3S7BA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
b'GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7bA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7bA01
5G05J 2Q7FA 4YNPA 3IHXA 3KS2A 3CVQA 4J8OA 4U07A 5JJ0A 5CHEE 3QWWA 3AS8A 3OS5A 1ZU2A 5G05C 2FBNA 3RO2A 3SZ7A 5T5GA 2IFUA 2C0MA 3DB5A 3CV0A 1XNFA 3U3WA 4J83A 4GYYA 4IN3B 3RKVA 2MHKA 3M58A 4RG9A 5FZSA 2KCKA 3TG5A 2W5YA 3QWVA 4J7IA 2PL2A 4JHRA 2JLBA 4AY5A 1MVHA 3RJVA 4I51A 3ESKA 5JJTA 5JJ7A 4HOTA 3IEGA 3CBOA 3VV0A 4GCNA 4WUYA 4J0UA 2FO7A 3Q47B 4N3BA 3DALA 4BWRA 2P58C 4QENA 5FT9A 5EX3A 1Y8MA 4GZ3A 4GA0A 2FF4A 4NVQA 5D0OD 1O9SA 4MI0A 2VGXA 2LSVA 2XGSA 3SW9A 4RG6A 2XGMA 4YNMA 4AY6A 1FCHA 4J7FA 1HXIA 2VQ2A 4ABNA 4N2SA 5JIYA 2YQ8A 4KXKB 3M53A 4BUPA 2Y4UA 2GW1A 3MV2B 3UUXA 3ZN3A 5EX0A 4BT8A 3ASFA 4GZ5A 5F6KC 2C2LA 3NF1A 3N71A 3ZFWA 4I9EA 5A7DB 1KT0A 4GCOA 1PC2A 3CBPA 3BEEA 1A17A 3URZA 3M54A 1ELRA 4N39A 3LY8A 4H12A 5KJKA 3OOIA 4QEOA 4W9RA 3S7BA 4KYOB 4GYWA 3CK7A 4N3AA 1ZKKA 1N3JA 3ASDA 3FP3A 5FZRA 3RO3A 2HO1A 4UI9C 3S8PA 3TGOA 4WNGA 2V5FA 4AU7A 4NJ5A 3Q4AB 4U04A 3S7JA 3LYAA 2VGXB 2W5ZA 2O8JA 3F9XA 3KD7A 3ZGQA 4BT9A 1MT6A 2ONDA 4NQ0A 3PE4A 3VTYA 2RFIA 2FI7A 3O48A 3ZPJA 4I9CA 3SWCA 4NRHB 2WPVA 2XCCA 1WM5A 2WQHA 2C0LA 5F6LA 3TAXA 3K9IA 3RAYA 5F59A 2R5SA 3CVLA 4GA2A 3UQ3A 5AYFA 4B94A 3OXGA 3ASGA 3LCAA 1MUFA 5T0MA 3GZ2A 4UQXA 1KT1A 2DBAA 3SF4A 1N6AA 4JLGA 3MA5A 5A6CA 3CVPA 1QZ2A 3ZHEB 5EG2A 4IJ8A 4APOA 2AVPA 3EP0A 2PZIA 2UY1A 3ASHA 4YPUA 3KMJA 5F5EA 5M72A 3M56A 4Y6WA 5DBKA 4I1AA 3QKYA 5BNWA 3LPZA 4LDGA 2VSYA 3FFLA 5TEGA 2IGQA 4N3CA 2HR2A 4UI9K 1NZNA 4BTBA 3M59A 4WNFA 4JA7A 2G46A 2KCVA 4C1QA 3E4BA 3EDTB 4QEPA 2FEZA 4J8DA 5JJ6A 3U4TA 3WXXA 1OUVA 3M5AA 3ULQA 5CCMA 4G26A 4G23A 4U0UA 3QWPA 4F3VA 3TG4A 3CKBA 3QOUA 4HOQA 4YVOA 3AS4A 4Y6CA 3RU0A 3PE3A 2XCBA 4G1TA 5C1DA 5KJMA 4FMUA 3CKCA 3LKUA 1E96B 3M57A 4O30A 4KBQA 2XEVA 4GYOA 5ARFA 2E2EA 3JYSA 3VUZA 4IJDA 5G04J 3RJWA 4G24A 1W3BA 4CGWA 1NA3A 4JDSA 2HYZA 4XIFA 5KJLA 5BW8C 1XQHA 5HI7A 3F9YA 3KMTA 3FPDA 2XPIA 4EQFA 3S7FA 2J9QA 4N5CA 4I17A 2XGOA 1TJCA 4MI5A 2IF4A 1B89A 4GPKA 3R9AB 4J8FA 2R3AA 3MO5A 3F9ZA 2QPWA 5FZQA 4HOUA 4WNDA 3LY7A 4UQYA 5EKQD 4Z4PA 3OXLA 4JL0A 3GYZA 4O6FA 1H3IA 5FJYA 4U0ZA 3GW4A 5AYWD 4HOSA 2Y4TA 4HORA 3MO0A 5CPRB 1MVXA 5JHNA 4H7XA 4JA9A 1ZBPA 3F9WA 3LY9A 4ME2A 3VTXA 2OOEA 4H7YA 1IYGA 4GZ6A 3MEKA 3GZ1A 3RQ4A 4N2QA 5JINA 5FTPA 3MV3B 4YVQC 3CBMA 4E47A 4UQZA 3PDNA 4GA1A 2NC9A 3BO5A 2JV0A 4RZ0A 1KLXA 1N6CA 5TH7A 5KJNA 5HQ8A 3CK8A 2KC7A 2L6JA 5LCWJ 4I2ZA 5ARGA 4A1SA 1ML9A 3CK9A 5DIZA 4BTAA 3MKRA 4LEUA 5TTFA 3RIBA 5CCLA 3QDNA 4CGVA 4AM9A 1HZ4A 2VYIA 3Q15A 5BT1A 5LCWC 1NA0A 3OXFA 3Q5MA 4G25A 3OPEA 3Q49B 4I2WA 2LSUA 3UPVA 2YHCA 4YPAA 1WAO1 2BUGA 4YNDA 2F69A 3KMAA 5T0KA 1QQEA 2I6HA 2PQRA 2VGYA 2QFCA 3AS5A 4CDRA 2PQNA 3KAEA 3FWVA 2UWJG 3CVNA 2BQZA 4XI0A 4AIFA 3MO2A 1PEGA 4U0SA 2UY1B 4YPEA 4J8EA 5D0QD 1P5QA 3M55A 2KATA 3S7DA 1YA0A 3K5KA 1ELWA 5G04C 2LNIA 3HNAA 4UI9J 5LSXA 3HYMB 2KCLA 1HH8A 4WNEA 3ZHEA 2VSNA 3CEQA 4XI9A 1IHGA 4G2VA 5LSZA
chains in the Genus database with same CATH superfamily
1OCOE 1OWNA 2H6FA 4IRUA 3KS2A 4FHKA 4EBAG 3SNXA 4U07A 5CHEE 3QWWA 3OS5A 1INZA 2ZGGA 3PZ1A 4K03A 2FBNA 3RO2A 3SZ7A 5T5GA 3V31A 2WMNA 4JPSA 2YINA 3FU5A 4B8CB 3CV0A 3KSLA 2P9LG 1XNFA 5T8IA 4J83A 4BFRA 4IN3B 2QZAA 3CGHA 4RG9A 2GGFA 2W5YA 2WVIA 4QFVA 3IKOB 3QWVA 4J7IA 4HRLA 5CEAA 3R9MA 4AY5A 5AAOA 3RJVA 2GRQB 3CLJA 5KWDA 1K1AA 2VGEA 4OVVA 4N3BA 2P58C 4QENA 2OEVA 1Y8MA 3C3QA 3LEWA 5JMND 1E8YA 2WXPA 2DYRE 3IHYA 3L6AA 1KZPA 2IONA 5KNHD 1O9SA 2VGXA 2I1KA 3FUIA 3SW9A 2XGMA 3G2SA 3TWTA 1FCHA 4ATGA 3ABLE 4EZLA 4XKBA 2PM6A 3ZKJA 4DI3A 3TL5A 3QC1A 4D10C 2Y4UA 3MKQB 3OAWA 4EBAA 4ILIA 1N52A 1OCRE 4HI9A 4FC8A 3NF1A 4I9EA 4GCOA 4N5QA 5EN5D 3EHQA 4FJZA 3PH0C 4H12A 3OOIA 3UXGA 4ANWA 4CT4A 1NL4A 3L22A 5T4YA 2GRLA 2EINE 3CK7A 1ZKKA 1E7UA 3ASDA 4UWLA 2VTBA 1MX4A 3APCA 4UI9C 3UM3A 3TGOA 2WXQA 1EYHA 4A55A 4EZJA 3Q4AB 4AV7A 3MZLB 2L0IA 5BXUA 3F9XA 1DCQA 3ZGQA 4BT9A 3TWQA 2DZNA 4CCAA 2R2LA 3ASNE 3TWVA 1ZB1A 3B7TA 3ZW3A 4PH4B 3W9GA 3EU5A 4GZDA 1N54A 4JHKA 5EIBE 3Q7AA 2XCCA 2AXUA 2OVFA 1LTXA 3V2OA 4L2LA 5F6LA 1G3NB 4M3OA 2WXFA 2R5SA 4V3IA 4DK5A 4LUNU 2I9CA 2P9IG 3FUMA 4L1BA 4U63A 4NIKA 2LAIA 3I4GA 1TYQG 3ASOE 4YDEA 3DEPA 4UQXA 3HIZA 2IU1A 5HKPA 2P9SG 2X6IA 4U96D 3CVPA 5AIJA 3AG1E 1JCRA 3JXJA 3AAAC 3UM1A 3FUNA 2NSZA 1K3ZD 4I1AA 3QKYA 3UIPC 5BNWA 4CT0A 5H7PA 4LDGA 2HR2A 3D9MA 4UI9K 1NZNA 3M59A 3SFXA 2RKKA 1IQRA 2KCVA 3AJIA 3L08A 2IJGX 2BF0X 5ENOD 2ETBA 4KVOA 2XQ0A 3Q73A 3T5VA 3FU0A 1H6KA 2RG8A 3SI5A 3ULQA 3ZIMA 3I5PA 4U0UA 4TV3A 2J07A 3CKBA 4HOQA 3PE3A 2NYJA 3S2AA 4APFA 4FMUA 3M57A 3DRAA 2V8SE 3FTUA 3GZSA 1JCSA 4GAAA 2XEVA 5CERB 2ETCA 3I4RB 3AU4A 4I6GA 2IO2C 2F37A 4HRNA 3JYSA 4OAVB 3MCXA 2WXOA 4U7EB 4ANVA 5FINA 4HVBA 3FUDA 1TNZA 1MQSA 1RW2A 4XIFA 4WWOA 5KJLA 4A1GA 4XKCA 5BW8C 4F1PA 3ULYA 4I17A 2XGOA 1TJCA 3JXIA 3V30A 1A5EA 3BQOA 3R9AB 2R3AA 2X6FA 2QPWA 2V0PA 3J5QB 4B8AA 1OCCE 2J8SD 3EU9A 3GYZA 4O6FA 1MJ0A 4XX5A 5FJYA 4U0ZA 3GW4A 4FU3A 1MVXA 4H7XA 3UI2A 4R7LA 1K8KG 3D9NA 2R03A 4RSYA 2XHEA 1H2VC 3MX3A 4GTTA 2VTBB 2BTDA 3Q79A 4FADA 2RFMA 4YVQC 2XZDG 1S70B 2NC9A 1OWMA 2JV0A 4RZ0A 5KJNA 3VLFA 3FULA 3ZYLA 2L6JA 1O1TA 4A1SA 1ML9A 4PDXA 4A3VA 3L82A 3T8MA 3PNTB 3QDNA 4E85A 4CGVA 4UWFA 3B7BA 4G25A 3CR3A 2EIJE 3OPEA 2LSUA 3FH5A 3L54A 4B93B 3UPVA 3SBTB 1NI1A 5AQ7A 4KMOA 3ZXSA 3DPYA 1QQEA 3WG7E 4CDRA 3BG1B 3OTNA 3TWUA 3DSUA 2UWJG 2BQZA 1PEGA 2KM4A 4U0SA 4YPEA 4DX5D 3E33A 3DXKG 3R7QA 3C98A 3M55A 3QARA 2XPYA 4FULA 3QAQA 1S0PA 5AN8A 3K5KA 1DC2A 5LSXA 2R02A 3Q9UC 4ATZD 2KCLA 2XENA 2YHEA 4WNEA 4X8QA 2VSNA 2CHXA 4G11A 1H2UA 1IHGA 2OV8A 1U3DA 2P2CP 4G2VA 4I9CA 4TXQA 3Q75A 3UIOC 2JABA 3DBSA 4LCTA 4BSXA 2GRPB 2Y1LE 3CVQA 4LNGA 3ABME 3AS8A 4ZFHA 1ZU2A 2CHWA 5G05C 2WXHA 4MRUA 3UMVA 1U2VG 1N95A 2C0MA 2DYSE 2A5UA 5D66A 3FTVA 3J5PA 1UJKA 5AQAA 2AXVA 2MHKA 2AJAA 3RK6A 3ZYKA 3RSEG 2F0YA 5B1BE 1UOHA 2PL2A 4K5BA 2LXMA 1E90A 3EHMA 3ESKA 5JJTA 4O60A 2WQ7A 5JJ7A 4Q96A 1BI8B 3CBOA 2GRRB 2R17C 3VV0A 3PZDA 1S63A 2EIME 2Y69E 2HM8A 5AENA 2IOSA 4MLPA 4A63B 5D0OD 4JVSA 4MI0A 2XGSA 4RG6A 4AY6A 4J7FA 1HXIA 3T8KA 2R59A 5JIYA 4KXKB 3M53A 4G8LA 4FP7A 1TEZA 4HNAD 5EYLA 4DRXE 3AG2E 3MV2B 4L23A 4FJYA 3BG0B 3D9OA 3PUJA 1N4RA 4JC8A 2R05A 4F1SA 1BD8A 1PC2A 3CBPA 3BEEA 4JEHA 4N39A 1O5MA 4QEOA 3SFZA 2V4HC 1YMPA 2RFAA 3LXUX 3HVEA 4CEMA 1OCZE 3ML8A 1N3JA 4HXIA 1N9AA 3QB2A 3SHFA 3T5XA 4BX8A 1YCSB 4NJ5A 3CHMA 4U04A 3LYAA 3FTSA 4AEZC 2W5ZA 2O8JA 1GW6A 3CVUA 3KD7A 2P9NG 4ACKA 4NQ0A 3VTYA 5KCMA 3CQCB 4HS2A 3APDA 3U66A 2FI7A 3ZPJA 2CG3A 4A3TA 2DVWA 3FTZA 3HXBA 4JEUA 1LD7A 4GMJA 1TNYA 3DSSA 4KZCA 3B7SA 2IQCA 3UQ3A 4B94A 1Q2ZA 3OXGA 3ASGA 1MUFA 5T0MA 2H6GA 1KT1A 1N6AA 5A6CA 3IBEA 5EG2A 4APOA 2PZIA 5LX8A 1UG3A 4YPUA 4LERA 1TN7A 1Z6TA 3SFYA 5F5EA 5M72A 2DCPA 3G2VA 1TNBA 3QK0A 5DBKA 3Q78A 1K1BA 3JUIA 3LPZA 5ANRA 3FFLA 2IGQA 2RD0A 4F7AA 3EDTB 3C72A 4O1PA 4XEIG 4TXPA 3B7UX 5JJ6A 3U4TA 5KBAA 1OUVA 5CCMA 5FQ4A 2J49A 3QWPA 1HO8A 4YVOA 3ZYQA 4Y6CA 3RU0A 1ELKA 5AJLA 4G1TA 2MRIA 1PAQA 1E8XA 4U8YD 1QYMA 3BU8A 1N94A 3D9KA 4GYOA 3VUZA 1SZAA 4IJDA 5G04J 1X81A 4JHJA 4NACA 2J08A 5D2MC 4CYMD 3Q9NC 4J6IA 1MHQA 3EHNA 4TRQA 3S7FA 2J9QA 3C3RA 3G2TA 3JQ0A 3UTMA 2MOWA 2J4DA 4GPKA 4J8FA 4GB9A 3IHVA 2VJ8A 3CVWA 3JUEA 4WAFA 4WNDA 4GZCA 4P29A 2WXMA 4UQYA 2XZTG 5CMYA 4JL0A 2Y4TA 4HORA 1E8ZA 4JXTA 2OOEA 4GPMA 2FULA 5BPPA 4H7YA 3HVEB 1JCQA 3APFA 4AVXA 3LDZA 5A23A 3GZ1A 3HXDA 4KVMA 4GMLA 4E47A 4UQZA 3FUHA 4J8SA 3FY4A 1Z3YA 1N6CA 4B89A 2XEHA 4ACLA 4GTOA 4GTRA 1FVFA 1N11A 2A4ZA 3MGBA 4K5AB 3CK9A 5DIZA 1EPUA 4IULA 3KEZA 5CCLA 2VYIA 5LCWC 3Q15A 3O4ZA 3RRUA 2HE0A 1NP7A 4YDWA 4BEPA 1HFAA 4YNDA 2JEKA 4K5CA 3KMAA 4GTMA 2QFCA 1WDYA 4EZKA 1DVPA 3E34A 3LVQE 3FTXA 2Y0BG 3KAEA 1V55E 5AARA 3CVNA 4AIFA 3D9JA 5D0QD 4MS6A 1D9SA 4K0RA 3LJNA 1FT2A 2LXLA 5G04C 5ENSD 4URKA 1TN8A 4L2YA 3NZSA 5J08A 3ZHEA 1Z3XA 2WXRA 2VSXE 2WXLA 2AWIA 5G05J 2Q7FA 2J4BA 1U3CA 4YNPA 3ULEG 5CRUA 4J8OA 3HHMA 4DLQA 3NOCD 4F53A 1MZCA 1OWLA 2IFUA 5FWQA 2XRZA 2WQ6A 4TUUA 3DEOA 1TNUA 5CBOA 5HRYA 4GYYA 3RKVA 2ZIRA 4UWKA 1HS6A 2KCKA 3TG5A 3BUAA 4PS8A 2QY7A 4ILHB 2JLBA 3D9LA 1MVHA 5IY5E 4I51A 2OEWA 2MYOA 1JWGA 4QQIA 3ZXPA 3KSQA 5ITZF 1TJFA 4LNBA 4J0UA 2FO7A 2A5EA 3HG0D 3R7RA 3UT7A 5ENRD 3DALA 4BWRA 5FT9A 4C48B 5EX3A 4GZ3A 4NURA 5G2NA 1QBQA 2FF4A 4FHJA 2LSVA 4C0MA 4YNMA 3ONKA 3VLDA 1E7VA 1L5JA 4ABNA 2I1JA 3EHRA 4N2SA 2YQ8A 4DLOA 4RVBA 2J09A 3L16A 2GROB 3CQGB 2L6BA 4BUPA 2GW1A 3PRZA 3UUXA 5FIOA 3B95A 4DX1A 4BT8A 2WMOA 2L0TB 2P9PG 3L17A 1FT1A 2ILRA 3KEAA 3LJ3A 1A17A 2WXIA 3URZA 5JHAA 5KJKA 4Q69A 4W9RA 3S7BA 3TWSA 1BI7B 4GYWA 4CZ2D 3CVXA 5CMWA 3G2UA 1N0QA 3RO3A 1S64A 4DX2A 3FDHA 3FU6A 4WNGA 5BV1A 2DWZA 2X6KA 4TXRA 3IV0A 2OCCE 3ZVVA 4UWGA 2QC9A 1MT6A 2ONDA 5BV0A 2EILE 2H6IA 3FH7A 2WQHA 4J7WA 2WXJA 3CVVA 3K9IA 3FUFA 1DNPA 5F59A 2IEJA 4GA2A 3EJNA 5AYFA 3AU5A 1UN8A 3LCAA 4ANXA 3NZUA 2DBAA 3SF4A 4JLGA 1IXVA 1QZ2A 3ZHEB 4J8YA 1AP7A 2UY1A 3ASHA 3FTWA 3QNKA 3KMJA 1OWOA 4U95D 4G8KA 1X5BA 2ZISA 3SO8A 3CVYA 5BUZA 4Y6WA 3TWRA 3PUKA 5FQ6A 4ANUA 1JPLA 5T3RA 2VSYA 4BY6A 4BX9A 4JA7A 2G46A 4BSZB 2ETAA 4C1QA 3TXMA 2ZU6B 3Q7FA 4Q94A 2CG2A 3U64A 4QEPA 4AJWA 4J8DA 1BPOA 2WB2A 5EIDA 2NXPA 5CRVA 3TXNA 4CRWA 4G23A 4HB5A 2XS8A 3TG4A 3E30A 3UM0A 4WWPA 3QOUA 5EILA 3SY2A 2XCBA 5C1DA 5KJMA 3RRMB 4Z68A 2AW6A 1E96B 3UKUG 3AG4E 3PNLB 1D8DA 3FUEA 1YYHA 3I3NA 2E2EA 3EUVA 2QYJA 4ZHBA 3RJWA 1MX2A 4GTQA 1HU3A 3D3MA 2B6CA 5AQ9A 2X3MA 4OAUC 5HI7A 4AP2A 1HG5A 3FPDA 2XPIA 3C3OA 1O1SA 3PS6A 3X2QE 1B89A 1H6PA 3MO5A 2F8YA 4DI4A 2P9UG 1KZOA 3MJWA 2CFZA 5LP0A 4HOUA 3D9IA 3LY7A 3HXEA 2BKKB 1H3IA 3L9TA 1H2TC 5AYWD 3D9HA 4HOSA 5CPRB 2DZOA 4JA9A 1ZBPA 3F9WA 4ME2A 5CECB 1SW6A 5KNGA 3RRNB 3FHEA 5AQBA 4GZ6A 3MEKA 1UJJA 4BESA 3RQ4A 4N2QA 3TWXA 5JINA 3MV3B 4CDNA 4RLYA 2V4LA 1RZ4A 5B3SE 3BO5A 5TH7A 5CEDB 4BETA 5HQ8A 4EECA 1BLXB 2KC7A 1TN6A 4UUCA 5LCWJ 4I2ZA 2IOLA 4HLEA 2LO6A 3ZEFA 3P2BA 4BTAA 5CBNA 3MKRA 5TTFA 3E37A 3PZ2A 4AM9A 1HE8A 3SQVA 1LD8A 1NA0A 3Q5MA 5ENTD 5G55A 4C9BB 3Q49B 4I2WA 2YHCA 3G2WA 2BUGA 4E6HA 5BXOA 2XS1A 2F69A 2I6HA 4HI8A 2VGYA 1D8EA 2PQNA 3MYVA 4RQIA 3QJZA 2FO1E 4B0ZA 3MO2A 2UY1B 3FUKA 5AJDA 1P5QA 2CHZA 1LF8A 2LNIA 2QYUA 4LSZE 3V2XA 3HNAA 3HYMB 1MX6A 3ZNGA 2KXPC 5ANLA 5EYPF 3UM2A 4CDMA 1H19A 2WM9A 2BEDA 1WG0A 2I2OA 4OYSA 3LS8A 3DSXA 3IHXA 3NOGD 4JZYA 1OXJA 1NFIE 3HRAA 1BU9A 5JJ0A 3ENEA 3HXFA 2F8XK 1SZ9A 3UT4A 3PEUB 2Y3AA 3DB5A 1WY6A 3PZ3A 3FUJA 3U3WA 4LG6A 3W9FA 3M58A 5FZSA 3DXMG 1HG2A 1IKND 1OWPA 4JHRA 3PZ4A 1N4QA 3AG3E 4YDOA 1JUQA 4WWNA 4FLBA 4HOTA 2B0OE 3IEGA 4F6RD 2KZTA 4GCNA 4WUYA 3F6QA 3Q47B 4EHMA 1VDYA 4GTPA 3ABKE 3PREA 3ONLA 4GA0A 2WXNA 4NVQA 2ZXWE 2EIKE 3SBSA 1IQUA 1Y6IA 2IO3C 3HXCA 2VQ2A 2P9KG 3JCKC 4U8VD 2X6JA 4HLLA 2WXKA 1PY1A 2EQXA 3VLEA 4FLHA 3ZN3A 1E8WA 5EX0A 2WXGA 3FU3A 1SA4A 1FPPA 4I1MA 3ASFA 3CSTA 4GZ5A 5F6KC 2C2LA 3N71A 1FVHA 4L9PA 1UW4B 3UKRG 3ZFWA 5A7DB 1KT0A 3M54A 1ELRA 3LY8A 1AWCB 3LVRE 3NQPA 4KYOB 3NBNB 3IXEA 4N3AA 4DPRA 3FP3A 5FZRA 3EIQC 2HO1A 3S8PA 2IY0C 2VSOE 3FEYA 4XZ4A 2V5FA 4AU7A 3C5RA 3ZUVB 3S7JA 4GTSA 2VGXB 4HRMB 4XE0A 3PE4A 1SA5A 2RFIA 3O48A 2BKGA 3NB2A 4AXHA 3SWCA 1V54E 2V5QC 4NRHB 2WPVA 1WM5A 2C0LA 3TAXA 3RAYA 3CVLA 3ISMC 5ENNA 1N4PA 5E76A 4MBGA 2XPZA 3GZ2A 2LAHA 3MA5A 3DPDA 3SD5A 3ZYMA 4IJ8A 2AVPA 3EP0A 4C0EA 4GTVA 3UT8A 3JQ1A 5ENQD 3M56A 1H6OA 3DWLG 4PS7A 5FQ8A 3FH8A 5TEGA 4N3CA 2GRNB 4BTBA 4WNFA 4M7CA 3E4BA 3CHOA 4ILGA 4KZ0A 4I6EA 2PM7A 3UINC 2FEZA 1OT8A 3E32A 3WXXA 2DIWA 3M5AA 3ZU7B 4G26A 4F3VA 3AS4A 3SGHA 5C2YA 3CKCA 3LKUA 4BERA 4HFGA 4O30A 3TWWA 3CHSA 4KBQA 3RAUA 3B13A 3CHPA 4HQDA 4DX7D 2KZTB 5ARFA 3ZRHA 4DJAA 5LFAA 4LRZA 1JWFA 4JD2G 1XGWA 3CSFA 4G24A 1DCEA 1IHBA 1W3BA 4CGWA 1NA3A 4JW1A 4JDSA 2HYZA 3T9KA 5EDSA 1EDUA 4IYPA 1XQHA 1HX8A 3F9YA 3KMTA 4PUCA 5ENPD 4EQFA 4N5CA 5FQ7A 4MI5A 2IF4A 1N4SA 4DX6D 1O1RA 3F9ZA 4I43A 2M63A 5FZQA 1UN9A 5EKQD 3V79K 4Z4PA 4MKTA 4DUIA 3OXLA 3U9WA 4LNUD 1KPSB 4HBDA 2OVBA 3HDXA 4O1OA 3MO0A 5JHNA 3MKQA 3LY9A 3VTXA 5JHBA 2L9BA 4PS3A 3DSWA 2LUHA 1IYGA 1Z5SC 3EIJA 1HF8A 1OY3D 3B7RL 5FTPA 4GU5A 3DSVA 4I6JA 3CBMA 1H0AA 3PDNA 4GMRA 1MYOA 4GA1A 3FTYA 3D9PA 4JB8P 5JA4D 4YDYA 1KLXA 3DSTA 5B1AE 3CK8A 2E0IA 3ESLA 1EF1C 3PEVB 1N0RA 2X6HA 5J90A 5ARGA 2X38A 3PVLA 4U8HA 2AXZA 2H6HA 1SQMA 3L13A 4EPZA 3UX4A 2XEEA 4LEUA 3RIBA 4OVUA 5BT1A 1HZ4A 4I1OB 3OXFA 1TNOA 3FEXA 2PNNA 4YPAA 1WAO1 5E75A 5HS0A 3CIAA 5LOZA 3NAWA 5T0KA 2PQRA 3TJPA 3AS5A 3CHRA 4TUMA 4FA6A 3FWVA 4XI0A 3P1UA 1QNFA 2CFUA 3CHQA 4J8EA 4KT6B 2ZGDA 2KATA 2YNQA 3S7DA 3ML9A 1YA0A 1ELWA 2GRMA 4UWHA 4L7TA 4UI9J 1HH8A 4AOFA 1SVXA 3CEQA 4XI9A 2XRYA 5LSZA 2KBXA 1TR4A
chains in the Genus database with same CATH topology
2WXLA 1OWNA 2AWIA 2I2OA 2WM9A 2Q7FA 4OYSA 4LCTA 3DBSA 4IRUA 5G05J 3LS8A 2J4BA 1U3CA 4BSXA 3IHXA 4YNPA 3KS2A 4FHKA 4EBAG 3CVQA 3SNXA 4JZYA 4J8OA 3HHMA 4U07A 5JJ0A 5CHEE 3QWWA 3AS8A 3OS5A 3ENEA 1ZU2A 2CHWA 1INZA 1SZ9A 5G05C 4DLQA 4K03A 3UT4A 4F53A 2FBNA 3PEUB 3RO2A 3SZ7A 5T5GA 2WXHA 2Y3AA 1OWLA 2WMNA 4MRUA 3UMVA 4JPSA 2YINA 2IFUA 2C0MA 1WY6A 3CV0A 3FU5A 4B8CB 3DB5A 5FWQA 3FUJA 2A5UA 2WQ6A 2XRZA 4TUUA 1XNFA 3FTVA 5T8IA 1UJKA 3U3WA 4J83A 4BFRA 4GYYA 2AXVA 4IN3B 3RKVA 2MHKA 3CGHA 3M58A 4RG9A 2GGFA 4UWKA 1HS6A 3RK6A 5FZSA 2KCKA 3ZYKA 3TG5A 2W5YA 2WVIA 4QFVA 3IKOB 3QWVA 1HG2A 1OWPA 4PS8A 4J7IA 2QY7A 4ILHB 2PL2A 4JHRA 2JLBA 3D9LA 4AY5A 1MVHA 1E90A 3EHMA 3RJVA 1JUQA 4I51A 3ESKA 5JJTA 4WWNA 4FLBA 1JWGA 3CLJA 5JJ7A 2WQ7A 4Q96A 4HOTA 3IEGA 4OVVA 3CBOA 2KZTA 1TJFA 2R17C 3VV0A 4GCNA 3PZDA 4WUYA 4J0UA 2FO7A 3R7RA 3UT7A 3Q47B 4N3BA 1VDYA 3DALA 4BWRA 2P58C 4QENA 5FT9A 2HM8A 3PREA 4CGVA 5EX3A 5AENA 2IOSA 4MLPA 1Y8MA 3R7QA 4GZ3A 3LEWA 1E8YA 2WXPA 3ONLA 4NURA 5G2NA 3IHYA 3L6AA 4GA0A 2FF4A 2IONA 2WXNA 4NVQA 5D0OD 4JVSA 4FHJA 1O9SA 4MI0A 2XGSA 2VGXA 2I1KA 2LSVA 3FUIA 3SBSA 3SW9A 1IQUA 1Y6IA 2XGMA 4RG6A 4C0MA 3G2SA 4YNMA 3ONKA 3VLDA 4AY6A 1FCHA 4J7FA 1HXIA 2VQ2A 1E7VA 1L5JA 4ATGA 4EZLA 3JCKC 4XKBA 2R59A 2PM6A 4ABNA 2I1JA 4N2SA 5JIYA 2YQ8A 2X6JA 4DLOA 4DI3A 4RVBA 4KXKB 2J09A 3L16A 3M53A 4FP7A 3TL5A 2WXKA 3CQGB 3QC1A 1PY1A 4D10C 1TEZA 4BUPA 2Y4UA 3MKQB 2GW1A 3MV2B 3PRZA 2EQXA 3OAWA 4L23A 4FJYA 3UUXA 4FLHA 3BG0B 3D9OA 3VLEA 3ZN3A 4EBAA 1E8WA 4ILIA 5EX0A 2WXGA 1N52A 3FU3A 4BT8A 3PUJA 2WMOA 4I1MA 3ASFA 3CSTA 4JC8A 4GZ5A 5F6KC 2C2LA 4FC8A 3NF1A 3N71A 1FVHA 4I9EA 1UW4B 3ZFWA 4F1SA 2L0TB 5A7DB 3L17A 1KT0A 2ILRA 1PC2A 4GCOA 3CBPA 3BEEA 4G2VA 3LJ3A 1A17A 2WXIA 4FJZA 3URZA 3M54A 1ELRA 4JEHA 3PH0C 4N39A 3LY8A 5JHAA 4H12A 5KJKA 3OOIA 4QEOA 3SFZA 4ANWA 4Q69A 4W9RA 3S7BA 3LVRE 4E85A 3NQPA 4KYOB 3LXUX 3HVEA 4CT4A 4CEMA 3L22A 5T4YA 4GYWA 2GRLA 3ML8A 3CK7A 4N3AA 1ZKKA 1N3JA 1E7UA 3ASDA 4UWLA 4DPRA 4HXIA 3FP3A 5CMWA 5FZRA 3CVXA 2VTBA 3G2UA 3EIQC 3QB2A 3RO3A 2HO1A 3APCA 4UI9C 3SHFA 3T5XA 3S8PA 3FDHA 3FU6A 4WNGA 3TGOA 2WXQA 4BX8A 1EYHA 2VSOE 3FEYA 4A55A 4XZ4A 5BV1A 2V5FA 4AU7A 4NJ5A 2X6KA 4EZJA 3Q4AB 3IV0A 4AV7A 3CHMA 4U04A 3S7JA 3MZLB 2L0IA 3LYAA 3FTSA 2VGXB 4AEZC 3ZVVA 2W5ZA 4UWGA 2O8JA 3F9XA 1GW6A 3CVUA 3KD7A 3ZGQA 4BT9A 4XE0A 4ACKA 1MT6A 2ONDA 4NQ0A 3PE4A 3VTYA 5KCMA 5BV0A 3CQCB 4HS2A 3APDA 4CCAA 3U66A 2RFIA 2FI7A 3O48A 3ZPJA 3B7TA 3ZW3A 4PH4B 4I9CA 4AXHA 3SWCA 2CG3A 4GZDA 1N54A 4NRHB 4JHKA 3FH7A 2WPVA 2XCCA 1WM5A 4A3TA 2AXUA 2OVFA 2WQHA 4L2LA 2C0LA 2WXJA 3FTZA 3TAXA 3CVVA 5F6LA 3K9IA 3FUFA 4JEUA 3RAYA 4M3OA 2WXFA 1DNPA 5F59A 2R5SA 4V3IA 4DK5A 3CVLA 4LUNU 4GMJA 2I9CA 4GA2A 5ENNA 4KZCA 3B7SA 3EJNA 2IQCA 3FUMA 4L1BA 3UQ3A 3AU5A 4U63A 5E76A 4B94A 5AYFA 2LAIA 1UN8A 3OXGA 3ASGA 3I4GA 3LCAA 1MUFA 3M56A 4ANXA 5T0MA 2XPZA 3GZ2A 3NZUA 4UQXA 3HIZA 1KT1A 2DBAA 2IU1A 2LAHA 3SF4A 1N6AA 2X6IA 4JLGA 3MA5A 5A6CA 3DPDA 3SD5A 3IBEA 3CVPA 1QZ2A 3ZHEB 5EG2A 5AIJA 3ZYMA 4IJ8A 4APOA 2AVPA 3EP0A 2PZIA 2UY1A 3ASHA 4C0EA 5LX8A 1UG3A 4YPUA 4LERA 3UT8A 3FTWA 3JQ1A 3QNKA 3KMJA 1Z6TA 5F5EA 1OWOA 5M72A 2DCPA 3G2VA 1X5BA 3CVYA 3QK0A 3FUNA 4Y6WA 5BUZA 5DBKA 5FQ6A 3PUKA 2NSZA 4PS7A 4ANUA 4I1AA 3JUIA 1JPLA 3QKYA 5T3RA 5BNWA 4CT0A 3LPZA 5ANRA 5FQ8A 2VSYA 3FFLA 4LDGA 3FH8A 2IGQA 4N3CA 5TEGA 2HR2A 2RD0A 3D9MA 4UI9K 4BY6A 1NZNA 4BTBA 3M59A 4F7AA 4WNFA 4BX9A 4JA7A 1IQRA 2G46A 2KCVA 4C1QA 3E4BA 3CHOA 4ILGA 3TXMA 2ZU6B 4KZ0A 3EDTB 3L08A 4Q94A 2CG2A 2IJGX 4I6EA 2PM7A 3U64A 4QEPA 2FEZA 2BF0X 4AJWA 4J8DA 3B7UX 4KVOA 2XQ0A 5JJ6A 1BPOA 3U4TA 3T5VA 2WB2A 3FU0A 1H6KA 3WXXA 2RG8A 2NXPA 2DIWA 3SI5A 1OUVA 3TXNA 3ULQA 5CCMA 3ZIMA 3M5AA 5FQ4A 3I5PA 4G26A 4CRWA 2J49A 4G23A 4U0UA 3QWPA 4F3VA 3TG4A 4TV3A 2J07A 4WWPA 1HO8A 3CKBA 3QOUA 4HOQA 4YVOA 3ZYQA 3AS4A 4Y6CA 3RU0A 1ELKA 3PE3A 5AJLA 3SGHA 5C2YA 2XCBA 4G1TA 3S2AA 4APFA 3RRMB 5C1DA 5KJMA 2MRIA 3CKCA 1PAQA 2AW6A 1E8XA 3LKUA 4FMUA 1E96B 3M57A 2V8SE 3FTUA 3GZSA 4HFGA 4O30A 3CHSA 4GAAA 4KBQA 2XEVA 3I4RB 3AU4A 4I6GA 3D9KA 3PNLB 3B13A 4GYOA 3FUEA 3CHPA 3I3NA 2KZTB 5ARFA 3ZRHA 2E2EA 3JYSA 4DJAA 3VUZA 1SZAA 5LFAA 4IJDA 5G04J 4JHJA 4LRZA 4NACA 3MCXA 1JWFA 2WXOA 3RJWA 2J08A 1XGWA 4ANVA 3CSFA 4HVBA 4G24A 3FUDA 1W3BA 4CGWA 1NA3A 4JW1A 1HU3A 3D3MA 1MQSA 4JDSA 2HYZA 4J6IA 2X3MA 4XIFA 4WWOA 5KJLA 4A1GA 1MHQA 4XKCA 5BW8C 5EDSA 1EDUA 3EHNA 4IYPA 1XQHA 5HI7A 4AP2A 1HX8A 4TRQA 3F9YA 3KMTA 1HG5A 3FPDA 4PUCA 2XPIA 4EQFA 3S7FA 2J9QA 4N5CA 3PS6A 4I17A 5FQ7A 2XGOA 1TJCA 3G2TA 4MI5A 2IF4A 3JQ0A 1B89A 2MOWA 2J4DA 4GPKA 3R9AB 4J8FA 2R3AA 3MO5A 4GB9A 2X6FA 4DI4A 3MJWA 2QPWA 3F9ZA 2V0PA 3IHVA 2VJ8A 2CFZA 4I43A 5LP0A 2M63A 5FZQA 4B8AA 4HOUA 1UN9A 3CVWA 3D9IA 4WAFA 4WNDA 3LY7A 4GZCA 4P29A 2WXMA 4UQYA 5EKQD 4Z4PA 5CMYA 4MKTA 3OXLA 4JL0A 3GYZA 3U9WA 4O6FA 1H3IA 4XX5A 1H2TC 2OVBA 5FJYA 4U0ZA 3GW4A 5AYWD 4HOSA 2Y4TA 3HDXA 1E8ZA 4JXTA 4HORA 3MO0A 5CPRB 4FU3A 1MVXA 5JHNA 3MKQA 4H7XA 4JA9A 1ZBPA 3F9WA 3LY9A 4ME2A 3VTXA 2OOEA 4R7LA 5JHBA 2FULA 5BPPA 4H7YA 3HVEB 3D9NA 4RSYA 2L9BA 3APFA 4PS3A 3RRNB 2XHEA 1H2VC 3FHEA 1IYGA 4AVXA 3EIJA 1HF8A 3LDZA 4GZ6A 5A23A 3MEKA 3GZ1A 1UJJA 3MX3A 3RQ4A 3B7RL 2VTBB 2BTDA 4N2QA 5JINA 5FTPA 4GU5A 4KVMA 4FADA 4GMLA 4I6JA 3MV3B 4CDNA 4YVQC 3CBMA 4E47A 4UQZA 2V4LA 3FUHA 1H0AA 3PDNA 4J8SA 4GA1A 3FTYA 3D9PA 3FY4A 2NC9A 3BO5A 1OWMA 1Z3YA 2JV0A 4RZ0A 1KLXA 1N6CA 5TH7A 4B89A 5KJNA 5HQ8A 3VLFA 3CK8A 4EECA 3FULA 2KC7A 2E0IA 3ESLA 1EF1C 3PEVB 4ACLA 3ZYLA 1FVFA 2L6JA 5LCWJ 2X6HA 4I2ZA 5J90A 2A4ZA 5ARGA 2IOLA 2X38A 3MGBA 4A1SA 4HLEA 3PVLA 1ML9A 4PDXA 4U8HA 2LO6A 3CK9A 3ZEFA 5DIZA 2AXZA 1EPUA 4A3VA 4IULA 3P2BA 4BTAA 1SQMA 3L13A 4EPZA 3MKRA 3UX4A 4LEUA 5TTFA 3RIBA 3KEZA 3T8MA 5CCLA 3PNTB 3QDNA 4OVUA 4AM9A 1HZ4A 1HE8A 2VYIA 3Q15A 4UWFA 3O4ZA 3RRUA 5BT1A 4I1OB 5LCWC 1NA0A 3OXFA 1NP7A 3Q5MA 4G25A 5G55A 4C9BB 3CR3A 3OPEA 3Q49B 4I2WA 2LSUA 3FH5A 2YHCA 3FEXA 3L54A 3UPVA 4YPAA 1WAO1 3SBTB 5E75A 3G2WA 2BUGA 3CIAA 4E6HA 1HFAA 4KMOA 4YNDA 2JEKA 5LOZA 3ZXSA 2F69A 3KMAA 5T0KA 1QQEA 2I6HA 2PQRA 2VGYA 3TJPA 2QFCA 3AS5A 4CDRA 3CHRA 2PQNA 3BG1B 3MYVA 3QJZA 4EZKA 1DVPA 4FA6A 3LVQE 3OTNA 3FTXA 3KAEA 4B0ZA 3FWVA 2UWJG 3CVNA 2BQZA 4XI0A 4AIFA 3MO2A 1PEGA 3P1UA 1QNFA 2KM4A 2UY1B 4U0SA 4YPEA 3FUKA 3D9JA 2CFUA 3CHQA 5AJDA 4J8EA 5D0QD 1P5QA 3C98A 4KT6B 3QARA 2CHZA 4MS6A 2XPYA 4FULA 2KATA 2YNQA 3M55A 4K0RA 3S7DA 3QAQA 3ML9A 1LF8A 1S0PA 1YA0A 3K5KA 1ELWA 2GRMA 4UWHA 5G04C 4L7TA 2LNIA 3HNAA 4URKA 4UI9J 5LSXA 3HYMB 2KCLA 1HH8A 4L2YA 2YHEA 3NZSA 5J08A 4WNEA 5ANLA 4AOFA 3ZHEA 1Z3XA 2CHXA 2VSNA 3CEQA 2XRYA 4G11A 1H2UA 1IHGA 2OV8A 1U3DA 2VSXE 2WXRA 4XI9A 4CDMA 5LSZA 1H19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G05 J;  2Q7F A;  4YNP A;  3IHX A;  3KS2 A;  3CVQ A;  4J8O A;  4U07 A;  5JJ0 A;  5CHE E;  3QWW A;  3AS8 A;  3OS5 A;  1ZU2 A;  5G05 C;  2FBN A;  3RO2 A;  3SZ7 A;  5T5G A;  2IFU A;  2C0M A;  3DB5 A;  3CV0 A;  1XNF A;  3U3W A;  4J83 A;  4GYY A;  4IN3 B;  3RKV A;  2MHK A;  3M58 A;  4RG9 A;  5FZS A;  2KCK A;  3TG5 A;  2W5Y A;  3QWV A;  4J7I A;  2PL2 A;  4JHR A;  2JLB A;  4AY5 A;  1MVH A;  3RJV A;  4I51 A;  3ESK A;  5JJT A;  5JJ7 A;  4HOT A;  3IEG A;  3CBO A;  3VV0 A;  4GCN A;  4WUY A;  4J0U A;  2FO7 A;  3Q47 B;  4N3B A;  3DAL A;  4BWR A;  2P58 C;  4QEN A;  5FT9 A;  5EX3 A;  1Y8M A;  4GZ3 A;  4GA0 A;  2FF4 A;  4NVQ A;  5D0O D;  1O9S A;  4MI0 A;  2VGX A;  2LSV A;  2XGS A;  3SW9 A;  4RG6 A;  2XGM A;  4YNM A;  4AY6 A;  1FCH A;  4J7F A;  1HXI A;  2VQ2 A;  4ABN A;  4N2S A;  5JIY A;  2YQ8 A;  4KXK B;  3M53 A;  4BUP A;  2Y4U A;  2GW1 A;  3MV2 B;  3UUX A;  3ZN3 A;  5EX0 A;  4BT8 A;  3ASF A;  4GZ5 A;  5F6K C;  2C2L A;  3NF1 A;  3N71 A;  3ZFW A;  4I9E A;  5A7D B;  1KT0 A;  4GCO A;  1PC2 A;  3CBP A;  3BEE A;  1A17 A;  3URZ A;  3M54 A;  1ELR A;  4N39 A;  3LY8 A;  4H12 A;  5KJK A;  3OOI A;  4QEO A;  4W9R A;  3S7B A;  4KYO B;  4GYW A;  3CK7 A;  4N3A A;  1ZKK A;  1N3J A;  3ASD A;  3FP3 A;  5FZR A;  3RO3 A;  2HO1 A;  4UI9 C;  3S8P A;  3TGO A;  4WNG A;  2V5F A;  4AU7 A;  4NJ5 A;  3Q4A B;  4U04 A;  3S7J A;  3LYA A;  2VGX B;  2W5Z A;  2O8J A;  3F9X A;  3KD7 A;  3ZGQ A;  4BT9 A;  1MT6 A;  2OND A;  4NQ0 A;  3PE4 A;  3VTY A;  2RFI A;  2FI7 A;  3O48 A;  3ZPJ A;  4I9C A;  3SWC A;  4NRH B;  2WPV A;  2XCC A;  1WM5 A;  2WQH A;  2C0L A;  5F6L A;  3TAX A;  3K9I A;  3RAY A;  5F59 A;  2R5S A;  3CVL A;  4GA2 A;  3UQ3 A;  5AYF A;  4B94 A;  3OXG A;  3ASG A;  3LCA A;  1MUF A;  5T0M A;  3GZ2 A;  4UQX A;  1KT1 A;  2DBA A;  3SF4 A;  1N6A A;  4JLG A;  3MA5 A;  5A6C A;  3CVP A;  1QZ2 A;  3ZHE B;  5EG2 A;  4IJ8 A;  4APO A;  2AVP A;  3EP0 A;  2PZI A;  2UY1 A;  3ASH A;  4YPU A;  3KMJ A;  5F5E A;  5M72 A;  3M56 A;  4Y6W A;  5DBK A;  4I1A A;  3QKY A;  5BNW A;  3LPZ A;  4LDG A;  2VSY A;  3FFL A;  5TEG A;  2IGQ A;  4N3C A;  2HR2 A;  4UI9 K;  1NZN A;  4BTB A;  3M59 A;  4WNF A;  4JA7 A;  2G46 A;  2KCV A;  4C1Q A;  3E4B A;  3EDT B;  4QEP A;  2FEZ A;  4J8D A;  5JJ6 A;  3U4T A;  3WXX A;  1OUV A;  3M5A A;  3ULQ A;  5CCM A;  4G26 A;  4G23 A;  4U0U A;  3QWP A;  4F3V A;  3TG4 A;  3CKB A;  3QOU A;  4HOQ A;  4YVO A;  3AS4 A;  4Y6C A;  3RU0 A;  3PE3 A;  2XCB A;  4G1T A;  5C1D A;  5KJM A;  4FMU A;  3CKC A;  3LKU A;  1E96 B;  3M57 A;  4O30 A;  4KBQ A;  2XEV A;  4GYO A;  5ARF A;  2E2E A;  3JYS A;  3VUZ A;  4IJD A;  5G04 J;  3RJW A;  4G24 A;  1W3B A;  4CGW A;  1NA3 A;  4JDS A;  2HYZ A;  4XIF A;  5KJL A;  5BW8 C;  1XQH A;  5HI7 A;  3F9Y A;  3KMT A;  3FPD A;  2XPI A;  4EQF A;  3S7F A;  2J9Q A;  4N5C A;  4I17 A;  2XGO A;  1TJC A;  4MI5 A;  2IF4 A;  1B89 A;  4GPK A;  3R9A B;  4J8F A;  2R3A A;  3MO5 A;  3F9Z A;  2QPW A;  5FZQ A;  4HOU A;  4WND A;  3LY7 A;  4UQY A;  5EKQ D;  4Z4P A;  3OXL A;  4JL0 A;  3GYZ A;  4O6F A;  1H3I A;  5FJY A;  4U0Z A;  3GW4 A;  5AYW D;  4HOS A;  2Y4T A;  4HOR A;  3MO0 A;  5CPR B;  1MVX A;  5JHN A;  4H7X A;  4JA9 A;  1ZBP A;  3F9W A;  3LY9 A;  4ME2 A;  3VTX A;  2OOE A;  4H7Y A;  1IYG A;  4GZ6 A;  3MEK A;  3GZ1 A;  3RQ4 A;  4N2Q A;  5JIN A;  5FTP A;  3MV3 B;  4YVQ C;  3CBM A;  4E47 A;  4UQZ A;  3PDN A;  4GA1 A;  2NC9 A;  3BO5 A;  2JV0 A;  4RZ0 A;  1KLX A;  1N6C A;  5TH7 A;  5KJN A;  5HQ8 A;  3CK8 A;  2KC7 A;  2L6J A;  5LCW J;  4I2Z A;  5ARG A;  4A1S A;  1ML9 A;  3CK9 A;  5DIZ A;  4BTA A;  3MKR A;  4LEU A;  5TTF A;  3RIB A;  5CCL A;  3QDN A;  4CGV A;  4AM9 A;  1HZ4 A;  2VYI A;  3Q15 A;  5BT1 A;  5LCW C;  1NA0 A;  3OXF A;  3Q5M A;  4G25 A;  3OPE A;  3Q49 B;  4I2W A;  2LSU A;  3UPV A;  2YHC A;  4YPA A;  1WAO 1;  2BUG A;  4YND A;  2F69 A;  3KMA A;  5T0K A;  1QQE A;  2I6H A;  2PQR A;  2VGY A;  2QFC A;  3AS5 A;  4CDR A;  2PQN A;  3KAE A;  3FWV A;  2UWJ G;  3CVN A;  2BQZ A;  4XI0 A;  4AIF A;  3MO2 A;  1PEG A;  4U0S A;  2UY1 B;  4YPE A;  4J8E A;  5D0Q D;  1P5Q A;  3M55 A;  2KAT A;  3S7D A;  1YA0 A;  3K5K A;  1ELW A;  5G04 C;  2LNI A;  3HNA A;  4UI9 J;  5LSX A;  3HYM B;  2KCL A;  1HH8 A;  4WNE A;  3ZHE A;  2VSN A;  3CEQ A;  4XI9 A;  1IHG A;  4G2V A;  5LSZ A; 
#chains in the Genus database with same CATH topology
 1OCO E;  1OWN A;  2H6F A;  4IRU A;  3KS2 A;  4FHK A;  4EBA G;  3SNX A;  4U07 A;  5CHE E;  3QWW A;  3OS5 A;  1INZ A;  2ZGG A;  3PZ1 A;  4K03 A;  2FBN A;  3RO2 A;  3SZ7 A;  5T5G A;  3V31 A;  2WMN A;  4JPS A;  2YIN A;  3FU5 A;  4B8C B;  3CV0 A;  3KSL A;  2P9L G;  1XNF A;  5T8I A;  4J83 A;  4BFR A;  4IN3 B;  2QZA A;  3CGH A;  4RG9 A;  2GGF A;  2W5Y A;  2WVI A;  4QFV A;  3IKO B;  3QWV A;  4J7I A;  4HRL A;  5CEA A;  3R9M A;  4AY5 A;  5AAO A;  3RJV A;  2GRQ B;  3CLJ A;  5KWD A;  1K1A A;  2VGE A;  4OVV A;  4N3B A;  2P58 C;  4QEN A;  2OEV A;  1Y8M A;  3C3Q A;  3LEW A;  5JMN D;  1E8Y A;  2WXP A;  2DYR E;  3IHY A;  3L6A A;  1KZP A;  2ION A;  5KNH D;  1O9S A;  2VGX A;  2I1K A;  3FUI A;  3SW9 A;  2XGM A;  3G2S A;  3TWT A;  1FCH A;  4ATG A;  3ABL E;  4EZL A;  4XKB A;  2PM6 A;  3ZKJ A;  4DI3 A;  3TL5 A;  3QC1 A;  4D10 C;  2Y4U A;  3MKQ B;  3OAW A;  4EBA A;  4ILI A;  1N52 A;  1OCR E;  4HI9 A;  4FC8 A;  3NF1 A;  4I9E A;  4GCO A;  4N5Q A;  5EN5 D;  3EHQ A;  4FJZ A;  3PH0 C;  4H12 A;  3OOI A;  3UXG A;  4ANW A;  4CT4 A;  1NL4 A;  3L22 A;  5T4Y A;  2GRL A;  2EIN E;  3CK7 A;  1ZKK A;  1E7U A;  3ASD A;  4UWL A;  2VTB A;  1MX4 A;  3APC A;  4UI9 C;  3UM3 A;  3TGO A;  2WXQ A;  1EYH A;  4A55 A;  4EZJ A;  3Q4A B;  4AV7 A;  3MZL B;  2L0I A;  5BXU A;  3F9X A;  1DCQ A;  3ZGQ A;  4BT9 A;  3TWQ A;  2DZN A;  4CCA A;  2R2L A;  3ASN E;  3TWV A;  1ZB1 A;  3B7T A;  3ZW3 A;  4PH4 B;  3W9G A;  3EU5 A;  4GZD A;  1N54 A;  4JHK A;  5EIB E;  3Q7A A;  2XCC A;  2AXU A;  2OVF A;  1LTX A;  3V2O A;  4L2L A;  5F6L A;  1G3N B;  4M3O A;  2WXF A;  2R5S A;  4V3I A;  4DK5 A;  4LUN U;  2I9C A;  2P9I G;  3FUM A;  4L1B A;  4U63 A;  4NIK A;  2LAI A;  3I4G A;  1TYQ G;  3ASO E;  4YDE A;  3DEP A;  4UQX A;  3HIZ A;  2IU1 A;  5HKP A;  2P9S G;  2X6I A;  4U96 D;  3CVP A;  5AIJ A;  3AG1 E;  1JCR A;  3JXJ A;  3AAA C;  3UM1 A;  3FUN A;  2NSZ A;  1K3Z D;  4I1A A;  3QKY A;  3UIP C;  5BNW A;  4CT0 A;  5H7P A;  4LDG A;  2HR2 A;  3D9M A;  4UI9 K;  1NZN A;  3M59 A;  3SFX A;  2RKK A;  1IQR A;  2KCV A;  3AJI A;  3L08 A;  2IJG X;  2BF0 X;  5ENO D;  2ETB A;  4KVO A;  2XQ0 A;  3Q73 A;  3T5V A;  3FU0 A;  1H6K A;  2RG8 A;  3SI5 A;  3ULQ A;  3ZIM A;  3I5P A;  4U0U A;  4TV3 A;  2J07 A;  3CKB A;  4HOQ A;  3PE3 A;  2NYJ A;  3S2A A;  4APF A;  4FMU A;  3M57 A;  3DRA A;  2V8S E;  3FTU A;  3GZS A;  1JCS A;  4GAA A;  2XEV A;  5CER B;  2ETC A;  3I4R B;  3AU4 A;  4I6G A;  2IO2 C;  2F37 A;  4HRN A;  3JYS A;  4OAV B;  3MCX A;  2WXO A;  4U7E B;  4ANV A;  5FIN A;  4HVB A;  3FUD A;  1TNZ A;  1MQS A;  1RW2 A;  4XIF A;  4WWO A;  5KJL A;  4A1G A;  4XKC A;  5BW8 C;  4F1P A;  3ULY A;  4I17 A;  2XGO A;  1TJC A;  3JXI A;  3V30 A;  1A5E A;  3BQO A;  3R9A B;  2R3A A;  2X6F A;  2QPW A;  2V0P A;  3J5Q B;  4B8A A;  1OCC E;  2J8S D;  3EU9 A;  3GYZ A;  4O6F A;  1MJ0 A;  4XX5 A;  5FJY A;  4U0Z A;  3GW4 A;  4FU3 A;  1MVX A;  4H7X A;  3UI2 A;  4R7L A;  1K8K G;  3D9N A;  2R03 A;  4RSY A;  2XHE A;  1H2V C;  3MX3 A;  4GTT A;  2VTB B;  2BTD A;  3Q79 A;  4FAD A;  2RFM A;  4YVQ C;  2XZD G;  1S70 B;  2NC9 A;  1OWM A;  2JV0 A;  4RZ0 A;  5KJN A;  3VLF A;  3FUL A;  3ZYL A;  2L6J A;  1O1T A;  4A1S A;  1ML9 A;  4PDX A;  4A3V A;  3L82 A;  3T8M A;  3PNT B;  3QDN A;  4E85 A;  4CGV A;  4UWF A;  3B7B A;  4G25 A;  3CR3 A;  2EIJ E;  3OPE A;  2LSU A;  3FH5 A;  3L54 A;  4B93 B;  3UPV A;  3SBT B;  1NI1 A;  5AQ7 A;  4KMO A;  3ZXS A;  3DPY A;  1QQE A;  3WG7 E;  4CDR A;  3BG1 B;  3OTN A;  3TWU A;  3DSU A;  2UWJ G;  2BQZ A;  1PEG A;  2KM4 A;  4U0S A;  4YPE A;  4DX5 D;  3E33 A;  3DXK G;  3R7Q A;  3C98 A;  3M55 A;  3QAR A;  2XPY A;  4FUL A;  3QAQ A;  1S0P A;  5AN8 A;  3K5K A;  1DC2 A;  5LSX A;  2R02 A;  3Q9U C;  4ATZ D;  2KCL A;  2XEN A;  2YHE A;  4WNE A;  4X8Q A;  2VSN A;  2CHX A;  4G11 A;  1H2U A;  1IHG A;  2OV8 A;  1U3D A;  2P2C P;  4G2V A;  4I9C A;  4TXQ A;  3Q75 A;  3UIO C;  2JAB A;  3DBS A;  4LCT A;  4BSX A;  2GRP B;  2Y1L E;  3CVQ A;  4LNG A;  3ABM E;  3AS8 A;  4ZFH A;  1ZU2 A;  2CHW A;  5G05 C;  2WXH A;  4MRU A;  3UMV A;  1U2V G;  1N95 A;  2C0M A;  2DYS E;  2A5U A;  5D66 A;  3FTV A;  3J5P A;  1UJK A;  5AQA A;  2AXV A;  2MHK A;  2AJA A;  3RK6 A;  3ZYK A;  3RSE G;  2F0Y A;  5B1B E;  1UOH A;  2PL2 A;  4K5B A;  2LXM A;  1E90 A;  3EHM A;  3ESK A;  5JJT A;  4O60 A;  2WQ7 A;  5JJ7 A;  4Q96 A;  1BI8 B;  3CBO A;  2GRR B;  2R17 C;  3VV0 A;  3PZD A;  1S63 A;  2EIM E;  2Y69 E;  2HM8 A;  5AEN A;  2IOS A;  4MLP A;  4A63 B;  5D0O D;  4JVS A;  4MI0 A;  2XGS A;  4RG6 A;  4AY6 A;  4J7F A;  1HXI A;  3T8K A;  2R59 A;  5JIY A;  4KXK B;  3M53 A;  4G8L A;  4FP7 A;  1TEZ A;  4HNA D;  5EYL A;  4DRX E;  3AG2 E;  3MV2 B;  4L23 A;  4FJY A;  3BG0 B;  3D9O A;  3PUJ A;  1N4R A;  4JC8 A;  2R05 A;  4F1S A;  1BD8 A;  1PC2 A;  3CBP A;  3BEE A;  4JEH A;  4N39 A;  1O5M A;  4QEO A;  3SFZ A;  2V4H C;  1YMP A;  2RFA A;  3LXU X;  3HVE A;  4CEM A;  1OCZ E;  3ML8 A;  1N3J A;  4HXI A;  1N9A A;  3QB2 A;  3SHF A;  3T5X A;  4BX8 A;  1YCS B;  4NJ5 A;  3CHM A;  4U04 A;  3LYA A;  3FTS A;  4AEZ C;  2W5Z A;  2O8J A;  1GW6 A;  3CVU A;  3KD7 A;  2P9N G;  4ACK A;  4NQ0 A;  3VTY A;  5KCM A;  3CQC B;  4HS2 A;  3APD A;  3U66 A;  2FI7 A;  3ZPJ A;  2CG3 A;  4A3T A;  2DVW A;  3FTZ A;  3HXB A;  4JEU A;  1LD7 A;  4GMJ A;  1TNY A;  3DSS A;  4KZC A;  3B7S A;  2IQC A;  3UQ3 A;  4B94 A;  1Q2Z A;  3OXG A;  3ASG A;  1MUF A;  5T0M A;  2H6G A;  1KT1 A;  1N6A A;  5A6C A;  3IBE A;  5EG2 A;  4APO A;  2PZI A;  5LX8 A;  1UG3 A;  4YPU A;  4LER A;  1TN7 A;  1Z6T A;  3SFY A;  5F5E A;  5M72 A;  2DCP A;  3G2V A;  1TNB A;  3QK0 A;  5DBK A;  3Q78 A;  1K1B A;  3JUI A;  3LPZ A;  5ANR A;  3FFL A;  2IGQ A;  2RD0 A;  4F7A A;  3EDT B;  3C72 A;  4O1P A;  4XEI G;  4TXP A;  3B7U X;  5JJ6 A;  3U4T A;  5KBA A;  1OUV A;  5CCM A;  5FQ4 A;  2J49 A;  3QWP A;  1HO8 A;  4YVO A;  3ZYQ A;  4Y6C A;  3RU0 A;  1ELK A;  5AJL A;  4G1T A;  2MRI A;  1PAQ A;  1E8X A;  4U8Y D;  1QYM A;  3BU8 A;  1N94 A;  3D9K A;  4GYO A;  3VUZ A;  1SZA A;  4IJD A;  5G04 J;  1X81 A;  4JHJ A;  4NAC A;  2J08 A;  5D2M C;  4CYM D;  3Q9N C;  4J6I A;  1MHQ A;  3EHN A;  4TRQ A;  3S7F A;  2J9Q A;  3C3R A;  3G2T A;  3JQ0 A;  3UTM A;  2MOW A;  2J4D A;  4GPK A;  4J8F A;  4GB9 A;  3IHV A;  2VJ8 A;  3CVW A;  3JUE A;  4WAF A;  4WND A;  4GZC A;  4P29 A;  2WXM A;  4UQY A;  2XZT G;  5CMY A;  4JL0 A;  2Y4T A;  4HOR A;  1E8Z A;  4JXT A;  2OOE A;  4GPM A;  2FUL A;  5BPP A;  4H7Y A;  3HVE B;  1JCQ A;  3APF A;  4AVX A;  3LDZ A;  5A23 A;  3GZ1 A;  3HXD A;  4KVM A;  4GML A;  4E47 A;  4UQZ A;  3FUH A;  4J8S A;  3FY4 A;  1Z3Y A;  1N6C A;  4B89 A;  2XEH A;  4ACL A;  4GTO A;  4GTR A;  1FVF A;  1N11 A;  2A4Z A;  3MGB A;  4K5A B;  3CK9 A;  5DIZ A;  1EPU A;  4IUL A;  3KEZ A;  5CCL A;  2VYI A;  5LCW C;  3Q15 A;  3O4Z A;  3RRU A;  2HE0 A;  1NP7 A;  4YDW A;  4BEP A;  1HFA A;  4YND A;  2JEK A;  4K5C A;  3KMA A;  4GTM A;  2QFC A;  1WDY A;  4EZK A;  1DVP A;  3E34 A;  3LVQ E;  3FTX A;  2Y0B G;  3KAE A;  1V55 E;  5AAR A;  3CVN A;  4AIF A;  3D9J A;  5D0Q D;  4MS6 A;  1D9S A;  4K0R A;  3LJN A;  1FT2 A;  2LXL A;  5G04 C;  5ENS D;  4URK A;  1TN8 A;  4L2Y A;  3NZS A;  5J08 A;  3ZHE A;  1Z3X A;  2WXR A;  2VSX E;  2WXL A;  2AWI A;  5G05 J;  2Q7F A;  2J4B A;  1U3C A;  4YNP A;  3ULE G;  5CRU A;  4J8O A;  3HHM A;  4DLQ A;  3NOC D;  4F53 A;  1MZC A;  1OWL A;  2IFU A;  5FWQ A;  2XRZ A;  2WQ6 A;  4TUU A;  3DEO A;  1TNU A;  5CBO A;  5HRY A;  4GYY A;  3RKV A;  2ZIR A;  4UWK A;  1HS6 A;  2KCK A;  3TG5 A;  3BUA A;  4PS8 A;  2QY7 A;  4ILH B;  2JLB A;  3D9L A;  1MVH A;  5IY5 E;  4I51 A;  2OEW A;  2MYO A;  1JWG A;  4QQI A;  3ZXP A;  3KSQ A;  5ITZ F;  1TJF A;  4LNB A;  4J0U A;  2FO7 A;  2A5E A;  3HG0 D;  3R7R A;  3UT7 A;  5ENR D;  3DAL A;  4BWR A;  5FT9 A;  4C48 B;  5EX3 A;  4GZ3 A;  4NUR A;  5G2N A;  1QBQ A;  2FF4 A;  4FHJ A;  2LSV A;  4C0M A;  4YNM A;  3ONK A;  3VLD A;  1E7V A;  1L5J A;  4ABN A;  2I1J A;  3EHR A;  4N2S A;  2YQ8 A;  4DLO A;  4RVB A;  2J09 A;  3L16 A;  2GRO B;  3CQG B;  2L6B A;  4BUP A;  2GW1 A;  3PRZ A;  3UUX A;  5FIO A;  3B95 A;  4DX1 A;  4BT8 A;  2WMO A;  2L0T B;  2P9P G;  3L17 A;  1FT1 A;  2ILR A;  3KEA A;  3LJ3 A;  1A17 A;  2WXI A;  3URZ A;  5JHA A;  5KJK A;  4Q69 A;  4W9R A;  3S7B A;  3TWS A;  1BI7 B;  4GYW A;  4CZ2 D;  3CVX A;  5CMW A;  3G2U A;  1N0Q A;  3RO3 A;  1S64 A;  4DX2 A;  3FDH A;  3FU6 A;  4WNG A;  5BV1 A;  2DWZ A;  2X6K A;  4TXR A;  3IV0 A;  2OCC E;  3ZVV A;  4UWG A;  2QC9 A;  1MT6 A;  2OND A;  5BV0 A;  2EIL E;  2H6I A;  3FH7 A;  2WQH A;  4J7W A;  2WXJ A;  3CVV A;  3K9I A;  3FUF A;  1DNP A;  5F59 A;  2IEJ A;  4GA2 A;  3EJN A;  5AYF A;  3AU5 A;  1UN8 A;  3LCA A;  4ANX A;  3NZU A;  2DBA A;  3SF4 A;  4JLG A;  1IXV A;  1QZ2 A;  3ZHE B;  4J8Y A;  1AP7 A;  2UY1 A;  3ASH A;  3FTW A;  3QNK A;  3KMJ A;  1OWO A;  4U95 D;  4G8K A;  1X5B A;  2ZIS A;  3SO8 A;  3CVY A;  5BUZ A;  4Y6W A;  3TWR A;  3PUK A;  5FQ6 A;  4ANU A;  1JPL A;  5T3R A;  2VSY A;  4BY6 A;  4BX9 A;  4JA7 A;  2G46 A;  4BSZ B;  2ETA A;  4C1Q A;  3TXM A;  2ZU6 B;  3Q7F A;  4Q94 A;  2CG2 A;  3U64 A;  4QEP A;  4AJW A;  4J8D A;  1BPO A;  2WB2 A;  5EID A;  2NXP A;  5CRV A;  3TXN A;  4CRW A;  4G23 A;  4HB5 A;  2XS8 A;  3TG4 A;  3E30 A;  3UM0 A;  4WWP A;  3QOU A;  5EIL A;  3SY2 A;  2XCB A;  5C1D A;  5KJM A;  3RRM B;  4Z68 A;  2AW6 A;  1E96 B;  3UKU G;  3AG4 E;  3PNL B;  1D8D A;  3FUE A;  1YYH A;  3I3N A;  2E2E A;  3EUV A;  2QYJ A;  4ZHB A;  3RJW A;  1MX2 A;  4GTQ A;  1HU3 A;  3D3M A;  2B6C A;  5AQ9 A;  2X3M A;  4OAU C;  5HI7 A;  4AP2 A;  1HG5 A;  3FPD A;  2XPI A;  3C3O A;  1O1S A;  3PS6 A;  3X2Q E;  1B89 A;  1H6P A;  3MO5 A;  2F8Y A;  4DI4 A;  2P9U G;  1KZO A;  3MJW A;  2CFZ A;  5LP0 A;  4HOU A;  3D9I A;  3LY7 A;  3HXE A;  2BKK B;  1H3I A;  3L9T A;  1H2T C;  5AYW D;  3D9H A;  4HOS A;  5CPR B;  2DZO A;  4JA9 A;  1ZBP A;  3F9W A;  4ME2 A;  5CEC B;  1SW6 A;  5KNG A;  3RRN B;  3FHE A;  5AQB A;  4GZ6 A;  3MEK A;  1UJJ A;  4BES A;  3RQ4 A;  4N2Q A;  3TWX A;  5JIN A;  3MV3 B;  4CDN A;  4RLY A;  2V4L A;  1RZ4 A;  5B3S E;  3BO5 A;  5TH7 A;  5CED B;  4BET A;  5HQ8 A;  4EEC A;  1BLX B;  2KC7 A;  1TN6 A;  4UUC A;  5LCW J;  4I2Z A;  2IOL A;  4HLE A;  2LO6 A;  3ZEF A;  3P2B A;  4BTA A;  5CBN A;  3MKR A;  5TTF A;  3E37 A;  3PZ2 A;  4AM9 A;  1HE8 A;  3SQV A;  1LD8 A;  1NA0 A;  3Q5M A;  5ENT D;  5G55 A;  4C9B B;  3Q49 B;  4I2W A;  2YHC A;  3G2W A;  2BUG A;  4E6H A;  5BXO A;  2XS1 A;  2F69 A;  2I6H A;  4HI8 A;  2VGY A;  1D8E A;  2PQN A;  3MYV A;  4RQI A;  3QJZ A;  2FO1 E;  4B0Z A;  3MO2 A;  2UY1 B;  3FUK A;  5AJD A;  1P5Q A;  2CHZ A;  1LF8 A;  2LNI A;  2QYU A;  4LSZ E;  3V2X A;  3HNA A;  3HYM B;  1MX6 A;  3ZNG A;  2KXP C;  5ANL A;  5EYP F;  3UM2 A;  4CDM A;  1H19 A;  2WM9 A;  2BED A;  1WG0 A;  2I2O A;  4OYS A;  3LS8 A;  3DSX A;  3IHX A;  3NOG D;  4JZY A;  1OXJ A;  1NFI E;  3HRA A;  1BU9 A;  5JJ0 A;  3ENE A;  3HXF A;  2F8X K;  1SZ9 A;  3UT4 A;  3PEU B;  2Y3A A;  3DB5 A;  1WY6 A;  3PZ3 A;  3FUJ A;  3U3W A;  4LG6 A;  3W9F A;  3M58 A;  5FZS A;  3DXM G;  1HG2 A;  1IKN D;  1OWP A;  4JHR A;  3PZ4 A;  1N4Q A;  3AG3 E;  4YDO A;  1JUQ A;  4WWN A;  4FLB A;  4HOT A;  2B0O E;  3IEG A;  4F6R D;  2KZT A;  4GCN A;  4WUY A;  3F6Q A;  3Q47 B;  4EHM A;  1VDY A;  4GTP A;  3ABK E;  3PRE A;  3ONL A;  4GA0 A;  2WXN A;  4NVQ A;  2ZXW E;  2EIK E;  3SBS A;  1IQU A;  1Y6I A;  2IO3 C;  3HXC A;  2VQ2 A;  2P9K G;  3JCK C;  4U8V D;  2X6J A;  4HLL A;  2WXK A;  1PY1 A;  2EQX A;  3VLE A;  4FLH A;  3ZN3 A;  1E8W A;  5EX0 A;  2WXG A;  3FU3 A;  1SA4 A;  1FPP A;  4I1M A;  3ASF A;  3CST A;  4GZ5 A;  5F6K C;  2C2L A;  3N71 A;  1FVH A;  4L9P A;  1UW4 B;  3UKR G;  3ZFW A;  5A7D B;  1KT0 A;  3M54 A;  1ELR A;  3LY8 A;  1AWC B;  3LVR E;  3NQP A;  4KYO B;  3NBN B;  3IXE A;  4N3A A;  4DPR A;  3FP3 A;  5FZR A;  3EIQ C;  2HO1 A;  3S8P A;  2IY0 C;  2VSO E;  3FEY A;  4XZ4 A;  2V5F A;  4AU7 A;  3C5R A;  3ZUV B;  3S7J A;  4GTS A;  2VGX B;  4HRM B;  4XE0 A;  3PE4 A;  1SA5 A;  2RFI A;  3O48 A;  2BKG A;  3NB2 A;  4AXH A;  3SWC A;  1V54 E;  2V5Q C;  4NRH B;  2WPV A;  1WM5 A;  2C0L A;  3TAX A;  3RAY A;  3CVL A;  3ISM C;  5ENN A;  1N4P A;  5E76 A;  4MBG A;  2XPZ A;  3GZ2 A;  2LAH A;  3MA5 A;  3DPD A;  3SD5 A;  3ZYM A;  4IJ8 A;  2AVP A;  3EP0 A;  4C0E A;  4GTV A;  3UT8 A;  3JQ1 A;  5ENQ D;  3M56 A;  1H6O A;  3DWL G;  4PS7 A;  5FQ8 A;  3FH8 A;  5TEG A;  4N3C A;  2GRN B;  4BTB A;  4WNF A;  4M7C A;  3E4B A;  3CHO A;  4ILG A;  4KZ0 A;  4I6E A;  2PM7 A;  3UIN C;  2FEZ A;  1OT8 A;  3E32 A;  3WXX A;  2DIW A;  3M5A A;  3ZU7 B;  4G26 A;  4F3V A;  3AS4 A;  3SGH A;  5C2Y A;  3CKC A;  3LKU A;  4BER A;  4HFG A;  4O30 A;  3TWW A;  3CHS A;  4KBQ A;  3RAU A;  3B13 A;  3CHP A;  4HQD A;  4DX7 D;  2KZT B;  5ARF A;  3ZRH A;  4DJA A;  5LFA A;  4LRZ A;  1JWF A;  4JD2 G;  1XGW A;  3CSF A;  4G24 A;  1DCE A;  1IHB A;  1W3B A;  4CGW A;  1NA3 A;  4JW1 A;  4JDS A;  2HYZ A;  3T9K A;  5EDS A;  1EDU A;  4IYP A;  1XQH A;  1HX8 A;  3F9Y A;  3KMT A;  4PUC A;  5ENP D;  4EQF A;  4N5C A;  5FQ7 A;  4MI5 A;  2IF4 A;  1N4S A;  4DX6 D;  1O1R A;  3F9Z A;  4I43 A;  2M63 A;  5FZQ A;  1UN9 A;  5EKQ D;  3V79 K;  4Z4P A;  4MKT A;  4DUI A;  3OXL A;  3U9W A;  4LNU D;  1KPS B;  4HBD A;  2OVB A;  3HDX A;  4O1O A;  3MO0 A;  5JHN A;  3MKQ A;  3LY9 A;  3VTX A;  5JHB A;  2L9B A;  4PS3 A;  3DSW A;  2LUH A;  1IYG A;  1Z5S C;  3EIJ A;  1HF8 A;  1OY3 D;  3B7R L;  5FTP A;  4GU5 A;  3DSV A;  4I6J A;  3CBM A;  1H0A A;  3PDN A;  4GMR A;  1MYO A;  4GA1 A;  3FTY A;  3D9P A;  4JB8 P;  5JA4 D;  4YDY A;  1KLX A;  3DST A;  5B1A E;  3CK8 A;  2E0I A;  3ESL A;  1EF1 C;  3PEV B;  1N0R A;  2X6H A;  5J90 A;  5ARG A;  2X38 A;  3PVL A;  4U8H A;  2AXZ A;  2H6H A;  1SQM A;  3L13 A;  4EPZ A;  3UX4 A;  2XEE A;  4LEU A;  3RIB A;  4OVU A;  5BT1 A;  1HZ4 A;  4I1O B;  3OXF A;  1TNO A;  3FEX A;  2PNN A;  4YPA A;  1WAO 1;  5E75 A;  5HS0 A;  3CIA A;  5LOZ A;  3NAW A;  5T0K A;  2PQR A;  3TJP A;  3AS5 A;  3CHR A;  4TUM A;  4FA6 A;  3FWV A;  4XI0 A;  3P1U A;  1QNF A;  2CFU A;  3CHQ A;  4J8E A;  4KT6 B;  2ZGD A;  2KAT A;  2YNQ A;  3S7D A;  3ML9 A;  1YA0 A;  1ELW A;  2GRM A;  4UWH A;  4L7T A;  4UI9 J;  1HH8 A;  4AOF A;  1SVX A;  3CEQ A;  4XI9 A;  2XRY A;  5LSZ A;  2KBX A;  1TR4 A; 
#chains in the Genus database with same CATH homology
 2WXL A;  1OWN A;  2AWI A;  2I2O A;  2WM9 A;  2Q7F A;  4OYS A;  4LCT A;  3DBS A;  4IRU A;  5G05 J;  3LS8 A;  2J4B A;  1U3C A;  4BSX A;  3IHX A;  4YNP A;  3KS2 A;  4FHK A;  4EBA G;  3CVQ A;  3SNX A;  4JZY A;  4J8O A;  3HHM A;  4U07 A;  5JJ0 A;  5CHE E;  3QWW A;  3AS8 A;  3OS5 A;  3ENE A;  1ZU2 A;  2CHW A;  1INZ A;  1SZ9 A;  5G05 C;  4DLQ A;  4K03 A;  3UT4 A;  4F53 A;  2FBN A;  3PEU B;  3RO2 A;  3SZ7 A;  5T5G A;  2WXH A;  2Y3A A;  1OWL A;  2WMN A;  4MRU A;  3UMV A;  4JPS A;  2YIN A;  2IFU A;  2C0M A;  1WY6 A;  3CV0 A;  3FU5 A;  4B8C B;  3DB5 A;  5FWQ A;  3FUJ A;  2A5U A;  2WQ6 A;  2XRZ A;  4TUU A;  1XNF A;  3FTV A;  5T8I A;  1UJK A;  3U3W A;  4J83 A;  4BFR A;  4GYY A;  2AXV A;  4IN3 B;  3RKV A;  2MHK A;  3CGH A;  3M58 A;  4RG9 A;  2GGF A;  4UWK A;  1HS6 A;  3RK6 A;  5FZS A;  2KCK A;  3ZYK A;  3TG5 A;  2W5Y A;  2WVI A;  4QFV A;  3IKO B;  3QWV A;  1HG2 A;  1OWP A;  4PS8 A;  4J7I A;  2QY7 A;  4ILH B;  2PL2 A;  4JHR A;  2JLB A;  3D9L A;  4AY5 A;  1MVH A;  1E90 A;  3EHM A;  3RJV A;  1JUQ A;  4I51 A;  3ESK A;  5JJT A;  4WWN A;  4FLB A;  1JWG A;  3CLJ A;  5JJ7 A;  2WQ7 A;  4Q96 A;  4HOT A;  3IEG A;  4OVV A;  3CBO A;  2KZT A;  1TJF A;  2R17 C;  3VV0 A;  4GCN A;  3PZD A;  4WUY A;  4J0U A;  2FO7 A;  3R7R A;  3UT7 A;  3Q47 B;  4N3B A;  1VDY A;  3DAL A;  4BWR A;  2P58 C;  4QEN A;  5FT9 A;  2HM8 A;  3PRE A;  4CGV A;  5EX3 A;  5AEN A;  2IOS A;  4MLP A;  1Y8M A;  3R7Q A;  4GZ3 A;  3LEW A;  1E8Y A;  2WXP A;  3ONL A;  4NUR A;  5G2N A;  3IHY A;  3L6A A;  4GA0 A;  2FF4 A;  2ION A;  2WXN A;  4NVQ A;  5D0O D;  4JVS A;  4FHJ A;  1O9S A;  4MI0 A;  2XGS A;  2VGX A;  2I1K A;  2LSV A;  3FUI A;  3SBS A;  3SW9 A;  1IQU A;  1Y6I A;  2XGM A;  4RG6 A;  4C0M A;  3G2S A;  4YNM A;  3ONK A;  3VLD A;  4AY6 A;  1FCH A;  4J7F A;  1HXI A;  2VQ2 A;  1E7V A;  1L5J A;  4ATG A;  4EZL A;  3JCK C;  4XKB A;  2R59 A;  2PM6 A;  4ABN A;  2I1J A;  4N2S A;  5JIY A;  2YQ8 A;  2X6J A;  4DLO A;  4DI3 A;  4RVB A;  4KXK B;  2J09 A;  3L16 A;  3M53 A;  4FP7 A;  3TL5 A;  2WXK A;  3CQG B;  3QC1 A;  1PY1 A;  4D10 C;  1TEZ A;  4BUP A;  2Y4U A;  3MKQ B;  2GW1 A;  3MV2 B;  3PRZ A;  2EQX A;  3OAW A;  4L23 A;  4FJY A;  3UUX A;  4FLH A;  3BG0 B;  3D9O A;  3VLE A;  3ZN3 A;  4EBA A;  1E8W A;  4ILI A;  5EX0 A;  2WXG A;  1N52 A;  3FU3 A;  4BT8 A;  3PUJ A;  2WMO A;  4I1M A;  3ASF A;  3CST A;  4JC8 A;  4GZ5 A;  5F6K C;  2C2L A;  4FC8 A;  3NF1 A;  3N71 A;  1FVH A;  4I9E A;  1UW4 B;  3ZFW A;  4F1S A;  2L0T B;  5A7D B;  3L17 A;  1KT0 A;  2ILR A;  1PC2 A;  4GCO A;  3CBP A;  3BEE A;  4G2V A;  3LJ3 A;  1A17 A;  2WXI A;  4FJZ A;  3URZ A;  3M54 A;  1ELR A;  4JEH A;  3PH0 C;  4N39 A;  3LY8 A;  5JHA A;  4H12 A;  5KJK A;  3OOI A;  4QEO A;  3SFZ A;  4ANW A;  4Q69 A;  4W9R A;  3S7B A;  3LVR E;  4E85 A;  3NQP A;  4KYO B;  3LXU X;  3HVE A;  4CT4 A;  4CEM A;  3L22 A;  5T4Y A;  4GYW A;  2GRL A;  3ML8 A;  3CK7 A;  4N3A A;  1ZKK A;  1N3J A;  1E7U A;  3ASD A;  4UWL A;  4DPR A;  4HXI A;  3FP3 A;  5CMW A;  5FZR A;  3CVX A;  2VTB A;  3G2U A;  3EIQ C;  3QB2 A;  3RO3 A;  2HO1 A;  3APC A;  4UI9 C;  3SHF A;  3T5X A;  3S8P A;  3FDH A;  3FU6 A;  4WNG A;  3TGO A;  2WXQ A;  4BX8 A;  1EYH A;  2VSO E;  3FEY A;  4A55 A;  4XZ4 A;  5BV1 A;  2V5F A;  4AU7 A;  4NJ5 A;  2X6K A;  4EZJ A;  3Q4A B;  3IV0 A;  4AV7 A;  3CHM A;  4U04 A;  3S7J A;  3MZL B;  2L0I A;  3LYA A;  3FTS A;  2VGX B;  4AEZ C;  3ZVV A;  2W5Z A;  4UWG A;  2O8J A;  3F9X A;  1GW6 A;  3CVU A;  3KD7 A;  3ZGQ A;  4BT9 A;  4XE0 A;  4ACK A;  1MT6 A;  2OND A;  4NQ0 A;  3PE4 A;  3VTY A;  5KCM A;  5BV0 A;  3CQC B;  4HS2 A;  3APD A;  4CCA A;  3U66 A;  2RFI A;  2FI7 A;  3O48 A;  3ZPJ A;  3B7T A;  3ZW3 A;  4PH4 B;  4I9C A;  4AXH A;  3SWC A;  2CG3 A;  4GZD A;  1N54 A;  4NRH B;  4JHK A;  3FH7 A;  2WPV A;  2XCC A;  1WM5 A;  4A3T A;  2AXU A;  2OVF A;  2WQH A;  4L2L A;  2C0L A;  2WXJ A;  3FTZ A;  3TAX A;  3CVV A;  5F6L A;  3K9I A;  3FUF A;  4JEU A;  3RAY A;  4M3O A;  2WXF A;  1DNP A;  5F59 A;  2R5S A;  4V3I A;  4DK5 A;  3CVL A;  4LUN U;  4GMJ A;  2I9C A;  4GA2 A;  5ENN A;  4KZC A;  3B7S A;  3EJN A;  2IQC A;  3FUM A;  4L1B A;  3UQ3 A;  3AU5 A;  4U63 A;  5E76 A;  4B94 A;  5AYF A;  2LAI A;  1UN8 A;  3OXG A;  3ASG A;  3I4G A;  3LCA A;  1MUF A;  3M56 A;  4ANX A;  5T0M A;  2XPZ A;  3GZ2 A;  3NZU A;  4UQX A;  3HIZ A;  1KT1 A;  2DBA A;  2IU1 A;  2LAH A;  3SF4 A;  1N6A A;  2X6I A;  4JLG A;  3MA5 A;  5A6C A;  3DPD A;  3SD5 A;  3IBE A;  3CVP A;  1QZ2 A;  3ZHE B;  5EG2 A;  5AIJ A;  3ZYM A;  4IJ8 A;  4APO A;  2AVP A;  3EP0 A;  2PZI A;  2UY1 A;  3ASH A;  4C0E A;  5LX8 A;  1UG3 A;  4YPU A;  4LER A;  3UT8 A;  3FTW A;  3JQ1 A;  3QNK A;  3KMJ A;  1Z6T A;  5F5E A;  1OWO A;  5M72 A;  2DCP A;  3G2V A;  1X5B A;  3CVY A;  3QK0 A;  3FUN A;  4Y6W A;  5BUZ A;  5DBK A;  5FQ6 A;  3PUK A;  2NSZ A;  4PS7 A;  4ANU A;  4I1A A;  3JUI A;  1JPL A;  3QKY A;  5T3R A;  5BNW A;  4CT0 A;  3LPZ A;  5ANR A;  5FQ8 A;  2VSY A;  3FFL A;  4LDG A;  3FH8 A;  2IGQ A;  4N3C A;  5TEG A;  2HR2 A;  2RD0 A;  3D9M A;  4UI9 K;  4BY6 A;  1NZN A;  4BTB A;  3M59 A;  4F7A A;  4WNF A;  4BX9 A;  4JA7 A;  1IQR A;  2G46 A;  2KCV A;  4C1Q A;  3E4B A;  3CHO A;  4ILG A;  3TXM A;  2ZU6 B;  4KZ0 A;  3EDT B;  3L08 A;  4Q94 A;  2CG2 A;  2IJG X;  4I6E A;  2PM7 A;  3U64 A;  4QEP A;  2FEZ A;  2BF0 X;  4AJW A;  4J8D A;  3B7U X;  4KVO A;  2XQ0 A;  5JJ6 A;  1BPO A;  3U4T A;  3T5V A;  2WB2 A;  3FU0 A;  1H6K A;  3WXX A;  2RG8 A;  2NXP A;  2DIW A;  3SI5 A;  1OUV A;  3TXN A;  3ULQ A;  5CCM A;  3ZIM A;  3M5A A;  5FQ4 A;  3I5P A;  4G26 A;  4CRW A;  2J49 A;  4G23 A;  4U0U A;  3QWP A;  4F3V A;  3TG4 A;  4TV3 A;  2J07 A;  4WWP A;  1HO8 A;  3CKB A;  3QOU A;  4HOQ A;  4YVO A;  3ZYQ A;  3AS4 A;  4Y6C A;  3RU0 A;  1ELK A;  3PE3 A;  5AJL A;  3SGH A;  5C2Y A;  2XCB A;  4G1T A;  3S2A A;  4APF A;  3RRM B;  5C1D A;  5KJM A;  2MRI A;  3CKC A;  1PAQ A;  2AW6 A;  1E8X A;  3LKU A;  4FMU A;  1E96 B;  3M57 A;  2V8S E;  3FTU A;  3GZS A;  4HFG A;  4O30 A;  3CHS A;  4GAA A;  4KBQ A;  2XEV A;  3I4R B;  3AU4 A;  4I6G A;  3D9K A;  3PNL B;  3B13 A;  4GYO A;  3FUE A;  3CHP A;  3I3N A;  2KZT B;  5ARF A;  3ZRH A;  2E2E A;  3JYS A;  4DJA A;  3VUZ A;  1SZA A;  5LFA A;  4IJD A;  5G04 J;  4JHJ A;  4LRZ A;  4NAC A;  3MCX A;  1JWF A;  2WXO A;  3RJW A;  2J08 A;  1XGW A;  4ANV A;  3CSF A;  4HVB A;  4G24 A;  3FUD A;  1W3B A;  4CGW A;  1NA3 A;  4JW1 A;  1HU3 A;  3D3M A;  1MQS A;  4JDS A;  2HYZ A;  4J6I A;  2X3M A;  4XIF A;  4WWO A;  5KJL A;  4A1G A;  1MHQ A;  4XKC A;  5BW8 C;  5EDS A;  1EDU A;  3EHN A;  4IYP A;  1XQH A;  5HI7 A;  4AP2 A;  1HX8 A;  4TRQ A;  3F9Y A;  3KMT A;  1HG5 A;  3FPD A;  4PUC A;  2XPI A;  4EQF A;  3S7F A;  2J9Q A;  4N5C A;  3PS6 A;  4I17 A;  5FQ7 A;  2XGO A;  1TJC A;  3G2T A;  4MI5 A;  2IF4 A;  3JQ0 A;  1B89 A;  2MOW A;  2J4D A;  4GPK A;  3R9A B;  4J8F A;  2R3A A;  3MO5 A;  4GB9 A;  2X6F A;  4DI4 A;  3MJW A;  2QPW A;  3F9Z A;  2V0P A;  3IHV A;  2VJ8 A;  2CFZ A;  4I43 A;  5LP0 A;  2M63 A;  5FZQ A;  4B8A A;  4HOU A;  1UN9 A;  3CVW A;  3D9I A;  4WAF A;  4WND A;  3LY7 A;  4GZC A;  4P29 A;  2WXM A;  4UQY A;  5EKQ D;  4Z4P A;  5CMY A;  4MKT A;  3OXL A;  4JL0 A;  3GYZ A;  3U9W A;  4O6F A;  1H3I A;  4XX5 A;  1H2T C;  2OVB A;  5FJY A;  4U0Z A;  3GW4 A;  5AYW D;  4HOS A;  2Y4T A;  3HDX A;  1E8Z A;  4JXT A;  4HOR A;  3MO0 A;  5CPR B;  4FU3 A;  1MVX A;  5JHN A;  3MKQ A;  4H7X A;  4JA9 A;  1ZBP A;  3F9W A;  3LY9 A;  4ME2 A;  3VTX A;  2OOE A;  4R7L A;  5JHB A;  2FUL A;  5BPP A;  4H7Y A;  3HVE B;  3D9N A;  4RSY A;  2L9B A;  3APF A;  4PS3 A;  3RRN B;  2XHE A;  1H2V C;  3FHE A;  1IYG A;  4AVX A;  3EIJ A;  1HF8 A;  3LDZ A;  4GZ6 A;  5A23 A;  3MEK A;  3GZ1 A;  1UJJ A;  3MX3 A;  3RQ4 A;  3B7R L;  2VTB B;  2BTD A;  4N2Q A;  5JIN A;  5FTP A;  4GU5 A;  4KVM A;  4FAD A;  4GML A;  4I6J A;  3MV3 B;  4CDN A;  4YVQ C;  3CBM A;  4E47 A;  4UQZ A;  2V4L A;  3FUH A;  1H0A A;  3PDN A;  4J8S A;  4GA1 A;  3FTY A;  3D9P A;  3FY4 A;  2NC9 A;  3BO5 A;  1OWM A;  1Z3Y A;  2JV0 A;  4RZ0 A;  1KLX A;  1N6C A;  5TH7 A;  4B89 A;  5KJN A;  5HQ8 A;  3VLF A;  3CK8 A;  4EEC A;  3FUL A;  2KC7 A;  2E0I A;  3ESL A;  1EF1 C;  3PEV B;  4ACL A;  3ZYL A;  1FVF A;  2L6J A;  5LCW J;  2X6H A;  4I2Z A;  5J90 A;  2A4Z A;  5ARG A;  2IOL A;  2X38 A;  3MGB A;  4A1S A;  4HLE A;  3PVL A;  1ML9 A;  4PDX A;  4U8H A;  2LO6 A;  3CK9 A;  3ZEF A;  5DIZ A;  2AXZ A;  1EPU A;  4A3V A;  4IUL A;  3P2B A;  4BTA A;  1SQM A;  3L13 A;  4EPZ A;  3MKR A;  3UX4 A;  4LEU A;  5TTF A;  3RIB A;  3KEZ A;  3T8M A;  5CCL A;  3PNT B;  3QDN A;  4OVU A;  4AM9 A;  1HZ4 A;  1HE8 A;  2VYI A;  3Q15 A;  4UWF A;  3O4Z A;  3RRU A;  5BT1 A;  4I1O B;  5LCW C;  1NA0 A;  3OXF A;  1NP7 A;  3Q5M A;  4G25 A;  5G55 A;  4C9B B;  3CR3 A;  3OPE A;  3Q49 B;  4I2W A;  2LSU A;  3FH5 A;  2YHC A;  3FEX A;  3L54 A;  3UPV A;  4YPA A;  1WAO 1;  3SBT B;  5E75 A;  3G2W A;  2BUG A;  3CIA A;  4E6H A;  1HFA A;  4KMO A;  4YND A;  2JEK A;  5LOZ A;  3ZXS A;  2F69 A;  3KMA A;  5T0K A;  1QQE A;  2I6H A;  2PQR A;  2VGY A;  3TJP A;  2QFC A;  3AS5 A;  4CDR A;  3CHR A;  2PQN A;  3BG1 B;  3MYV A;  3QJZ A;  4EZK A;  1DVP A;  4FA6 A;  3LVQ E;  3OTN A;  3FTX A;  3KAE A;  4B0Z A;  3FWV A;  2UWJ G;  3CVN A;  2BQZ A;  4XI0 A;  4AIF A;  3MO2 A;  1PEG A;  3P1U A;  1QNF A;  2KM4 A;  2UY1 B;  4U0S A;  4YPE A;  3FUK A;  3D9J A;  2CFU A;  3CHQ A;  5AJD A;  4J8E A;  5D0Q D;  1P5Q A;  3C98 A;  4KT6 B;  3QAR A;  2CHZ A;  4MS6 A;  2XPY A;  4FUL A;  2KAT A;  2YNQ A;  3M55 A;  4K0R A;  3S7D A;  3QAQ A;  3ML9 A;  1LF8 A;  1S0P A;  1YA0 A;  3K5K A;  1ELW A;  2GRM A;  4UWH A;  5G04 C;  4L7T A;  2LNI A;  3HNA A;  4URK A;  4UI9 J;  5LSX A;  3HYM B;  2KCL A;  1HH8 A;  4L2Y A;  2YHE A;  3NZS A;  5J08 A;  4WNE A;  5ANL A;  4AOF A;  3ZHE A;  1Z3X A;  2CHX A;  2VSN A;  3CEQ A;  2XRY A;  4G11 A;  1H2U A;  1IHG A;  2OV8 A;  1U3D A;  2VSX E;  2WXR A;  4XI9 A;  4CDM A;  5LSZ A;  1H19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...