3S7BA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7bA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7bA01
4RG9A 4BTAA 5T0MA 1KT0A 4IN3B 5G04C 3DALA 5F6KC 5D0OD 3RJWA 5HQ8A 2R3AA 2FBNA 2P58C 4YPUA 4J8DA 4QEPA 4YNMA 4YPAA 4J8EA 1KLXA 4B94A 4XI9A 5M72A 3S7FA 3F9ZA 3GZ1A 1ELRA 1O9SA 3RKVA 5JIYA 3R9AB 4WNDA 3ZHEB 2W5YA 4GZ3A 4UI9J 3MV3B 4Y6WA 3QWWA 5FJYA 2HO1A 4O6FA 4WUYA 3CK8A 4I9CA 2C0MA 2XGMA 1WM5A 2PQNA 5CCMA 1XNFA 1IHGA 1MT6A 3CBOA 3GW4A 4G26A 5G05C 4HOQA 1ZU2A 2YHCA 2LSVA 2VQ2A 1OUVA 3S7DA 4CDRA 1WAO1 3ULQA 3KMTA 2HYZA 3S7BA 5DIZA 3S8PA 2HR2A 1ELWA 4HOSA 3WXXA 3CVPA 5EG2A 3LYAA 3N71A 4CGVA 1QZ2A 1W3BA 2IFUA 4XI0A 2XGSA 4G1TA 3PE4A 4WNFA 4GA1A 1TJCA 4BT9A 5FZRA 4KBQA 3MO5A 3CBMA 3TGOA 4JA9A 1N3JA 1IYGA 1HZ4A 4GZ6A 3MO2A 2V5FA 3M54A 4YPEA 5ARFA 5LSXA 4XIFA 5FZSA 1ZKKA 4H12A 3Q4AB 3MV2B 5JJ0A 3TG5A 2Y4TA 4WNGA 2W5ZA 2KC7A 5C1DA 4YVQC 2IF4A 5BNWA 3LY8A 2L6JA 4RG6A 2GW1A 3KMJA 2JV0A 3K5KA 3ZPJA 2FF4A 4U0SA 4N2SA 5CPRB 3CEQA 1QQEA 3ZGQA 3UPVA 2VGXA 1PC2A 5D0QD 4EQFA 5A7DB 3IEGA 4ME2A 3ZFWA 3M53A 3EP0A 2UWJG 5JJTA 3VUZA 2VSYA 4NJ5A 4I17A 4JLGA 2E2EA 1B89A 3CVNA 3KS2A 5LCWJ 3QDNA 3QWPA 4J8OA 2LNIA 2PL2A 2XGOA 3CVLA 5TTFA 3FFLA 5G04J 5F59A 2QPWA 2KCVA 4I2WA 3OXFA 4N39A 3RIBA 3EDTB 3HYMB 2UY1B 2PQRA 3HNAA 2R5SA 2KCKA 4AM9A 4GA2A 4G24A 4MI0A 4Z4PA 2XPIA 5KJMA 2BUGA 5JINA 1NA3A 1ZBPA 2YQ8A 3CK9A 1N6AA 5LSZA 3U3WA 5HI7A 4LEUA 3KD7A 3MKRA 5EX3A 2BQZA 3QOUA 3FWVA 5G05J 3CKCA 4LDGA 3SZ7A 4RZ0A 3LY7A 4HORA 3Q47B 3JYSA 4AIFA 4CGWA 2XEVA 4HOUA 4BUPA 2QFCA 5AYFA 3RAYA 4KXKB 4GYWA 5KJKA 3UQ3A 3QKYA 2VYIA 1YA0A 2VGYA 5EX0A 4I9EA 2FEZA 5AYWD 5A6CA 3M57A 4J7FA 3CKBA 4QEOA 4YNPA 4BWRA 3TG4A 4HOTA 4U0ZA 1P5QA 5JJ6A 1HXIA 5FT9A 4J7IA 2Y4UA 5JHNA 2C2LA 1HH8A 3FPDA 3SF4A 2XCBA 3ZHEA 3S7JA 3PE3A 4N3CA 4IJDA 5F5EA 3OXGA 4O30A 3ESKA 5CHEE 4U0UA 4ABNA 3URZA 3K9IA 2WPVA 3RJVA 3CV0A 4I1AA 3M58A 4NQ0A 3VTYA 4GCOA 3Q5MA 3MEKA 3M59A 1ML9A 4N2QA 3OOIA 3RO3A 3OS5A 1MUFA 4I51A 3ASDA 2KCLA 1NZNA 4H7XA 3LKUA 3GYZA 3ZN3A 1MVXA 5FZQA 4YVOA 4N3AA 5BT1A 5T0KA 3UUXA 4FMUA 2XCCA 4KYOB 1XQHA 5EKQD 3CBPA 4NVQA 4MI5A 3Q15A 2PZIA 4U04A 4JA7A 4UI9C 1FCHA 4GCNA 3ASHA 1KT1A 4APOA 3PDNA 4W9RA 5F6LA 2RFIA 4BTBA 4J0UA 4BT8A 3E4BA 3F9WA 4J8FA 4F3VA 4GPKA 3NF1A 5KJLA 3KMAA 5DBKA 4UQXA 2F69A 4AY5A 4UQZA 4C1QA 4G2VA 3O48A 3SW9A 5CCLA 2VGXB 3FP3A 3RQ4A 2O8JA 3RU0A 4U07A 3CK7A 3BO5A 4GA0A 4IJ8A 3VTXA 5TH7A 3F9YA 3SWCA 5ARGA 3AS8A 3AS5A 5TEGA 1H3IA 3KAEA 2J9QA 3ASGA 3M55A 2OOEA 3OPEA 2AVPA 4I2ZA 4QENA 4WNEA 2MHKA 4UI9K 4Y6CA 1NA0A 4E47A 4N5CA 2WQHA 4UQYA 1N6CA 4A1SA 4JHRA 4JL0A 3LCAA 4GZ5A 1Y8MA 3QWVA 3ASFA 4H7YA 3AS4A 2UY1A 2KATA 3GZ2A 2LSUA 4JDSA 2VSNA 3F9XA 2G46A 5FTPA 2C0LA 4YNDA 5T5GA 2NC9A 4NRHB 3U4TA 3M56A 4G23A 2FO7A 3CVQA 5BW8C 2FI7A 4AY6A 5JJ7A 3VV0A 3Q49B 3IHXA 2JLBA 3RO2A 1E96B 4GYOA 3DB5A 1MVHA 2ONDA 4J83A 3M5AA 1PEGA 3BEEA 2Q7FA 4N3BA 3LY9A 3MA5A 4GYYA 4G25A 5KJNA 2I6HA 4AU7A 2DBAA 3OXLA 3LPZA 1A17A 5LCWC 2IGQA 3MO0A 3TAXA
chains in the Genus database with same CATH superfamily
4DX1A 1EPUA 3MKQA 1KT0A 3DALA 5T8IA 3RAUA 5LX8A 3KEAA 4DPRA 4ZHBA 1LD8A 2F37A 4DI3A 4YPUA 4QEPA 1LTXA 3FDHA 1E8YA 3UI2A 4DX2A 5KBAA 4AVXA 3FTVA 4K03A 1N95A 2CFZA 2DYSE 1O5MA 3UM0A 3MYVA 4FJYA 3NB2A 4F6RD 1JWGA 3PZ1A 3EHRA 3CGHA 4WNDA 1EYHA 4GZ3A 2HO1A 4WUYA 1H6PA 4URKA 4G26A 4EZLA 5G05C 2YHCA 3Q78A 4EBAG 4HXIA 3CVVA 1OUVA 4JB8P 3ZYLA 4JC8A 4DK5A 2HYZA 3W9GA 4GMJA 3S8PA 2HR2A 2XEHA 4HOSA 5AARA 2ZGGA 3LYAA 3NOGD 4CGVA 4KZCA 1S63A 1W3BA 2QYJA 3ZYKA 4XKCA 3E33A 3FEYA 2XGSA 3KSQA 3PE4A 2LXLA 2WXOA 5FZRA 3MO5A 2JABA 4HB5A 3ZKJA 4GZ6A 5CEAA 1D8DA 2V5FA 4U8HA 2EINE 5ARFA 4CCAA 2V5QC 4H12A 3ASNE 5FIOA 3CR3A 3TG5A 4WNGA 2W5ZA 4IRUA 5C1DA 3NZUA 3DSTA 4XE0A 4RG6A 4UUCA 4BESA 2EILE 3QB2A 2ZXWE 3ISMC 2JV0A 2FF4A 3HVEA 4FLHA 1QQEA 4J7WA 2VGXA 4G8KA 5D0QD 4EQFA 2WVIA 2V4HC 5A7DB 3IEGA 2DIWA 1JWFA 3ZFWA 3ML8A 4B89A 4F1SA 1N54A 3M53A 5JJTA 4GAAA 4O1PA 4JLGA 2CFUA 5JA4D 3ZXSA 1E8ZA 2J4BA 4ANWA 2ETAA 4YDWA 3DPYA 2VSOE 4J8SA 3R9MA 3IV0A 2QC9A 2X6KA 1UOHA 3QJZA 2IQCA 5G04J 2V4LA 3LDZA 1BLXB 3Q9UC 4IULA 4N39A 1AWCB 2GRPB 3E32A 3ZVVA 4XZ4A 3HDXA 3EU9A 2PQRA 3HNAA 2CG2A 3D9IA 4G24A 4PS3A 4Z4PA 5BV0A 1HF8A 2ZISA 3HRAA 4BY6A 5ENOD 4BERA 4V3IA 4DJAA 2WXFA 2BQZA 1MJ0A 3QOUA 5HKPA 3C3RA 1DNPA 1U3DA 2AWIA 5ANRA 5G55A 4LDGA 3JXJA 2IOLA 4KMOA 1OWMA 3UM1A 2DCPA 5AYFA 4IYPA 3MKQB 2VGYA 5EX0A 5AYWD 3PNLB 3PNTB 3TG4A 4U0ZA 4F1PA 3GZSA 2Y4UA 4RVBA 3FPDA 3UTMA 3ZXPA 3T5VA 1TR4A 1OWPA 2PM7A 3R7RA 4AJWA 2P9SG 4IJDA 3OXGA 3FUDA 5EIBE 1TN8A 5KCMA 5JHBA 3SFXA 5CERB 2CHZA 3FUFA 3PH0C 4MKTA 1MUFA 3J5PA 4WWNA 4I51A 2OCCE 1KZOA 3ZN3A 4JVSA 4ILIA 2IO3C 4NURA 1TNZA 4TUUA 4G8LA 2XCCA 3B7TA 3T8KA 4KYOB 1PY1A 1H19A 3EIQC 4MS6A 5EKQD 4JPSA 5AIJA 2L0TB 3PEVB 3FULA 1U3CA 1TYQG 4KT6B 4LNUD 1D9SA 3FEXA 4W9RA 5F6LA 4LRZA 3ZU7B 4PS8A 3EJNA 5JHAA 2YINA 3PVLA 5KNGA 5AQBA 4Z68A 5DBKA 4WWPA 4L1BA 2F69A 4PH4B 4UQZA 4OVVA 4G2VA 3HVEB 4I6EA 2VGXB 3FU6A 2BEDA 3CK7A 5CECB 4DX7D 3BO5A 3VTXA 3VLFA 2AJAA 3SWCA 1OWOA 4LUNU 3ZYQA 3RSEG 3AU5A 3OPEA 2AVPA 4G11A 4L23A 2X6FA 4ANUA 1N94A 1KPSB 3IXEA 4N5CA 1S0PA 4PDXA 2IJGX 4GZ5A 4AEZC 4YDOA 2J07A 3D9JA 4JDSA 2Y0BG 4P29A 4AOFA 1H6KA 3B7UX 5FTPA 2C0LA 3C72A 5T5GA 2BF0X 3FY4A 4CDNA 3M56A 4G23A 2FI7A 2RKKA 2WXNA 1MX2A 2H6IA 3Q49B 3IHXA 3G2SA 4NACA 4TUMA 4JZYA 4GYOA 2FULA 1MVHA 3EHMA 1KZPA 2GRQB 2Q7FA 1IKND 3ESLA 4FC8A 1YYHA 2X6JA 4FLBA 1SA5A 3MA5A 2RFAA 4PS7A 5LCWC 1TNBA 3TAXA 1XGWA 4BTAA 5HRYA 1Y6IA 4U96D 2R3AA 4HI8A 3CVUA 5CMWA 4YPAA 4J8EA 4DRXE 4AXHA 1H2TC 5AQ9A 3GZ1A 3EU5A 3D9KA 3BG1B 1HE8A 4DI4A 2W5YA 5EN5D 4UI9J 4XKBA 3SFYA 3QWWA 2PNNA 4O6FA 2C0MA 1WM5A 5CCMA 1DCEA 3CHOA 3GW4A 2OVBA 2LSVA 2VQ2A 4CDRA 4EZJA 3ULQA 2EQXA 2XQ0A 3S7BA 1E7VA 3UM3A 2GRNB 5BXOA 1PAQA 3WXXA 4JEUA 1QZ2A 2IFUA 5ENQD 2MRIA 3TGOA 4B8AA 3MX3A 1QYMA 3HXDA 3M54A 4YPEA 4XIFA 4EZKA 4RSYA 3MZLB 2Y4TA 4J8YA 2EIJE 5FWQA 4YVQC 2XHEA 3ULEG 1YCSB 1O1SA 4U8VD 2ZIRA 5ENNA 4BSXA 2AXZA 1H0AA 4UWKA 2IEJA 5CPRB 1QBQA 4BFRA 1BPOA 3UPVA 1PC2A 3U64A 1NI1A 3U9WA 3NBNB 1K1AA 5CBNA 1YMPA 3EP0A 2UWJG 3QNKA 1NP7A 3CVXA 4LERA 2VSYA 4I17A 3Q9NC 2BKKB 2E2EA 2I2OA 4YDEA 3APCA 3CVNA 3KS2A 3B7SA 4J8OA 2XGOA 2X6HA 3CVLA 4JEHA 5TTFA 3OAWA 3O4ZA 5F59A 5CRUA 3L82A 2KCVA 4I2WA 3QC1A 4F7AA 1RZ4A 2M63A 3TWQA 2KCKA 3HIZA 4KZ0A 4AM9A 4GA2A 3OTNA 3PZ4A 2R59A 1JUQA 3RRMB 3HG0D 4BX8A 3UT8A 1TNYA 2YQ8A 1N6AA 5HI7A 5BV1A 3PS6A 4TV3A 4KVOA 3ONLA 3FWVA 4U95D 3PZ3A 3Q73A 2KXPC 1Z5SC 5B1AE 1JCSA 2X3MA 3G2WA 3JYSA 4CGWA 1OCRE 1OWNA 4BUPA 3DEOA 5KJKA 1O1TA 3UQ3A 3QKYA 2VYIA 2WXJA 2RD0A 3UKUG 3P1UA 2FEZA 5A6CA 3UXGA 1SQMA 4QEOA 3CKBA 4YNPA 1S70B 2VTBA 2QYUA 1OCZE 5BPPA 5D66A 1HXIA 5FT9A 3Q79A 3SF4A 3CHSA 3MGBA 1FPPA 5CEDB 3PREA 3PE3A 3PZDA 5F5EA 4GZDA 3ABLE 3ESKA 1Q2ZA 1HG5A 3WG7E 3FHEA 3FU0A 4C0EA 2WPVA 3CV0A 2I1JA 4I1AA 3M58A 3TWRA 3ZUVB 3QARA 3Q5MA 2XS1A 3M59A 1ML9A 4FA6A 4N2QA 3AG3E 3TWXA 3RO3A 3OOIA 3OS5A 3ASDA 1K3ZD 3ZYMA 5CBOA 4HBDA 1MVXA 3R7QA 3BU8A 4N3AA 5BT1A 2R05A 5G2NA 2WXRA 5AJDA 4GU5A 1N4PA 1X81A 2P9KG 4NVQA 1INZA 4U7EB 4MI5A 4BSZB 1UN8A 3F6QA 3RRNB 3APFA 3PDNA 1BU9A 4BT8A 2MOWA 3E4BA 3T8MA 4UWFA 1FT1A 2DZOA 4FU3A 1WG0A 4EHMA 3NF1A 4K0RA 3KMAA 1UJKA 5ITZF 2YNQA 2DZNA 3EIJA 4MLPA 3C98A 2B0OE 3SBTB 4IJ8A 3DSWA 3F9YA 2XPZA 3SQVA 4ACKA 2J8SD 1H3IA 5FINA 2J9QA 2OOEA 4DLQA 4ATZD 4QENA 4FULA 3TJPA 4C48B 3BQOA 4FP7A 3UM2A 2WQHA 4UWLA 1U2VG 2L6BA 1N6CA 4JL0A 4ZFHA 3LCAA 1ZB1A 4DUIA 3ENEA 3GZ2A 5AAOA 2R2LA 2LAIA 2B6CA 1JCRA 2G46A 1HX8A 1EF1C 3AG4E 4FJZA 4NRHB 3NQPA 3TXMA 5BW8C 5JJ7A 3VV0A 3CSFA 3B13A 2JLBA 3ZIMA 3RO2A 1E96B 3JUEA 3DB5A 2ONDA 2R02A 4J83A 4GYYA 2L0IA 2YHEA 4G25A 5KJNA 2VSXE 2VGEA 3OXLA 2QZAA 3SBSA 3CHRA 4ILHB 4RG9A 3PZ2A 5T0MA 2XEEA 5G04C 2GROB 3KEZA 3RJWA 3CVYA 3S2AA 3I5PA 2LXMA 2ETCA 4GMLA 1N4SA 4CT0A 1H2VC 2J08A 1E8XA 2JEKA 1UJJA 2WXPA 3SD5A 4C0MA 4YNMA 2GRLA 2VTBB 4I6GA 1S64A 5FQ7A 4WWOA 1N52A 1LF8A 1NFIE 2CHXA 4DX5D 1O9SA 5JIYA 2A4ZA 2XRYA 3R9AB 4HRLA 4AP2A 4GTTA 3MV3B 4Y6WA 4EPZA 3CK8A 4I9CA 2XGMA 1HFAA 2WQ7A 1FVFA 2F8XK 3CBOA 4XEIG 3L17A 1V54E 4BETA 3CQGB 4HOQA 3D3MA 5T4YA 3S7DA 2FO1E 1E7UA 4GPMA 4FHJA 3LVQE 3TWWA 1MX6A 5DIZA 4L7TA 4CRWA 3CVWA 5EG2A 2XPYA 2IO2C 4K5BA 4GA1A 1TJCA 4TXQA 3TWSA 3HXEA 3VLEA 4KBQA 1N3JA 1IYGA 1HZ4A 3IHVA 4ATGA 3PRZA 2X6IA 1SVXA 5FZSA 1ZKKA 3LS8A 3MV2B 4C9BB 3IKOB 1FVHA 4EECA 2E0IA 1SW6A 2KC7A 2IF4A 5EYLA 5LFAA 3D9OA 3LY8A 4DX6D 3FUEA 3ULYA 3KMJA 3QAQA 2F0YA 1ELKA 3ZPJA 5B1BE 4U0SA 4N2SA 3C3OA 3DSXA 1DC2A 4L2YA 4ME2A 3SFZA 4D10C 3FH7A 3FH8A 3VUZA 2GRRB 2KZTA 4A63B 3TWTA 3KSLA 1Z3XA 3I3NA 3V2XA 3QWPA 2VJ8A 2LNIA 2WMOA 4U63A 4JW1A 3LXUX 2F8YA 3FFLA 3UIPC 4FADA 2QPWA 2OEVA 3OXFA 1E8WA 3DSSA 2ILRA 2XZDG 4LNBA 3EDTB 2IONA 5KWDA 2PM6A 5CRVA 4GTQA 4KVMA 4MI0A 3ABME 2WXQA 4O1OA 4UWHA 5FQ8A 2BUGA 3T9KA 4WAFA 4HNAD 4BEPA 2AXUA 1ZBPA 3CK9A 3EUVA 1QNFA 3U3WA 4JXTA 3KD7A 3ABKE 4LEUA 5EX3A 3PEUB 4CYMD 1RW2A 5G05J 3CKCA 4K5CA 3B95A 3G2VA 2P9PG 4RZ0A 3LY7A 4DLOA 4HORA 1NL4A 1Z3YA 3AG2E 3Q47B 1MQSA 4AIFA 3SO8A 1TN6A 3U66A 4HOUA 5ENSD 2WQ6A 4GB9A 1YA0A 1TNOA 2R17C 4ANVA 3M57A 4J7FA 2WXMA 1SZ9A 3SY2A 4A55A 2XS8A 4APFA 5IY5E 2OEWA 5JJ6A 3UKRG 4J7IA 1JCQA 5D2MC 1HH8A 5BUZA 3CHMA 2XCBA 3ZHEA 2KM4A 2A5EA 1DVPA 3AG1E 2CHWA 4O30A 3SI5A 2LUHA 4ABNA 3URZA 2RFMA 1FT2A 1UN9A 4HRNA 5AENA 3T5XA 2HM8A 3CSTA 2NSZA 4HLLA 5BXUA 3Q75A 1IQRA 1NZNA 4H7XA 3FU5A 3LKUA 3ZRHA 3LJ3A 4J6IA 3CQCB 5FZQA 1AP7A 5T0KA 4FMUA 1XQHA 2P9IG 1WDYA 1OCOE 1OWLA 2WXGA 2NXPA 1TN7A 3E37A 2BKGA 1O1RA 4ILGA 2AXVA 4MRUA 4U04A 4UI9C 1FCHA 3ASHA 4M7CA 3SHFA 3RRUA 3F9WA 3UX4A 4GPKA 1N0QA 5E75A 5KJLA 3AU4A 3TL5A 2IU1A 4TRQA 3P2BA 4AY5A 4C1QA 3O48A 5CCLA 3X2QE 3DPDA 3RU0A 3TXNA 2QY7A 1HG2A 4E6HA 4GA0A 5TH7A 4NIKA 2EIKE 5FQ4A 3FUIA 1BI8B 2BTDA 4A3VA 5ARGA 4B0ZA 4LSZE 2V8SE 3AS5A 5TEGA 4X8QA 2IOSA 2KZTB 4OVUA 4I2ZA 4WNEA 4UI9K 5J90A 5EILA 3NZSA 3FTSA 4Y6CA 2Y69E 1NA0A 2I1KA 3E30A 4M3OA 3HXCA 4UQYA 1N4RA 4I1MA 2XENA 4JHRA 1Y8MA 3ASFA 4GTPA 4H7YA 1EDUA 2UY1A 5J08A 5C2YA 4MBGA 5KNHD 4A3TA 4XX5A 4JHKA 3D9MA 1H6OA 2WXHA 3CHPA 4EBAA 3BG0B 2WM9A 4TXRA 3CVQA 4AY6A 3DWLG 4B8CB 3AAAC 3UIOC 3W9FA 2ZGDA 4R7LA 4LCTA 1MYOA 3M5AA 5ANLA 1OT8A 2P2CP 2WMNA 3LY9A 4AU7A 2DBAA 3LPZA 4LNGA 3MO0A 3MCXA 1MX4A 4IN3B 3JQ1A 5F6KC 5D0OD 3IBEA 5HQ8A 2DYRE 2MYOA 2FBNA 2Y3AA 2P58C 5T3RA 3EHNA 3V2OA 4J8DA 3UT7A 1OXJA 3DSVA 2HE0A 1KLXA 4B94A 4B93B 4QFVA 5EDSA 4XI9A 3L22A 4JHJA 3V31A 5M72A 5AQAA 3FU3A 3S7FA 3F9ZA 4GZCA 3C5RA 1DCQA 1ELRA 1TEZA 3TWUA 3RKVA 1H2UA 3RK6A 3DSUA 3ZHEB 2P9NG 5FJYA 3JQ0A 2H6HA 2PQNA 2DWZA 1XNFA 1IHGA 3IHYA 1MT6A 3FTUA 3NOCD 4L9PA 1ZU2A 3I4GA 5A23A 1WAO1 1BD8A 3B7BA 5B3SE 3KMTA 3UMVA 1K8KG 2H6GA 1ELWA 1SA4A 3CVPA 3HHMA 3PUJA 1UW4B 1MHQA 4JD2G 3L6AA 3N71A 4GTOA 1UG3A 1SZAA 4XI0A 4G1TA 4WNFA 4E85A 4L2LA 4BT9A 3FUJA 3CBMA 4JA9A 4BX9A 4Q69A 3MO2A 1X5BA 1L5JA 2WXKA 4HFGA 5LSXA 2GGFA 4K5AB 4TXPA 3Q4AB 2KBXA 1MZCA 5JJ0A 3HXBA 2X38A 3JUIA 4GTRA 4HQDA 4U8YD 1V55E 2EIME 5BNWA 2L6JA 3FTWA 2GW1A 2I9CA 3K5KA 3CEQA 3ZGQA 3G2UA 1G3NB 3L16A 2Y1LE 2XZTG 2ETBA 1TNUA 4Q96A 4HI9A 1Z6TA 2P9LG 4FHKA 4NJ5A 1IXVA 4ANXA 4ACLA 1B89A 3D9LA 3FUMA 3FUKA 2J49A 4GTVA 5LP0A 5LCWJ 4I43A 3QDNA 2PL2A 3HXFA 5ENTD 3L13A 5LOZA 2R03A 4GTSA 3ZW3A 3RIBA 5AN8A 3TWVA 3HYMB 2UY1B 2R5SA 3DXKG 2XPIA 3ML9A 5KJMA 3FUHA 1JPLA 5E76A 5JINA 1NA3A 2OV8A 5LSZA 3MKRA 3FTYA 2LO6A 2H6FA 4HRMB 4CZ2D 1N0RA 4OYSA 4Q94A 3SZ7A 1IQUA 2XEVA 1E90A 3JCKC 5EIDA 3ONKA 3VLDA 2QFCA 3ASOE 3RAYA 4KXKB 4GYWA 2XRZA 3L9TA 4I9EA 3V30A 4BWRA 2ZU6B 2WB2A 4HOTA 1P5QA 2IY0C 4GTMA 3BUAA 5CMYA 5JHNA 2C2LA 4GMRA 3E34A 5JMND 3J5QB 3S7JA 2A5UA 2GRMA 2WXLA 5AJLA 4N3CA 5CHEE 4U0UA 4YDYA 1D8EA 3DRAA 3K9IA 3EHQA 3RJVA 4NQ0A 3VTYA 4GCOA 3APDA 3D9PA 3SGHA 3MEKA 4OAUC 3AJIA 3LEWA 5HS0A 4PUCA 4OAVB 3SNXA 2KCLA 4HLEA 4N5QA 3ZEFA 3GYZA 2AW6A 4YVOA 3LVRE 5ENRD 2RG8A 3UUXA 4RQIA 4LG6A 1HS6A 3B7RL 1HO8A 3UINC 3QK0A 3CBPA 1IHBA 2L9BA 3Q15A 2PZIA 3JXIA 4JA7A 4AV7A 5ENPD 4CEMA 4GCNA 2LAHA 1GW6A 4QQIA 1KT1A 4APOA 3LJNA 2RFIA 3V79K 4BTBA 3CHQA 4J0UA 2DVWA 2CG3A 3D9HA 4J8FA 4F3VA 3DBSA 1N11A 3ZNGA 4UQXA 4CT4A 1HU3A 3NAWA 3PUKA 3SW9A 1BI7B 2WXIA 3FP3A 3RQ4A 3CIAA 2O8JA 1N4QA 4I1OB 4U07A 1A5EA 3D9NA 3DEPA 2NYJA 5EYPF 2J4DA 3AS8A 4HS2A 3KAEA 3M55A 3ASGA 1N9AA 4F53A 1K1BA 3MJWA 2OVFA 4O60A 2MHKA 2J09A 2V0PA 3DXMG 4A1GA 4E47A 3CLJA 3FUNA 5H7PA 4A1SA 4HVBA 3QWVA 1OY3D 4I6JA 3AS4A 2KATA 3UT4A 1OCCE 3FH5A 3L54A 2LSUA 2VSNA 3F9XA 2P9UG 4RLYA 3FTZA 3FTXA 4UWGA 4YNDA 2NC9A 1WY6A 3C3QA 3U4TA 2FO7A 3G2TA 1VDYA 3Q7AA 3I4RB 1PEGA 3BEEA 5AQ7A 4N3BA 1TJFA 3Q7FA 3L08A 2I6HA 1A17A 5FQ6A 2IGQA 4CDMA 1LD7A
chains in the Genus database with same CATH topology
3CHRA 4ILHB 4RG9A 4BTAA 1EPUA 3MKQA 5T0MA 1KT0A 4IN3B 5G04C 3JQ1A 3DALA 3KEZA 5T8IA 5F6KC 5D0OD 3CVYA 1Y6IA 3IBEA 3S2AA 5HQ8A 5LX8A 3I5PA 2R3AA 3RJWA 4DPRA 3CVUA 4GMLA 2FBNA 4CT0A 1H2VC 2J08A 1E8XA 2JEKA 2Y3AA 4DI3A 5CMWA 1UJJA 2P58C 2WXPA 3EHNA 5T3RA 3SD5A 4J8DA 3UT7A 4YPUA 4QEPA 4C0MA 4YNMA 4YPAA 3FDHA 1E8YA 1KLXA 2GRLA 4J8EA 4QFVA 4B94A 4I6GA 2VTBB 4AVXA 5EDSA 4XI9A 3L22A 4JHJA 5FQ7A 5M72A 4AXHA 1H2TC 3FTVA 3FU3A 3S7FA 4K03A 3F9ZA 4WWOA 2CFZA 4GZCA 1N52A 1LF8A 3MYVA 4FJYA 2CHXA 3GZ1A 1ELRA 1TEZA 3D9KA 1JWGA 1O9SA 3RKVA 3BG1B 5JIYA 2A4ZA 2XRYA 1HE8A 1H2UA 3R9AB 3CGHA 3RK6A 4WNDA 3ZHEB 4DI4A 2W5YA 4AP2A 1EYHA 4GZ3A 4UI9J 3MV3B 4Y6WA 4XKBA 3QWWA 5FJYA 2HO1A 4EPZA 3JQ0A 4O6FA 4WUYA 3CK8A 4I9CA 2C0MA 2XGMA 1WM5A 1HFAA 2PQNA 1FVFA 2WQ7A 5CCMA 4URKA 1XNFA 1IHGA 3IHYA 1MT6A 3CBOA 3CHOA 3GW4A 3L17A 3FTUA 4G26A 4EZLA 3CQGB 5G05C 4HOQA 3D3MA 5T4YA 1ZU2A 2YHCA 2OVBA 3I4GA 2LSVA 2VQ2A 4HXIA 4EBAG 3CVVA 5A23A 1OUVA 3S7DA 4CDRA 4EZJA 3ZYLA 1WAO1 1E7UA 2EQXA 3ULQA 4FHJA 3LVQE 4JC8A 3KMTA 3UMVA 2XQ0A 4DK5A 2HYZA 3S7BA 1E7VA 5DIZA 4L7TA 4GMJA 3S8PA 3TAXA 1PAQA 2HR2A 1ELWA 4CRWA 3CVWA 3WXXA 4HOSA 3CVPA 3HHMA 3PUJA 1UW4B 1MHQA 5EG2A 3L6AA 4JEUA 3LYAA 3N71A 4CGVA 4KZCA 1QZ2A 2XPYA 1UG3A 1W3BA 3ZYKA 2IFUA 4XKCA 1SZAA 3FEYA 4XI0A 2XGSA 4G1TA 3PE4A 4WNFA 4E85A 4GA1A 1TJCA 4L2LA 4BT9A 3VLEA 2WXOA 5FZRA 3FUJA 4KBQA 3MO5A 2MRIA 3TGOA 4JA9A 4BX9A 4Q69A 1N3JA 3CBMA 4B8AA 3MX3A 1IYGA 1HZ4A 4GZ6A 3IHVA 4ATGA 3MO2A 1X5BA 2V5FA 3M54A 1L5JA 4YPEA 2WXKA 4U8HA 5ARFA 4HFGA 5LSXA 3PRZA 2GGFA 2X6IA 4XIFA 5FZSA 4EZKA 4CCAA 1ZKKA 3LS8A 3Q4AB 4H12A 3MV2B 4RSYA 4C9BB 5JJ0A 3F9WA 2X38A 3IKOB 3MZLB 1FVHA 3CR3A 3TG5A 2Y4TA 4WNGA 5FWQA 3JUIA 4EECA 2E0IA 2W5ZA 4IRUA 2KC7A 5C1DA 4YVQC 2IF4A 5LFAA 3NZUA 5BNWA 3D9OA 2XHEA 3LY8A 2L6JA 4XE0A 3FUEA 4RG6A 3FTWA 2GW1A 3KMJA 3QAQA 2I9CA 3QB2A 5ENNA 4BSXA 2JV0A 2AXZA 1ELKA 1H0AA 4UWKA 3ZPJA 3K5KA 2FF4A 4U0SA 4N2SA 3HVEA 3CEQA 4FLHA 4BFRA 5CPRB 1QQEA 1BPOA 3ZGQA 3UPVA 2VGXA 1PC2A 3G2UA 5D0QD 4EQFA 3L16A 2WVIA 5A7DB 3IEGA 3U64A 4L2YA 4ME2A 3U9WA 2DIWA 1JWFA 3ZFWA 4Q96A 3ML8A 4B89A 4F1SA 1N54A 3EP0A 3M53A 2UWJG 5JJTA 3SFZA 4D10C 4GAAA 1Z6TA 3FH7A 3QNKA 3FH8A 1NP7A 3VUZA 3CVXA 4FHKA 4LERA 2VSYA 4NJ5A 4I17A 2KZTA 4JLGA 2E2EA 1Z3XA 2I2OA 3I3NA 4ANXA 4ACLA 1B89A 3D9LA 3FUMA 2CFUA 3APCA 3FUKA 3ZXSA 1E8ZA 2J4BA 4ANWA 3CVNA 3KS2A 2J49A 2VSOE 4J8SA 5LP0A 5LCWJ 4I43A 3B7SA 3QDNA 3QWPA 4J8OA 2VJ8A 3IV0A 2LNIA 2PL2A 2WMOA 2X6HA 2XGOA 4U63A 2X6KA 4JW1A 3CVLA 3LXUX 3QJZA 4JEHA 3L13A 5LOZA 3FFLA 3OAWA 5TTFA 2IQCA 5G04J 3O4ZA 2V4LA 5F59A 4FADA 2QPWA 2KCVA 4I2WA 3OXFA 1E8WA 3LDZA 3QC1A 4IULA 2ILRA 4N39A 4F7AA 3ZW3A 3RIBA 3EDTB 2IONA 2M63A 3HYMB 3ZVVA 2PM6A 2UY1B 3HDXA 4XZ4A 2PQRA 3HNAA 2R5SA 2KCKA 3HIZA 4KZ0A 4AM9A 2CG2A 3D9IA 4GA2A 3OTNA 4G24A 4KVMA 4MI0A 4PS3A 4Z4PA 5BV0A 1HF8A 2XPIA 2R59A 3ML9A 2WXQA 5KJMA 1JUQA 3RRMB 4UWHA 5FQ8A 4BY6A 4BX8A 3FUHA 2BUGA 3UT8A 1JPLA 5E76A 4WAFA 4V3IA 5JINA 1NA3A 2OV8A 4DJAA 2AXUA 1ZBPA 2YQ8A 2WXFA 3CK9A 1N6AA 5LSZA 1QNFA 5HI7A 3U3WA 4JXTA 3KD7A 3MKRA 3FTYA 4LEUA 5EX3A 2BQZA 5BV1A 2LO6A 3QOUA 3PS6A 4TV3A 3PEUB 1DNPA 4KVOA 3ONLA 1U3DA 3FWVA 5G05J 2AWIA 5ANRA 3CKCA 5G55A 4LDGA 4OYSA 4Q94A 3G2VA 2IOLA 4KMOA 3SZ7A 1IQUA 4RZ0A 3LY7A 4DLOA 1OWMA 4HORA 1Z3YA 2X3MA 3Q47B 1MQSA 3G2WA 3JYSA 4AIFA 4CGWA 3U66A 2XEVA 1OWNA 1E90A 4HOUA 3JCKC 3VLDA 3ONKA 4BUPA 2WQ6A 2QFCA 2DCPA 5AYFA 3RAYA 4KXKB 4GYWA 5KJKA 2XRZA 3UQ3A 4IYPA 4GB9A 3QKYA 3MKQB 2VYIA 2WXJA 1YA0A 2VGYA 5EX0A 2R17C 2RD0A 3P1UA 4I9EA 2FEZA 5AYWD 3PNLB 4ANVA 5A6CA 3M57A 1SQMA 4J7FA 3CKBA 4QEOA 4YNPA 4BWRA 2WXMA 2ZU6B 2VTBA 1SZ9A 3PNTB 3TG4A 4A55A 2WB2A 4HOTA 4U0ZA 1P5QA 4APFA 5BPPA 3GZSA 5JJ6A 1HXIA 5FT9A 4J7IA 2Y4UA 5CMYA 5JHNA 4RVBA 1HH8A 2C2LA 3FPDA 5BUZA 3SF4A 3CHMA 3CHSA 2XCBA 3ZHEA 2KM4A 3T5VA 1OWPA 2PM7A 3MGBA 3R7RA 4AJWA 3S7JA 3PREA 2A5UA 3PE3A 3PZDA 2GRMA 2WXLA 5AJLA 4N3CA 4IJDA 5F5EA 1DVPA 3OXGA 4GZDA 3FUDA 2CHWA 4O30A 3ESKA 5CHEE 3SI5A 1HG5A 4U0UA 3FHEA 4ABNA 3FU0A 3URZA 4C0EA 3K9IA 2WPVA 3RJVA 3CV0A 2I1JA 4I1AA 5KCMA 3M58A 5JHBA 1UN9A 4NQ0A 3VTYA 4GCOA 2CHZA 3FUFA 5AENA 3PH0C 3QARA 3APDA 3D9PA 3Q5MA 3SGHA 3MEKA 3T5XA 3M59A 1ML9A 4FA6A 2HM8A 3CSTA 2NSZA 4N2QA 4MKTA 3OOIA 3RO3A 3LEWA 3OS5A 1MUFA 4WWNA 4PUCA 4I51A 3ASDA 3SNXA 1IQRA 2KCLA 1NZNA 4H7XA 4HLEA 3ZEFA 3FU5A 3LKUA 3GYZA 3ZRHA 3LJ3A 4JVSA 2AW6A 3ZN3A 4ILIA 3ZYMA 4J6IA 4NURA 3CQCB 5FZQA 1MVXA 4TUUA 4YVOA 3LVRE 3R7QA 4N3AA 2RG8A 5BT1A 5T0KA 3UUXA 4FMUA 5G2NA 2WXRA 2XCCA 3B7TA 4KYOB 1HS6A 1PY1A 5AJDA 1H19A 3EIQC 1XQHA 3B7RL 4GU5A 1HO8A 4MS6A 1OWLA 2WXGA 2NXPA 5EKQD 4JPSA 3QK0A 5AIJA 2L0TB 3CBPA 4NVQA 3PEVB 1INZA 3FULA 4MI5A 2L9BA 3Q15A 4ILGA 1UN8A 2AXVA 1U3CA 2PZIA 3RRNB 4MRUA 3APFA 4U04A 4JA7A 4UI9C 4AV7A 1FCHA 4CEMA 4GCNA 2LAHA 1GW6A 3ASHA 1KT1A 3PDNA 4KT6B 4APOA 3FEXA 4W9RA 5F6LA 4LRZA 2RFIA 4BTBA 3CHQA 4J0UA 3SHFA 2CG3A 4BT8A 2MOWA 3E4BA 4UWFA 3RRUA 4FU3A 4J8FA 3EJNA 4PS8A 3DBSA 3T8MA 3UX4A 4F3VA 5JHAA 4GPKA 3NF1A 2YINA 5E75A 3PVLA 5KJLA 3AU4A 4K0RA 3KMAA 1UJKA 2YNQA 3TL5A 2IU1A 4TRQA 5DBKA 3P2BA 4WWPA 4L1BA 4UQXA 4CT4A 4AY5A 2F69A 1HU3A 4PH4B 4UQZA 3PUKA 4OVVA 4G2VA 4C1QA 3HVEB 3O48A 3SW9A 5CCLA 2WXIA 3EIJA 4I6EA 2VGXB 3FP3A 4MLPA 3RQ4A 3CIAA 3C98A 2O8JA 3DPDA 3RU0A 4I1OB 3TXNA 2QY7A 3FU6A 4U07A 3CK7A 1HG2A 4E6HA 3D9NA 3SBTB 4GA0A 3BO5A 4IJ8A 3VTXA 5TH7A 3VLFA 3F9YA 2XPZA 5FQ4A 3FUIA 2BTDA 4A3VA 3SWCA 5ARGA 4B0ZA 1OWOA 4ACKA 2V8SE 2J4DA 3AS8A 3AS5A 5TEGA 4LUNU 4HS2A 2IOSA 3ZYQA 1H3IA 3KAEA 2J9QA 3ASGA 3M55A 2KZTB 2OOEA 3AU5A 4DLQA 4F53A 2AVPA 4OVUA 4I2ZA 3OPEA 4QENA 3MJWA 2OVFA 4WNEA 2MHKA 4UI9K 5J90A 4FULA 3NZSA 4G11A 2J09A 4L23A 2X6FA 2V0PA 3FTSA 3TJPA 4ANUA 4Y6CA 4A1GA 4FP7A 1NA0A 2I1KA 4N5CA 4M3OA 4E47A 2WQHA 3CLJA 4UWLA 3FUNA 4UQYA 1S0PA 1N6CA 4I1MA 4PDXA 4A1SA 4JHRA 4JL0A 2IJGX 3LCAA 1Y8MA 3QWVA 4GZ5A 4HVBA 4AEZC 3ASFA 4H7YA 1EDUA 4I6JA 3AS4A 2UY1A 3ENEA 2KATA 3UT4A 3GZ2A 2J07A 5J08A 3FH5A 3L54A 5C2YA 3D9JA 2LSUA 4JDSA 4P29A 2VSNA 4AOFA 2LAIA 4A3TA 3F9XA 4XX5A 2G46A 4JHKA 3D9MA 1H6KA 3B7UX 1HX8A 2C0LA 2WXHA 3FTZA 3FTXA 5FTPA 3CHPA 1EF1C 4UWGA 4YNDA 4FJZA 5T5GA 2BF0X 1WY6A 2NC9A 3BG0B 4NRHB 4EBAA 2WM9A 3FY4A 3NQPA 3U4TA 4CDNA 3M56A 4G23A 2FO7A 3CVQA 3TXMA 5BW8C 2FI7A 4AY6A 3G2TA 2WXNA 5JJ7A 3VV0A 4B8CB 3Q49B 3IHXA 3G2SA 4NACA 1VDYA 3CSFA 3B13A 2JLBA 3I4RB 3ZIMA 3RO2A 1E96B 4JZYA 4GYOA 2FULA 3DB5A 4R7LA 1MVHA 2ONDA 4LCTA 4J83A 3M5AA 1PEGA 3EHMA 3BEEA 2Q7FA 5ANLA 3ESLA 4N3BA 4FC8A 2X6JA 1TJFA 2WMNA 4FLBA 3LY9A 2L0IA 2YHEA 3MA5A 3L08A 4G25A 4GYYA 2I6HA 5KJNA 2DBAA 2VSXE 3OXLA 4PS7A 4AU7A 3LPZA 1A17A 5FQ6A 5LCWC 2IGQA 4CDMA 3MO0A 3MCXA 1XGWA 3SBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG9 A;  4BTA A;  5T0M A;  1KT0 A;  4IN3 B;  5G04 C;  3DAL A;  5F6K C;  5D0O D;  3RJW A;  5HQ8 A;  2R3A A;  2FBN A;  2P58 C;  4YPU A;  4J8D A;  4QEP A;  4YNM A;  4YPA A;  4J8E A;  1KLX A;  4B94 A;  4XI9 A;  5M72 A;  3S7F A;  3F9Z A;  3GZ1 A;  1ELR A;  1O9S A;  3RKV A;  5JIY A;  3R9A B;  4WND A;  3ZHE B;  2W5Y A;  4GZ3 A;  4UI9 J;  3MV3 B;  4Y6W A;  3QWW A;  5FJY A;  2HO1 A;  4O6F A;  4WUY A;  3CK8 A;  4I9C A;  2C0M A;  2XGM A;  1WM5 A;  2PQN A;  5CCM A;  1XNF A;  1IHG A;  1MT6 A;  3CBO A;  3GW4 A;  4G26 A;  5G05 C;  4HOQ A;  1ZU2 A;  2YHC A;  2LSV A;  2VQ2 A;  1OUV A;  3S7D A;  4CDR A;  1WAO 1;  3ULQ A;  3KMT A;  2HYZ A;  3S7B A;  5DIZ A;  3S8P A;  2HR2 A;  1ELW A;  4HOS A;  3WXX A;  3CVP A;  5EG2 A;  3LYA A;  3N71 A;  4CGV A;  1QZ2 A;  1W3B A;  2IFU A;  4XI0 A;  2XGS A;  4G1T A;  3PE4 A;  4WNF A;  4GA1 A;  1TJC A;  4BT9 A;  5FZR A;  4KBQ A;  3MO5 A;  3CBM A;  3TGO A;  4JA9 A;  1N3J A;  1IYG A;  1HZ4 A;  4GZ6 A;  3MO2 A;  2V5F A;  3M54 A;  4YPE A;  5ARF A;  5LSX A;  4XIF A;  5FZS A;  1ZKK A;  4H12 A;  3Q4A B;  3MV2 B;  5JJ0 A;  3TG5 A;  2Y4T A;  4WNG A;  2W5Z A;  2KC7 A;  5C1D A;  4YVQ C;  2IF4 A;  5BNW A;  3LY8 A;  2L6J A;  4RG6 A;  2GW1 A;  3KMJ A;  2JV0 A;  3K5K A;  3ZPJ A;  2FF4 A;  4U0S A;  4N2S A;  5CPR B;  3CEQ A;  1QQE A;  3ZGQ A;  3UPV A;  2VGX A;  1PC2 A;  5D0Q D;  4EQF A;  5A7D B;  3IEG A;  4ME2 A;  3ZFW A;  3M53 A;  3EP0 A;  2UWJ G;  5JJT A;  3VUZ A;  2VSY A;  4NJ5 A;  4I17 A;  4JLG A;  2E2E A;  1B89 A;  3CVN A;  3KS2 A;  5LCW J;  3QDN A;  3QWP A;  4J8O A;  2LNI A;  2PL2 A;  2XGO A;  3CVL A;  5TTF A;  3FFL A;  5G04 J;  5F59 A;  2QPW A;  2KCV A;  4I2W A;  3OXF A;  4N39 A;  3RIB A;  3EDT B;  3HYM B;  2UY1 B;  2PQR A;  3HNA A;  2R5S A;  2KCK A;  4AM9 A;  4GA2 A;  4G24 A;  4MI0 A;  4Z4P A;  2XPI A;  5KJM A;  2BUG A;  5JIN A;  1NA3 A;  1ZBP A;  2YQ8 A;  3CK9 A;  1N6A A;  5LSZ A;  3U3W A;  5HI7 A;  4LEU A;  3KD7 A;  3MKR A;  5EX3 A;  2BQZ A;  3QOU A;  3FWV A;  5G05 J;  3CKC A;  4LDG A;  3SZ7 A;  4RZ0 A;  3LY7 A;  4HOR A;  3Q47 B;  3JYS A;  4AIF A;  4CGW A;  2XEV A;  4HOU A;  4BUP A;  2QFC A;  5AYF A;  3RAY A;  4KXK B;  4GYW A;  5KJK A;  3UQ3 A;  3QKY A;  2VYI A;  1YA0 A;  2VGY A;  5EX0 A;  4I9E A;  2FEZ A;  5AYW D;  5A6C A;  3M57 A;  4J7F A;  3CKB A;  4QEO A;  4YNP A;  4BWR A;  3TG4 A;  4HOT A;  4U0Z A;  1P5Q A;  5JJ6 A;  1HXI A;  5FT9 A;  4J7I A;  2Y4U A;  5JHN A;  2C2L A;  1HH8 A;  3FPD A;  3SF4 A;  2XCB A;  3ZHE A;  3S7J A;  3PE3 A;  4N3C A;  4IJD A;  5F5E A;  3OXG A;  4O30 A;  3ESK A;  5CHE E;  4U0U A;  4ABN A;  3URZ A;  3K9I A;  2WPV A;  3RJV A;  3CV0 A;  4I1A A;  3M58 A;  4NQ0 A;  3VTY A;  4GCO A;  3Q5M A;  3MEK A;  3M59 A;  1ML9 A;  4N2Q A;  3OOI A;  3RO3 A;  3OS5 A;  1MUF A;  4I51 A;  3ASD A;  2KCL A;  1NZN A;  4H7X A;  3LKU A;  3GYZ A;  3ZN3 A;  1MVX A;  5FZQ A;  4YVO A;  4N3A A;  5BT1 A;  5T0K A;  3UUX A;  4FMU A;  2XCC A;  4KYO B;  1XQH A;  5EKQ D;  3CBP A;  4NVQ A;  4MI5 A;  3Q15 A;  2PZI A;  4U04 A;  4JA7 A;  4UI9 C;  1FCH A;  4GCN A;  3ASH A;  1KT1 A;  4APO A;  3PDN A;  4W9R A;  5F6L A;  2RFI A;  4BTB A;  4J0U A;  4BT8 A;  3E4B A;  3F9W A;  4J8F A;  4F3V A;  4GPK A;  3NF1 A;  5KJL A;  3KMA A;  5DBK A;  4UQX A;  2F69 A;  4AY5 A;  4UQZ A;  4C1Q A;  4G2V A;  3O48 A;  3SW9 A;  5CCL A;  2VGX B;  3FP3 A;  3RQ4 A;  2O8J A;  3RU0 A;  4U07 A;  3CK7 A;  3BO5 A;  4GA0 A;  4IJ8 A;  3VTX A;  5TH7 A;  3F9Y A;  3SWC A;  5ARG A;  3AS8 A;  3AS5 A;  5TEG A;  1H3I A;  3KAE A;  2J9Q A;  3ASG A;  3M55 A;  2OOE A;  3OPE A;  2AVP A;  4I2Z A;  4QEN A;  4WNE A;  2MHK A;  4UI9 K;  4Y6C A;  1NA0 A;  4E47 A;  4N5C A;  2WQH A;  4UQY A;  1N6C A;  4A1S A;  4JHR A;  4JL0 A;  3LCA A;  4GZ5 A;  1Y8M A;  3QWV A;  3ASF A;  4H7Y A;  3AS4 A;  2UY1 A;  2KAT A;  3GZ2 A;  2LSU A;  4JDS A;  2VSN A;  3F9X A;  2G46 A;  5FTP A;  2C0L A;  4YND A;  5T5G A;  2NC9 A;  4NRH B;  3U4T A;  3M56 A;  4G23 A;  2FO7 A;  3CVQ A;  5BW8 C;  2FI7 A;  4AY6 A;  5JJ7 A;  3VV0 A;  3Q49 B;  3IHX A;  2JLB A;  3RO2 A;  1E96 B;  4GYO A;  3DB5 A;  1MVH A;  2OND A;  4J83 A;  3M5A A;  1PEG A;  3BEE A;  2Q7F A;  4N3B A;  3LY9 A;  3MA5 A;  4GYY A;  4G25 A;  5KJN A;  2I6H A;  4AU7 A;  2DBA A;  3OXL A;  3LPZ A;  1A17 A;  5LCW C;  2IGQ A;  3MO0 A;  3TAX A; 
#chains in the Genus database with same CATH topology
 4DX1 A;  1EPU A;  3MKQ A;  1KT0 A;  3DAL A;  5T8I A;  3RAU A;  5LX8 A;  3KEA A;  4DPR A;  4ZHB A;  1LD8 A;  2F37 A;  4DI3 A;  4YPU A;  4QEP A;  1LTX A;  3FDH A;  1E8Y A;  3UI2 A;  4DX2 A;  5KBA A;  4AVX A;  3FTV A;  4K03 A;  1N95 A;  2CFZ A;  2DYS E;  1O5M A;  3UM0 A;  3MYV A;  4FJY A;  3NB2 A;  4F6R D;  1JWG A;  3PZ1 A;  3EHR A;  3CGH A;  4WND A;  1EYH A;  4GZ3 A;  2HO1 A;  4WUY A;  1H6P A;  4URK A;  4G26 A;  4EZL A;  5G05 C;  2YHC A;  3Q78 A;  4EBA G;  4HXI A;  3CVV A;  1OUV A;  4JB8 P;  3ZYL A;  4JC8 A;  4DK5 A;  2HYZ A;  3W9G A;  4GMJ A;  3S8P A;  2HR2 A;  2XEH A;  4HOS A;  5AAR A;  2ZGG A;  3LYA A;  3NOG D;  4CGV A;  4KZC A;  1S63 A;  1W3B A;  2QYJ A;  3ZYK A;  4XKC A;  3E33 A;  3FEY A;  2XGS A;  3KSQ A;  3PE4 A;  2LXL A;  2WXO A;  5FZR A;  3MO5 A;  2JAB A;  4HB5 A;  3ZKJ A;  4GZ6 A;  5CEA A;  1D8D A;  2V5F A;  4U8H A;  2EIN E;  5ARF A;  4CCA A;  2V5Q C;  4H12 A;  3ASN E;  5FIO A;  3CR3 A;  3TG5 A;  4WNG A;  2W5Z A;  4IRU A;  5C1D A;  3NZU A;  3DST A;  4XE0 A;  4RG6 A;  4UUC A;  4BES A;  2EIL E;  3QB2 A;  2ZXW E;  3ISM C;  2JV0 A;  2FF4 A;  3HVE A;  4FLH A;  1QQE A;  4J7W A;  2VGX A;  4G8K A;  5D0Q D;  4EQF A;  2WVI A;  2V4H C;  5A7D B;  3IEG A;  2DIW A;  1JWF A;  3ZFW A;  3ML8 A;  4B89 A;  4F1S A;  1N54 A;  3M53 A;  5JJT A;  4GAA A;  4O1P A;  4JLG A;  2CFU A;  5JA4 D;  3ZXS A;  1E8Z A;  2J4B A;  4ANW A;  2ETA A;  4YDW A;  3DPY A;  2VSO E;  4J8S A;  3R9M A;  3IV0 A;  2QC9 A;  2X6K A;  1UOH A;  3QJZ A;  2IQC A;  5G04 J;  2V4L A;  3LDZ A;  1BLX B;  3Q9U C;  4IUL A;  4N39 A;  1AWC B;  2GRP B;  3E32 A;  3ZVV A;  4XZ4 A;  3HDX A;  3EU9 A;  2PQR A;  3HNA A;  2CG2 A;  3D9I A;  4G24 A;  4PS3 A;  4Z4P A;  5BV0 A;  1HF8 A;  2ZIS A;  3HRA A;  4BY6 A;  5ENO D;  4BER A;  4V3I A;  4DJA A;  2WXF A;  2BQZ A;  1MJ0 A;  3QOU A;  5HKP A;  3C3R A;  1DNP A;  1U3D A;  2AWI A;  5ANR A;  5G55 A;  4LDG A;  3JXJ A;  2IOL A;  4KMO A;  1OWM A;  3UM1 A;  2DCP A;  5AYF A;  4IYP A;  3MKQ B;  2VGY A;  5EX0 A;  5AYW D;  3PNL B;  3PNT B;  3TG4 A;  4U0Z A;  4F1P A;  3GZS A;  2Y4U A;  4RVB A;  3FPD A;  3UTM A;  3ZXP A;  3T5V A;  1TR4 A;  1OWP A;  2PM7 A;  3R7R A;  4AJW A;  2P9S G;  4IJD A;  3OXG A;  3FUD A;  5EIB E;  1TN8 A;  5KCM A;  5JHB A;  3SFX A;  5CER B;  2CHZ A;  3FUF A;  3PH0 C;  4MKT A;  1MUF A;  3J5P A;  4WWN A;  4I51 A;  2OCC E;  1KZO A;  3ZN3 A;  4JVS A;  4ILI A;  2IO3 C;  4NUR A;  1TNZ A;  4TUU A;  4G8L A;  2XCC A;  3B7T A;  3T8K A;  4KYO B;  1PY1 A;  1H19 A;  3EIQ C;  4MS6 A;  5EKQ D;  4JPS A;  5AIJ A;  2L0T B;  3PEV B;  3FUL A;  1U3C A;  1TYQ G;  4KT6 B;  4LNU D;  1D9S A;  3FEX A;  4W9R A;  5F6L A;  4LRZ A;  3ZU7 B;  4PS8 A;  3EJN A;  5JHA A;  2YIN A;  3PVL A;  5KNG A;  5AQB A;  4Z68 A;  5DBK A;  4WWP A;  4L1B A;  2F69 A;  4PH4 B;  4UQZ A;  4OVV A;  4G2V A;  3HVE B;  4I6E A;  2VGX B;  3FU6 A;  2BED A;  3CK7 A;  5CEC B;  4DX7 D;  3BO5 A;  3VTX A;  3VLF A;  2AJA A;  3SWC A;  1OWO A;  4LUN U;  3ZYQ A;  3RSE G;  3AU5 A;  3OPE A;  2AVP A;  4G11 A;  4L23 A;  2X6F A;  4ANU A;  1N94 A;  1KPS B;  3IXE A;  4N5C A;  1S0P A;  4PDX A;  2IJG X;  4GZ5 A;  4AEZ C;  4YDO A;  2J07 A;  3D9J A;  4JDS A;  2Y0B G;  4P29 A;  4AOF A;  1H6K A;  3B7U X;  5FTP A;  2C0L A;  3C72 A;  5T5G A;  2BF0 X;  3FY4 A;  4CDN A;  3M56 A;  4G23 A;  2FI7 A;  2RKK A;  2WXN A;  1MX2 A;  2H6I A;  3Q49 B;  3IHX A;  3G2S A;  4NAC A;  4TUM A;  4JZY A;  4GYO A;  2FUL A;  1MVH A;  3EHM A;  1KZP A;  2GRQ B;  2Q7F A;  1IKN D;  3ESL A;  4FC8 A;  1YYH A;  2X6J A;  4FLB A;  1SA5 A;  3MA5 A;  2RFA A;  4PS7 A;  5LCW C;  1TNB A;  3TAX A;  1XGW A;  4BTA A;  5HRY A;  1Y6I A;  4U96 D;  2R3A A;  4HI8 A;  3CVU A;  5CMW A;  4YPA A;  4J8E A;  4DRX E;  4AXH A;  1H2T C;  5AQ9 A;  3GZ1 A;  3EU5 A;  3D9K A;  3BG1 B;  1HE8 A;  4DI4 A;  2W5Y A;  5EN5 D;  4UI9 J;  4XKB A;  3SFY A;  3QWW A;  2PNN A;  4O6F A;  2C0M A;  1WM5 A;  5CCM A;  1DCE A;  3CHO A;  3GW4 A;  2OVB A;  2LSV A;  2VQ2 A;  4CDR A;  4EZJ A;  3ULQ A;  2EQX A;  2XQ0 A;  3S7B A;  1E7V A;  3UM3 A;  2GRN B;  5BXO A;  1PAQ A;  3WXX A;  4JEU A;  1QZ2 A;  2IFU A;  5ENQ D;  2MRI A;  3TGO A;  4B8A A;  3MX3 A;  1QYM A;  3HXD A;  3M54 A;  4YPE A;  4XIF A;  4EZK A;  4RSY A;  3MZL B;  2Y4T A;  4J8Y A;  2EIJ E;  5FWQ A;  4YVQ C;  2XHE A;  3ULE G;  1YCS B;  1O1S A;  4U8V D;  2ZIR A;  5ENN A;  4BSX A;  2AXZ A;  1H0A A;  4UWK A;  2IEJ A;  5CPR B;  1QBQ A;  4BFR A;  1BPO A;  3UPV A;  1PC2 A;  3U64 A;  1NI1 A;  3U9W A;  3NBN B;  1K1A A;  5CBN A;  1YMP A;  3EP0 A;  2UWJ G;  3QNK A;  1NP7 A;  3CVX A;  4LER A;  2VSY A;  4I17 A;  3Q9N C;  2BKK B;  2E2E A;  2I2O A;  4YDE A;  3APC A;  3CVN A;  3KS2 A;  3B7S A;  4J8O A;  2XGO A;  2X6H A;  3CVL A;  4JEH A;  5TTF A;  3OAW A;  3O4Z A;  5F59 A;  5CRU A;  3L82 A;  2KCV A;  4I2W A;  3QC1 A;  4F7A A;  1RZ4 A;  2M63 A;  3TWQ A;  2KCK A;  3HIZ A;  4KZ0 A;  4AM9 A;  4GA2 A;  3OTN A;  3PZ4 A;  2R59 A;  1JUQ A;  3RRM B;  3HG0 D;  4BX8 A;  3UT8 A;  1TNY A;  2YQ8 A;  1N6A A;  5HI7 A;  5BV1 A;  3PS6 A;  4TV3 A;  4KVO A;  3ONL A;  3FWV A;  4U95 D;  3PZ3 A;  3Q73 A;  2KXP C;  1Z5S C;  5B1A E;  1JCS A;  2X3M A;  3G2W A;  3JYS A;  4CGW A;  1OCR E;  1OWN A;  4BUP A;  3DEO A;  5KJK A;  1O1T A;  3UQ3 A;  3QKY A;  2VYI A;  2WXJ A;  2RD0 A;  3UKU G;  3P1U A;  2FEZ A;  5A6C A;  3UXG A;  1SQM A;  4QEO A;  3CKB A;  4YNP A;  1S70 B;  2VTB A;  2QYU A;  1OCZ E;  5BPP A;  5D66 A;  1HXI A;  5FT9 A;  3Q79 A;  3SF4 A;  3CHS A;  3MGB A;  1FPP A;  5CED B;  3PRE A;  3PE3 A;  3PZD A;  5F5E A;  4GZD A;  3ABL E;  3ESK A;  1Q2Z A;  1HG5 A;  3WG7 E;  3FHE A;  3FU0 A;  4C0E A;  2WPV A;  3CV0 A;  2I1J A;  4I1A A;  3M58 A;  3TWR A;  3ZUV B;  3QAR A;  3Q5M A;  2XS1 A;  3M59 A;  1ML9 A;  4FA6 A;  4N2Q A;  3AG3 E;  3TWX A;  3RO3 A;  3OOI A;  3OS5 A;  3ASD A;  1K3Z D;  3ZYM A;  5CBO A;  4HBD A;  1MVX A;  3R7Q A;  3BU8 A;  4N3A A;  5BT1 A;  2R05 A;  5G2N A;  2WXR A;  5AJD A;  4GU5 A;  1N4P A;  1X81 A;  2P9K G;  4NVQ A;  1INZ A;  4U7E B;  4MI5 A;  4BSZ B;  1UN8 A;  3F6Q A;  3RRN B;  3APF A;  3PDN A;  1BU9 A;  4BT8 A;  2MOW A;  3E4B A;  3T8M A;  4UWF A;  1FT1 A;  2DZO A;  4FU3 A;  1WG0 A;  4EHM A;  3NF1 A;  4K0R A;  3KMA A;  1UJK A;  5ITZ F;  2YNQ A;  2DZN A;  3EIJ A;  4MLP A;  3C98 A;  2B0O E;  3SBT B;  4IJ8 A;  3DSW A;  3F9Y A;  2XPZ A;  3SQV A;  4ACK A;  2J8S D;  1H3I A;  5FIN A;  2J9Q A;  2OOE A;  4DLQ A;  4ATZ D;  4QEN A;  4FUL A;  3TJP A;  4C48 B;  3BQO A;  4FP7 A;  3UM2 A;  2WQH A;  4UWL A;  1U2V G;  2L6B A;  1N6C A;  4JL0 A;  4ZFH A;  3LCA A;  1ZB1 A;  4DUI A;  3ENE A;  3GZ2 A;  5AAO A;  2R2L A;  2LAI A;  2B6C A;  1JCR A;  2G46 A;  1HX8 A;  1EF1 C;  3AG4 E;  4FJZ A;  4NRH B;  3NQP A;  3TXM A;  5BW8 C;  5JJ7 A;  3VV0 A;  3CSF A;  3B13 A;  2JLB A;  3ZIM A;  3RO2 A;  1E96 B;  3JUE A;  3DB5 A;  2OND A;  2R02 A;  4J83 A;  4GYY A;  2L0I A;  2YHE A;  4G25 A;  5KJN A;  2VSX E;  2VGE A;  3OXL A;  2QZA A;  3SBS A;  3CHR A;  4ILH B;  4RG9 A;  3PZ2 A;  5T0M A;  2XEE A;  5G04 C;  2GRO B;  3KEZ A;  3RJW A;  3CVY A;  3S2A A;  3I5P A;  2LXM A;  2ETC A;  4GML A;  1N4S A;  4CT0 A;  1H2V C;  2J08 A;  1E8X A;  2JEK A;  1UJJ A;  2WXP A;  3SD5 A;  4C0M A;  4YNM A;  2GRL A;  2VTB B;  4I6G A;  1S64 A;  5FQ7 A;  4WWO A;  1N52 A;  1LF8 A;  1NFI E;  2CHX A;  4DX5 D;  1O9S A;  5JIY A;  2A4Z A;  2XRY A;  3R9A B;  4HRL A;  4AP2 A;  4GTT A;  3MV3 B;  4Y6W A;  4EPZ A;  3CK8 A;  4I9C A;  2XGM A;  1HFA A;  2WQ7 A;  1FVF A;  2F8X K;  3CBO A;  4XEI G;  3L17 A;  1V54 E;  4BET A;  3CQG B;  4HOQ A;  3D3M A;  5T4Y A;  3S7D A;  2FO1 E;  1E7U A;  4GPM A;  4FHJ A;  3LVQ E;  3TWW A;  1MX6 A;  5DIZ A;  4L7T A;  4CRW A;  3CVW A;  5EG2 A;  2XPY A;  2IO2 C;  4K5B A;  4GA1 A;  1TJC A;  4TXQ A;  3TWS A;  3HXE A;  3VLE A;  4KBQ A;  1N3J A;  1IYG A;  1HZ4 A;  3IHV A;  4ATG A;  3PRZ A;  2X6I A;  1SVX A;  5FZS A;  1ZKK A;  3LS8 A;  3MV2 B;  4C9B B;  3IKO B;  1FVH A;  4EEC A;  2E0I A;  1SW6 A;  2KC7 A;  2IF4 A;  5EYL A;  5LFA A;  3D9O A;  3LY8 A;  4DX6 D;  3FUE A;  3ULY A;  3KMJ A;  3QAQ A;  2F0Y A;  1ELK A;  3ZPJ A;  5B1B E;  4U0S A;  4N2S A;  3C3O A;  3DSX A;  1DC2 A;  4L2Y A;  4ME2 A;  3SFZ A;  4D10 C;  3FH7 A;  3FH8 A;  3VUZ A;  2GRR B;  2KZT A;  4A63 B;  3TWT A;  3KSL A;  1Z3X A;  3I3N A;  3V2X A;  3QWP A;  2VJ8 A;  2LNI A;  2WMO A;  4U63 A;  4JW1 A;  3LXU X;  2F8Y A;  3FFL A;  3UIP C;  4FAD A;  2QPW A;  2OEV A;  3OXF A;  1E8W A;  3DSS A;  2ILR A;  2XZD G;  4LNB A;  3EDT B;  2ION A;  5KWD A;  2PM6 A;  5CRV A;  4GTQ A;  4KVM A;  4MI0 A;  3ABM E;  2WXQ A;  4O1O A;  4UWH A;  5FQ8 A;  2BUG A;  3T9K A;  4WAF A;  4HNA D;  4BEP A;  2AXU A;  1ZBP A;  3CK9 A;  3EUV A;  1QNF A;  3U3W A;  4JXT A;  3KD7 A;  3ABK E;  4LEU A;  5EX3 A;  3PEU B;  4CYM D;  1RW2 A;  5G05 J;  3CKC A;  4K5C A;  3B95 A;  3G2V A;  2P9P G;  4RZ0 A;  3LY7 A;  4DLO A;  4HOR A;  1NL4 A;  1Z3Y A;  3AG2 E;  3Q47 B;  1MQS A;  4AIF A;  3SO8 A;  1TN6 A;  3U66 A;  4HOU A;  5ENS D;  2WQ6 A;  4GB9 A;  1YA0 A;  1TNO A;  2R17 C;  4ANV A;  3M57 A;  4J7F A;  2WXM A;  1SZ9 A;  3SY2 A;  4A55 A;  2XS8 A;  4APF A;  5IY5 E;  2OEW A;  5JJ6 A;  3UKR G;  4J7I A;  1JCQ A;  5D2M C;  1HH8 A;  5BUZ A;  3CHM A;  2XCB A;  3ZHE A;  2KM4 A;  2A5E A;  1DVP A;  3AG1 E;  2CHW A;  4O30 A;  3SI5 A;  2LUH A;  4ABN A;  3URZ A;  2RFM A;  1FT2 A;  1UN9 A;  4HRN A;  5AEN A;  3T5X A;  2HM8 A;  3CST A;  2NSZ A;  4HLL A;  5BXU A;  3Q75 A;  1IQR A;  1NZN A;  4H7X A;  3FU5 A;  3LKU A;  3ZRH A;  3LJ3 A;  4J6I A;  3CQC B;  5FZQ A;  1AP7 A;  5T0K A;  4FMU A;  1XQH A;  2P9I G;  1WDY A;  1OCO E;  1OWL A;  2WXG A;  2NXP A;  1TN7 A;  3E37 A;  2BKG A;  1O1R A;  4ILG A;  2AXV A;  4MRU A;  4U04 A;  4UI9 C;  1FCH A;  3ASH A;  4M7C A;  3SHF A;  3RRU A;  3F9W A;  3UX4 A;  4GPK A;  1N0Q A;  5E75 A;  5KJL A;  3AU4 A;  3TL5 A;  2IU1 A;  4TRQ A;  3P2B A;  4AY5 A;  4C1Q A;  3O48 A;  5CCL A;  3X2Q E;  3DPD A;  3RU0 A;  3TXN A;  2QY7 A;  1HG2 A;  4E6H A;  4GA0 A;  5TH7 A;  4NIK A;  2EIK E;  5FQ4 A;  3FUI A;  1BI8 B;  2BTD A;  4A3V A;  5ARG A;  4B0Z A;  4LSZ E;  2V8S E;  3AS5 A;  5TEG A;  4X8Q A;  2IOS A;  2KZT B;  4OVU A;  4I2Z A;  4WNE A;  4UI9 K;  5J90 A;  5EIL A;  3NZS A;  3FTS A;  4Y6C A;  2Y69 E;  1NA0 A;  2I1K A;  3E30 A;  4M3O A;  3HXC A;  4UQY A;  1N4R A;  4I1M A;  2XEN A;  4JHR A;  1Y8M A;  3ASF A;  4GTP A;  4H7Y A;  1EDU A;  2UY1 A;  5J08 A;  5C2Y A;  4MBG A;  5KNH D;  4A3T A;  4XX5 A;  4JHK A;  3D9M A;  1H6O A;  2WXH A;  3CHP A;  4EBA A;  3BG0 B;  2WM9 A;  4TXR A;  3CVQ A;  4AY6 A;  3DWL G;  4B8C B;  3AAA C;  3UIO C;  3W9F A;  2ZGD A;  4R7L A;  4LCT A;  1MYO A;  3M5A A;  5ANL A;  1OT8 A;  2P2C P;  2WMN A;  3LY9 A;  4AU7 A;  2DBA A;  3LPZ A;  4LNG A;  3MO0 A;  3MCX A;  1MX4 A;  4IN3 B;  3JQ1 A;  5F6K C;  5D0O D;  3IBE A;  5HQ8 A;  2DYR E;  2MYO A;  2FBN A;  2Y3A A;  2P58 C;  5T3R A;  3EHN A;  3V2O A;  4J8D A;  3UT7 A;  1OXJ A;  3DSV A;  2HE0 A;  1KLX A;  4B94 A;  4B93 B;  4QFV A;  5EDS A;  4XI9 A;  3L22 A;  4JHJ A;  3V31 A;  5M72 A;  5AQA A;  3FU3 A;  3S7F A;  3F9Z A;  4GZC A;  3C5R A;  1DCQ A;  1ELR A;  1TEZ A;  3TWU A;  3RKV A;  1H2U A;  3RK6 A;  3DSU A;  3ZHE B;  2P9N G;  5FJY A;  3JQ0 A;  2H6H A;  2PQN A;  2DWZ A;  1XNF A;  1IHG A;  3IHY A;  1MT6 A;  3FTU A;  3NOC D;  4L9P A;  1ZU2 A;  3I4G A;  5A23 A;  1WAO 1;  1BD8 A;  3B7B A;  5B3S E;  3KMT A;  3UMV A;  1K8K G;  2H6G A;  1ELW A;  1SA4 A;  3CVP A;  3HHM A;  3PUJ A;  1UW4 B;  1MHQ A;  4JD2 G;  3L6A A;  3N71 A;  4GTO A;  1UG3 A;  1SZA A;  4XI0 A;  4G1T A;  4WNF A;  4E85 A;  4L2L A;  4BT9 A;  3FUJ A;  3CBM A;  4JA9 A;  4BX9 A;  4Q69 A;  3MO2 A;  1X5B A;  1L5J A;  2WXK A;  4HFG A;  5LSX A;  2GGF A;  4K5A B;  4TXP A;  3Q4A B;  2KBX A;  1MZC A;  5JJ0 A;  3HXB A;  2X38 A;  3JUI A;  4GTR A;  4HQD A;  4U8Y D;  1V55 E;  2EIM E;  5BNW A;  2L6J A;  3FTW A;  2GW1 A;  2I9C A;  3K5K A;  3CEQ A;  3ZGQ A;  3G2U A;  1G3N B;  3L16 A;  2Y1L E;  2XZT G;  2ETB A;  1TNU A;  4Q96 A;  4HI9 A;  1Z6T A;  2P9L G;  4FHK A;  4NJ5 A;  1IXV A;  4ANX A;  4ACL A;  1B89 A;  3D9L A;  3FUM A;  3FUK A;  2J49 A;  4GTV A;  5LP0 A;  5LCW J;  4I43 A;  3QDN A;  2PL2 A;  3HXF A;  5ENT D;  3L13 A;  5LOZ A;  2R03 A;  4GTS A;  3ZW3 A;  3RIB A;  5AN8 A;  3TWV A;  3HYM B;  2UY1 B;  2R5S A;  3DXK G;  2XPI A;  3ML9 A;  5KJM A;  3FUH A;  1JPL A;  5E76 A;  5JIN A;  1NA3 A;  2OV8 A;  5LSZ A;  3MKR A;  3FTY A;  2LO6 A;  2H6F A;  4HRM B;  4CZ2 D;  1N0R A;  4OYS A;  4Q94 A;  3SZ7 A;  1IQU A;  2XEV A;  1E90 A;  3JCK C;  5EID A;  3ONK A;  3VLD A;  2QFC A;  3ASO E;  3RAY A;  4KXK B;  4GYW A;  2XRZ A;  3L9T A;  4I9E A;  3V30 A;  4BWR A;  2ZU6 B;  2WB2 A;  4HOT A;  1P5Q A;  2IY0 C;  4GTM A;  3BUA A;  5CMY A;  5JHN A;  2C2L A;  4GMR A;  3E34 A;  5JMN D;  3J5Q B;  3S7J A;  2A5U A;  2GRM A;  2WXL A;  5AJL A;  4N3C A;  5CHE E;  4U0U A;  4YDY A;  1D8E A;  3DRA A;  3K9I A;  3EHQ A;  3RJV A;  4NQ0 A;  3VTY A;  4GCO A;  3APD A;  3D9P A;  3SGH A;  3MEK A;  4OAU C;  3AJI A;  3LEW A;  5HS0 A;  4PUC A;  4OAV B;  3SNX A;  2KCL A;  4HLE A;  4N5Q A;  3ZEF A;  3GYZ A;  2AW6 A;  4YVO A;  3LVR E;  5ENR D;  2RG8 A;  3UUX A;  4RQI A;  4LG6 A;  1HS6 A;  3B7R L;  1HO8 A;  3UIN C;  3QK0 A;  3CBP A;  1IHB A;  2L9B A;  3Q15 A;  2PZI A;  3JXI A;  4JA7 A;  4AV7 A;  5ENP D;  4CEM A;  4GCN A;  2LAH A;  1GW6 A;  4QQI A;  1KT1 A;  4APO A;  3LJN A;  2RFI A;  3V79 K;  4BTB A;  3CHQ A;  4J0U A;  2DVW A;  2CG3 A;  3D9H A;  4J8F A;  4F3V A;  3DBS A;  1N11 A;  3ZNG A;  4UQX A;  4CT4 A;  1HU3 A;  3NAW A;  3PUK A;  3SW9 A;  1BI7 B;  2WXI A;  3FP3 A;  3RQ4 A;  3CIA A;  2O8J A;  1N4Q A;  4I1O B;  4U07 A;  1A5E A;  3D9N A;  3DEP A;  2NYJ A;  5EYP F;  2J4D A;  3AS8 A;  4HS2 A;  3KAE A;  3M55 A;  3ASG A;  1N9A A;  4F53 A;  1K1B A;  3MJW A;  2OVF A;  4O60 A;  2MHK A;  2J09 A;  2V0P A;  3DXM G;  4A1G A;  4E47 A;  3CLJ A;  3FUN A;  5H7P A;  4A1S A;  4HVB A;  3QWV A;  1OY3 D;  4I6J A;  3AS4 A;  2KAT A;  3UT4 A;  1OCC E;  3FH5 A;  3L54 A;  2LSU A;  2VSN A;  3F9X A;  2P9U G;  4RLY A;  3FTZ A;  3FTX A;  4UWG A;  4YND A;  2NC9 A;  1WY6 A;  3C3Q A;  3U4T A;  2FO7 A;  3G2T A;  1VDY A;  3Q7A A;  3I4R B;  1PEG A;  3BEE A;  5AQ7 A;  4N3B A;  1TJF A;  3Q7F A;  3L08 A;  2I6H A;  1A17 A;  5FQ6 A;  2IGQ A;  4CDM A;  1LD7 A; 
#chains in the Genus database with same CATH homology
 3CHR A;  4ILH B;  4RG9 A;  4BTA A;  1EPU A;  3MKQ A;  5T0M A;  1KT0 A;  4IN3 B;  5G04 C;  3JQ1 A;  3DAL A;  3KEZ A;  5T8I A;  5F6K C;  5D0O D;  3CVY A;  1Y6I A;  3IBE A;  3S2A A;  5HQ8 A;  5LX8 A;  3I5P A;  2R3A A;  3RJW A;  4DPR A;  3CVU A;  4GML A;  2FBN A;  4CT0 A;  1H2V C;  2J08 A;  1E8X A;  2JEK A;  2Y3A A;  4DI3 A;  5CMW A;  1UJJ A;  2P58 C;  2WXP A;  3EHN A;  5T3R A;  3SD5 A;  4J8D A;  3UT7 A;  4YPU A;  4QEP A;  4C0M A;  4YNM A;  4YPA A;  3FDH A;  1E8Y A;  1KLX A;  2GRL A;  4J8E A;  4QFV A;  4B94 A;  4I6G A;  2VTB B;  4AVX A;  5EDS A;  4XI9 A;  3L22 A;  4JHJ A;  5FQ7 A;  5M72 A;  4AXH A;  1H2T C;  3FTV A;  3FU3 A;  3S7F A;  4K03 A;  3F9Z A;  4WWO A;  2CFZ A;  4GZC A;  1N52 A;  1LF8 A;  3MYV A;  4FJY A;  2CHX A;  3GZ1 A;  1ELR A;  1TEZ A;  3D9K A;  1JWG A;  1O9S A;  3RKV A;  3BG1 B;  5JIY A;  2A4Z A;  2XRY A;  1HE8 A;  1H2U A;  3R9A B;  3CGH A;  3RK6 A;  4WND A;  3ZHE B;  4DI4 A;  2W5Y A;  4AP2 A;  1EYH A;  4GZ3 A;  4UI9 J;  3MV3 B;  4Y6W A;  4XKB A;  3QWW A;  5FJY A;  2HO1 A;  4EPZ A;  3JQ0 A;  4O6F A;  4WUY A;  3CK8 A;  4I9C A;  2C0M A;  2XGM A;  1WM5 A;  1HFA A;  2PQN A;  1FVF A;  2WQ7 A;  5CCM A;  4URK A;  1XNF A;  1IHG A;  3IHY A;  1MT6 A;  3CBO A;  3CHO A;  3GW4 A;  3L17 A;  3FTU A;  4G26 A;  4EZL A;  3CQG B;  5G05 C;  4HOQ A;  3D3M A;  5T4Y A;  1ZU2 A;  2YHC A;  2OVB A;  3I4G A;  2LSV A;  2VQ2 A;  4HXI A;  4EBA G;  3CVV A;  5A23 A;  1OUV A;  3S7D A;  4CDR A;  4EZJ A;  3ZYL A;  1WAO 1;  1E7U A;  2EQX A;  3ULQ A;  4FHJ A;  3LVQ E;  4JC8 A;  3KMT A;  3UMV A;  2XQ0 A;  4DK5 A;  2HYZ A;  3S7B A;  1E7V A;  5DIZ A;  4L7T A;  4GMJ A;  3S8P A;  3TAX A;  1PAQ A;  2HR2 A;  1ELW A;  4CRW A;  3CVW A;  3WXX A;  4HOS A;  3CVP A;  3HHM A;  3PUJ A;  1UW4 B;  1MHQ A;  5EG2 A;  3L6A A;  4JEU A;  3LYA A;  3N71 A;  4CGV A;  4KZC A;  1QZ2 A;  2XPY A;  1UG3 A;  1W3B A;  3ZYK A;  2IFU A;  4XKC A;  1SZA A;  3FEY A;  4XI0 A;  2XGS A;  4G1T A;  3PE4 A;  4WNF A;  4E85 A;  4GA1 A;  1TJC A;  4L2L A;  4BT9 A;  3VLE A;  2WXO A;  5FZR A;  3FUJ A;  4KBQ A;  3MO5 A;  2MRI A;  3TGO A;  4JA9 A;  4BX9 A;  4Q69 A;  1N3J A;  3CBM A;  4B8A A;  3MX3 A;  1IYG A;  1HZ4 A;  4GZ6 A;  3IHV A;  4ATG A;  3MO2 A;  1X5B A;  2V5F A;  3M54 A;  1L5J A;  4YPE A;  2WXK A;  4U8H A;  5ARF A;  4HFG A;  5LSX A;  3PRZ A;  2GGF A;  2X6I A;  4XIF A;  5FZS A;  4EZK A;  4CCA A;  1ZKK A;  3LS8 A;  3Q4A B;  4H12 A;  3MV2 B;  4RSY A;  4C9B B;  5JJ0 A;  3F9W A;  2X38 A;  3IKO B;  3MZL B;  1FVH A;  3CR3 A;  3TG5 A;  2Y4T A;  4WNG A;  5FWQ A;  3JUI A;  4EEC A;  2E0I A;  2W5Z A;  4IRU A;  2KC7 A;  5C1D A;  4YVQ C;  2IF4 A;  5LFA A;  3NZU A;  5BNW A;  3D9O A;  2XHE A;  3LY8 A;  2L6J A;  4XE0 A;  3FUE A;  4RG6 A;  3FTW A;  2GW1 A;  3KMJ A;  3QAQ A;  2I9C A;  3QB2 A;  5ENN A;  4BSX A;  2JV0 A;  2AXZ A;  1ELK A;  1H0A A;  4UWK A;  3ZPJ A;  3K5K A;  2FF4 A;  4U0S A;  4N2S A;  3HVE A;  3CEQ A;  4FLH A;  4BFR A;  5CPR B;  1QQE A;  1BPO A;  3ZGQ A;  3UPV A;  2VGX A;  1PC2 A;  3G2U A;  5D0Q D;  4EQF A;  3L16 A;  2WVI A;  5A7D B;  3IEG A;  3U64 A;  4L2Y A;  4ME2 A;  3U9W A;  2DIW A;  1JWF A;  3ZFW A;  4Q96 A;  3ML8 A;  4B89 A;  4F1S A;  1N54 A;  3EP0 A;  3M53 A;  2UWJ G;  5JJT A;  3SFZ A;  4D10 C;  4GAA A;  1Z6T A;  3FH7 A;  3QNK A;  3FH8 A;  1NP7 A;  3VUZ A;  3CVX A;  4FHK A;  4LER A;  2VSY A;  4NJ5 A;  4I17 A;  2KZT A;  4JLG A;  2E2E A;  1Z3X A;  2I2O A;  3I3N A;  4ANX A;  4ACL A;  1B89 A;  3D9L A;  3FUM A;  2CFU A;  3APC A;  3FUK A;  3ZXS A;  1E8Z A;  2J4B A;  4ANW A;  3CVN A;  3KS2 A;  2J49 A;  2VSO E;  4J8S A;  5LP0 A;  5LCW J;  4I43 A;  3B7S A;  3QDN A;  3QWP A;  4J8O A;  2VJ8 A;  3IV0 A;  2LNI A;  2PL2 A;  2WMO A;  2X6H A;  2XGO A;  4U63 A;  2X6K A;  4JW1 A;  3CVL A;  3LXU X;  3QJZ A;  4JEH A;  3L13 A;  5LOZ A;  3FFL A;  3OAW A;  5TTF A;  2IQC A;  5G04 J;  3O4Z A;  2V4L A;  5F59 A;  4FAD A;  2QPW A;  2KCV A;  4I2W A;  3OXF A;  1E8W A;  3LDZ A;  3QC1 A;  4IUL A;  2ILR A;  4N39 A;  4F7A A;  3ZW3 A;  3RIB A;  3EDT B;  2ION A;  2M63 A;  3HYM B;  3ZVV A;  2PM6 A;  2UY1 B;  3HDX A;  4XZ4 A;  2PQR A;  3HNA A;  2R5S A;  2KCK A;  3HIZ A;  4KZ0 A;  4AM9 A;  2CG2 A;  3D9I A;  4GA2 A;  3OTN A;  4G24 A;  4KVM A;  4MI0 A;  4PS3 A;  4Z4P A;  5BV0 A;  1HF8 A;  2XPI A;  2R59 A;  3ML9 A;  2WXQ A;  5KJM A;  1JUQ A;  3RRM B;  4UWH A;  5FQ8 A;  4BY6 A;  4BX8 A;  3FUH A;  2BUG A;  3UT8 A;  1JPL A;  5E76 A;  4WAF A;  4V3I A;  5JIN A;  1NA3 A;  2OV8 A;  4DJA A;  2AXU A;  1ZBP A;  2YQ8 A;  2WXF A;  3CK9 A;  1N6A A;  5LSZ A;  1QNF A;  5HI7 A;  3U3W A;  4JXT A;  3KD7 A;  3MKR A;  3FTY A;  4LEU A;  5EX3 A;  2BQZ A;  5BV1 A;  2LO6 A;  3QOU A;  3PS6 A;  4TV3 A;  3PEU B;  1DNP A;  4KVO A;  3ONL A;  1U3D A;  3FWV A;  5G05 J;  2AWI A;  5ANR A;  3CKC A;  5G55 A;  4LDG A;  4OYS A;  4Q94 A;  3G2V A;  2IOL A;  4KMO A;  3SZ7 A;  1IQU A;  4RZ0 A;  3LY7 A;  4DLO A;  1OWM A;  4HOR A;  1Z3Y A;  2X3M A;  3Q47 B;  1MQS A;  3G2W A;  3JYS A;  4AIF A;  4CGW A;  3U66 A;  2XEV A;  1OWN A;  1E90 A;  4HOU A;  3JCK C;  3VLD A;  3ONK A;  4BUP A;  2WQ6 A;  2QFC A;  2DCP A;  5AYF A;  3RAY A;  4KXK B;  4GYW A;  5KJK A;  2XRZ A;  3UQ3 A;  4IYP A;  4GB9 A;  3QKY A;  3MKQ B;  2VYI A;  2WXJ A;  1YA0 A;  2VGY A;  5EX0 A;  2R17 C;  2RD0 A;  3P1U A;  4I9E A;  2FEZ A;  5AYW D;  3PNL B;  4ANV A;  5A6C A;  3M57 A;  1SQM A;  4J7F A;  3CKB A;  4QEO A;  4YNP A;  4BWR A;  2WXM A;  2ZU6 B;  2VTB A;  1SZ9 A;  3PNT B;  3TG4 A;  4A55 A;  2WB2 A;  4HOT A;  4U0Z A;  1P5Q A;  4APF A;  5BPP A;  3GZS A;  5JJ6 A;  1HXI A;  5FT9 A;  4J7I A;  2Y4U A;  5CMY A;  5JHN A;  4RVB A;  1HH8 A;  2C2L A;  3FPD A;  5BUZ A;  3SF4 A;  3CHM A;  3CHS A;  2XCB A;  3ZHE A;  2KM4 A;  3T5V A;  1OWP A;  2PM7 A;  3MGB A;  3R7R A;  4AJW A;  3S7J A;  3PRE A;  2A5U A;  3PE3 A;  3PZD A;  2GRM A;  2WXL A;  5AJL A;  4N3C A;  4IJD A;  5F5E A;  1DVP A;  3OXG A;  4GZD A;  3FUD A;  2CHW A;  4O30 A;  3ESK A;  5CHE E;  3SI5 A;  1HG5 A;  4U0U A;  3FHE A;  4ABN A;  3FU0 A;  3URZ A;  4C0E A;  3K9I A;  2WPV A;  3RJV A;  3CV0 A;  2I1J A;  4I1A A;  5KCM A;  3M58 A;  5JHB A;  1UN9 A;  4NQ0 A;  3VTY A;  4GCO A;  2CHZ A;  3FUF A;  5AEN A;  3PH0 C;  3QAR A;  3APD A;  3D9P A;  3Q5M A;  3SGH A;  3MEK A;  3T5X A;  3M59 A;  1ML9 A;  4FA6 A;  2HM8 A;  3CST A;  2NSZ A;  4N2Q A;  4MKT A;  3OOI A;  3RO3 A;  3LEW A;  3OS5 A;  1MUF A;  4WWN A;  4PUC A;  4I51 A;  3ASD A;  3SNX A;  1IQR A;  2KCL A;  1NZN A;  4H7X A;  4HLE A;  3ZEF A;  3FU5 A;  3LKU A;  3GYZ A;  3ZRH A;  3LJ3 A;  4JVS A;  2AW6 A;  3ZN3 A;  4ILI A;  3ZYM A;  4J6I A;  4NUR A;  3CQC B;  5FZQ A;  1MVX A;  4TUU A;  4YVO A;  3LVR E;  3R7Q A;  4N3A A;  2RG8 A;  5BT1 A;  5T0K A;  3UUX A;  4FMU A;  5G2N A;  2WXR A;  2XCC A;  3B7T A;  4KYO B;  1HS6 A;  1PY1 A;  5AJD A;  1H19 A;  3EIQ C;  1XQH A;  3B7R L;  4GU5 A;  1HO8 A;  4MS6 A;  1OWL A;  2WXG A;  2NXP A;  5EKQ D;  4JPS A;  3QK0 A;  5AIJ A;  2L0T B;  3CBP A;  4NVQ A;  3PEV B;  1INZ A;  3FUL A;  4MI5 A;  2L9B A;  3Q15 A;  4ILG A;  1UN8 A;  2AXV A;  1U3C A;  2PZI A;  3RRN B;  4MRU A;  3APF A;  4U04 A;  4JA7 A;  4UI9 C;  4AV7 A;  1FCH A;  4CEM A;  4GCN A;  2LAH A;  1GW6 A;  3ASH A;  1KT1 A;  3PDN A;  4KT6 B;  4APO A;  3FEX A;  4W9R A;  5F6L A;  4LRZ A;  2RFI A;  4BTB A;  3CHQ A;  4J0U A;  3SHF A;  2CG3 A;  4BT8 A;  2MOW A;  3E4B A;  4UWF A;  3RRU A;  4FU3 A;  4J8F A;  3EJN A;  4PS8 A;  3DBS A;  3T8M A;  3UX4 A;  4F3V A;  5JHA A;  4GPK A;  3NF1 A;  2YIN A;  5E75 A;  3PVL A;  5KJL A;  3AU4 A;  4K0R A;  3KMA A;  1UJK A;  2YNQ A;  3TL5 A;  2IU1 A;  4TRQ A;  5DBK A;  3P2B A;  4WWP A;  4L1B A;  4UQX A;  4CT4 A;  4AY5 A;  2F69 A;  1HU3 A;  4PH4 B;  4UQZ A;  3PUK A;  4OVV A;  4G2V A;  4C1Q A;  3HVE B;  3O48 A;  3SW9 A;  5CCL A;  2WXI A;  3EIJ A;  4I6E A;  2VGX B;  3FP3 A;  4MLP A;  3RQ4 A;  3CIA A;  3C98 A;  2O8J A;  3DPD A;  3RU0 A;  4I1O B;  3TXN A;  2QY7 A;  3FU6 A;  4U07 A;  3CK7 A;  1HG2 A;  4E6H A;  3D9N A;  3SBT B;  4GA0 A;  3BO5 A;  4IJ8 A;  3VTX A;  5TH7 A;  3VLF A;  3F9Y A;  2XPZ A;  5FQ4 A;  3FUI A;  2BTD A;  4A3V A;  3SWC A;  5ARG A;  4B0Z A;  1OWO A;  4ACK A;  2V8S E;  2J4D A;  3AS8 A;  3AS5 A;  5TEG A;  4LUN U;  4HS2 A;  2IOS A;  3ZYQ A;  1H3I A;  3KAE A;  2J9Q A;  3ASG A;  3M55 A;  2KZT B;  2OOE A;  3AU5 A;  4DLQ A;  4F53 A;  2AVP A;  4OVU A;  4I2Z A;  3OPE A;  4QEN A;  3MJW A;  2OVF A;  4WNE A;  2MHK A;  4UI9 K;  5J90 A;  4FUL A;  3NZS A;  4G11 A;  2J09 A;  4L23 A;  2X6F A;  2V0P A;  3FTS A;  3TJP A;  4ANU A;  4Y6C A;  4A1G A;  4FP7 A;  1NA0 A;  2I1K A;  4N5C A;  4M3O A;  4E47 A;  2WQH A;  3CLJ A;  4UWL A;  3FUN A;  4UQY A;  1S0P A;  1N6C A;  4I1M A;  4PDX A;  4A1S A;  4JHR A;  4JL0 A;  2IJG X;  3LCA A;  1Y8M A;  3QWV A;  4GZ5 A;  4HVB A;  4AEZ C;  3ASF A;  4H7Y A;  1EDU A;  4I6J A;  3AS4 A;  2UY1 A;  3ENE A;  2KAT A;  3UT4 A;  3GZ2 A;  2J07 A;  5J08 A;  3FH5 A;  3L54 A;  5C2Y A;  3D9J A;  2LSU A;  4JDS A;  4P29 A;  2VSN A;  4AOF A;  2LAI A;  4A3T A;  3F9X A;  4XX5 A;  2G46 A;  4JHK A;  3D9M A;  1H6K A;  3B7U X;  1HX8 A;  2C0L A;  2WXH A;  3FTZ A;  3FTX A;  5FTP A;  3CHP A;  1EF1 C;  4UWG A;  4YND A;  4FJZ A;  5T5G A;  2BF0 X;  1WY6 A;  2NC9 A;  3BG0 B;  4NRH B;  4EBA A;  2WM9 A;  3FY4 A;  3NQP A;  3U4T A;  4CDN A;  3M56 A;  4G23 A;  2FO7 A;  3CVQ A;  3TXM A;  5BW8 C;  2FI7 A;  4AY6 A;  3G2T A;  2WXN A;  5JJ7 A;  3VV0 A;  4B8C B;  3Q49 B;  3IHX A;  3G2S A;  4NAC A;  1VDY A;  3CSF A;  3B13 A;  2JLB A;  3I4R B;  3ZIM A;  3RO2 A;  1E96 B;  4JZY A;  4GYO A;  2FUL A;  3DB5 A;  4R7L A;  1MVH A;  2OND A;  4LCT A;  4J83 A;  3M5A A;  1PEG A;  3EHM A;  3BEE A;  2Q7F A;  5ANL A;  3ESL A;  4N3B A;  4FC8 A;  2X6J A;  1TJF A;  2WMN A;  4FLB A;  3LY9 A;  2L0I A;  2YHE A;  3MA5 A;  3L08 A;  4G25 A;  4GYY A;  2I6H A;  5KJN A;  2DBA A;  2VSX E;  3OXL A;  4PS7 A;  4AU7 A;  3LPZ A;  1A17 A;  5FQ6 A;  5LCW C;  2IGQ A;  4CDM A;  3MO0 A;  3MCX A;  1XGW A;  3SBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...