4AY5 A;  2W5Z A;  5EDS A;  1ELK A;  3PEV B;  4JEU A;  2OOE A;  2X6K A;  3ZXS A;  4A3V A;  3G2W A;  2IOL A;  2RG8 A;  3PZD A;  5ANR A;  4CDN A;  1LF8 A;  3P2B A;  3MYV A;  3FUF A;  5ARF A;  2WXL A;  3P1U A;  3URZ A;  4HOU A;  3IHY A;  4BTA A;  3D9M A;  4I9E A;  3MKR A;  4XZ4 A;  2IQC A;  3M53 A;  2PQR A;  2VJ8 A;  1FVH A;  1EDU A;  4U0S A;  4YND A;  1WY6 A;  4CDM A;  5LFA A;  4JHR A;  5A6C A;  4J7F A;  2UWJ G;  3G2T A;  3IHV A;  3MKQ A;  4N3A A;  5A23 A;  4NJ5 A;  2VYI A;  4UWK A;  3CR3 A;  1A17 A;  2IFU A;  3EHN A;  4FC8 A;  3ONL A;  2AWI A;  3PVL A;  4BT8 A;  1FCH A;  2ILR A;  4AV7 A;  3ASD A;  2PQN A;  3AS8 A;  5T4Y A;  5T3R A;  3CBO A;  4MRU A;  2XPZ A;  4F53 A;  4NUR A;  4APO A;  4JLG A;  1H6K A;  3SFZ A;  4YVQ C;  4XKB A;  3L17 A;  3LY8 A;  4FUL A;  4RG6 A;  2JEK A;  3FUK A;  1FVF A;  1TJC A;  3O4Z A;  2V8S E;  4LEU A;  5JHA A;  3MJW A;  4I17 A;  3KMA A;  2WXP A;  3I5P A;  4DK5 A;  5CCM A;  4DI4 A;  2KC7 A;  1JUQ A;  3EHM A;  3NZU A;  5G05 J;  3G2U A;  4PS3 A;  5AJD A;  2IJG X;  3TXM A;  4CT0 A;  4GA0 A;  5M72 A;  4JDS A;  3QDN A;  2CHX A;  3OXL A;  4A3T A;  2KAT A;  3CST A;  2WQ7 A;  1E8X A;  3CEQ A;  4B0Z A;  2YHC A;  1PY1 A;  1H0A A;  1Z6T A;  3FU3 A;  2X6I A;  4ANU A;  1SZA A;  1JWG A;  4MI5 A;  2E2E A;  4GZC A;  2VSN A;  3C98 A;  3Q47 B;  4HOQ A;  5T5G A;  4RVB A;  3ZIM A;  4PH4 B;  3QK0 A;  4NQ0 A;  2EQX A;  4APF A;  3UQ3 A;  4QEP A;  2VGX B;  5FQ8 A;  2G46 A;  2FI7 A;  3QC1 A;  2WXO A;  3MCX A;  5AEN A;  2BTD A;  2XPY A;  4I9C A;  1UJK A;  2PZI A;  2YNQ A;  1E96 B;  4AM9 A;  3L22 A;  1UN9 A;  2JLB A;  4GYW A;  4ILH B;  3UMV A;  4A55 A;  2KM4 A;  3OOI A;  3SWC A;  3MX3 A;  3RJV A;  3FUM A;  2Q7F A;  3O48 A;  3U4T A;  3Q5M A;  4MLP A;  3JUI A;  2VQ2 A;  4UI9 K;  3CV0 A;  3QWV A;  4I6E A;  3HDX A;  5EKQ D;  3MO2 A;  5KJN A;  2LAI A;  2X6J A;  3RO3 A;  4B8C B;  5FZQ A;  5G05 C;  5LOZ A;  3QWP A;  4FJY A;  3FEY A;  2LSV A;  3SBS A;  2VGX A;  3CVV A;  4PS8 A;  4AY6 A;  3QWW A;  3N71 A;  5FQ6 A;  2I1J A;  3QAR A;  5TH7 A;  1ML9 A;  2MHK A;  1UN8 A;  4WAF A;  4ATG A;  1N52 A;  3EDT B;  2MOW A;  2XRZ A;  2QY7 A;  4BWR A;  2DBA A;  3JQ0 A;  4AIF A;  3L08 A;  1WM5 A;  4E6H A;  4XIF A;  1H2V C;  4N2Q A;  3MO0 A;  2I2O A;  4FP7 A;  4F1S A;  3ML8 A;  2KZT B;  3VLF A;  4YPE A;  4NRH B;  4IUL A;  3AU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...