3S7BA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7bA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7bA01
2V5FA 5T0KA 1H3IA 3MEKA 4IN3B 4WUYA 4WNDA 3ZHEB 2C0MA 4XI0A 2VGXA 3LYAA 3LY7A 4LEUA 5FTPA 3R9AB 4BUPA 2FO7A 3SWCA 1XQHA 2VYIA 2C0LA 4FMUA 2XCBA 3CK9A 5JJTA 3KMTA 1TJCA 2O8JA 4I9EA 4U07A 1N6AA 2KCKA 4GCOA 2G46A 3JYSA 3TAXA 3QOUA 2LNIA 4UI9K 2W5YA 2FBNA 4KYOB 1NA0A 3IHXA 4I2ZA 2QFCA 5CCLA 4N3BA 3EP0A 4BTBA 1PEGA 4AY6A 3ZFWA 5KJLA 4QENA 2IF4A 2Q7FA 1ML9A 5ARGA 2UY1B 5JJ7A 3M5AA 4G1TA 5CPRB 4JL0A 1KT1A 4WNEA 3MO5A 4W9RA 2KCVA 4YVOA 3QWVA 1MVXA 1N6CA 4G26A 3M57A 3CBOA 3CK7A 4EQFA 2VGXB 4ME2A 5T5GA 1IHGA 4RZ0A 3GZ1A 5G04C 2QPWA 3PE3A 3ZN3A 3FPDA 3AS5A 1ZU2A 2Y4TA 5JHNA 3S7FA 3M56A 4IJ8A 2UY1A 3Q47B 3VTYA 2R3AA 1B89A 2KATA 3WXXA 5KJKA 4ABNA 2P58C 5AYFA 3E4BA 4O6FA 1MT6A 4YNDA 3TG4A 2PL2A 2W5ZA 4F3VA 5EX0A 5CCMA 2R5SA 1YA0A 4GYOA 5FT9A 4U0SA 4A1SA 3M55A 2VQ2A 5D0OD 2XGMA 2L6JA 5C1DA 5FZRA 1ELRA 4J7FA 2XEVA 3ZGQA 2JLBA 2XGOA 3QKYA 4GPKA 2LSVA 2YQ8A 4GZ5A 2IGQA 4GA0A 4I9CA 4NJ5A 4GYWA 1XNFA 3CK8A 5F6LA 3F9WA 5TH7A 2IFUA 3CKCA 2XCCA 3RAYA 3RO3A 3AS4A 3Q49B 2BQZA 4YPEA 5CHEE 4LDGA 2HYZA 3MV3B 3KS2A 1HZ4A 4I2WA 1OUVA 4BTAA 5G04J 3HYMB 3K5KA 5LCWC 5LSXA 4XIFA 5EG2A 3S7JA 2VSNA 3RU0A 4YNMA 3UQ3A 5BNWA 1NA3A 3QWWA 3GZ2A 5FZQA 5TEGA 3TG5A 3OXGA 4UQZA 4HOUA 4N2QA 5FZSA 2VGYA 3CV0A 3ZHEA 3S8PA 2KC7A 4HOSA 2PQRA 3MV2B 5JJ6A 3DALA 3OXLA 5JIYA 4U04A 3ESKA 1PC2A 3M59A 4H7YA 3OPEA 5AYWD 3MO0A 4I51A 1W3BA 3FP3A 4O30A 2I6HA 2BUGA 4YPUA 4U0ZA 3UPVA 2PQNA 3LPZA 4G24A 5LSZA 5ARFA 4GCNA 3BEEA 4J8OA 4G23A 4J8DA 3FWVA 3F9YA 4AY5A 3Q4AB 4GA2A 3S7DA 3ASHA 4RG6A 3FFLA 2WQHA 3RO2A 4CGVA 3U4TA 5TTFA 1WM5A 3ULQA 2FF4A 1QQEA 4HOQA 5KJMA 4MI0A 3DB5A 3ASDA 5F6KC 5F59A 1MUFA 3S7BA 3BO5A 3CVQA 4JA9A 2GW1A 3KAEA 3TGOA 2DBAA 5BT1A 4H7XA 5FJYA 2XPIA 4KXKB 1WAO1 3CEQA 3RKVA 4J7IA 3AS8A 3O48A 3CBMA 4BWRA 1MVHA 1P5QA 5T0MA 1KLXA 3QDNA 5D0QD 3CKBA 5EX3A 3Q5MA 4GA1A 3QWPA 3SF4A 3CBPA 2J9QA 2HR2A 5M72A 3IEGA 3KMAA 3LCAA 1NZNA 1HH8A 3M58A 2OOEA 4B94A 3CVLA 3U3WA 1HXIA 5BW8C 5KJNA 3VTXA 4AU7A 2FEZA 4G25A 5A6CA 3LKUA 5JJ0A 4YVQC 4AIFA 4G2VA 2E2EA 2ONDA 4RG9A 4MI5A 3ASFA 4WNFA 3KD7A 1IYGA 1O9SA 4Y6WA 3RJWA 5G05J 4H12A 4XI9A 4CGWA 1KT0A 4UQYA 2YHCA 3M53A 3OOIA 3HNAA 4KBQA 3RJVA 2XGSA 4GYYA 3LY8A 3PDNA 4J0UA 3EDTB 4BT9A 2FI7A 3SZ7A 2F69A 4JDSA 3ZPJA 4UI9C 2WPVA 5DBKA 2NC9A 3KMJA 4JLGA 3CVNA 4UI9J 4YNPA 4HORA 1N3JA 5LCWJ 3MO2A 5F5EA 4UQXA 2VSYA 2HO1A 4GZ3A 3Q15A 3K9IA 5JINA 2PZIA 5HQ8A 4CDRA 3URZA 2AVPA 4NRHB 1A17A 3OS5A 4WNGA 4JHRA 4YPAA 4I17A 3NF1A 3RQ4A 1FCHA 4NQ0A 5A7DB 4Z4PA 4E47A 1E96B 1ZBPA 4N5CA 4N2SA 4HOTA 4J8FA 3GYZA 4N3AA 3VV0A 4NVQA 3LY9A 5EKQD 3CVPA 3F9XA 3RIBA 4J83A 3OXFA 4U0UA 4APOA 2RFIA 1Y8MA 2KCLA 4QEPA 4Y6CA 3GW4A 4QEOA 1QZ2A 4N3CA 4J8EA 1ZKKA 5DIZA 2JV0A 3SW9A 3VUZA 1ELWA 4I1AA 4N39A 2C2LA 3MA5A 4C1QA 3M54A 2Y4UA 3N71A 3PE4A 4GZ6A 3F9ZA 4AM9A 3MKRA 5HI7A 4IJDA 2MHKA 4JA7A 5G05C 3UUXA 2LSUA 3ASGA 2UWJG 4BT8A
chains in the Genus database with same CATH superfamily
1N4SA 3D9KA 3T5VA 4IN3B 4WUYA 4WNDA 1N9AA 3ZXPA 3T9KA 1H19A 1KZPA 3SFXA 4XI0A 2ETAA 3LY7A 5FTPA 3DSUA 4HFGA 1TN6A 3RRNB 2VYIA 4DX2A 4FMUA 3ZUVB 1TJCA 2IU1A 2P9LG 4U07A 5EIBE 3ML8A 4U8YD 3QOUA 3TXMA 3CVUA 3O4ZA 2IO2C 2P9SG 4FJYA 3DPDA 3BUAA 3TWRA 1JCRA 4G1TA 5CPRB 4UWGA 2F8XK 5AQBA 2QC9A 4PS3A 3MO5A 1H6PA 3NZUA 3CBOA 3NB2A 2WMOA 5T5GA 4U63A 5G04C 2QPWA 3PE3A 4GTMA 4PS8A 2WXFA 3FPDA 4DX7D 2Y4TA 2ZISA 3FDHA 4DRXE 5LFAA 4IJ8A 4CRWA 2UY1A 3Q47B 3VTYA 4U8HA 1JPLA 3KEZA 1OCRE 4U95D 1HX8A 3FTUA 3TWXA 1MT6A 3LVRE 3DSXA 3PS6A 1DCEA 5EX0A 3UT7A 3M55A 4JPSA 5CMWA 1K1AA 2IONA 2XGMA 3DXMG 3UX4A 3TWVA 2DYRE 1IXVA 1HE8A 2JABA 4GPKA 3DBSA 4GZ5A 3PH0C 5ENTD 2IGQA 1LD7A 3UXGA 2VSOE 2NXPA 1DNPA 4NJ5A 1XNFA 2AXZA 3CK8A 3EJNA 3CKCA 3RO3A 5B3SE 3MV3B 3UKUG 4NIKA 4PS7A 4URKA 3DEPA 4I2WA 1MX6A 3MCXA 1NL4A 3Q78A 2X6KA 2IO3C 4BX8A 1OT8A 2VSNA 3UQ3A 2PNNA 3D9OA 4DUIA 4HI8A 4XX5A 2J4BA 4EBAA 3OXGA 2XPZA 1KZOA 4GTRA 1BLXB 2PQRA 4D10C 3TL5A 5LP0A 3DALA 4PUCA 4CT0A 3FHEA 4U04A 5EIDA 3ESKA 3BG1B 4HLEA 4A3TA 4BESA 4ZFHA 3C3QA 3PNLB 5FIOA 2BKGA 3FUJA 2BUGA 4LNGA 3LPZA 4GTSA 3DSSA 4RVBA 1NP7A 4J8OA 2VTBA 2R02A 2GROB 4J8DA 4AY5A 5KBAA 3CHRA 4G8KA 2WXKA 2V4HC 4O1PA 3ASHA 2KM4A 1JCSA 4B0ZA 3SNXA 2FO1E 4CGVA 1EDUA 3E34A 1QQEA 2P9PG 2OEVA 4MI0A 5F59A 3ASDA 3APFA 4HBDA 3EUVA 3FU0A 1H6KA 4J7WA 5AQ7A 3RSEG 4OAVB 1FT2A 5AN8A 5CEDB 3APCA 3R9MA 3SFYA 5FJYA 2XPIA 3VLDA 2J49A 2L0TB 3HHMA 4LSZE 2VGEA 4DPRA 4FLBA 4BWRA 4I6EA 2DWZA 2V4LA 5T0MA 1KLXA 1OWLA 5EX3A 4GA1A 1MZCA 3T8MA 3QWPA 4U7EB 2WXJA 3LCAA 3EHQA 4XZ4A 1HH8A 1HU3A 3HXCA 4RQIA 2R59A 3CVLA 1DC2A 3DPYA 3UM3A 4AU7A 4ANXA 5A6CA 2YNQA 4L1BA 4AIFA 2ONDA 5CECB 3J5PA 3S2AA 3KD7A 1IYGA 3D9NA 1O9SA 5G05J 2H6IA 5J08A 2X38A 3PVLA 2HM8A 1HG5A 1IKND 5EDSA 1PAQA 2I1JA 4KBQA 3PDNA 4J0UA 2GRLA 3L9TA 3QK0A 4JHJA 2JEKA 3Q7FA 3SZ7A 4JDSA 3ZPJA 1O1SA 3D9PA 2WPVA 4L2LA 3MX3A 5ENNA 1TNZA 3FUFA 3UINC 1HS6A 4I1MA 4APFA 4UQXA 1PY1A 2XEHA 1O5MA 5JINA 3E33A 3ZYKA 4MKTA 2AVPA 4NRHB 3OS5A 2OEWA 3RQ4A 4HRNA 4GTOA 4N2SA 4HOTA 4J8FA 3CHQA 4J8YA 4TUMA 3VV0A 4NVQA 3ZKJA 2LUHA 1MHQA 3ENEA 4B93B 2KCLA 4CEMA 2B0OE 5CRUA 3EIQC 4GMLA 2R17C 2IEJA 2J09A 1E7VA 4J8EA 4HI9A 3SW9A 1ELWA 3JXJA 4NACA 2DZNA 3PE4A 3V30A 3B7SA 2LSUA 3FEXA 4BT8A 2GGFA 2V5FA 5T0KA 4JB8P 3MEKA 2WM9A 4DK5A 2ETBA 2VGXA 3LYAA 3QJZA 1UJJA 2LAIA 4LEUA 3R9AB 4BUPA 4HNAD 2XCBA 3CK9A 4QQIA 5JJTA 4DX1A 4GZCA 3C5RA 3TAXA 3B7RL 3NQPA 2FBNA 4KYOB 4I2ZA 2QFCA 3EP0A 2DZOA 4BTBA 1ELKA 1PEGA 3ZFWA 3UM1A 5KJLA 3AG3E 2IF4A 5ARGA 4ILHB 1U3DA 4WNEA 1KPSB 5CEAA 4YVOA 2RG8A 3Q73A 4G26A 3M57A 1FPPA 4EQFA 4JHKA 2VGXB 2XRZA 3FUMA 3OTNA 1BU9A 5ENRD 1IHGA 4RZ0A 4LRZA 4FJZA 3AS5A 4GAAA 2WXQA 4K5CA 3L22A 3TXNA 5EYLA 4M7CA 4U96D 1L5JA 1UOHA 4XEIG 5LOZA 3ZYQA 1MJ0A 2KZTB 4JEUA 3ZYMA 2P58C 5AYFA 3E4BA 1Q2ZA 4YNDA 5FQ4A 4F3VA 1YA0A 2V5QC 4GYOA 3UKRG 4ATZD 5BXUA 3SO8A 4A1SA 3FTXA 2AJAA 3UMVA 4LUNU 2VQ2A 5IY5E 3I4GA 1OCCE 5AQAA 4KVMA 2QYUA 1Z3YA 3QKYA 4HVBA 3BQOA 3U64A 2CHXA 2LXMA 4GYWA 5F6LA 3FUEA 2IFUA 5FQ7A 2GRRB 4Q94A 1OXJA 3AS4A 2BQZA 5CHEE 2P9NG 2J07A 3DSWA 3KS2A 5J90A 4TXQA 5G04J 1H6OA 4OVUA 3HYMB 3V2OA 3ULEG 3LJNA 3CGHA 4JW1A 2X6FA 1DVPA 3MKQA 1IHBA 3FTWA 3PZ3A 3ULYA 3PZ4A 2ZU6B 3JCKC 5BNWA 3QWWA 4LNUD 2L0IA 4UQZA 4E6HA 4KZCA 5FQ8A 4ILIA 2BEDA 2R03A 3I4RB 2KC7A 3EIJA 3S8PA 4ILGA 3MV2B 1MX2A 2AWIA 2IQCA 2WXGA 1U3CA 5JIYA 2XEEA 1PC2A 1TN8A 3C3RA 3OPEA 1FVHA 3D9MA 3MO0A 5JHBA 5CRVA 4P29A 2Y0BG 3JUEA 2V0PA 2QYJA 3CQCB 4LERA 5LSZA 3QAQA 4L23A 3L08A 5ARFA 2I9CA 3FH7A 4FHKA 3HXFA 3T5XA 3P2BA 4G23A 1N52A 4K03A 4WWPA 3CQGB 2WQHA 4ANWA 1YMPA 2PM6A 3U4TA 4EZKA 1WM5A 2FF4A 2CHZA 3ABME 4HOQA 4UWHA 2BF0X 5F6KC 3DB5A 3W9GA 2F0YA 1BI7B 5G2NA 4JA9A 3TGOA 1LD8A 5HRYA 3WG7E 3UIPC 2X3MA 3AS8A 3O48A 1MVHA 3D3MA 3LJ3A 4TV3A 3Q5MA 3SF4A 1E8YA 2HR2A 3TWWA 2EINE 5M72A 3IEGA 3L54A 3CHOA 4NURA 3DRAA 3QARA 3L6AA 3FTSA 5BW8C 1UJKA 1JCQA 2FEZA 3LKUA 4ACLA 4MI5A 4AVXA 4WNFA 1H0AA 4IRUA 2XQ0A 4Y6WA 3RJWA 3CVXA 3MYVA 1KT0A 4CGWA 3I5PA 3M53A 1TNYA 2J8SD 3HNAA 3W9FA 3LVQE 3APDA 2ZXWE 3E32A 3CVYA 2PM7A 4R7LA 1QNFA 2F69A 2WXOA 5E76A 4UI9C 2XZDG 3NZSA 3KMJA 3CVNA 3EHNA 3FUIA 4YNPA 3EU9A 3C3OA 3B7BA 5LCWJ 3ABLE 4A55A 3RRMB 4OYSA 2KBXA 5F5EA 2IOLA 2VSYA 4GZ3A 3Q15A 4MRUA 2VTBB 4JHRA 4HLLA 4I17A 3D9JA 3FH5A 3EU5A 3NF1A 5AIJA 4Z4PA 4NQ0A 3V2XA 2LO6A 2X6JA 3UIOC 2YINA 3NOGD 4ANUA 5JHAA 2QZAA 3CVPA 1TNOA 3RIBA 3PNTB 4J83A 3GZSA 4QEPA 3NOCD 1QZ2A 2XHEA 4N3CA 1EPUA 2J4DA 1LTXA 3VLEA 1EYHA 4I1AA 4L7TA 4JVSA 2C2LA 3E30A 4PH4B 4C48B 4DI3A 4C1QA 3N71A 4GZ6A 3MKRA 3CR3A 5G05C 4L9PA 2WXHA 3UUXA 2UWJG 5A23A 1Z5SC 1EF1C 3UTMA 2Y1LE 4MLPA 5B1AE 3ZHEB 5H7PA 3PZDA 2FO7A 3SWCA 1N0QA 2LXLA 3L16A 3D9LA 4JXTA 4I1OB 4TRQA 3FU6A 1SVXA 4CZ2D 2LNIA 2X6HA 5FQ6A 1NA0A 5EYPF 3IHXA 4C9BB 4UWLA 5CCLA 3UM0A 1TNBA 4GTTA 4QENA 2Q7FA 1ML9A 5BV1A 2UY1B 4E85A 3EHMA 2WXPA 4HS2A 5JJ7A 3M5AA 3IKOB 3TWTA 3FUDA 1KT1A 2KCVA 1NI1A 1OCZE 1MVXA 4AEZC 4A1GA 1N4QA 2EIKE 3TWUA 3BG0B 2H6FA 3GZ1A 5AAOA 2CG3A 3SD5A 1HFAA 1ZU2A 5JHNA 3S7FA 3M56A 3R7RA 1UW4B 3UI2A 3TJPA 5BPPA 2R3AA 1B89A 2KATA 2OVBA 3ZIMA 2A4ZA 3CHMA 1ZB1A 4ABNA 2XENA 2XZTG 3G2VA 1SZAA 1TN7A 5EN5D 1QYMA 4WAFA 1E7UA 3TG4A 2PL2A 3ABKE 1O1RA 2R5SA 3J5QB 1AWCB 4EZJA 2GRPB 3EHRA 1N4RA 1TR4A 4V3IA 2RFAA 2BKKB 2I1KA 2CHWA 2QY7A 2AW6A 5D0OD 2L6JA 2MOWA 4K0RA 5FZRA 1ELRA 2CG2A 4J7FA 4O60A 2JLBA 3AG4E 3SFZA 3PEUB 2YHEA 2YQ8A 2WMNA 3CVVA 4EZLA 2OCCE 1N0RA 2NYJA 2R05A 3F9WA 5TH7A 1JWFA 3RAYA 3CHSA 2Y3AA 4C0MA 4YPEA 3Q49B 3OAWA 2HYZA 4RSYA 3FUNA 3LDZA 4A3VA 5D2MC 3IHYA 1HZ4A 4BTAA 5CERB 2KXPC 5LCWC 4FA6A 3I3NA 4M3OA 5EG2A 3KSQA 1MQSA 5KNHD 1H2UA 1NA3A 3GZ2A 3TG5A 3B7UX 4LG6A 4N2QA 5FZSA 2P9KG 2VGYA 3CV0A 3ZHEA 2WXNA 3OXLA 4OAUC 3FEYA 5AARA 3FH8A 3TWSA 4JZYA 2EIJE 4H7YA 2Y69E 4I51A 3ZRHA 2OV8A 3IXEA 4Z68A 3FP3A 2M63A 4DI4A 2XPYA 2ZGDA 4RLYA 4U0ZA 5BV0A 1RZ4A 3BU8A 4U8VD 5ANRA 3IBEA 3JUIA 1E8WA 3P1UA 1WG0A 4EHMA 4LNBA 4GCNA 1H2VC 1D9SA 2A5UA 3BEEA 3RAUA 2GRQB 3F9YA 1FT1A 3Q4AB 4GA2A 3S7DA 3AG2E 3Q75A 5TTFA 3ZNGA 2E0IA 3G2TA 3L13A 3HDXA 4FC8A 1GW6A 2OVFA 1N95A 4PDXA 1HF8A 1Z6TA 1MUFA 3BO5A 2X6IA 1MYOA 3CVQA 2GW1A 2L6BA 3KAEA 2DBAA 3HXDA 3LS8A 3IV0A 4BFRA 5HKPA 4KXKB 4XKCA 1WAO1 3SHFA 4J7IA 3CBMA 4UWKA 3JQ0A 1FVFA 1INZA 1SW6A 1Z3XA 5D0QD 3CKBA 1YCSB 3CBPA 3DEOA 5BXOA 3ESLA 3CSFA 3ASNE 2WXLA 4BSZB 5AQ9A 3HXEA 4B8CB 4Q96A 4ACKA 2B6CA 3U3WA 4DLQA 1UN8A 3HRAA 4L2YA 3VTXA 5T4YA 4JEHA 3T8KA 1N54A 2XS8A 4HXIA 3CLJA 3AAAC 4G2VA 4BY6A 3DSTA 4TXPA 5AJDA 1D8EA 4KT6B 3B13A 4G8LA 1G3NB 4F1PA 4UQYA 3HVEA 3OOIA 3Q79A 2KZTA 1BI8B 3RJVA 4GYYA 1BD8A 3LY8A 3AG1E 2F37A 1V55E 3SY2A 4BT9A 4DX6D 3VLFA 2P2CP 2LAHA 2NC9A 4J8SA 1S64A 4K5BA 2L9BA 4JD2G 3Q7AA 4YDYA 5AENA 1N3JA 5ENSD 3HXBA 1D8DA 4MBGA 3K9IA 4XE0A 4CDRA 3URZA 2MRIA 3PUKA 1K1BA 4B8AA 1A5EA 4FP7A 3MZLB 4WWOA 1FCHA 4K5AB 5A7DB 4E47A 1E96B 4GU5A 4N5CA 1SA4A 4KVOA 2H6GA 3MJWA 4N3AA 4DLOA 3FUHA 3LY9A 1VDYA 3F9XA 5E75A 3AJIA 2RFIA 5KNGA 2DIWA 3KSLA 3PRZA 2CFUA 4ANVA 1AP7A 4Y6CA 3JXIA 2J08A 2EIME 3FUKA 1TNUA 4BEPA 5DIZA 3D9HA 2WXMA 2JV0A 3AU4A 3DWLG 3UM2A 5JA4D 1QBQA 3SQVA 4A63B 3D9IA 3KEAA 1K8KG 4C0EA 2Y4UA 4AV7A 1DCQA 4DJAA 4HB5A 4AM9A 4IJDA 2MHKA 4YDOA 4JA7A 1OWMA 4MS6A 1OCOE 3ASGA 1W3BA 3ZXSA 1H3IA 2VJ8A 2C0MA 2WQ6A 4XKBA 4GTVA 1XQHA 3SGHA 1X5BA 5ANLA 5KCMA 1SA5A 2C0LA 4HRLA 4TXRA 3KMTA 1IQRA 2IJGX 2O8JA 3MGBA 3CHPA 4I9EA 4GTQA 1N6AA 2KCKA 2F8YA 4GCOA 2G46A 3JYSA 1N11A 1V54E 2RD0A 4HRMB 4UI9K 2W5YA 3HVEB 4F7AA 3F6QA 3B7TA 4N3BA 4AY6A 4LCTA 2DYSE 3ML9A 4JL0A 4W9RA 4FADA 3U66A 3QWVA 1N6CA 2EILE 3ISMC 3SI5A 1S63A 3CK7A 5LX8A 3NBNB 2IY0C 3PZ2A 4I6GA 4ME2A 4B89A 3E37A 4BETA 2ZGGA 2FULA 3PREA 2VSXE 2ETCA 3ZEFA 3ZN3A 4CCAA 4GMRA 1OWOA 3FULA 4UWFA 3FY4A 1K3ZD 3UT8A 3WXXA 5KJKA 1UG3A 4O6FA 3G2WA 2W5ZA 5CCMA 2R2LA 1U2VG 3CIAA 1E90A 5FT9A 5ITZF 2WQ7A 3Q9UC 4U0SA 2HE0A 1MX4A 4AXHA 5C1DA 2WVIA 3LEWA 3V31A 3PZ1A 3HG0D 1OY3D 2GRMA 2XEVA 3ZGQA 2XGOA 3QNKA 2LSVA 4GA0A 4I9CA 1JUQA 2XCCA 1LF8A 3G2UA 3FTYA 4LDGA 1OUVA 1O1TA 4DX5D 3K5KA 3C72A 2WB2A 5LSXA 5HS0A 4XIFA 3UT4A 3S7JA 3L82A 4BX9A 3RU0A 4YNMA 2DVWA 5FZQA 5TEGA 2AXVA 4JC8A 3V79K 2ILRA 4GZDA 4HOUA 5C2YA 2CFZA 4HOSA 5FINA 3AU5A 5JJ6A 1UN9A 1OWPA 2EQXA 3M59A 5AYWD 3PUJA 3NAWA 4F6RD 4GB9A 4FULA 3X2QE 4CDNA 4O30A 2I6HA 4YPUA 1OWNA 3SBSA 3UPVA 2PQNA 4O1OA 3MKQB 4G24A 2RKKA 3C98A 4OVVA 3FWVA 4GMJA 4GPMA 4RG6A 3FFLA 2BTDA 3RO2A 4UUCA 2GRNB 4CT4A 3L17A 2RFMA 3ULQA 4EPZA 3CSTA 3ONKA 4EECA 5AJLA 5CBNA 5KJMA 3QB2A 4QFVA 4FLHA 3S7BA 3TWQA 2WXIA 5BT1A 4H7XA 3U9WA 3CEQA 2DCPA 3RKVA 5T3RA 3Q9NC 3DSVA 5FWQA 4GTPA 1YYHA 1P5QA 3QDNA 4AP2A 2ZIRA 2J9QA 1HO8A 4AJWA 3ZVVA 1NFIE 3G2SA 4YDEA 3KMAA 1NZNA 3ASOE 3M58A 4KZ0A 2V8SE 2OOEA 3RK6A 4KMOA 4B94A 1HXIA 4I43A 4YDWA 5KJNA 2IOSA 4G25A 2I2OA 4BSXA 3JQ1A 5KWDA 5JJ0A 4YVQC 4J6IA 1SZ9A 2E2EA 4RG9A 3SBTB 1E8XA 5CBOA 3ASFA 1SQMA 1JWGA 3ZU7B 4Q69A 4H12A 5BUZA 3ONLA 4XI9A 2YHCA 1TYQG 2P9IG 4IYPA 1XGWA 4IULA 2NSZA 4I6JA 2XGSA 4FHJA 3R7QA 3EDTB 3FU5A 4F1SA 4AOFA 2AXUA 3LXUX 2XS1A 4N5QA 2FI7A 1WDYA 4FU3A 4ATGA 2P9UG 3DXKG 4F53A 5CMYA 4WWNA 5B1BE 4BERA 5DBKA 4JLGA 4UI9J 5D66A 4HORA 3QC1A 2H6HA 3ZW3A 1H2TC 4CDMA 3MO2A 3ZYLA 2HO1A 1TJFA 3IHVA 5JMND 2XRYA 3FU3A 2PZIA 5HQ8A 1N94A 1A17A 4WNGA 4YPAA 5ENQD 2WXRA 3FTZA 5ENPD 1ZBPA 5EILA 3RRUA 1BPOA 4G11A 1S0PA 3GYZA 1IQUA 2A5EA 3HIZA 1X81A 5EKQD 5G55A 1RW2A 4TUUA 3OXFA 4U0UA 4APOA 1S70B 1N4PA 1Y8MA 1WY6A 1Y6IA 4EBAG 3B95A 3GW4A 4QEOA 1ZKKA 1E8ZA 4CYMD 3VUZA 4HQDA 3PEVB 4N39A 3FTVA 3MA5A 3M54A 3F9ZA 5HI7A 2MYOA 5ENOD 3CVWA 5T8IA 1HG2A 1TEZA 4X8QA 4ZHBA
chains in the Genus database with same CATH topology
3ZXSA 5A23A 2GGFA 2V5FA 1EF1C 3D9KA 1H3IA 2VJ8A 4MLPA 5T0KA 3MEKA 4IN3B 4WUYA 3T5VA 4WNDA 3ZHEB 2WM9A 1H19A 2C0MA 4XI0A 4DK5A 2VGXA 2WQ6A 3PZDA 4XKBA 3LYAA 3QJZA 1UJJA 2LAIA 3LY7A 4LEUA 5FTPA 3R9AB 4BUPA 2FO7A 3SWCA 1XQHA 3SGHA 1X5BA 5ANLA 4HFGA 5KCMA 3RRNB 2VYIA 2C0LA 4FMUA 2XCBA 3CK9A 5JJTA 3L16A 1TJCA 1IQRA 2IJGX 2IU1A 3D9LA 4JXTA 3MGBA 2O8JA 3CHPA 4I9EA 4U07A 1N6AA 4I1OB 2KCKA 3ML8A 4GZCA 4TRQA 4GCOA 2G46A 3FU6A 3JYSA 2RD0A 3TAXA 3QOUA 3TXMA 3B7RL 2LNIA 2X6HA 3NQPA 4UI9K 3CVUA 2FBNA 3HVEB 2W5YA 5FQ6A 4KYOB 4F7AA 1NA0A 3IHXA 3O4ZA 4I2ZA 2QFCA 3B7TA 4C9BB 4UWLA 5CCLA 4N3BA 3EP0A 4BTBA 1ELKA 1PEGA 4AY6A 4LCTA 3ZFWA 5KJLA 4QENA 2IF4A 2Q7FA 1ML9A 5ARGA 2UY1B 4E85A 3EHMA 5BV1A 2WXPA 3ML9A 4FJYA 4ILHB 3DPDA 4HS2A 5JJ7A 3M5AA 1U3DA 3IKOB 3FUDA 4G1TA 5CPRB 4UWGA 4JL0A 1KT1A 4PS3A 4WNEA 4W9RA 3MO5A 4FADA 2KCVA 4YVOA 3QWVA 3U66A 1MVXA 2RG8A 4G26A 1N6CA 3NZUA 4AEZC 3CBOA 3M57A 3SI5A 3CK7A 4EQFA 4JHKA 5LX8A 2VGXB 2XRZA 4A1GA 3FUMA 3OTNA 4I6GA 4ME2A 4B89A 2WMOA 5T5GA 4U63A 1IHGA 3BG0B 4RZ0A 3GZ1A 5G04C 4LRZA 2QPWA 3PE3A 2FULA 3PREA 2CG3A 2VSXE 4PS8A 3ZEFA 2WXFA 3SD5A 3ZN3A 3FPDA 4FJZA 3AS5A 1HFAA 4CCAA 1ZU2A 2Y4TA 5JHNA 4GAAA 3S7FA 2WXQA 3FDHA 3L22A 3M56A 1OWOA 3TXNA 3R7RA 3FULA 4UWFA 5LFAA 3FY4A 4IJ8A 1UW4B 3TJPA 4CRWA 5BPPA 2UY1A 3Q47B 3VTYA 1L5JA 2R3AA 4U8HA 5LOZA 1B89A 1JPLA 3ZYQA 2KATA 3KEZA 3UT8A 2OVBA 3WXXA 5KJKA 3ZIMA 2KZTB 2A4ZA 4JEUA 3ZYMA 3CHMA 3G2VA 1HX8A 4ABNA 3FTUA 1SZAA 1UG3A 2P58C 5AYFA 3E4BA 4O6FA 4WAFA 3LVRE 1MT6A 1E7UA 3G2WA 3PS6A 4YNDA 3TG4A 5FQ4A 2PL2A 2W5ZA 4F3VA 5EX0A 5CCMA 2R5SA 1YA0A 4GYOA 4EZJA 3UT7A 3CIAA 1E90A 5FT9A 2WQ7A 4U0SA 4A1SA 4V3IA 3M55A 2I1KA 2CHWA 4JPSA 2QY7A 3FTXA 5CMWA 3UMVA 2AW6A 4LUNU 2VQ2A 4AXHA 2IONA 5D0OD 2XGMA 3I4GA 2L6JA 2MOWA 5C1DA 2WVIA 3LEWA 4K0RA 5FZRA 1ELRA 4KVMA 3UX4A 2CG2A 4J7FA 2GRMA 2XEVA 3ZGQA 2JLBA 2XGOA 3SFZA 1Z3YA 1HE8A 3QKYA 3PEUB 4HVBA 2YHEA 4GPKA 3DBSA 3QNKA 3DALA 2LSVA 2CHXA 2WMNA 2YQ8A 3PH0C 4GZ5A 3U64A 3CVVA 2IGQA 2VSOE 4EZLA 4GA0A 2NXPA 1DNPA 4I9CA 4GYWA 4NJ5A 1XNFA 2AXZA 3CK8A 5F6LA 1JUQA 3F9WA 5TH7A 3EJNA 3FUEA 1JWFA 2IFUA 2XCCA 3CKCA 1LF8A 5FQ7A 3RAYA 3CHSA 2Y3AA 4C0MA 4Q94A 3RO3A 3AS4A 3G2UA 3Q49B 2BQZA 4YPEA 3OAWA 3FTYA 5CHEE 4LDGA 2HYZA 4RSYA 3FUNA 3LDZA 2J07A 3MV3B 4PS7A 4A3VA 4URKA 3IHYA 3KS2A 5J90A 1HZ4A 4I2WA 1OUVA 4BTAA 5G04J 4OVUA 3HYMB 3K5KA 5LCWC 4FA6A 2WB2A 3MCXA 5LSXA 3I3NA 4M3OA 3CGHA 4JW1A 2X6FA 4XIFA 2X6KA 5EG2A 3UT4A 1DVPA 1MQSA 3MKQA 3S7JA 4BX8A 2VSNA 3FTWA 3RU0A 4BX9A 4YNMA 3UQ3A 2ZU6B 3JCKC 3FEXA 3D9OA 1H2UA 5BNWA 1NA3A 3QWWA 3GZ2A 5FZQA 4XX5A 2J4BA 5TEGA 3TG5A 2L0IA 3OXGA 2XPZA 2AXVA 4JC8A 4EBAA 4UQZA 3B7UX 2ILRA 4E6HA 4GZDA 4HOUA 5C2YA 4KZCA 4ILIA 2CFZA 2VGYA 5FQ8A 5FZSA 3CV0A 3ZHEA 4N2QA 3I4RB 2KC7A 3EIJA 3S8PA 4HOSA 4ILGA 2PQRA 3MV2B 3AU5A 5JJ6A 2AWIA 2IQCA 1UN9A 1OWPA 2WXNA 1U3CA 2WXGA 3TL5A 3OXLA 4D10C 3FEYA 4PUCA 4CT0A 5LP0A 2EQXA 3FHEA 4U04A 5JIYA 3ESKA 3FH8A 1PC2A 3M59A 3BG1B 4JZYA 4H7YA 4HLEA 4A3TA 3OPEA 1FVHA 5AYWD 3D9MA 3MO0A 5JHBA 4I51A 3PUJA 3ZRHA 2OV8A 4GB9A 4P29A 4FULA 3PNLB 3FP3A 2M63A 2V0PA 4CDNA 2XPYA 4DI4A 4O30A 2I6HA 3FUJA 2BUGA 4YPUA 1OWNA 4U0ZA 3SBSA 2PQNA 5BV0A 3UPVA 3CQCB 5ANRA 3IBEA 3JUIA 3LPZA 1E8WA 3MKQB 3P1UA 4G24A 4LERA 5LSZA 3QAQA 4L23A 3L08A 4GCNA 5ARFA 2I9CA 3FH7A 4RVBA 1H2VC 2A5UA 1NP7A 3BEEA 4J8OA 4FHKA 2VTBA 3T5XA 3C98A 3P2BA 4G23A 4J8DA 1N52A 3FWVA 4OVVA 4AY5A 3F9YA 3CHRA 3Q4AB 4K03A 4GA2A 2WXKA 4WWPA 4GMJA 3S7DA 3CQGB 3ASHA 4BT8A 4RG6A 3FFLA 2BTDA 2KM4A 2WQHA 3RO2A 4ANWA 4B0ZA 3SNXA 4CT4A 3L17A 4CGVA 2PM6A 3U4TA 5TTFA 1EDUA 4EZKA 2E0IA 1WM5A 3ULQA 3G2TA 2FF4A 1QQEA 3L13A 3CSTA 3ONKA 4EECA 4EPZA 5AJLA 2CHZA 3HDXA 4HOQA 4FC8A 5KJMA 4UWHA 1GW6A 2BF0X 2OVFA 4MI0A 4PDXA 3ASDA 3DB5A 5F6KC 3APFA 5F59A 1HF8A 3QB2A 4QFVA 1Z6TA 1MUFA 4FLHA 3S7BA 3BO5A 3FU0A 1H6KA 5G2NA 2X6IA 3CVQA 4JA9A 2GW1A 3APCA 3KAEA 3TGOA 2WXIA 2DBAA 5BT1A 4H7XA 3LS8A 5FJYA 3IV0A 2XPIA 4BFRA 4KXKB 3VLDA 4XKCA 1WAO1 3U9WA 2J49A 3CEQA 2DCPA 3RKVA 3SHFA 2L0TB 2X3MA 5T3RA 4J7IA 3HHMA 3AS8A 3O48A 5FWQA 3CBMA 4UWKA 4DPRA 4FLBA 4BWRA 3JQ0A 1MVHA 1P5QA 4I6EA 3KMTA 2V4LA 5T0MA 1FVFA 1KLXA 1INZA 1OWLA 1Z3XA 3D3MA 3LJ3A 3CKBA 3QDNA 4TV3A 5D0QD 3Q5MA 4GA1A 5EX3A 4AP2A 3T8MA 3QWPA 3SF4A 3CBPA 2J9QA 1E8YA 2HR2A 1HO8A 3ESLA 3CSFA 4AJWA 3ZVVA 5M72A 2WXLA 3IEGA 3G2SA 2WXJA 3KMAA 3LCAA 3L54A 4XZ4A 3CHOA 1NZNA 1HH8A 4NURA 3M58A 4KZ0A 2V8SE 4B8CB 1HU3A 2OOEA 4Q96A 3RK6A 4KMOA 2R59A 3CVLA 4ACKA 4B94A 3QARA 3U3WA 3L6AA 1HXIA 1UN8A 3FTSA 4I43A 4DLQA 5BW8C 1UJKA 5KJNA 4L2YA 3VTXA 5T4YA 2IOSA 4JEHA 4AU7A 2FEZA 4G25A 2I2OA 4ANXA 5A6CA 3LKUA 2YNQA 1N54A 4L1BA 4BSXA 3JQ1A 5JJ0A 4HXIA 3CLJA 4J6IA 4YVQC 4G2VA 1SZ9A 4AIFA 4BY6A 2E2EA 2ONDA 4RG9A 3SBTB 1E8XA 5AJDA 4ACLA 4MI5A 3S2AA 3ASFA 1H0AA 4WNFA 1SQMA 4KT6B 3B13A 3KD7A 4IRUA 4AVXA 2XQ0A 1IYGA 3D9NA 1O9SA 1JWGA 4Y6WA 5G05J 4Q69A 3CVXA 4H12A 3RJWA 5J08A 2X38A 5BUZA 3ONLA 3PVLA 3MYVA 1KT0A 4XI9A 4CGWA 4UQYA 3I5PA 2YHCA 2HM8A 1HG5A 3HVEA 3M53A 3OOIA 5EDSA 4IYPA 1PAQA 2KZTA 1XGWA 4IULA 3HNAA 2NSZA 2I1JA 4KBQA 3RJVA 4I6JA 3LVQE 2XGSA 4GYYA 3APDA 3LY8A 4FHJA 3R7QA 3PDNA 4J0UA 3EDTB 3FU5A 4F1SA 4AOFA 4BT9A 2GRLA 3CVYA 2PM7A 2AXUA 3QK0A 3VLFA 4JHJA 3LXUX 2JEKA 4R7LA 2LAHA 2FI7A 1QNFA 3SZ7A 2F69A 4FU3A 4ATGA 2WXOA 4JDSA 3ZPJA 5E76A 4F53A 3D9PA 5CMYA 4UI9C 2WPVA 4WWNA 5DBKA 2NC9A 4J8SA 3NZSA 4L2LA 3KMJA 3CVNA 3EHNA 3FUIA 4JLGA 3MX3A 4UI9J 5ENNA 2L9BA 4YNPA 4HORA 3FUFA 3QC1A 5AENA 5LCWJ 1N3JA 3ZW3A 4A55A 1H2TC 1HS6A 4I1MA 3RRMB 4CDMA 4OYSA 4APFA 3MO2A 5F5EA 3ZYLA 2IOLA 4UQXA 2VSYA 2HO1A 4GZ3A 1TJFA 1PY1A 3IHVA 3Q15A 3K9IA 2XRYA 4MRUA 5JINA 3FU3A 4XE0A 3ZYKA 2PZIA 4MKTA 5HQ8A 4CDRA 3URZA 2MRIA 3PUKA 2AVPA 4NRHB 1A17A 3OS5A 2VTBB 4B8AA 4WNGA 4JHRA 4YPAA 4I17A 3D9JA 3FH5A 2WXRA 4FP7A 3MZLB 3NF1A 3RQ4A 5AIJA 3FTZA 4WWOA 1FCHA 4NQ0A 5A7DB 4Z4PA 4E47A 1E96B 1ZBPA 4GU5A 4N5CA 4N2SA 4HOTA 4J8FA 3RRUA 3CHQA 1BPOA 2LO6A 4G11A 2X6JA 4KVOA 1S0PA 2YINA 3GYZA 3MJWA 4N3AA 4DLOA 3VV0A 4NVQA 1IQUA 3FUHA 3HIZA 3LY9A 1VDYA 4ANUA 5EKQD 5JHAA 3CVPA 5G55A 1MHQA 3F9XA 3RIBA 5E75A 3PNTB 4TUUA 4J83A 3ENEA 3OXFA 4U0UA 4APOA 2RFIA 2DIWA 3GZSA 1Y8MA 1WY6A 3PRZA 2CFUA 2KCLA 1Y6IA 4QEPA 4ANVA 4CEMA 4EBAG 4Y6CA 2J08A 3FUKA 3GW4A 4QEOA 1QZ2A 2XHEA 4N3CA 3EIQC 4GMLA 1EPUA 2J4DA 2J09A 2R17C 1E7VA 4J8EA 5DIZA 1E8ZA 1ZKKA 2WXMA 2JV0A 3SW9A 3AU4A 3VLEA 3VUZA 1ELWA 1EYHA 3PEVB 4I1AA 4NACA 4N39A 4L7TA 3FTVA 4JVSA 2C2LA 3D9IA 3MA5A 4PH4B 4DI3A 4C0EA 4C1QA 3M54A 2Y4UA 3N71A 4AV7A 4DJAA 3PE4A 4GZ6A 3F9ZA 4AM9A 3MKRA 5HI7A 4IJDA 3B7SA 2MHKA 3CVWA 4JA7A 1OWMA 3CR3A 5G05C 5T8IA 4MS6A 1HG2A 2WXHA 3UUXA 2LSUA 1TEZA 3ASGA 2UWJG 1W3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V5F A;  5T0K A;  1H3I A;  3MEK A;  4IN3 B;  4WUY A;  4WND A;  3ZHE B;  2C0M A;  4XI0 A;  2VGX A;  3LYA A;  3LY7 A;  4LEU A;  5FTP A;  3R9A B;  4BUP A;  2FO7 A;  3SWC A;  1XQH A;  2VYI A;  2C0L A;  4FMU A;  2XCB A;  3CK9 A;  5JJT A;  3KMT A;  1TJC A;  2O8J A;  4I9E A;  4U07 A;  1N6A A;  2KCK A;  4GCO A;  2G46 A;  3JYS A;  3TAX A;  3QOU A;  2LNI A;  4UI9 K;  2W5Y A;  2FBN A;  4KYO B;  1NA0 A;  3IHX A;  4I2Z A;  2QFC A;  5CCL A;  4N3B A;  3EP0 A;  4BTB A;  1PEG A;  4AY6 A;  3ZFW A;  5KJL A;  4QEN A;  2IF4 A;  2Q7F A;  1ML9 A;  5ARG A;  2UY1 B;  5JJ7 A;  3M5A A;  4G1T A;  5CPR B;  4JL0 A;  1KT1 A;  4WNE A;  3MO5 A;  4W9R A;  2KCV A;  4YVO A;  3QWV A;  1MVX A;  1N6C A;  4G26 A;  3M57 A;  3CBO A;  3CK7 A;  4EQF A;  2VGX B;  4ME2 A;  5T5G A;  1IHG A;  4RZ0 A;  3GZ1 A;  5G04 C;  2QPW A;  3PE3 A;  3ZN3 A;  3FPD A;  3AS5 A;  1ZU2 A;  2Y4T A;  5JHN A;  3S7F A;  3M56 A;  4IJ8 A;  2UY1 A;  3Q47 B;  3VTY A;  2R3A A;  1B89 A;  2KAT A;  3WXX A;  5KJK A;  4ABN A;  2P58 C;  5AYF A;  3E4B A;  4O6F A;  1MT6 A;  4YND A;  3TG4 A;  2PL2 A;  2W5Z A;  4F3V A;  5EX0 A;  5CCM A;  2R5S A;  1YA0 A;  4GYO A;  5FT9 A;  4U0S A;  4A1S A;  3M55 A;  2VQ2 A;  5D0O D;  2XGM A;  2L6J A;  5C1D A;  5FZR A;  1ELR A;  4J7F A;  2XEV A;  3ZGQ A;  2JLB A;  2XGO A;  3QKY A;  4GPK A;  2LSV A;  2YQ8 A;  4GZ5 A;  2IGQ A;  4GA0 A;  4I9C A;  4NJ5 A;  4GYW A;  1XNF A;  3CK8 A;  5F6L A;  3F9W A;  5TH7 A;  2IFU A;  3CKC A;  2XCC A;  3RAY A;  3RO3 A;  3AS4 A;  3Q49 B;  2BQZ A;  4YPE A;  5CHE E;  4LDG A;  2HYZ A;  3MV3 B;  3KS2 A;  1HZ4 A;  4I2W A;  1OUV A;  4BTA A;  5G04 J;  3HYM B;  3K5K A;  5LCW C;  5LSX A;  4XIF A;  5EG2 A;  3S7J A;  2VSN A;  3RU0 A;  4YNM A;  3UQ3 A;  5BNW A;  1NA3 A;  3QWW A;  3GZ2 A;  5FZQ A;  5TEG A;  3TG5 A;  3OXG A;  4UQZ A;  4HOU A;  4N2Q A;  5FZS A;  2VGY A;  3CV0 A;  3ZHE A;  3S8P A;  2KC7 A;  4HOS A;  2PQR A;  3MV2 B;  5JJ6 A;  3DAL A;  3OXL A;  5JIY A;  4U04 A;  3ESK A;  1PC2 A;  3M59 A;  4H7Y A;  3OPE A;  5AYW D;  3MO0 A;  4I51 A;  1W3B A;  3FP3 A;  4O30 A;  2I6H A;  2BUG A;  4YPU A;  4U0Z A;  3UPV A;  2PQN A;  3LPZ A;  4G24 A;  5LSZ A;  5ARF A;  4GCN A;  3BEE A;  4J8O A;  4G23 A;  4J8D A;  3FWV A;  3F9Y A;  4AY5 A;  3Q4A B;  4GA2 A;  3S7D A;  3ASH A;  4RG6 A;  3FFL A;  2WQH A;  3RO2 A;  4CGV A;  3U4T A;  5TTF A;  1WM5 A;  3ULQ A;  2FF4 A;  1QQE A;  4HOQ A;  5KJM A;  4MI0 A;  3DB5 A;  3ASD A;  5F6K C;  5F59 A;  1MUF A;  3S7B A;  3BO5 A;  3CVQ A;  4JA9 A;  2GW1 A;  3KAE A;  3TGO A;  2DBA A;  5BT1 A;  4H7X A;  5FJY A;  2XPI A;  4KXK B;  1WAO 1;  3CEQ A;  3RKV A;  4J7I A;  3AS8 A;  3O48 A;  3CBM A;  4BWR A;  1MVH A;  1P5Q A;  5T0M A;  1KLX A;  3QDN A;  5D0Q D;  3CKB A;  5EX3 A;  3Q5M A;  4GA1 A;  3QWP A;  3SF4 A;  3CBP A;  2J9Q A;  2HR2 A;  5M72 A;  3IEG A;  3KMA A;  3LCA A;  1NZN A;  1HH8 A;  3M58 A;  2OOE A;  4B94 A;  3CVL A;  3U3W A;  1HXI A;  5BW8 C;  5KJN A;  3VTX A;  4AU7 A;  2FEZ A;  4G25 A;  5A6C A;  3LKU A;  5JJ0 A;  4YVQ C;  4AIF A;  4G2V A;  2E2E A;  2OND A;  4RG9 A;  4MI5 A;  3ASF A;  4WNF A;  3KD7 A;  1IYG A;  1O9S A;  4Y6W A;  3RJW A;  5G05 J;  4H12 A;  4XI9 A;  4CGW A;  1KT0 A;  4UQY A;  2YHC A;  3M53 A;  3OOI A;  3HNA A;  4KBQ A;  3RJV A;  2XGS A;  4GYY A;  3LY8 A;  3PDN A;  4J0U A;  3EDT B;  4BT9 A;  2FI7 A;  3SZ7 A;  2F69 A;  4JDS A;  3ZPJ A;  4UI9 C;  2WPV A;  5DBK A;  2NC9 A;  3KMJ A;  4JLG A;  3CVN A;  4UI9 J;  4YNP A;  4HOR A;  1N3J A;  5LCW J;  3MO2 A;  5F5E A;  4UQX A;  2VSY A;  2HO1 A;  4GZ3 A;  3Q15 A;  3K9I A;  5JIN A;  2PZI A;  5HQ8 A;  4CDR A;  3URZ A;  2AVP A;  4NRH B;  1A17 A;  3OS5 A;  4WNG A;  4JHR A;  4YPA A;  4I17 A;  3NF1 A;  3RQ4 A;  1FCH A;  4NQ0 A;  5A7D B;  4Z4P A;  4E47 A;  1E96 B;  1ZBP A;  4N5C A;  4N2S A;  4HOT A;  4J8F A;  3GYZ A;  4N3A A;  3VV0 A;  4NVQ A;  3LY9 A;  5EKQ D;  3CVP A;  3F9X A;  3RIB A;  4J83 A;  3OXF A;  4U0U A;  4APO A;  2RFI A;  1Y8M A;  2KCL A;  4QEP A;  4Y6C A;  3GW4 A;  4QEO A;  1QZ2 A;  4N3C A;  4J8E A;  1ZKK A;  5DIZ A;  2JV0 A;  3SW9 A;  3VUZ A;  1ELW A;  4I1A A;  4N39 A;  2C2L A;  3MA5 A;  4C1Q A;  3M54 A;  2Y4U A;  3N71 A;  3PE4 A;  4GZ6 A;  3F9Z A;  4AM9 A;  3MKR A;  5HI7 A;  4IJD A;  2MHK A;  4JA7 A;  5G05 C;  3UUX A;  2LSU A;  3ASG A;  2UWJ G;  4BT8 A; 
#chains in the Genus database with same CATH topology
 1N4S A;  3D9K A;  3T5V A;  4IN3 B;  4WUY A;  4WND A;  1N9A A;  3ZXP A;  3T9K A;  1H19 A;  1KZP A;  3SFX A;  4XI0 A;  2ETA A;  3LY7 A;  5FTP A;  3DSU A;  4HFG A;  1TN6 A;  3RRN B;  2VYI A;  4DX2 A;  4FMU A;  3ZUV B;  1TJC A;  2IU1 A;  2P9L G;  4U07 A;  5EIB E;  3ML8 A;  4U8Y D;  3QOU A;  3TXM A;  3CVU A;  3O4Z A;  2IO2 C;  2P9S G;  4FJY A;  3DPD A;  3BUA A;  3TWR A;  1JCR A;  4G1T A;  5CPR B;  4UWG A;  2F8X K;  5AQB A;  2QC9 A;  4PS3 A;  3MO5 A;  1H6P A;  3NZU A;  3CBO A;  3NB2 A;  2WMO A;  5T5G A;  4U63 A;  5G04 C;  2QPW A;  3PE3 A;  4GTM A;  4PS8 A;  2WXF A;  3FPD A;  4DX7 D;  2Y4T A;  2ZIS A;  3FDH A;  4DRX E;  5LFA A;  4IJ8 A;  4CRW A;  2UY1 A;  3Q47 B;  3VTY A;  4U8H A;  1JPL A;  3KEZ A;  1OCR E;  4U95 D;  1HX8 A;  3FTU A;  3TWX A;  1MT6 A;  3LVR E;  3DSX A;  3PS6 A;  1DCE A;  5EX0 A;  3UT7 A;  3M55 A;  4JPS A;  5CMW A;  1K1A A;  2ION A;  2XGM A;  3DXM G;  3UX4 A;  3TWV A;  2DYR E;  1IXV A;  1HE8 A;  2JAB A;  4GPK A;  3DBS A;  4GZ5 A;  3PH0 C;  5ENT D;  2IGQ A;  1LD7 A;  3UXG A;  2VSO E;  2NXP A;  1DNP A;  4NJ5 A;  1XNF A;  2AXZ A;  3CK8 A;  3EJN A;  3CKC A;  3RO3 A;  5B3S E;  3MV3 B;  3UKU G;  4NIK A;  4PS7 A;  4URK A;  3DEP A;  4I2W A;  1MX6 A;  3MCX A;  1NL4 A;  3Q78 A;  2X6K A;  2IO3 C;  4BX8 A;  1OT8 A;  2VSN A;  3UQ3 A;  2PNN A;  3D9O A;  4DUI A;  4HI8 A;  4XX5 A;  2J4B A;  4EBA A;  3OXG A;  2XPZ A;  1KZO A;  4GTR A;  1BLX B;  2PQR A;  4D10 C;  3TL5 A;  5LP0 A;  3DAL A;  4PUC A;  4CT0 A;  3FHE A;  4U04 A;  5EID A;  3ESK A;  3BG1 B;  4HLE A;  4A3T A;  4BES A;  4ZFH A;  3C3Q A;  3PNL B;  5FIO A;  2BKG A;  3FUJ A;  2BUG A;  4LNG A;  3LPZ A;  4GTS A;  3DSS A;  4RVB A;  1NP7 A;  4J8O A;  2VTB A;  2R02 A;  2GRO B;  4J8D A;  4AY5 A;  5KBA A;  3CHR A;  4G8K A;  2WXK A;  2V4H C;  4O1P A;  3ASH A;  2KM4 A;  1JCS A;  4B0Z A;  3SNX A;  2FO1 E;  4CGV A;  1EDU A;  3E34 A;  1QQE A;  2P9P G;  2OEV A;  4MI0 A;  5F59 A;  3ASD A;  3APF A;  4HBD A;  3EUV A;  3FU0 A;  1H6K A;  4J7W A;  5AQ7 A;  3RSE G;  4OAV B;  1FT2 A;  5AN8 A;  5CED B;  3APC A;  3R9M A;  3SFY A;  5FJY A;  2XPI A;  3VLD A;  2J49 A;  2L0T B;  3HHM A;  4LSZ E;  2VGE A;  4DPR A;  4FLB A;  4BWR A;  4I6E A;  2DWZ A;  2V4L A;  5T0M A;  1KLX A;  1OWL A;  5EX3 A;  4GA1 A;  1MZC A;  3T8M A;  3QWP A;  4U7E B;  2WXJ A;  3LCA A;  3EHQ A;  4XZ4 A;  1HH8 A;  1HU3 A;  3HXC A;  4RQI A;  2R59 A;  3CVL A;  1DC2 A;  3DPY A;  3UM3 A;  4AU7 A;  4ANX A;  5A6C A;  2YNQ A;  4L1B A;  4AIF A;  2OND A;  5CEC B;  3J5P A;  3S2A A;  3KD7 A;  1IYG A;  3D9N A;  1O9S A;  5G05 J;  2H6I A;  5J08 A;  2X38 A;  3PVL A;  2HM8 A;  1HG5 A;  1IKN D;  5EDS A;  1PAQ A;  2I1J A;  4KBQ A;  3PDN A;  4J0U A;  2GRL A;  3L9T A;  3QK0 A;  4JHJ A;  2JEK A;  3Q7F A;  3SZ7 A;  4JDS A;  3ZPJ A;  1O1S A;  3D9P A;  2WPV A;  4L2L A;  3MX3 A;  5ENN A;  1TNZ A;  3FUF A;  3UIN C;  1HS6 A;  4I1M A;  4APF A;  4UQX A;  1PY1 A;  2XEH A;  1O5M A;  5JIN A;  3E33 A;  3ZYK A;  4MKT A;  2AVP A;  4NRH B;  3OS5 A;  2OEW A;  3RQ4 A;  4HRN A;  4GTO A;  4N2S A;  4HOT A;  4J8F A;  3CHQ A;  4J8Y A;  4TUM A;  3VV0 A;  4NVQ A;  3ZKJ A;  2LUH A;  1MHQ A;  3ENE A;  4B93 B;  2KCL A;  4CEM A;  2B0O E;  5CRU A;  3EIQ C;  4GML A;  2R17 C;  2IEJ A;  2J09 A;  1E7V A;  4J8E A;  4HI9 A;  3SW9 A;  1ELW A;  3JXJ A;  4NAC A;  2DZN A;  3PE4 A;  3V30 A;  3B7S A;  2LSU A;  3FEX A;  4BT8 A;  2GGF A;  2V5F A;  5T0K A;  4JB8 P;  3MEK A;  2WM9 A;  4DK5 A;  2ETB A;  2VGX A;  3LYA A;  3QJZ A;  1UJJ A;  2LAI A;  4LEU A;  3R9A B;  4BUP A;  4HNA D;  2XCB A;  3CK9 A;  4QQI A;  5JJT A;  4DX1 A;  4GZC A;  3C5R A;  3TAX A;  3B7R L;  3NQP A;  2FBN A;  4KYO B;  4I2Z A;  2QFC A;  3EP0 A;  2DZO A;  4BTB A;  1ELK A;  1PEG A;  3ZFW A;  3UM1 A;  5KJL A;  3AG3 E;  2IF4 A;  5ARG A;  4ILH B;  1U3D A;  4WNE A;  1KPS B;  5CEA A;  4YVO A;  2RG8 A;  3Q73 A;  4G26 A;  3M57 A;  1FPP A;  4EQF A;  4JHK A;  2VGX B;  2XRZ A;  3FUM A;  3OTN A;  1BU9 A;  5ENR D;  1IHG A;  4RZ0 A;  4LRZ A;  4FJZ A;  3AS5 A;  4GAA A;  2WXQ A;  4K5C A;  3L22 A;  3TXN A;  5EYL A;  4M7C A;  4U96 D;  1L5J A;  1UOH A;  4XEI G;  5LOZ A;  3ZYQ A;  1MJ0 A;  2KZT B;  4JEU A;  3ZYM A;  2P58 C;  5AYF A;  3E4B A;  1Q2Z A;  4YND A;  5FQ4 A;  4F3V A;  1YA0 A;  2V5Q C;  4GYO A;  3UKR G;  4ATZ D;  5BXU A;  3SO8 A;  4A1S A;  3FTX A;  2AJA A;  3UMV A;  4LUN U;  2VQ2 A;  5IY5 E;  3I4G A;  1OCC E;  5AQA A;  4KVM A;  2QYU A;  1Z3Y A;  3QKY A;  4HVB A;  3BQO A;  3U64 A;  2CHX A;  2LXM A;  4GYW A;  5F6L A;  3FUE A;  2IFU A;  5FQ7 A;  2GRR B;  4Q94 A;  1OXJ A;  3AS4 A;  2BQZ A;  5CHE E;  2P9N G;  2J07 A;  3DSW A;  3KS2 A;  5J90 A;  4TXQ A;  5G04 J;  1H6O A;  4OVU A;  3HYM B;  3V2O A;  3ULE G;  3LJN A;  3CGH A;  4JW1 A;  2X6F A;  1DVP A;  3MKQ A;  1IHB A;  3FTW A;  3PZ3 A;  3ULY A;  3PZ4 A;  2ZU6 B;  3JCK C;  5BNW A;  3QWW A;  4LNU D;  2L0I A;  4UQZ A;  4E6H A;  4KZC A;  5FQ8 A;  4ILI A;  2BED A;  2R03 A;  3I4R B;  2KC7 A;  3EIJ A;  3S8P A;  4ILG A;  3MV2 B;  1MX2 A;  2AWI A;  2IQC A;  2WXG A;  1U3C A;  5JIY A;  2XEE A;  1PC2 A;  1TN8 A;  3C3R A;  3OPE A;  1FVH A;  3D9M A;  3MO0 A;  5JHB A;  5CRV A;  4P29 A;  2Y0B G;  3JUE A;  2V0P A;  2QYJ A;  3CQC B;  4LER A;  5LSZ A;  3QAQ A;  4L23 A;  3L08 A;  5ARF A;  2I9C A;  3FH7 A;  4FHK A;  3HXF A;  3T5X A;  3P2B A;  4G23 A;  1N52 A;  4K03 A;  4WWP A;  3CQG B;  2WQH A;  4ANW A;  1YMP A;  2PM6 A;  3U4T A;  4EZK A;  1WM5 A;  2FF4 A;  2CHZ A;  3ABM E;  4HOQ A;  4UWH A;  2BF0 X;  5F6K C;  3DB5 A;  3W9G A;  2F0Y A;  1BI7 B;  5G2N A;  4JA9 A;  3TGO A;  1LD8 A;  5HRY A;  3WG7 E;  3UIP C;  2X3M A;  3AS8 A;  3O48 A;  1MVH A;  3D3M A;  3LJ3 A;  4TV3 A;  3Q5M A;  3SF4 A;  1E8Y A;  2HR2 A;  3TWW A;  2EIN E;  5M72 A;  3IEG A;  3L54 A;  3CHO A;  4NUR A;  3DRA A;  3QAR A;  3L6A A;  3FTS A;  5BW8 C;  1UJK A;  1JCQ A;  2FEZ A;  3LKU A;  4ACL A;  4MI5 A;  4AVX A;  4WNF A;  1H0A A;  4IRU A;  2XQ0 A;  4Y6W A;  3RJW A;  3CVX A;  3MYV A;  1KT0 A;  4CGW A;  3I5P A;  3M53 A;  1TNY A;  2J8S D;  3HNA A;  3W9F A;  3LVQ E;  3APD A;  2ZXW E;  3E32 A;  3CVY A;  2PM7 A;  4R7L A;  1QNF A;  2F69 A;  2WXO A;  5E76 A;  4UI9 C;  2XZD G;  3NZS A;  3KMJ A;  3CVN A;  3EHN A;  3FUI A;  4YNP A;  3EU9 A;  3C3O A;  3B7B A;  5LCW J;  3ABL E;  4A55 A;  3RRM B;  4OYS A;  2KBX A;  5F5E A;  2IOL A;  2VSY A;  4GZ3 A;  3Q15 A;  4MRU A;  2VTB B;  4JHR A;  4HLL A;  4I17 A;  3D9J A;  3FH5 A;  3EU5 A;  3NF1 A;  5AIJ A;  4Z4P A;  4NQ0 A;  3V2X A;  2LO6 A;  2X6J A;  3UIO C;  2YIN A;  3NOG D;  4ANU A;  5JHA A;  2QZA A;  3CVP A;  1TNO A;  3RIB A;  3PNT B;  4J83 A;  3GZS A;  4QEP A;  3NOC D;  1QZ2 A;  2XHE A;  4N3C A;  1EPU A;  2J4D A;  1LTX A;  3VLE A;  1EYH A;  4I1A A;  4L7T A;  4JVS A;  2C2L A;  3E30 A;  4PH4 B;  4C48 B;  4DI3 A;  4C1Q A;  3N71 A;  4GZ6 A;  3MKR A;  3CR3 A;  5G05 C;  4L9P A;  2WXH A;  3UUX A;  2UWJ G;  5A23 A;  1Z5S C;  1EF1 C;  3UTM A;  2Y1L E;  4MLP A;  5B1A E;  3ZHE B;  5H7P A;  3PZD A;  2FO7 A;  3SWC A;  1N0Q A;  2LXL A;  3L16 A;  3D9L A;  4JXT A;  4I1O B;  4TRQ A;  3FU6 A;  1SVX A;  4CZ2 D;  2LNI A;  2X6H A;  5FQ6 A;  1NA0 A;  5EYP F;  3IHX A;  4C9B B;  4UWL A;  5CCL A;  3UM0 A;  1TNB A;  4GTT A;  4QEN A;  2Q7F A;  1ML9 A;  5BV1 A;  2UY1 B;  4E85 A;  3EHM A;  2WXP A;  4HS2 A;  5JJ7 A;  3M5A A;  3IKO B;  3TWT A;  3FUD A;  1KT1 A;  2KCV A;  1NI1 A;  1OCZ E;  1MVX A;  4AEZ C;  4A1G A;  1N4Q A;  2EIK E;  3TWU A;  3BG0 B;  2H6F A;  3GZ1 A;  5AAO A;  2CG3 A;  3SD5 A;  1HFA A;  1ZU2 A;  5JHN A;  3S7F A;  3M56 A;  3R7R A;  1UW4 B;  3UI2 A;  3TJP A;  5BPP A;  2R3A A;  1B89 A;  2KAT A;  2OVB A;  3ZIM A;  2A4Z A;  3CHM A;  1ZB1 A;  4ABN A;  2XEN A;  2XZT G;  3G2V A;  1SZA A;  1TN7 A;  5EN5 D;  1QYM A;  4WAF A;  1E7U A;  3TG4 A;  2PL2 A;  3ABK E;  1O1R A;  2R5S A;  3J5Q B;  1AWC B;  4EZJ A;  2GRP B;  3EHR A;  1N4R A;  1TR4 A;  4V3I A;  2RFA A;  2BKK B;  2I1K A;  2CHW A;  2QY7 A;  2AW6 A;  5D0O D;  2L6J A;  2MOW A;  4K0R A;  5FZR A;  1ELR A;  2CG2 A;  4J7F A;  4O60 A;  2JLB A;  3AG4 E;  3SFZ A;  3PEU B;  2YHE A;  2YQ8 A;  2WMN A;  3CVV A;  4EZL A;  2OCC E;  1N0R A;  2NYJ A;  2R05 A;  3F9W A;  5TH7 A;  1JWF A;  3RAY A;  3CHS A;  2Y3A A;  4C0M A;  4YPE A;  3Q49 B;  3OAW A;  2HYZ A;  4RSY A;  3FUN A;  3LDZ A;  4A3V A;  5D2M C;  3IHY A;  1HZ4 A;  4BTA A;  5CER B;  2KXP C;  5LCW C;  4FA6 A;  3I3N A;  4M3O A;  5EG2 A;  3KSQ A;  1MQS A;  5KNH D;  1H2U A;  1NA3 A;  3GZ2 A;  3TG5 A;  3B7U X;  4LG6 A;  4N2Q A;  5FZS A;  2P9K G;  2VGY A;  3CV0 A;  3ZHE A;  2WXN A;  3OXL A;  4OAU C;  3FEY A;  5AAR A;  3FH8 A;  3TWS A;  4JZY A;  2EIJ E;  4H7Y A;  2Y69 E;  4I51 A;  3ZRH A;  2OV8 A;  3IXE A;  4Z68 A;  3FP3 A;  2M63 A;  4DI4 A;  2XPY A;  2ZGD A;  4RLY A;  4U0Z A;  5BV0 A;  1RZ4 A;  3BU8 A;  4U8V D;  5ANR A;  3IBE A;  3JUI A;  1E8W A;  3P1U A;  1WG0 A;  4EHM A;  4LNB A;  4GCN A;  1H2V C;  1D9S A;  2A5U A;  3BEE A;  3RAU A;  2GRQ B;  3F9Y A;  1FT1 A;  3Q4A B;  4GA2 A;  3S7D A;  3AG2 E;  3Q75 A;  5TTF A;  3ZNG A;  2E0I A;  3G2T A;  3L13 A;  3HDX A;  4FC8 A;  1GW6 A;  2OVF A;  1N95 A;  4PDX A;  1HF8 A;  1Z6T A;  1MUF A;  3BO5 A;  2X6I A;  1MYO A;  3CVQ A;  2GW1 A;  2L6B A;  3KAE A;  2DBA A;  3HXD A;  3LS8 A;  3IV0 A;  4BFR A;  5HKP A;  4KXK B;  4XKC A;  1WAO 1;  3SHF A;  4J7I A;  3CBM A;  4UWK A;  3JQ0 A;  1FVF A;  1INZ A;  1SW6 A;  1Z3X A;  5D0Q D;  3CKB A;  1YCS B;  3CBP A;  3DEO A;  5BXO A;  3ESL A;  3CSF A;  3ASN E;  2WXL A;  4BSZ B;  5AQ9 A;  3HXE A;  4B8C B;  4Q96 A;  4ACK A;  2B6C A;  3U3W A;  4DLQ A;  1UN8 A;  3HRA A;  4L2Y A;  3VTX A;  5T4Y A;  4JEH A;  3T8K A;  1N54 A;  2XS8 A;  4HXI A;  3CLJ A;  3AAA C;  4G2V A;  4BY6 A;  3DST A;  4TXP A;  5AJD A;  1D8E A;  4KT6 B;  3B13 A;  4G8L A;  1G3N B;  4F1P A;  4UQY A;  3HVE A;  3OOI A;  3Q79 A;  2KZT A;  1BI8 B;  3RJV A;  4GYY A;  1BD8 A;  3LY8 A;  3AG1 E;  2F37 A;  1V55 E;  3SY2 A;  4BT9 A;  4DX6 D;  3VLF A;  2P2C P;  2LAH A;  2NC9 A;  4J8S A;  1S64 A;  4K5B A;  2L9B A;  4JD2 G;  3Q7A A;  4YDY A;  5AEN A;  1N3J A;  5ENS D;  3HXB A;  1D8D A;  4MBG A;  3K9I A;  4XE0 A;  4CDR A;  3URZ A;  2MRI A;  3PUK A;  1K1B A;  4B8A A;  1A5E A;  4FP7 A;  3MZL B;  4WWO A;  1FCH A;  4K5A B;  5A7D B;  4E47 A;  1E96 B;  4GU5 A;  4N5C A;  1SA4 A;  4KVO A;  2H6G A;  3MJW A;  4N3A A;  4DLO A;  3FUH A;  3LY9 A;  1VDY A;  3F9X A;  5E75 A;  3AJI A;  2RFI A;  5KNG A;  2DIW A;  3KSL A;  3PRZ A;  2CFU A;  4ANV A;  1AP7 A;  4Y6C A;  3JXI A;  2J08 A;  2EIM E;  3FUK A;  1TNU A;  4BEP A;  5DIZ A;  3D9H A;  2WXM A;  2JV0 A;  3AU4 A;  3DWL G;  3UM2 A;  5JA4 D;  1QBQ A;  3SQV A;  4A63 B;  3D9I A;  3KEA A;  1K8K G;  4C0E A;  2Y4U A;  4AV7 A;  1DCQ A;  4DJA A;  4HB5 A;  4AM9 A;  4IJD A;  2MHK A;  4YDO A;  4JA7 A;  1OWM A;  4MS6 A;  1OCO E;  3ASG A;  1W3B A;  3ZXS A;  1H3I A;  2VJ8 A;  2C0M A;  2WQ6 A;  4XKB A;  4GTV A;  1XQH A;  3SGH A;  1X5B A;  5ANL A;  5KCM A;  1SA5 A;  2C0L A;  4HRL A;  4TXR A;  3KMT A;  1IQR A;  2IJG X;  2O8J A;  3MGB A;  3CHP A;  4I9E A;  4GTQ A;  1N6A A;  2KCK A;  2F8Y A;  4GCO A;  2G46 A;  3JYS A;  1N11 A;  1V54 E;  2RD0 A;  4HRM B;  4UI9 K;  2W5Y A;  3HVE B;  4F7A A;  3F6Q A;  3B7T A;  4N3B A;  4AY6 A;  4LCT A;  2DYS E;  3ML9 A;  4JL0 A;  4W9R A;  4FAD A;  3U66 A;  3QWV A;  1N6C A;  2EIL E;  3ISM C;  3SI5 A;  1S63 A;  3CK7 A;  5LX8 A;  3NBN B;  2IY0 C;  3PZ2 A;  4I6G A;  4ME2 A;  4B89 A;  3E37 A;  4BET A;  2ZGG A;  2FUL A;  3PRE A;  2VSX E;  2ETC A;  3ZEF A;  3ZN3 A;  4CCA A;  4GMR A;  1OWO A;  3FUL A;  4UWF A;  3FY4 A;  1K3Z D;  3UT8 A;  3WXX A;  5KJK A;  1UG3 A;  4O6F A;  3G2W A;  2W5Z A;  5CCM A;  2R2L A;  1U2V G;  3CIA A;  1E90 A;  5FT9 A;  5ITZ F;  2WQ7 A;  3Q9U C;  4U0S A;  2HE0 A;  1MX4 A;  4AXH A;  5C1D A;  2WVI A;  3LEW A;  3V31 A;  3PZ1 A;  3HG0 D;  1OY3 D;  2GRM A;  2XEV A;  3ZGQ A;  2XGO A;  3QNK A;  2LSV A;  4GA0 A;  4I9C A;  1JUQ A;  2XCC A;  1LF8 A;  3G2U A;  3FTY A;  4LDG A;  1OUV A;  1O1T A;  4DX5 D;  3K5K A;  3C72 A;  2WB2 A;  5LSX A;  5HS0 A;  4XIF A;  3UT4 A;  3S7J A;  3L82 A;  4BX9 A;  3RU0 A;  4YNM A;  2DVW A;  5FZQ A;  5TEG A;  2AXV A;  4JC8 A;  3V79 K;  2ILR A;  4GZD A;  4HOU A;  5C2Y A;  2CFZ A;  4HOS A;  5FIN A;  3AU5 A;  5JJ6 A;  1UN9 A;  1OWP A;  2EQX A;  3M59 A;  5AYW D;  3PUJ A;  3NAW A;  4F6R D;  4GB9 A;  4FUL A;  3X2Q E;  4CDN A;  4O30 A;  2I6H A;  4YPU A;  1OWN A;  3SBS A;  3UPV A;  2PQN A;  4O1O A;  3MKQ B;  4G24 A;  2RKK A;  3C98 A;  4OVV A;  3FWV A;  4GMJ A;  4GPM A;  4RG6 A;  3FFL A;  2BTD A;  3RO2 A;  4UUC A;  2GRN B;  4CT4 A;  3L17 A;  2RFM A;  3ULQ A;  4EPZ A;  3CST A;  3ONK A;  4EEC A;  5AJL A;  5CBN A;  5KJM A;  3QB2 A;  4QFV A;  4FLH A;  3S7B A;  3TWQ A;  2WXI A;  5BT1 A;  4H7X A;  3U9W A;  3CEQ A;  2DCP A;  3RKV A;  5T3R A;  3Q9N C;  3DSV A;  5FWQ A;  4GTP A;  1YYH A;  1P5Q A;  3QDN A;  4AP2 A;  2ZIR A;  2J9Q A;  1HO8 A;  4AJW A;  3ZVV A;  1NFI E;  3G2S A;  4YDE A;  3KMA A;  1NZN A;  3ASO E;  3M58 A;  4KZ0 A;  2V8S E;  2OOE A;  3RK6 A;  4KMO A;  4B94 A;  1HXI A;  4I43 A;  4YDW A;  5KJN A;  2IOS A;  4G25 A;  2I2O A;  4BSX A;  3JQ1 A;  5KWD A;  5JJ0 A;  4YVQ C;  4J6I A;  1SZ9 A;  2E2E A;  4RG9 A;  3SBT B;  1E8X A;  5CBO A;  3ASF A;  1SQM A;  1JWG A;  3ZU7 B;  4Q69 A;  4H12 A;  5BUZ A;  3ONL A;  4XI9 A;  2YHC A;  1TYQ G;  2P9I G;  4IYP A;  1XGW A;  4IUL A;  2NSZ A;  4I6J A;  2XGS A;  4FHJ A;  3R7Q A;  3EDT B;  3FU5 A;  4F1S A;  4AOF A;  2AXU A;  3LXU X;  2XS1 A;  4N5Q A;  2FI7 A;  1WDY A;  4FU3 A;  4ATG A;  2P9U G;  3DXK G;  4F53 A;  5CMY A;  4WWN A;  5B1B E;  4BER A;  5DBK A;  4JLG A;  4UI9 J;  5D66 A;  4HOR A;  3QC1 A;  2H6H A;  3ZW3 A;  1H2T C;  4CDM A;  3MO2 A;  3ZYL A;  2HO1 A;  1TJF A;  3IHV A;  5JMN D;  2XRY A;  3FU3 A;  2PZI A;  5HQ8 A;  1N94 A;  1A17 A;  4WNG A;  4YPA A;  5ENQ D;  2WXR A;  3FTZ A;  5ENP D;  1ZBP A;  5EIL A;  3RRU A;  1BPO A;  4G11 A;  1S0P A;  3GYZ A;  1IQU A;  2A5E A;  3HIZ A;  1X81 A;  5EKQ D;  5G55 A;  1RW2 A;  4TUU A;  3OXF A;  4U0U A;  4APO A;  1S70 B;  1N4P A;  1Y8M A;  1WY6 A;  1Y6I A;  4EBA G;  3B95 A;  3GW4 A;  4QEO A;  1ZKK A;  1E8Z A;  4CYM D;  3VUZ A;  4HQD A;  3PEV B;  4N39 A;  3FTV A;  3MA5 A;  3M54 A;  3F9Z A;  5HI7 A;  2MYO A;  5ENO D;  3CVW A;  5T8I A;  1HG2 A;  1TEZ A;  4X8Q A;  4ZHB A; 
#chains in the Genus database with same CATH homology
 3ZXS A;  5A23 A;  2GGF A;  2V5F A;  1EF1 C;  3D9K A;  1H3I A;  2VJ8 A;  4MLP A;  5T0K A;  3MEK A;  4IN3 B;  4WUY A;  3T5V A;  4WND A;  3ZHE B;  2WM9 A;  1H19 A;  2C0M A;  4XI0 A;  4DK5 A;  2VGX A;  2WQ6 A;  3PZD A;  4XKB A;  3LYA A;  3QJZ A;  1UJJ A;  2LAI A;  3LY7 A;  4LEU A;  5FTP A;  3R9A B;  4BUP A;  2FO7 A;  3SWC A;  1XQH A;  3SGH A;  1X5B A;  5ANL A;  4HFG A;  5KCM A;  3RRN B;  2VYI A;  2C0L A;  4FMU A;  2XCB A;  3CK9 A;  5JJT A;  3L16 A;  1TJC A;  1IQR A;  2IJG X;  2IU1 A;  3D9L A;  4JXT A;  3MGB A;  2O8J A;  3CHP A;  4I9E A;  4U07 A;  1N6A A;  4I1O B;  2KCK A;  3ML8 A;  4GZC A;  4TRQ A;  4GCO A;  2G46 A;  3FU6 A;  3JYS A;  2RD0 A;  3TAX A;  3QOU A;  3TXM A;  3B7R L;  2LNI A;  2X6H A;  3NQP A;  4UI9 K;  3CVU A;  2FBN A;  3HVE B;  2W5Y A;  5FQ6 A;  4KYO B;  4F7A A;  1NA0 A;  3IHX A;  3O4Z A;  4I2Z A;  2QFC A;  3B7T A;  4C9B B;  4UWL A;  5CCL A;  4N3B A;  3EP0 A;  4BTB A;  1ELK A;  1PEG A;  4AY6 A;  4LCT A;  3ZFW A;  5KJL A;  4QEN A;  2IF4 A;  2Q7F A;  1ML9 A;  5ARG A;  2UY1 B;  4E85 A;  3EHM A;  5BV1 A;  2WXP A;  3ML9 A;  4FJY A;  4ILH B;  3DPD A;  4HS2 A;  5JJ7 A;  3M5A A;  1U3D A;  3IKO B;  3FUD A;  4G1T A;  5CPR B;  4UWG A;  4JL0 A;  1KT1 A;  4PS3 A;  4WNE A;  4W9R A;  3MO5 A;  4FAD A;  2KCV A;  4YVO A;  3QWV A;  3U66 A;  1MVX A;  2RG8 A;  4G26 A;  1N6C A;  3NZU A;  4AEZ C;  3CBO A;  3M57 A;  3SI5 A;  3CK7 A;  4EQF A;  4JHK A;  5LX8 A;  2VGX B;  2XRZ A;  4A1G A;  3FUM A;  3OTN A;  4I6G A;  4ME2 A;  4B89 A;  2WMO A;  5T5G A;  4U63 A;  1IHG A;  3BG0 B;  4RZ0 A;  3GZ1 A;  5G04 C;  4LRZ A;  2QPW A;  3PE3 A;  2FUL A;  3PRE A;  2CG3 A;  2VSX E;  4PS8 A;  3ZEF A;  2WXF A;  3SD5 A;  3ZN3 A;  3FPD A;  4FJZ A;  3AS5 A;  1HFA A;  4CCA A;  1ZU2 A;  2Y4T A;  5JHN A;  4GAA A;  3S7F A;  2WXQ A;  3FDH A;  3L22 A;  3M56 A;  1OWO A;  3TXN A;  3R7R A;  3FUL A;  4UWF A;  5LFA A;  3FY4 A;  4IJ8 A;  1UW4 B;  3TJP A;  4CRW A;  5BPP A;  2UY1 A;  3Q47 B;  3VTY A;  1L5J A;  2R3A A;  4U8H A;  5LOZ A;  1B89 A;  1JPL A;  3ZYQ A;  2KAT A;  3KEZ A;  3UT8 A;  2OVB A;  3WXX A;  5KJK A;  3ZIM A;  2KZT B;  2A4Z A;  4JEU A;  3ZYM A;  3CHM A;  3G2V A;  1HX8 A;  4ABN A;  3FTU A;  1SZA A;  1UG3 A;  2P58 C;  5AYF A;  3E4B A;  4O6F A;  4WAF A;  3LVR E;  1MT6 A;  1E7U A;  3G2W A;  3PS6 A;  4YND A;  3TG4 A;  5FQ4 A;  2PL2 A;  2W5Z A;  4F3V A;  5EX0 A;  5CCM A;  2R5S A;  1YA0 A;  4GYO A;  4EZJ A;  3UT7 A;  3CIA A;  1E90 A;  5FT9 A;  2WQ7 A;  4U0S A;  4A1S A;  4V3I A;  3M55 A;  2I1K A;  2CHW A;  4JPS A;  2QY7 A;  3FTX A;  5CMW A;  3UMV A;  2AW6 A;  4LUN U;  2VQ2 A;  4AXH A;  2ION A;  5D0O D;  2XGM A;  3I4G A;  2L6J A;  2MOW A;  5C1D A;  2WVI A;  3LEW A;  4K0R A;  5FZR A;  1ELR A;  4KVM A;  3UX4 A;  2CG2 A;  4J7F A;  2GRM A;  2XEV A;  3ZGQ A;  2JLB A;  2XGO A;  3SFZ A;  1Z3Y A;  1HE8 A;  3QKY A;  3PEU B;  4HVB A;  2YHE A;  4GPK A;  3DBS A;  3QNK A;  3DAL A;  2LSV A;  2CHX A;  2WMN A;  2YQ8 A;  3PH0 C;  4GZ5 A;  3U64 A;  3CVV A;  2IGQ A;  2VSO E;  4EZL A;  4GA0 A;  2NXP A;  1DNP A;  4I9C A;  4GYW A;  4NJ5 A;  1XNF A;  2AXZ A;  3CK8 A;  5F6L A;  1JUQ A;  3F9W A;  5TH7 A;  3EJN A;  3FUE A;  1JWF A;  2IFU A;  2XCC A;  3CKC A;  1LF8 A;  5FQ7 A;  3RAY A;  3CHS A;  2Y3A A;  4C0M A;  4Q94 A;  3RO3 A;  3AS4 A;  3G2U A;  3Q49 B;  2BQZ A;  4YPE A;  3OAW A;  3FTY A;  5CHE E;  4LDG A;  2HYZ A;  4RSY A;  3FUN A;  3LDZ A;  2J07 A;  3MV3 B;  4PS7 A;  4A3V A;  4URK A;  3IHY A;  3KS2 A;  5J90 A;  1HZ4 A;  4I2W A;  1OUV A;  4BTA A;  5G04 J;  4OVU A;  3HYM B;  3K5K A;  5LCW C;  4FA6 A;  2WB2 A;  3MCX A;  5LSX A;  3I3N A;  4M3O A;  3CGH A;  4JW1 A;  2X6F A;  4XIF A;  2X6K A;  5EG2 A;  3UT4 A;  1DVP A;  1MQS A;  3MKQ A;  3S7J A;  4BX8 A;  2VSN A;  3FTW A;  3RU0 A;  4BX9 A;  4YNM A;  3UQ3 A;  2ZU6 B;  3JCK C;  3FEX A;  3D9O A;  1H2U A;  5BNW A;  1NA3 A;  3QWW A;  3GZ2 A;  5FZQ A;  4XX5 A;  2J4B A;  5TEG A;  3TG5 A;  2L0I A;  3OXG A;  2XPZ A;  2AXV A;  4JC8 A;  4EBA A;  4UQZ A;  3B7U X;  2ILR A;  4E6H A;  4GZD A;  4HOU A;  5C2Y A;  4KZC A;  4ILI A;  2CFZ A;  2VGY A;  5FQ8 A;  5FZS A;  3CV0 A;  3ZHE A;  4N2Q A;  3I4R B;  2KC7 A;  3EIJ A;  3S8P A;  4HOS A;  4ILG A;  2PQR A;  3MV2 B;  3AU5 A;  5JJ6 A;  2AWI A;  2IQC A;  1UN9 A;  1OWP A;  2WXN A;  1U3C A;  2WXG A;  3TL5 A;  3OXL A;  4D10 C;  3FEY A;  4PUC A;  4CT0 A;  5LP0 A;  2EQX A;  3FHE A;  4U04 A;  5JIY A;  3ESK A;  3FH8 A;  1PC2 A;  3M59 A;  3BG1 B;  4JZY A;  4H7Y A;  4HLE A;  4A3T A;  3OPE A;  1FVH A;  5AYW D;  3D9M A;  3MO0 A;  5JHB A;  4I51 A;  3PUJ A;  3ZRH A;  2OV8 A;  4GB9 A;  4P29 A;  4FUL A;  3PNL B;  3FP3 A;  2M63 A;  2V0P A;  4CDN A;  2XPY A;  4DI4 A;  4O30 A;  2I6H A;  3FUJ A;  2BUG A;  4YPU A;  1OWN A;  4U0Z A;  3SBS A;  2PQN A;  5BV0 A;  3UPV A;  3CQC B;  5ANR A;  3IBE A;  3JUI A;  3LPZ A;  1E8W A;  3MKQ B;  3P1U A;  4G24 A;  4LER A;  5LSZ A;  3QAQ A;  4L23 A;  3L08 A;  4GCN A;  5ARF A;  2I9C A;  3FH7 A;  4RVB A;  1H2V C;  2A5U A;  1NP7 A;  3BEE A;  4J8O A;  4FHK A;  2VTB A;  3T5X A;  3C98 A;  3P2B A;  4G23 A;  4J8D A;  1N52 A;  3FWV A;  4OVV A;  4AY5 A;  3F9Y A;  3CHR A;  3Q4A B;  4K03 A;  4GA2 A;  2WXK A;  4WWP A;  4GMJ A;  3S7D A;  3CQG B;  3ASH A;  4BT8 A;  4RG6 A;  3FFL A;  2BTD A;  2KM4 A;  2WQH A;  3RO2 A;  4ANW A;  4B0Z A;  3SNX A;  4CT4 A;  3L17 A;  4CGV A;  2PM6 A;  3U4T A;  5TTF A;  1EDU A;  4EZK A;  2E0I A;  1WM5 A;  3ULQ A;  3G2T A;  2FF4 A;  1QQE A;  3L13 A;  3CST A;  3ONK A;  4EEC A;  4EPZ A;  5AJL A;  2CHZ A;  3HDX A;  4HOQ A;  4FC8 A;  5KJM A;  4UWH A;  1GW6 A;  2BF0 X;  2OVF A;  4MI0 A;  4PDX A;  3ASD A;  3DB5 A;  5F6K C;  3APF A;  5F59 A;  1HF8 A;  3QB2 A;  4QFV A;  1Z6T A;  1MUF A;  4FLH A;  3S7B A;  3BO5 A;  3FU0 A;  1H6K A;  5G2N A;  2X6I A;  3CVQ A;  4JA9 A;  2GW1 A;  3APC A;  3KAE A;  3TGO A;  2WXI A;  2DBA A;  5BT1 A;  4H7X A;  3LS8 A;  5FJY A;  3IV0 A;  2XPI A;  4BFR A;  4KXK B;  3VLD A;  4XKC A;  1WAO 1;  3U9W A;  2J49 A;  3CEQ A;  2DCP A;  3RKV A;  3SHF A;  2L0T B;  2X3M A;  5T3R A;  4J7I A;  3HHM A;  3AS8 A;  3O48 A;  5FWQ A;  3CBM A;  4UWK A;  4DPR A;  4FLB A;  4BWR A;  3JQ0 A;  1MVH A;  1P5Q A;  4I6E A;  3KMT A;  2V4L A;  5T0M A;  1FVF A;  1KLX A;  1INZ A;  1OWL A;  1Z3X A;  3D3M A;  3LJ3 A;  3CKB A;  3QDN A;  4TV3 A;  5D0Q D;  3Q5M A;  4GA1 A;  5EX3 A;  4AP2 A;  3T8M A;  3QWP A;  3SF4 A;  3CBP A;  2J9Q A;  1E8Y A;  2HR2 A;  1HO8 A;  3ESL A;  3CSF A;  4AJW A;  3ZVV A;  5M72 A;  2WXL A;  3IEG A;  3G2S A;  2WXJ A;  3KMA A;  3LCA A;  3L54 A;  4XZ4 A;  3CHO A;  1NZN A;  1HH8 A;  4NUR A;  3M58 A;  4KZ0 A;  2V8S E;  4B8C B;  1HU3 A;  2OOE A;  4Q96 A;  3RK6 A;  4KMO A;  2R59 A;  3CVL A;  4ACK A;  4B94 A;  3QAR A;  3U3W A;  3L6A A;  1HXI A;  1UN8 A;  3FTS A;  4I43 A;  4DLQ A;  5BW8 C;  1UJK A;  5KJN A;  4L2Y A;  3VTX A;  5T4Y A;  2IOS A;  4JEH A;  4AU7 A;  2FEZ A;  4G25 A;  2I2O A;  4ANX A;  5A6C A;  3LKU A;  2YNQ A;  1N54 A;  4L1B A;  4BSX A;  3JQ1 A;  5JJ0 A;  4HXI A;  3CLJ A;  4J6I A;  4YVQ C;  4G2V A;  1SZ9 A;  4AIF A;  4BY6 A;  2E2E A;  2OND A;  4RG9 A;  3SBT B;  1E8X A;  5AJD A;  4ACL A;  4MI5 A;  3S2A A;  3ASF A;  1H0A A;  4WNF A;  1SQM A;  4KT6 B;  3B13 A;  3KD7 A;  4IRU A;  4AVX A;  2XQ0 A;  1IYG A;  3D9N A;  1O9S A;  1JWG A;  4Y6W A;  5G05 J;  4Q69 A;  3CVX A;  4H12 A;  3RJW A;  5J08 A;  2X38 A;  5BUZ A;  3ONL A;  3PVL A;  3MYV A;  1KT0 A;  4XI9 A;  4CGW A;  4UQY A;  3I5P A;  2YHC A;  2HM8 A;  1HG5 A;  3HVE A;  3M53 A;  3OOI A;  5EDS A;  4IYP A;  1PAQ A;  2KZT A;  1XGW A;  4IUL A;  3HNA A;  2NSZ A;  2I1J A;  4KBQ A;  3RJV A;  4I6J A;  3LVQ E;  2XGS A;  4GYY A;  3APD A;  3LY8 A;  4FHJ A;  3R7Q A;  3PDN A;  4J0U A;  3EDT B;  3FU5 A;  4F1S A;  4AOF A;  4BT9 A;  2GRL A;  3CVY A;  2PM7 A;  2AXU A;  3QK0 A;  3VLF A;  4JHJ A;  3LXU X;  2JEK A;  4R7L A;  2LAH A;  2FI7 A;  1QNF A;  3SZ7 A;  2F69 A;  4FU3 A;  4ATG A;  2WXO A;  4JDS A;  3ZPJ A;  5E76 A;  4F53 A;  3D9P A;  5CMY A;  4UI9 C;  2WPV A;  4WWN A;  5DBK A;  2NC9 A;  4J8S A;  3NZS A;  4L2L A;  3KMJ A;  3CVN A;  3EHN A;  3FUI A;  4JLG A;  3MX3 A;  4UI9 J;  5ENN A;  2L9B A;  4YNP A;  4HOR A;  3FUF A;  3QC1 A;  5AEN A;  5LCW J;  1N3J A;  3ZW3 A;  4A55 A;  1H2T C;  1HS6 A;  4I1M A;  3RRM B;  4CDM A;  4OYS A;  4APF A;  3MO2 A;  5F5E A;  3ZYL A;  2IOL A;  4UQX A;  2VSY A;  2HO1 A;  4GZ3 A;  1TJF A;  1PY1 A;  3IHV A;  3Q15 A;  3K9I A;  2XRY A;  4MRU A;  5JIN A;  3FU3 A;  4XE0 A;  3ZYK A;  2PZI A;  4MKT A;  5HQ8 A;  4CDR A;  3URZ A;  2MRI A;  3PUK A;  2AVP A;  4NRH B;  1A17 A;  3OS5 A;  2VTB B;  4B8A A;  4WNG A;  4JHR A;  4YPA A;  4I17 A;  3D9J A;  3FH5 A;  2WXR A;  4FP7 A;  3MZL B;  3NF1 A;  3RQ4 A;  5AIJ A;  3FTZ A;  4WWO A;  1FCH A;  4NQ0 A;  5A7D B;  4Z4P A;  4E47 A;  1E96 B;  1ZBP A;  4GU5 A;  4N5C A;  4N2S A;  4HOT A;  4J8F A;  3RRU A;  3CHQ A;  1BPO A;  2LO6 A;  4G11 A;  2X6J A;  4KVO A;  1S0P A;  2YIN A;  3GYZ A;  3MJW A;  4N3A A;  4DLO A;  3VV0 A;  4NVQ A;  1IQU A;  3FUH A;  3HIZ A;  3LY9 A;  1VDY A;  4ANU A;  5EKQ D;  5JHA A;  3CVP A;  5G55 A;  1MHQ A;  3F9X A;  3RIB A;  5E75 A;  3PNT B;  4TUU A;  4J83 A;  3ENE A;  3OXF A;  4U0U A;  4APO A;  2RFI A;  2DIW A;  3GZS A;  1Y8M A;  1WY6 A;  3PRZ A;  2CFU A;  2KCL A;  1Y6I A;  4QEP A;  4ANV A;  4CEM A;  4EBA G;  4Y6C A;  2J08 A;  3FUK A;  3GW4 A;  4QEO A;  1QZ2 A;  2XHE A;  4N3C A;  3EIQ C;  4GML A;  1EPU A;  2J4D A;  2J09 A;  2R17 C;  1E7V A;  4J8E A;  5DIZ A;  1E8Z A;  1ZKK A;  2WXM A;  2JV0 A;  3SW9 A;  3AU4 A;  3VLE A;  3VUZ A;  1ELW A;  1EYH A;  3PEV B;  4I1A A;  4NAC A;  4N39 A;  4L7T A;  3FTV A;  4JVS A;  2C2L A;  3D9I A;  3MA5 A;  4PH4 B;  4DI3 A;  4C0E A;  4C1Q A;  3M54 A;  2Y4U A;  3N71 A;  4AV7 A;  4DJA A;  3PE4 A;  4GZ6 A;  3F9Z A;  4AM9 A;  3MKR A;  5HI7 A;  4IJD A;  3B7S A;  2MHK A;  3CVW A;  4JA7 A;  1OWM A;  3CR3 A;  5G05 C;  5T8I A;  4MS6 A;  1HG2 A;  2WXH A;  3UUX A;  2LSU A;  1TEZ A;  3ASG A;  2UWJ G;  1W3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...