3S7BA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7bA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7bA01
5JJ0A 5EX0A 4H12A 3FWVA 5TEGA 4LDGA 3S7BA 1FCHA 5KJNA 3BO5A 3ULQA 4N39A 3LYAA 3AS5A 4YPEA 4JLGA 3GZ1A 4G1TA 1N6AA 3TGOA 3OOIA 2XGOA 3RIBA 3SF4A 3KMJA 5ARGA 3M58A 3LY7A 4WNGA 4BT9A 3TAXA 4U0UA 4QEOA 4AIFA 2PZIA 2RFIA 5JIYA 2Y4TA 3MO5A 3F9XA 3PDNA 4IN3B 5HQ8A 4NQ0A 5KJKA 4RZ0A 3MKRA 3CKBA 4JA7A 4IJ8A 3MV3B 2BQZA 3NF1A 4B94A 3ZN3A 4N2SA 4YPAA 4H7XA 4N5CA 5ARFA 3CBMA 3ZGQA 4WNFA 5JHNA 3OXGA 3CVQA 5LSXA 1N6CA 4I51A 2V5FA 2YHCA 4J7FA 3TG4A 4GA0A 2FF4A 1A17A 3CKCA 4G23A 3M55A 2BUGA 1PEGA 4G26A 2W5ZA 1ZBPA 4WNEA 3ASGA 4LEUA 5A7DB 4Z4PA 1XNFA 3CVNA 5EX3A 4JDSA 3S8PA 4NVQA 5F6LA 5F6KC 3LCAA 3UQ3A 3RQ4A 1N3JA 3AS4A 4XI9A 2DBAA 4U0SA 4I17A 5T0KA 1NZNA 4F3VA 3S7FA 1H3IA 3CEQA 2XGMA 4U07A 1IYGA 3M5AA 3CK7A 3U4TA 5BW8C 4BUPA 2XEVA 2J9QA 5CHEE 2VSYA 4BWRA 3K5KA 1QQEA 3M53A 1NA3A 4GCNA 2C0MA 5CPRB 4N3BA 4G25A 4XIFA 1W3BA 4I9EA 4O6FA 4YPUA 2WQHA 3ZPJA 3FP3A 5FTPA 4KXKB 4J8DA 4CGWA 4UI9K 1ZKKA 3GW4A 4C1QA 2MHKA 3RAYA 4N3AA 4CGVA 2Y4UA 4W9RA 4I2ZA 1E96B 2HR2A 2KCVA 3LKUA 1XQHA 1WM5A 5FZRA 5D0QD 3Q49B 2F69A 2FEZA 3OPEA 3IEGA 1TJCA 3TG5A 4RG6A 2JLBA 3Q4AB 4HOQA 5KJLA 4JL0A 2WPVA 3OXLA 3U3WA 3HNAA 5LCWJ 5FZQA 3ZHEA 2XCBA 3F9YA 4YVOA 4KBQA 3QWVA 1ELWA 2UY1B 5A6CA 5DIZA 3CVPA 3WXXA 4U04A 1HXIA 4UQXA 3MO2A 3QDNA 3S7DA 2KATA 1MVHA 2G46A 2HYZA 2OOEA 2JV0A 3ASDA 4HOSA 1KT0A 1ELRA 3RKVA 4YVQC 3PE3A 2C0LA 4I9CA 1HH8A 4GYYA 5DBKA 4G2VA 5G04C 1YA0A 1MT6A 2KCKA 4APOA 4CDRA 4MI5A 2PQRA 2LSUA 3KD7A 4J83A 2Q7FA 3RJWA 2LNIA 4WNDA 1ZU2A 3Q47B 2O8JA 3OXFA 1QZ2A 2KC7A 3E4BA 3CK9A 4AY6A 3CVLA 3JYSA 5FT9A 3LPZA 1B89A 4G24A 4GCOA 4O30A 4Y6WA 4N2QA 2E2EA 4NJ5A 3Q15A 3Q5MA 2XCCA 2QPWA 3M57A 4Y6CA 2UWJG 3MV2B 1Y8MA 3IHXA 4FMUA 4UQYA 4GYWA 2LSVA 2IF4A 3MA5A 2QFCA 4BTAA 3UPVA 3EP0A 3VTYA 5F5EA 5EG2A 4JA9A 2KCLA 2XPIA 4KYOB 3SW9A 2FO7A 3CV0A 3O48A 5D0OD 4A1SA 4I2WA 1PC2A 3M59A 3SWCA 4JHRA 3VUZA 4QENA 5TH7A 4HOUA 4I1AA 5BT1A 2I6HA 4HORA 5F59A 3QWPA 3FPDA 5BNWA 5HI7A 1OUVA 2AVPA 5JJ7A 4GZ6A 3MO0A 3RU0A 2NC9A 1NA0A 4J8FA 5CCMA 4GPKA 3ESKA 3VTXA 2VYIA 2C2LA 4QEPA 4J8EA 3K9IA 3ASHA 3S7JA 3GYZA 4ABNA 2YQ8A 1P5QA 3CBOA 3AS8A 5AYFA 5FJYA 2VQ2A 3DALA 5G05C 1KLXA 2FI7A 3EDTB 5LSZA 1MUFA 5KJMA 3GZ2A 3RO2A 2ONDA 1MVXA 5G04J 5AYWD 3QKYA 2IFUA 3CK8A 4IJDA 3PE4A 3QOUA 4GYOA 3KS2A 5TTFA 4GA1A 4H7YA 4UQZA 4J7IA 4WUYA 4RG9A 4BTBA 1KT1A 3HYMB 3F9WA 3SZ7A 4NRHB 4AM9A 3MEKA 3DB5A 3RO3A 4N3CA 3N71A 5EKQD 2XGSA 3FFLA 5FZSA 5G05J 4E47A 4YNMA 3KMAA 3UUXA 5T0MA 3URZA 3OS5A 3LY9A 4UI9J 3M56A 3LY8A 2FBNA 2R5SA 3M54A 4AU7A 3VV0A 2L6JA 2W5YA 4U0ZA 1ML9A 1IHGA 4EQFA 5JJTA 2R3AA 1O9SA 4MI0A 2GW1A 2UY1A 4GZ3A 5T5GA 5LCWC 4UI9C 4BT8A 5C1DA 3RJVA 4HOTA 3F9ZA 4J8OA 4AY5A 5CCLA 1WAO1 3QWWA 1HZ4A 2VSNA 3ASFA 3ZHEB 4GA2A 3ZFWA 2PQNA 3KAEA 3R9AB 4ME2A 5M72A 4YNPA 3CBPA 4GZ5A 4J0UA 5JINA 2VGYA 2VGXB 5JJ6A 2HO1A 3BEEA 2IGQA 2P58C 4YNDA 2VGXA 3KMTA 4XI0A 2PL2A
chains in the Genus database with same CATH superfamily
4XKCA 5ENTD 1OY3D 1FCHA 4N39A 4ATGA 3LYAA 3UM3A 5EILA 4XZ4A 3HVEB 2ETBA 3OOIA 4MLPA 2XGOA 3G2VA 2QYJA 4GPMA 1WY6A 1N4PA 3KMJA 2RFMA 5ARGA 4TXQA 4HVBA 1TYQG 4BESA 2H6GA 2V8SE 5CRVA 5JIYA 2ZIRA 5ENRD 4EECA 3JUIA 1BD8A 4I6GA 3SNXA 5BUZA 2FULA 4JA7A 5J08A 5CERB 3NF1A 2RD0A 3UM1A 3L9TA 3TJPA 2WXRA 1H2VC 4N2SA 4LRZA 4H7XA 5ARFA 4CZ2D 5JHNA 2V5FA 4C48B 3L6AA 4LNGA 1U2VG 3FUHA 2H6FA 2DVWA 4GA0A 5CMYA 3CKCA 1DCEA 4G23A 1E8WA 3C72A 5CMWA 2BUGA 3M55A 1ZBPA 4WNEA 3PZ2A 1NP7A 3ASGA 4LEUA 1MX2A 1SQMA 2L0TB 2X6JA 5EX3A 4BY6A 3HXCA 3UQ3A 3RQ4A 4XI9A 4U0SA 5T0KA 3CHOA 2XGMA 1XGWA 4IRUA 5BV1A 4DX2A 2XHEA 3ZW3A 2RG8A 4MBGA 4OAUC 4DX5D 2WXJA 3AU4A 4LNUD 1SZAA 1TNYA 3K5KA 1QQEA 3M53A 4G25A 2M63A 4K0RA 5ANRA 2ETAA 3AG1E 2L6BA 2MOWA 2WQHA 2AJAA 3FP3A 5FTPA 4HS2A 4Q96A 4CGWA 4UI9K 5HS0A 1ZKKA 3Q78A 3UIOC 2MHKA 1HF8A 4BSZB 4HRMB 3SBSA 4W9RA 4LUNU 1VDYA 4EHMA 1K1BA 3TWRA 3DEPA 1JWGA 3E30A 3TG5A 1HE8A 5AN8A 4RG6A 4Q94A 4JXTA 4HOQA 3UM0A 4JL0A 1WDYA 2GRNB 3AAAC 4FLHA 5ENNA 1Z6TA 2XCBA 4HI9A 3NB2A 1IHBA 2GGFA 4FULA 3B7UX 1IKND 2WXMA 3Q9UC 2H6HA 1OCRE 4LG6A 2XRZA 5AJDA 3EHRA 4UWKA 3IXEA 2KATA 1DNPA 1MVHA 2G46A 1GW6A 2VSOE 4HOSA 1KT0A 3G2TA 2C0LA 5DBKA 3T8KA 1YA0A 2P9KG 2WM9A 2OCCE 2WXNA 3E33A 3FEYA 5EDSA 3LXUX 3FH5A 1O1TA 3EIQC 4AY6A 5D2MC 3JYSA 5FT9A 3HXBA 3LPZA 3UIPC 3PNTB 4B8CB 3V2OA 4LERA 3NZUA 4UWHA 4I1MA 1YCSB 3QARA 2X6FA 1E8ZA 3ZRHA 4NJ5A 2B6CA 2QPWA 1Z3XA 4Y6CA 4D10C 3ABKE 3L54A 5T8IA 3MV2B 4GTRA 3G2UA 3IHXA 4FMUA 3PS6A 4B8AA 4GTOA 2IF4A 4DJAA 4OVUA 4K5AB 1OCOE 4BTAA 4B93B 3FTXA 3VTYA 5CECB 3WG7E 1MX6A 1O1RA 1Q2ZA 2Y0BG 4A1SA 1PC2A 1JUQA 3M59A 3SWCA 3HIZA 1H6PA 3VUZA 1TNOA 3VLEA 3Q7FA 2I6HA 1MJ0A 3V2XA 4HQDA 5BNWA 3ML8A 4WWPA 4GZ6A 1U3CA 4I43A 4J8FA 5ANLA 4XX5A 5A23A 1AP7A 3I5PA 2VYIA 3DXMG 1TNZA 2XRYA 3ASHA 2WXQA 3S7JA 4ABNA 3Q79A 5FJYA 2VQ2A 2V4HC 1MUFA 5AENA 3EHMA 2YHEA 3CLJA 3CVYA 3FTUA 5BV0A 4G11A 2BTDA 2I2OA 1SVXA 4J8SA 4G8LA 3Q7AA 5ENQD 4WUYA 2WXGA 4RG9A 4AEZC 3P1UA 1FT1A 3HYMB 3F9WA 1OCZE 2EIKE 4NRHB 3ZKJA 3KEZA 4GB9A 2WXLA 3HXDA 4BERA 4ILIA 3LVRE 3N71A 5EKQD 2XGSA 3FFLA 5G05J 2WXOA 1UOHA 2EIME 2X38A 3S2AA 3UUXA 5T0MA 1JPLA 3M56A 2R5SA 3D9OA 1H0AA 4AU7A 3VV0A 1OWNA 3LJ3A 1LD7A 1IHGA 2AW6A 1RW2A 4GTMA 2UY1A 3KSLA 3RJVA 1BU9A 3T5VA 4AY5A 1WAO1 4EBAG 1S64A 3ZYKA 2YINA 2WB2A 3ASFA 3ZHEB 2P9UG 3TWTA 3ZFWA 2PQNA 4DX7D 3JXIA 4ME2A 3U9WA 3ABLE 3G2SA 5CBNA 4YNPA 3I3NA 2P9NG 4J0UA 2VGXB 2XZTG 5JJ6A 2HO1A 3CSFA 2LO6A 3QK0A 1E7UA 1NFIE 5B1AE 1FT2A 1IXVA 3UX4A 3KMTA 4X8QA 2LUHA 2PL2A 2WXPA 5JJ0A 5EX0A 4L2YA 3RRUA 1D9SA 4LDGA 3S7BA 5KJNA 1LTXA 3JQ1A 4YPEA 4JLGA 4G1TA 5JMND 1E8YA 3TGOA 3UT8A 3ONKA 3R7RA 1UJJA 1FVFA 1OWPA 1N11A 4FC8A 3SF4A 3FUNA 3M58A 2OEWA 4KVMA 5E76A 4BT9A 1NI1A 4QEOA 5IY5E 4HRLA 4HXIA 4IYPA 3MZLB 4F1SA 3EU5A 5HQ8A 4FJYA 4RQIA 1DC2A 3CKBA 4ZFHA 1KPSB 3OAWA 2OVFA 5KWDA 4NACA 3ZN3A 3DPDA 2MRIA 1ELKA 5FINA 4YPAA 4AOFA 3APCA 3LEWA 3ZGQA 4WNFA 3OXGA 1JCSA 3ENEA 5EYPF 5LSXA 1N6CA 4GTVA 5G55A 4J7FA 4NURA 3ISMC 3L08A 2PNNA 3TG4A 2IO3C 1PEGA 4FP7A 5J90A 2W5ZA 4HBDA 3PEVB 3T5XA 4JDSA 2ETCA 3LCAA 2V5QC 2XZDG 2IO2C 1NZNA 3HRAA 2XENA 4F3VA 3JQ0A 4YDEA 3S7FA 3L22A 1N95A 2CG3A 4QFVA 4TUMA 1QNFA 3CIAA 4AP2A 3CK7A 4FHJA 3U4TA 5BW8C 1MZCA 3NQPA 4BUPA 2VSYA 5AJLA 1TN6A 1IQRA 3TWUA 5ENOD 3HHMA 4K5BA 4XIFA 1W3BA 4YPUA 2RFAA 2LXLA 3D9KA 4J8DA 5FQ8A 3AU5A 1V54E 4C1QA 5AAOA 1X5BA 2OVBA 2VJ8A 1XQHA 3W9FA 1EF1C 2FEZA 2AXVA 2DZOA 4CRWA 2X6KA 1H6KA 3Q4AB 3DSVA 2DIWA 3U66A 2IU1A 5AQBA 5B1BE 1N0QA 3F9YA 4JHJA 1TEZA 2WMOA 3RSEG 1ELWA 3FU3A 2Y3AA 3CVPA 3WXXA 4FHKA 3Q9NC 4U04A 3TWXA 2ZXWE 3MO2A 5AQ9A 2JV0A 1LD8A 3HXFA 4DUIA 3PE3A 3ZUVB 4DRXE 2VSXE 4G2VA 4APOA 3EJNA 4CDRA 4J83A 3HVEA 3KD7A 3C3RA 4F1PA 2AXZA 3Q47B 2O8JA 1N54A 3TWWA 1JWFA 3SBTB 3SFZA 3MCXA 3CK9A 2IQCA 4TUUA 4HLLA 3UMVA 3UXGA 4O1PA 5LX8A 2J4BA 4N2QA 1N94A 3ABME 2XCCA 4GTTA 3C3QA 5T3RA 1Y8MA 3L17A 4C9BB 2DYSE 3NAWA 2QYUA 5BXUA 2QFCA 3UPVA 4GTSA 3MKQA 5EIDA 3QB2A 2DYRE 4JA9A 2XPIA 3RAUA 4R7LA 4BSXA 4B89A 4N5QA 3J5PA 4I2WA 2ZU6B 1N4SA 2L0IA 5FIOA 4Q69A 3D9JA 3ZXPA 4I1AA 1HU3A 1BI7B 4L7TA 5F59A 4A3TA 5HI7A 1OUVA 3FTSA 2NC9A 4ANXA 4GPKA 4EZJA 2CHXA 3FUKA 3VTXA 3UKRG 3VLDA 2C2LA 3K9IA 3MKQB 2XEHA 4FADA 5AYFA 4U96D 5G05C 3FUDA 3EDTB 4A3VA 2LAHA 2A5UA 5LSZA 1UJKA 2R05A 2ONDA 2GRPB 1N4QA 1Y6IA 4GYOA 4ANWA 4OAVB 3E32A 4KVOA 3IBEA 4JB8P 4J7IA 1A5EA 4NIKA 3ZNGA 2ZGGA 1NL4A 3SZ7A 3ML9A 3LDZA 1E7VA 3MEKA 3DB5A 1H2TC 2WQ6A 4E47A 3KMAA 1JCRA 3LY8A 4V3IA 4F6RD 2FBNA 4YDWA 1RZ4A 3I4RB 4U0ZA 4EQFA 3NBNB 2GW1A 4GZ3A 4AV7A 4KT6B 4J8OA 3D9HA 2R59A 2VSNA 2V4LA 2ZGDA 3FH7A 3KAEA 5AARA 2WXFA 3FU0A 1KZPA 4YDOA 3CBPA 4GZ5A 2YNQA 2IGQA 4YNDA 4BX9A 2WMNA 1Z5SC 3B7SA 3EIJA 3QJZA 4PS3A 3CGHA 4K5CA 1FVHA 4I1OB 4OYSA 4E6HA 1BLXB 3DSWA 4MKTA 4L2LA 5ENPD 3BO5A 4JPSA 3ZYMA 1TNUA 3AS5A 2CHWA 3C5RA 2WQ7A 2R02A 5JA4D 4K03A 4WNGA 1ZB1A 2PZIA 4PDXA 2RFIA 2CFUA 2WXKA 3MO5A 4F7AA 3F9XA 3PDNA 4GMLA 3RK6A 4NQ0A 5KJKA 4RZ0A 3MKRA 3C3OA 3ZYQA 4IJ8A 3MV3B 5C2YA 1UG3A 4OVVA 4B94A 3BQOA 1OXJA 4PH4B 3I4GA 5CRUA 5B3SE 3CVQA 3FDHA 3BG0B 2HE0A 3L16A 2YHCA 4RVBA 2IJGX 5AQ7A 4EZKA 1MHQA 3RRNB 4J6IA 3CVWA 4F53A 3U64A 4G26A 3UT7A 5A7DB 1DVPA 1AWCB 4Z4PA 1XNFA 4JEUA 3AS4A 4PUCA 2DBAA 4I17A 4GU5A 1H3IA 3CEQA 1D8DA 4HRNA 3TL5A 3T9KA 4C0EA 1IYGA 3IHVA 3M5AA 5G2NA 2GRMA 4LSZE 4BWRA 2KZTA 3EHNA 2C0MA 5CPRB 1EYHA 3V79K 4I9EA 4O6FA 3FY4A 3ONLA 4QQIA 3GW4A 4APFA 3TXMA 4GMRA 3CHSA 3RAYA 4IULA 4I2ZA 1TR4A 2KCVA 5LOZA 3QC1A 1WM5A 2ILRA 3ESLA 5D0QD 4U95D 3Q49B 2F69A 3OPEA 3IEGA 4LNBA 4I6JA 1SZ9A 3JUEA 3MGBA 5CBOA 5KJLA 3PREA 5E75A 3OXLA 3LS8A 5LCWJ 5FZQA 3ZHEA 4UWGA 2PM7A 1YMPA 3PZ3A 1OT8A 3VLFA 2R17C 3ZEFA 4O60A 3QWVA 4L1BA 4FA6A 5A6CA 5DIZA 1HXIA 5T4YA 1S63A 2HYZA 2OOEA 3ASDA 3B7RL 2LAIA 3RKVA 4YVQC 4JC8A 1D8EA 3C98A 1HH8A 3CHPA 5HRYA 5G04C 3J5QB 3FTWA 2J8SD 1MT6A 2KCKA 4DLQA 4MI5A 1TJFA 2LSUA 3AJIA 4PS7A 2LNIA 2VTBB 4WNDA 3UTMA 1ZU2A 1K1AA 1N52A 3OXFA 5EN5D 4CEMA 4GAAA 3EUVA 4ANUA 2KC7A 1EDUA 3V30A 3CVLA 3SFYA 3FUIA 4UUCA 4G8KA 3D3MA 3AG4E 1DCQA 1SA5A 4WAFA 3Q15A 3ZXSA 3Q5MA 3OTNA 2DZNA 3M57A 1S0PA 3L82A 1INZA 4CT4A 4UQYA 1TNBA 4GYWA 2LSVA 4URKA 2P9IG 5BXOA 3EP0A 5F5EA 2QZAA 5EG2A 2QY7A 3PNLB 3PEUB 4KYOB 2L9BA 2FO7A 2NSZA 5LFAA 3O48A 3SHFA 2AWIA 4U8VD 3UM2A 5JHAA 2J49A 3PH0C 5KCMA 3FPDA 2J09A 3UINC 3ASNE 5JJ7A 3MO0A 1NA0A 1U3DA 5CCMA 1N4RA 2RKKA 2GRLA 2P2CP 2JEKA 4WWOA 4QEPA 2DCPA 4RSYA 3SFXA 3GYZA 3CBOA 3V31A 3DSUA 3UI2A 3DALA 2J07A 3FUJA 4JD2G 3B7TA 4JZYA 3GZ2A 3B13A 1PAQA 3FU6A 1MVXA 5G04J 5AYWD 3QKYA 4I6EA 1OWMA 2IFUA 5FQ4A 2A4ZA 3PVLA 2IEJA 3PE4A 2MYOA 4J7WA 4BX8A 4GA1A 4ILGA 4UQZA 4GZCA 2Y1LE 2A5EA 3HXEA 2EILE 3NOCD 1KT1A 4KZCA 2CHZA 3ZIMA 3RO3A 4ACLA 5HKPA 3SD5A 4ANVA 4DX6D 2BF0X 4YNMA 4TXPA 2GRRB 3URZA 4UI9J 1KZOA 1TN7A 3FH8A 3UKUG 1MX4A 4JEHA 2W5YA 4BETA 4DPRA 1ML9A 5JJTA 3AG3E 4MI0A 4BFRA 4GZDA 5T5GA 5LCWC 1N9AA 4CYMD 4HOTA 3F9ZA 5CCLA 4DX1A 3QWWA 5EIBE 2EIJE 1UN8A 4TXRA 3L13A 2WVIA 2F8YA 2XS8A 4ACKA 3IKOB 5H7PA 3MYVA 5M72A 3FTVA 5JINA 2VGYA 1YYHA 3BEEA 2P58C 5LP0A 2CG2A 3FUFA 3CVVA 4H12A 3FWVA 5TEGA 2VTBA 4WWNA 3SQVA 3ULQA 2WXHA 4UWLA 3GZ1A 3D9PA 1N6AA 3RIBA 3CR3A 3LY7A 2F0YA 3TAXA 4U0UA 4M7CA 2V0PA 1OCCE 4AIFA 1L5JA 3BU8A 2IONA 2Y4TA 3DSTA 4AJWA 2XS1A 5ITZF 4IN3B 2ZISA 4A63B 1WG0A 2I1KA 2NXPA 1HO8A 3DXKG 3CQCB 2I1JA 4Z68A 2AXUA 2BQZA 4CDMA 1UN9A 5AQAA 4N5CA 1Z3YA 2CFZA 3CBMA 3EU9A 4JVSA 2BEDA 4M3OA 1HG2A 2P9LG 3FTYA 4JHKA 4I51A 3CHMA 2GRQB 3KSQA 5FWQA 2J4DA 3FHEA 1A17A 2FF4A 2B0OE 4GMJA 1BPOA 3DSSA 3NZSA 3BG1B 1MYOA 4JW1A 5KBAA 1MQSA 2LXMA 3CVNA 2HM8A 4A55A 3S8PA 4NVQA 5F6LA 3TXNA 5F6KC 3P2BA 4FJZA 3X2QE 4AVXA 1N3JA 1SW6A 2XPYA 1HFAA 1PY1A 1O5MA 3LJNA 2IOSA 4U07A 5AIJA 2E0IA 2KZTB 4GTQA 3W9GA 4EZLA 2XEVA 2J9QA 5CHEE 4HI8A 3ZYLA 4KMOA 4U8YD 3SO8A 4PS8A 1NA3A 3FUMA 4GCNA 4N3BA 3R9MA 2R03A 3D9NA 3DWLG 3DPYA 3PUJA 1S70B 1HX8A 3ZPJA 4KXKB 1K3ZD 3APDA 3ULYA 4CCAA 3ASOE 4N3AA 3LVQE 3FEXA 4HNAD 4J8YA 4CGVA 2Y4UA 1E96B 2HR2A 3LKUA 3MX3A 5FZRA 4AXHA 3QAQA 1TJCA 3D9IA 3CVUA 3ULEG 3PZ4A 2JLBA 3QNKA 3CHQA 1SA4A 2WPVA 4EBAA 3U3WA 2X3MA 3HNAA 3FTZA 1H2UA 4ATZD 2QC9A 4FLBA 4YVOA 3CHRA 4KBQA 2P9SG 2UY1B 4E85A 1E90A 4UQXA 2P9PG 2EQXA 3CSTA 3QDNA 3G2WA 3S7DA 3APFA 3PRZA 4L23A 4EPZA 1ELRA 2DWZA 3IHYA 4CT0A 4L9PA 4I9CA 4DI3A 3E34A 2JABA 4GYYA 4XEIG 5FQ7A 3O4ZA 3SI5A 2KBXA 4TV3A 2PQRA 3UT4A 1JCQA 2Q7FA 3TWVA 3RJWA 3IV0A 2J08A 3D9LA 1FPPA 4A1GA 1QZ2A 3E4BA 4HB5A 4U63A 3PZDA 5FQ6A 4U8HA 2FO1E 1X81A 3SGHA 1B89A 2XQ0A 4G24A 4GCOA 4O30A 4Y6WA 3TWSA 3AG2E 2E2EA 3HDXA 1UW4B 3DBSA 2UWJG 4C0MA 4KZ0A 4RLYA 3JXJA 1H19A 3FULA 3JCKC 3MA5A 1LF8A 1G3NB 1H6OA 4MS6A 2KCLA 3SW9A 1OWOA 3PZ1A 2NYJA 3CV0A 3SY2A 4LCTA 2EINE 4BEPA 5D0OD 2KXPC 5KNHD 3EHQA 3ZVVA 3HG0D 1N0RA 2GROB 5EYLA 4JHRA 4QENA 5TH7A 4TRQA 4HOUA 2X6HA 5BT1A 1V55E 4HORA 3QWPA 1TN8A 2AVPA 3R7QA 4FU3A 3RU0A 1BI8B 2VGEA 3E37A 4UWFA 4GTPA 4P29A 3ESKA 5JHBA 3B95A 3RRMB 2KM4A 4DLOA 4ILHB 4J8EA 5KNGA 3DSXA 2YQ8A 1P5QA 3AS8A 3T8MA 3B7BA 4HFGA 1KLXA 1OWLA 2FI7A 3F6QA 2BKGA 5KJMA 3MJWA 3DRAA 3Q75A 3RO2A 2X6IA 3NOGD 2PM6A 4CDNA 3BUAA 3CK8A 4IJDA 2XEEA 3QOUA 1E8XA 4ZHBA 2H6IA 3KS2A 5TTFA 4H7YA 3FU5A 4BTBA 5ENSD 5BPPA 5D66A 4AM9A 4U7EB 3TWQA 4N3CA 2F8XK 4XE0A 5FZSA 1EPUA 3ZU7B 1IQUA 4DI4A 2OEVA 3PUKA 1QYMA 2WXIA 3OS5A 3LY9A 3DEOA 4O1OA 4DK5A 5CEAA 3M54A 2IOLA 2L6JA 1QBQA 2F37A 4MRUA 3GZSA 2R3AA 3Q73A 1O9SA 1O1SA 1HS6A 4B0ZA 4UI9C 4BT8A 5C1DA 4HLEA 3D9MA 1HZ4A 2BKKB 3KEAA 4GA2A 2XPZA 3CVXA 4XKBA 3R9AB 4YDYA 2I9CA 2R2LA 3CQGB 1HG5A 2OV8A 2IY0C 2Y69E 2VGXA 5CEDB 3FUEA 4XI0A 1K8KG
chains in the Genus database with same CATH topology
4XKCA 2WXPA 3FUFA 5JJ0A 5EX0A 3CVVA 4H12A 3FWVA 5TEGA 4MKTA 4L2YA 4L2LA 3RRUA 4LDGA 3S7BA 2VTBA 4WWNA 1FCHA 5KJNA 4JPSA 3ZYMA 3ULQA 3BO5A 4N39A 4ATGA 3LYAA 2WXHA 3AS5A 2CHWA 4UWLA 3JQ1A 4XZ4A 4YPEA 4JLGA 3GZ1A 3D9PA 3HVEB 4G1TA 1N6AA 1E8YA 3TGOA 3OOIA 4MLPA 2XGOA 3G2VA 3UT8A 3ONKA 3R7RA 2G46A 1UJJA 1FVFA 1OWPA 2WQ7A 1WY6A 3RIBA 4FC8A 3SF4A 3FUNA 3KMJA 3CR3A 4K03A 5ARGA 3LY7A 3M58A 4WNGA 4KVMA 5E76A 4HVBA 4BT9A 3TAXA 2V8SE 4U0UA 2V0PA 4QEOA 4AIFA 1L5JA 2PZIA 4PDXA 2IONA 2CFUA 2RFIA 2WXKA 2Y4TA 5JIYA 2JV0A 4HXIA 4IYPA 4AJWA 4F7AA 3MO5A 3F9XA 3MZLB 3PDNA 4EECA 4IN3B 4GMLA 4F1SA 3RK6A 5HQ8A 4FJYA 4NQ0A 5KJKA 2I1KA 4RZ0A 3JUIA 4I6GA 3SNXA 5BUZA 3MKRA 3CKBA 2FULA 2NXPA 3ZYQA 1HO8A 4JA7A 5J08A 4IJ8A 3OAWA 3MV3B 3CQCB 5C2YA 1UG3A 2I1JA 2OVFA 2AXUA 4OVVA 2BQZA 3NF1A 4B94A 4CDMA 4NACA 2RD0A 3TJPA 1UN9A 2WXRA 3ZN3A 3DPDA 2MRIA 4PH4B 1ELKA 1H2VC 4N2SA 4LRZA 4YPAA 3I4GA 4H7XA 4N5CA 4AOFA 5ARFA 3APCA 1Z3YA 3LEWA 2CFZA 3CBMA 3ZGQA 4JVSA 4WNFA 5JHNA 3OXGA 3CVQA 3FDHA 1HG2A 3ENEA 3FTYA 3BG0B 4JHKA 4M3OA 5LSXA 1N6CA 3L16A 4I51A 2V5FA 2YHCA 4RVBA 3CHMA 2IJGX 5G55A 4J7FA 3L6AA 4NURA 3L08A 3FUHA 5FWQA 3TG4A 4EZKA 2J4DA 4GA0A 3FHEA 1MHQA 1A17A 2FF4A 3CKCA 5CMYA 3RRNB 4J6IA 3CVWA 4G23A 4F53A 1E8WA 4GMJA 5CMWA 1BPOA 2BUGA 4FP7A 3U64A 4G26A 5J90A 1PEGA 2W5ZA 1ZBPA 3NZSA 4WNEA 3UT7A 3BG1B 1NP7A 3ASGA 4JW1A 1MQSA 4LEUA 5A7DB 1DVPA 1SQMA 2L0TB 3PEVB 4Z4PA 3CVNA 1XNFA 2X6JA 2HM8A 5EX3A 3T5XA 4A55A 4BY6A 4JDSA 4JEUA 4NVQA 3S8PA 5F6LA 3TXNA 5F6KC 3LCAA 3UQ3A 3RQ4A 3P2BA 4FJZA 4AVXA 3AS4A 4XI9A 4PUCA 2XPYA 1N3JA 2DBAA 1HFAA 1PY1A 4U0SA 4I17A 5T0KA 1NZNA 4GU5A 3JQ0A 3CHOA 3S7FA 3CEQA 2XGMA 3L22A 4F3VA 1H3IA 1XGWA 2CG3A 4QFVA 4IRUA 2IOSA 3TL5A 4U07A 5BV1A 4C0EA 1QNFA 1IYGA 3IHVA 2E0IA 2KZTB 3CIAA 4AP2A 2XHEA 5AIJA 3CK7A 5G2NA 4EZLA 3M5AA 4FHJA 2RG8A 3U4TA 5BW8C 3ZW3A 3NQPA 2XEVA 4BUPA 2J9QA 5CHEE 2WXJA 3AU4A 2GRMA 2VSYA 4BWRA 5AJLA 4KMOA 3ZYLA 1SZAA 3K5KA 1QQEA 3M53A 2KZTA 3EHNA 4PS8A 1NA3A 3FUMA 4GCNA 2C0MA 5CPRB 1IQRA 4N3BA 1EYHA 3HHMA 4G25A 4XIFA 1W3BA 3D9NA 2M63A 4K0RA 5ANRA 4I9EA 4O6FA 4YPUA 3PUJA 3FY4A 2MOWA 2WQHA 3ONLA 3D9KA 1HX8A 3ZPJA 3FP3A 5FTPA 4HS2A 4KXKB 4J8DA 4Q96A 5FQ8A 4CGWA 4UI9K 1ZKKA 3GW4A 4APFA 3AU5A 3APDA 4C1QA 2MHKA 1X5BA 3CHSA 1HF8A 3TXMA 4CCAA 4N3AA 3M55A 3RAYA 3LVQE 2OVBA 2VJ8A 3FEXA 4IULA 3SBSA 4CGVA 2Y4UA 4W9RA 4I2ZA 1E96B 2HR2A 2KCVA 3LKUA 4LUNU 1VDYA 3QC1A 5LOZA 1XQHA 1WM5A 2ILRA 1EF1C 3ESLA 3MX3A 5FZRA 4AXHA 5D0QD 3Q49B 2F69A 1JWGA 2FEZA 3OPEA 2AXVA 3IEGA 3QAQA 1TJCA 3TG5A 1HE8A 3D9IA 4CRWA 3CVUA 4I6JA 4RG6A 2X6KA 1SZ9A 2JLBA 4Q94A 4JXTA 1H6KA 3Q4AB 3MGBA 3QNKA 4HOQA 5KJLA 4JL0A 2DIWA 3PREA 3CHQA 5E75A 2IU1A 3U66A 2WPVA 3OXLA 4EBAA 3U3WA 2X3MA 3HNAA 3FTZA 3LS8A 5FZQA 5LCWJ 3ZHEA 4UWGA 1H2UA 2PM7A 4FLHA 5ENNA 1Z6TA 2XCBA 2GGFA 4FULA 3VLFA 3F9YA 4FLBA 4JHJA 4YVOA 2R17C 3ZEFA 3B7UX 1TEZA 3CHRA 2WXMA 2WMOA 4KBQA 3QWVA 4L1BA 1ELWA 2XRZA 3FU3A 2UY1B 4E85A 4FA6A 5A6CA 2Y3AA 5DIZA 3CVPA 4FHKA 4U04A 5AJDA 1HXIA 4UWKA 3WXXA 1E90A 4UQXA 3MO2A 3QDNA 2EQXA 3CSTA 5T4YA 3G2WA 3S7DA 2KATA 1DNPA 3APFA 1MVHA 2HYZA 2OOEA 3PRZA 3ASDA 1GW6A 2VSOE 1KT0A 2LAIA 3B7RL 4L23A 4EPZA 1ELRA 3RKVA 4HOSA 4YVQC 3G2TA 4JC8A 3IHYA 3PE3A 2C0LA 4CT0A 3C98A 4I9CA 1HH8A 4DI3A 3CHPA 2VSXE 4GYYA 5DBKA 4G2VA 5G04C 1YA0A 3FTWA 1MT6A 2KCKA 2WM9A 4APOA 3EJNA 5FQ7A 4CDRA 4DLQA 3O4ZA 3SI5A 4MI5A 4TV3A 2PQRA 2WXNA 1TJFA 2LSUA 3HVEA 3KD7A 4J83A 3UT4A 2Q7FA 2AXZA 3RJWA 4PS7A 2LNIA 2VTBB 3FEYA 4WNDA 3IV0A 5EDSA 3LXUX 1ZU2A 2J08A 3D9LA 3Q47B 2O8JA 1N54A 1N52A 3OXFA 4CEMA 4GAAA 1JWFA 3FH5A 3SBTB 4A1GA 4ANUA 1QZ2A 3SFZA 2KC7A 1EDUA 3E4BA 3EIQC 3MCXA 3CK9A 4AY6A 2IQCA 4TUUA 3CVLA 4U63A 3JYSA 3PZDA 5FT9A 3UMVA 3LPZA 5FQ6A 4U8HA 3SGHA 1B89A 3PNTB 2XQ0A 3FUIA 4G24A 4B8CB 4GCOA 4LERA 5LX8A 3NZUA 4UWHA 4O30A 2J4BA 3D3MA 4I1MA 4Y6WA 4N2QA 2E2EA 3QARA 2X6FA 1E8ZA 4WAFA 3ZRHA 4NJ5A 3Q15A 3ZXSA 3Q5MA 3HDXA 2XCCA 2QPWA 1Z3XA 3OTNA 1UW4B 3M57A 3DBSA 2UWJG 4Y6CA 1S0PA 4KZ0A 4C0MA 4D10C 3L54A 5T8IA 3MV2B 5T3RA 3G2UA 1INZA 1Y8MA 4CT4A 3IHXA 4FMUA 3L17A 4UQYA 4GYWA 4C9BB 2LSVA 1H19A 3FULA 3PS6A 2IF4A 3JCKC 4OVUA 4B8AA 4DJAA 3MA5A 2QFCA 4URKA 1LF8A 4BTAA 3UPVA 3MKQA 3QB2A 3EP0A 3FTXA 4MS6A 3VTYA 5F5EA 5EG2A 4JA9A 2QY7A 2XPIA 2KCLA 3PNLB 3PEUB 4KYOB 3SW9A 1OWOA 2L9BA 4R7LA 2FO7A 4BSXA 2NSZA 4B89A 3CV0A 4LCTA 5LFAA 3O48A 5D0OD 4A1SA 4I2WA 3ZVVA 3SHFA 2ZU6B 1PC2A 1JUQA 2L0IA 3M59A 3SWCA 2AWIA 4Q69A 3D9JA 3HIZA 4JHRA 3VUZA 4QENA 5TH7A 4TRQA 5JHAA 4HOUA 3VLEA 2X6HA 4I1AA 1HU3A 5BT1A 2I6HA 2J49A 3PH0C 4L7TA 4HORA 5F59A 5KCMA 4A3TA 3QWPA 3FPDA 5BNWA 2J09A 5HI7A 1OUVA 2AVPA 3FTSA 3ML8A 4WWPA 3R7QA 4GZ6A 5JJ7A 3MO0A 4FU3A 3RU0A 2NC9A 4ANXA 1NA0A 1U3CA 1U3DA 4I43A 4J8FA 4UWFA 5ANLA 4P29A 5CCMA 4XX5A 4GPKA 3ESKA 5JHBA 4EZJA 2GRLA 5A23A 2CHXA 3FUKA 2JEKA 3I5PA 4WWOA 3VLDA 2VYIA 3RRMB 2KM4A 3VTXA 2C2LA 4QEPA 4DLOA 4ILHB 4J8EA 2DCPA 3K9IA 4RSYA 3MKQB 2XRYA 3ASHA 2WXQA 3S7JA 3GYZA 4ABNA 2YQ8A 1P5QA 3CBOA 3AS8A 4FADA 5AYFA 5FJYA 2VQ2A 3T8MA 3DALA 4HFGA 5G05C 1KLXA 1OWLA 2FI7A 2J07A 3EDTB 3FUJA 3FUDA 4A3VA 2LAHA 2A5UA 3B7TA 1MUFA 5LSZA 4JZYA 5KJMA 3GZ2A 3MJWA 3B13A 5AENA 1PAQA 1UJKA 3RO2A 3EHMA 3FU6A 2YHEA 2ONDA 2X6IA 1MVXA 2PM6A 3CLJA 5G04J 5AYWD 3CVYA 3FTUA 3QKYA 4CDNA 4I6EA 5BV0A 1OWMA 1Y6IA 2IFUA 5FQ4A 2A4ZA 3CK8A 3PVLA 4G11A 4IJDA 3PE4A 3QOUA 4BX8A 4GYOA 4ANWA 2BTDA 2I2OA 1E8XA 3KS2A 5TTFA 4KVOA 3IBEA 4J8SA 4GA1A 4H7YA 4ILGA 4UQZA 4J7IA 4GZCA 3FU5A 4WUYA 2WXGA 4RG9A 4AEZC 3P1UA 4BTBA 1KT1A 4KZCA 3HYMB 3F9WA 3SZ7A 3ML9A 4NRHB 3LDZA 5BPPA 3KEZA 2CHZA 4GB9A 1E7VA 2WXLA 4AM9A 3MEKA 3ZIMA 4ILIA 3DB5A 3LVRE 1H2TC 3RO3A 4N3CA 4ACLA 3N71A 5EKQD 2XGSA 3FFLA 4XE0A 5FZSA 5G05J 3SD5A 4ANVA 2WQ6A 1EPUA 4E47A 2BF0X 2WXOA 4YNMA 3KMAA 2X38A 1IQUA 3S2AA 3UUXA 4DI4A 5T0MA 3URZA 3PUKA 3OS5A 1JPLA 2WXIA 3LY9A 4UI9J 3M56A 3LY8A 4V3IA 2FBNA 2R5SA 3FH8A 3D9OA 1H0AA 4DK5A 4JEHA 3M54A 2IOLA 4AU7A 3VV0A 2L6JA 1OWNA 3I4RB 3LJ3A 2W5YA 4MRUA 4U0ZA 3GZSA 4DPRA 1IHGA 2AW6A 4EQFA 5JJTA 1ML9A 1O9SA 2R3AA 4MI0A 1HS6A 4BFRA 2GW1A 4GZDA 4B0ZA 2UY1A 4GZ3A 5T5GA 4AV7A 4UI9C 4BT8A 5LCWC 5C1DA 3RJVA 4HLEA 3T5VA 4HOTA 4KT6B 3D9MA 3F9ZA 4J8OA 4AY5A 5CCLA 1WAO1 4EBAG 3QWWA 1HZ4A 2R59A 2VSNA 2V4LA 1UN8A 3ZYKA 2YINA 2WB2A 3ASFA 3ZHEB 4GA2A 2XPZA 3L13A 3ZFWA 2PQNA 2WVIA 3FH7A 4ACKA 3KAEA 3CVXA 4XKBA 3R9AB 2WXFA 4ME2A 3FU0A 3IKOB 3U9WA 2I9CA 3MYVA 3G2SA 5M72A 4YNPA 3FTVA 3CBPA 4GZ5A 3I3NA 3CQGB 4J0UA 5JINA 2VGYA 2YNQA 2VGXB 1HG5A 5JJ6A 2OV8A 2HO1A 3BEEA 3CSFA 2LO6A 2IGQA 2P58C 4YNDA 4BX9A 2WMNA 3EIJA 3B7SA 3QJZA 1E7UA 3QK0A 4PS3A 3CGHA 5LP0A 2VGXA 3KMTA 1FVHA 3UX4A 4I1OB 2CG2A 4OYSA 4E6HA 3FUEA 4XI0A 2PL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ0 A;  5EX0 A;  4H12 A;  3FWV A;  5TEG A;  4LDG A;  3S7B A;  1FCH A;  5KJN A;  3BO5 A;  3ULQ A;  4N39 A;  3LYA A;  3AS5 A;  4YPE A;  4JLG A;  3GZ1 A;  4G1T A;  1N6A A;  3TGO A;  3OOI A;  2XGO A;  3RIB A;  3SF4 A;  3KMJ A;  5ARG A;  3M58 A;  3LY7 A;  4WNG A;  4BT9 A;  3TAX A;  4U0U A;  4QEO A;  4AIF A;  2PZI A;  2RFI A;  5JIY A;  2Y4T A;  3MO5 A;  3F9X A;  3PDN A;  4IN3 B;  5HQ8 A;  4NQ0 A;  5KJK A;  4RZ0 A;  3MKR A;  3CKB A;  4JA7 A;  4IJ8 A;  3MV3 B;  2BQZ A;  3NF1 A;  4B94 A;  3ZN3 A;  4N2S A;  4YPA A;  4H7X A;  4N5C A;  5ARF A;  3CBM A;  3ZGQ A;  4WNF A;  5JHN A;  3OXG A;  3CVQ A;  5LSX A;  1N6C A;  4I51 A;  2V5F A;  2YHC A;  4J7F A;  3TG4 A;  4GA0 A;  2FF4 A;  1A17 A;  3CKC A;  4G23 A;  3M55 A;  2BUG A;  1PEG A;  4G26 A;  2W5Z A;  1ZBP A;  4WNE A;  3ASG A;  4LEU A;  5A7D B;  4Z4P A;  1XNF A;  3CVN A;  5EX3 A;  4JDS A;  3S8P A;  4NVQ A;  5F6L A;  5F6K C;  3LCA A;  3UQ3 A;  3RQ4 A;  1N3J A;  3AS4 A;  4XI9 A;  2DBA A;  4U0S A;  4I17 A;  5T0K A;  1NZN A;  4F3V A;  3S7F A;  1H3I A;  3CEQ A;  2XGM A;  4U07 A;  1IYG A;  3M5A A;  3CK7 A;  3U4T A;  5BW8 C;  4BUP A;  2XEV A;  2J9Q A;  5CHE E;  2VSY A;  4BWR A;  3K5K A;  1QQE A;  3M53 A;  1NA3 A;  4GCN A;  2C0M A;  5CPR B;  4N3B A;  4G25 A;  4XIF A;  1W3B A;  4I9E A;  4O6F A;  4YPU A;  2WQH A;  3ZPJ A;  3FP3 A;  5FTP A;  4KXK B;  4J8D A;  4CGW A;  4UI9 K;  1ZKK A;  3GW4 A;  4C1Q A;  2MHK A;  3RAY A;  4N3A A;  4CGV A;  2Y4U A;  4W9R A;  4I2Z A;  1E96 B;  2HR2 A;  2KCV A;  3LKU A;  1XQH A;  1WM5 A;  5FZR A;  5D0Q D;  3Q49 B;  2F69 A;  2FEZ A;  3OPE A;  3IEG A;  1TJC A;  3TG5 A;  4RG6 A;  2JLB A;  3Q4A B;  4HOQ A;  5KJL A;  4JL0 A;  2WPV A;  3OXL A;  3U3W A;  3HNA A;  5LCW J;  5FZQ A;  3ZHE A;  2XCB A;  3F9Y A;  4YVO A;  4KBQ A;  3QWV A;  1ELW A;  2UY1 B;  5A6C A;  5DIZ A;  3CVP A;  3WXX A;  4U04 A;  1HXI A;  4UQX A;  3MO2 A;  3QDN A;  3S7D A;  2KAT A;  1MVH A;  2G46 A;  2HYZ A;  2OOE A;  2JV0 A;  3ASD A;  4HOS A;  1KT0 A;  1ELR A;  3RKV A;  4YVQ C;  3PE3 A;  2C0L A;  4I9C A;  1HH8 A;  4GYY A;  5DBK A;  4G2V A;  5G04 C;  1YA0 A;  1MT6 A;  2KCK A;  4APO A;  4CDR A;  4MI5 A;  2PQR A;  2LSU A;  3KD7 A;  4J83 A;  2Q7F A;  3RJW A;  2LNI A;  4WND A;  1ZU2 A;  3Q47 B;  2O8J A;  3OXF A;  1QZ2 A;  2KC7 A;  3E4B A;  3CK9 A;  4AY6 A;  3CVL A;  3JYS A;  5FT9 A;  3LPZ A;  1B89 A;  4G24 A;  4GCO A;  4O30 A;  4Y6W A;  4N2Q A;  2E2E A;  4NJ5 A;  3Q15 A;  3Q5M A;  2XCC A;  2QPW A;  3M57 A;  4Y6C A;  2UWJ G;  3MV2 B;  1Y8M A;  3IHX A;  4FMU A;  4UQY A;  4GYW A;  2LSV A;  2IF4 A;  3MA5 A;  2QFC A;  4BTA A;  3UPV A;  3EP0 A;  3VTY A;  5F5E A;  5EG2 A;  4JA9 A;  2KCL A;  2XPI A;  4KYO B;  3SW9 A;  2FO7 A;  3CV0 A;  3O48 A;  5D0O D;  4A1S A;  4I2W A;  1PC2 A;  3M59 A;  3SWC A;  4JHR A;  3VUZ A;  4QEN A;  5TH7 A;  4HOU A;  4I1A A;  5BT1 A;  2I6H A;  4HOR A;  5F59 A;  3QWP A;  3FPD A;  5BNW A;  5HI7 A;  1OUV A;  2AVP A;  5JJ7 A;  4GZ6 A;  3MO0 A;  3RU0 A;  2NC9 A;  1NA0 A;  4J8F A;  5CCM A;  4GPK A;  3ESK A;  3VTX A;  2VYI A;  2C2L A;  4QEP A;  4J8E A;  3K9I A;  3ASH A;  3S7J A;  3GYZ A;  4ABN A;  2YQ8 A;  1P5Q A;  3CBO A;  3AS8 A;  5AYF A;  5FJY A;  2VQ2 A;  3DAL A;  5G05 C;  1KLX A;  2FI7 A;  3EDT B;  5LSZ A;  1MUF A;  5KJM A;  3GZ2 A;  3RO2 A;  2OND A;  1MVX A;  5G04 J;  5AYW D;  3QKY A;  2IFU A;  3CK8 A;  4IJD A;  3PE4 A;  3QOU A;  4GYO A;  3KS2 A;  5TTF A;  4GA1 A;  4H7Y A;  4UQZ A;  4J7I A;  4WUY A;  4RG9 A;  4BTB A;  1KT1 A;  3HYM B;  3F9W A;  3SZ7 A;  4NRH B;  4AM9 A;  3MEK A;  3DB5 A;  3RO3 A;  4N3C A;  3N71 A;  5EKQ D;  2XGS A;  3FFL A;  5FZS A;  5G05 J;  4E47 A;  4YNM A;  3KMA A;  3UUX A;  5T0M A;  3URZ A;  3OS5 A;  3LY9 A;  4UI9 J;  3M56 A;  3LY8 A;  2FBN A;  2R5S A;  3M54 A;  4AU7 A;  3VV0 A;  2L6J A;  2W5Y A;  4U0Z A;  1ML9 A;  1IHG A;  4EQF A;  5JJT A;  2R3A A;  1O9S A;  4MI0 A;  2GW1 A;  2UY1 A;  4GZ3 A;  5T5G A;  5LCW C;  4UI9 C;  4BT8 A;  5C1D A;  3RJV A;  4HOT A;  3F9Z A;  4J8O A;  4AY5 A;  5CCL A;  1WAO 1;  3QWW A;  1HZ4 A;  2VSN A;  3ASF A;  3ZHE B;  4GA2 A;  3ZFW A;  2PQN A;  3KAE A;  3R9A B;  4ME2 A;  5M72 A;  4YNP A;  3CBP A;  4GZ5 A;  4J0U A;  5JIN A;  2VGY A;  2VGX B;  5JJ6 A;  2HO1 A;  3BEE A;  2IGQ A;  2P58 C;  4YND A;  2VGX A;  3KMT A;  4XI0 A;  2PL2 A; 
#chains in the Genus database with same CATH topology
 4XKC A;  5ENT D;  1OY3 D;  1FCH A;  4N39 A;  4ATG A;  3LYA A;  3UM3 A;  5EIL A;  4XZ4 A;  3HVE B;  2ETB A;  3OOI A;  4MLP A;  2XGO A;  3G2V A;  2QYJ A;  4GPM A;  1WY6 A;  1N4P A;  3KMJ A;  2RFM A;  5ARG A;  4TXQ A;  4HVB A;  1TYQ G;  4BES A;  2H6G A;  2V8S E;  5CRV A;  5JIY A;  2ZIR A;  5ENR D;  4EEC A;  3JUI A;  1BD8 A;  4I6G A;  3SNX A;  5BUZ A;  2FUL A;  4JA7 A;  5J08 A;  5CER B;  3NF1 A;  2RD0 A;  3UM1 A;  3L9T A;  3TJP A;  2WXR A;  1H2V C;  4N2S A;  4LRZ A;  4H7X A;  5ARF A;  4CZ2 D;  5JHN A;  2V5F A;  4C48 B;  3L6A A;  4LNG A;  1U2V G;  3FUH A;  2H6F A;  2DVW A;  4GA0 A;  5CMY A;  3CKC A;  1DCE A;  4G23 A;  1E8W A;  3C72 A;  5CMW A;  2BUG A;  3M55 A;  1ZBP A;  4WNE A;  3PZ2 A;  1NP7 A;  3ASG A;  4LEU A;  1MX2 A;  1SQM A;  2L0T B;  2X6J A;  5EX3 A;  4BY6 A;  3HXC A;  3UQ3 A;  3RQ4 A;  4XI9 A;  4U0S A;  5T0K A;  3CHO A;  2XGM A;  1XGW A;  4IRU A;  5BV1 A;  4DX2 A;  2XHE A;  3ZW3 A;  2RG8 A;  4MBG A;  4OAU C;  4DX5 D;  2WXJ A;  3AU4 A;  4LNU D;  1SZA A;  1TNY A;  3K5K A;  1QQE A;  3M53 A;  4G25 A;  2M63 A;  4K0R A;  5ANR A;  2ETA A;  3AG1 E;  2L6B A;  2MOW A;  2WQH A;  2AJA A;  3FP3 A;  5FTP A;  4HS2 A;  4Q96 A;  4CGW A;  4UI9 K;  5HS0 A;  1ZKK A;  3Q78 A;  3UIO C;  2MHK A;  1HF8 A;  4BSZ B;  4HRM B;  3SBS A;  4W9R A;  4LUN U;  1VDY A;  4EHM A;  1K1B A;  3TWR A;  3DEP A;  1JWG A;  3E30 A;  3TG5 A;  1HE8 A;  5AN8 A;  4RG6 A;  4Q94 A;  4JXT A;  4HOQ A;  3UM0 A;  4JL0 A;  1WDY A;  2GRN B;  3AAA C;  4FLH A;  5ENN A;  1Z6T A;  2XCB A;  4HI9 A;  3NB2 A;  1IHB A;  2GGF A;  4FUL A;  3B7U X;  1IKN D;  2WXM A;  3Q9U C;  2H6H A;  1OCR E;  4LG6 A;  2XRZ A;  5AJD A;  3EHR A;  4UWK A;  3IXE A;  2KAT A;  1DNP A;  1MVH A;  2G46 A;  1GW6 A;  2VSO E;  4HOS A;  1KT0 A;  3G2T A;  2C0L A;  5DBK A;  3T8K A;  1YA0 A;  2P9K G;  2WM9 A;  2OCC E;  2WXN A;  3E33 A;  3FEY A;  5EDS A;  3LXU X;  3FH5 A;  1O1T A;  3EIQ C;  4AY6 A;  5D2M C;  3JYS A;  5FT9 A;  3HXB A;  3LPZ A;  3UIP C;  3PNT B;  4B8C B;  3V2O A;  4LER A;  3NZU A;  4UWH A;  4I1M A;  1YCS B;  3QAR A;  2X6F A;  1E8Z A;  3ZRH A;  4NJ5 A;  2B6C A;  2QPW A;  1Z3X A;  4Y6C A;  4D10 C;  3ABK E;  3L54 A;  5T8I A;  3MV2 B;  4GTR A;  3G2U A;  3IHX A;  4FMU A;  3PS6 A;  4B8A A;  4GTO A;  2IF4 A;  4DJA A;  4OVU A;  4K5A B;  1OCO E;  4BTA A;  4B93 B;  3FTX A;  3VTY A;  5CEC B;  3WG7 E;  1MX6 A;  1O1R A;  1Q2Z A;  2Y0B G;  4A1S A;  1PC2 A;  1JUQ A;  3M59 A;  3SWC A;  3HIZ A;  1H6P A;  3VUZ A;  1TNO A;  3VLE A;  3Q7F A;  2I6H A;  1MJ0 A;  3V2X A;  4HQD A;  5BNW A;  3ML8 A;  4WWP A;  4GZ6 A;  1U3C A;  4I43 A;  4J8F A;  5ANL A;  4XX5 A;  5A23 A;  1AP7 A;  3I5P A;  2VYI A;  3DXM G;  1TNZ A;  2XRY A;  3ASH A;  2WXQ A;  3S7J A;  4ABN A;  3Q79 A;  5FJY A;  2VQ2 A;  2V4H C;  1MUF A;  5AEN A;  3EHM A;  2YHE A;  3CLJ A;  3CVY A;  3FTU A;  5BV0 A;  4G11 A;  2BTD A;  2I2O A;  1SVX A;  4J8S A;  4G8L A;  3Q7A A;  5ENQ D;  4WUY A;  2WXG A;  4RG9 A;  4AEZ C;  3P1U A;  1FT1 A;  3HYM B;  3F9W A;  1OCZ E;  2EIK E;  4NRH B;  3ZKJ A;  3KEZ A;  4GB9 A;  2WXL A;  3HXD A;  4BER A;  4ILI A;  3LVR E;  3N71 A;  5EKQ D;  2XGS A;  3FFL A;  5G05 J;  2WXO A;  1UOH A;  2EIM E;  2X38 A;  3S2A A;  3UUX A;  5T0M A;  1JPL A;  3M56 A;  2R5S A;  3D9O A;  1H0A A;  4AU7 A;  3VV0 A;  1OWN A;  3LJ3 A;  1LD7 A;  1IHG A;  2AW6 A;  1RW2 A;  4GTM A;  2UY1 A;  3KSL A;  3RJV A;  1BU9 A;  3T5V A;  4AY5 A;  1WAO 1;  4EBA G;  1S64 A;  3ZYK A;  2YIN A;  2WB2 A;  3ASF A;  3ZHE B;  2P9U G;  3TWT A;  3ZFW A;  2PQN A;  4DX7 D;  3JXI A;  4ME2 A;  3U9W A;  3ABL E;  3G2S A;  5CBN A;  4YNP A;  3I3N A;  2P9N G;  4J0U A;  2VGX B;  2XZT G;  5JJ6 A;  2HO1 A;  3CSF A;  2LO6 A;  3QK0 A;  1E7U A;  1NFI E;  5B1A E;  1FT2 A;  1IXV A;  3UX4 A;  3KMT A;  4X8Q A;  2LUH A;  2PL2 A;  2WXP A;  5JJ0 A;  5EX0 A;  4L2Y A;  3RRU A;  1D9S A;  4LDG A;  3S7B A;  5KJN A;  1LTX A;  3JQ1 A;  4YPE A;  4JLG A;  4G1T A;  5JMN D;  1E8Y A;  3TGO A;  3UT8 A;  3ONK A;  3R7R A;  1UJJ A;  1FVF A;  1OWP A;  1N11 A;  4FC8 A;  3SF4 A;  3FUN A;  3M58 A;  2OEW A;  4KVM A;  5E76 A;  4BT9 A;  1NI1 A;  4QEO A;  5IY5 E;  4HRL A;  4HXI A;  4IYP A;  3MZL B;  4F1S A;  3EU5 A;  5HQ8 A;  4FJY A;  4RQI A;  1DC2 A;  3CKB A;  4ZFH A;  1KPS B;  3OAW A;  2OVF A;  5KWD A;  4NAC A;  3ZN3 A;  3DPD A;  2MRI A;  1ELK A;  5FIN A;  4YPA A;  4AOF A;  3APC A;  3LEW A;  3ZGQ A;  4WNF A;  3OXG A;  1JCS A;  3ENE A;  5EYP F;  5LSX A;  1N6C A;  4GTV A;  5G55 A;  4J7F A;  4NUR A;  3ISM C;  3L08 A;  2PNN A;  3TG4 A;  2IO3 C;  1PEG A;  4FP7 A;  5J90 A;  2W5Z A;  4HBD A;  3PEV B;  3T5X A;  4JDS A;  2ETC A;  3LCA A;  2V5Q C;  2XZD G;  2IO2 C;  1NZN A;  3HRA A;  2XEN A;  4F3V A;  3JQ0 A;  4YDE A;  3S7F A;  3L22 A;  1N95 A;  2CG3 A;  4QFV A;  4TUM A;  1QNF A;  3CIA A;  4AP2 A;  3CK7 A;  4FHJ A;  3U4T A;  5BW8 C;  1MZC A;  3NQP A;  4BUP A;  2VSY A;  5AJL A;  1TN6 A;  1IQR A;  3TWU A;  5ENO D;  3HHM A;  4K5B A;  4XIF A;  1W3B A;  4YPU A;  2RFA A;  2LXL A;  3D9K A;  4J8D A;  5FQ8 A;  3AU5 A;  1V54 E;  4C1Q A;  5AAO A;  1X5B A;  2OVB A;  2VJ8 A;  1XQH A;  3W9F A;  1EF1 C;  2FEZ A;  2AXV A;  2DZO A;  4CRW A;  2X6K A;  1H6K A;  3Q4A B;  3DSV A;  2DIW A;  3U66 A;  2IU1 A;  5AQB A;  5B1B E;  1N0Q A;  3F9Y A;  4JHJ A;  1TEZ A;  2WMO A;  3RSE G;  1ELW A;  3FU3 A;  2Y3A A;  3CVP A;  3WXX A;  4FHK A;  3Q9N C;  4U04 A;  3TWX A;  2ZXW E;  3MO2 A;  5AQ9 A;  2JV0 A;  1LD8 A;  3HXF A;  4DUI A;  3PE3 A;  3ZUV B;  4DRX E;  2VSX E;  4G2V A;  4APO A;  3EJN A;  4CDR A;  4J83 A;  3HVE A;  3KD7 A;  3C3R A;  4F1P A;  2AXZ A;  3Q47 B;  2O8J A;  1N54 A;  3TWW A;  1JWF A;  3SBT B;  3SFZ A;  3MCX A;  3CK9 A;  2IQC A;  4TUU A;  4HLL A;  3UMV A;  3UXG A;  4O1P A;  5LX8 A;  2J4B A;  4N2Q A;  1N94 A;  3ABM E;  2XCC A;  4GTT A;  3C3Q A;  5T3R A;  1Y8M A;  3L17 A;  4C9B B;  2DYS E;  3NAW A;  2QYU A;  5BXU A;  2QFC A;  3UPV A;  4GTS A;  3MKQ A;  5EID A;  3QB2 A;  2DYR E;  4JA9 A;  2XPI A;  3RAU A;  4R7L A;  4BSX A;  4B89 A;  4N5Q A;  3J5P A;  4I2W A;  2ZU6 B;  1N4S A;  2L0I A;  5FIO A;  4Q69 A;  3D9J A;  3ZXP A;  4I1A A;  1HU3 A;  1BI7 B;  4L7T A;  5F59 A;  4A3T A;  5HI7 A;  1OUV A;  3FTS A;  2NC9 A;  4ANX A;  4GPK A;  4EZJ A;  2CHX A;  3FUK A;  3VTX A;  3UKR G;  3VLD A;  2C2L A;  3K9I A;  3MKQ B;  2XEH A;  4FAD A;  5AYF A;  4U96 D;  5G05 C;  3FUD A;  3EDT B;  4A3V A;  2LAH A;  2A5U A;  5LSZ A;  1UJK A;  2R05 A;  2OND A;  2GRP B;  1N4Q A;  1Y6I A;  4GYO A;  4ANW A;  4OAV B;  3E32 A;  4KVO A;  3IBE A;  4JB8 P;  4J7I A;  1A5E A;  4NIK A;  3ZNG A;  2ZGG A;  1NL4 A;  3SZ7 A;  3ML9 A;  3LDZ A;  1E7V A;  3MEK A;  3DB5 A;  1H2T C;  2WQ6 A;  4E47 A;  3KMA A;  1JCR A;  3LY8 A;  4V3I A;  4F6R D;  2FBN A;  4YDW A;  1RZ4 A;  3I4R B;  4U0Z A;  4EQF A;  3NBN B;  2GW1 A;  4GZ3 A;  4AV7 A;  4KT6 B;  4J8O A;  3D9H A;  2R59 A;  2VSN A;  2V4L A;  2ZGD A;  3FH7 A;  3KAE A;  5AAR A;  2WXF A;  3FU0 A;  1KZP A;  4YDO A;  3CBP A;  4GZ5 A;  2YNQ A;  2IGQ A;  4YND A;  4BX9 A;  2WMN A;  1Z5S C;  3B7S A;  3EIJ A;  3QJZ A;  4PS3 A;  3CGH A;  4K5C A;  1FVH A;  4I1O B;  4OYS A;  4E6H A;  1BLX B;  3DSW A;  4MKT A;  4L2L A;  5ENP D;  3BO5 A;  4JPS A;  3ZYM A;  1TNU A;  3AS5 A;  2CHW A;  3C5R A;  2WQ7 A;  2R02 A;  5JA4 D;  4K03 A;  4WNG A;  1ZB1 A;  2PZI A;  4PDX A;  2RFI A;  2CFU A;  2WXK A;  3MO5 A;  4F7A A;  3F9X A;  3PDN A;  4GML A;  3RK6 A;  4NQ0 A;  5KJK A;  4RZ0 A;  3MKR A;  3C3O A;  3ZYQ A;  4IJ8 A;  3MV3 B;  5C2Y A;  1UG3 A;  4OVV A;  4B94 A;  3BQO A;  1OXJ A;  4PH4 B;  3I4G A;  5CRU A;  5B3S E;  3CVQ A;  3FDH A;  3BG0 B;  2HE0 A;  3L16 A;  2YHC A;  4RVB A;  2IJG X;  5AQ7 A;  4EZK A;  1MHQ A;  3RRN B;  4J6I A;  3CVW A;  4F53 A;  3U64 A;  4G26 A;  3UT7 A;  5A7D B;  1DVP A;  1AWC B;  4Z4P A;  1XNF A;  4JEU A;  3AS4 A;  4PUC A;  2DBA A;  4I17 A;  4GU5 A;  1H3I A;  3CEQ A;  1D8D A;  4HRN A;  3TL5 A;  3T9K A;  4C0E A;  1IYG A;  3IHV A;  3M5A A;  5G2N A;  2GRM A;  4LSZ E;  4BWR A;  2KZT A;  3EHN A;  2C0M A;  5CPR B;  1EYH A;  3V79 K;  4I9E A;  4O6F A;  3FY4 A;  3ONL A;  4QQI A;  3GW4 A;  4APF A;  3TXM A;  4GMR A;  3CHS A;  3RAY A;  4IUL A;  4I2Z A;  1TR4 A;  2KCV A;  5LOZ A;  3QC1 A;  1WM5 A;  2ILR A;  3ESL A;  5D0Q D;  4U95 D;  3Q49 B;  2F69 A;  3OPE A;  3IEG A;  4LNB A;  4I6J A;  1SZ9 A;  3JUE A;  3MGB A;  5CBO A;  5KJL A;  3PRE A;  5E75 A;  3OXL A;  3LS8 A;  5LCW J;  5FZQ A;  3ZHE A;  4UWG A;  2PM7 A;  1YMP A;  3PZ3 A;  1OT8 A;  3VLF A;  2R17 C;  3ZEF A;  4O60 A;  3QWV A;  4L1B A;  4FA6 A;  5A6C A;  5DIZ A;  1HXI A;  5T4Y A;  1S63 A;  2HYZ A;  2OOE A;  3ASD A;  3B7R L;  2LAI A;  3RKV A;  4YVQ C;  4JC8 A;  1D8E A;  3C98 A;  1HH8 A;  3CHP A;  5HRY A;  5G04 C;  3J5Q B;  3FTW A;  2J8S D;  1MT6 A;  2KCK A;  4DLQ A;  4MI5 A;  1TJF A;  2LSU A;  3AJI A;  4PS7 A;  2LNI A;  2VTB B;  4WND A;  3UTM A;  1ZU2 A;  1K1A A;  1N52 A;  3OXF A;  5EN5 D;  4CEM A;  4GAA A;  3EUV A;  4ANU A;  2KC7 A;  1EDU A;  3V30 A;  3CVL A;  3SFY A;  3FUI A;  4UUC A;  4G8K A;  3D3M A;  3AG4 E;  1DCQ A;  1SA5 A;  4WAF A;  3Q15 A;  3ZXS A;  3Q5M A;  3OTN A;  2DZN A;  3M57 A;  1S0P A;  3L82 A;  1INZ A;  4CT4 A;  4UQY A;  1TNB A;  4GYW A;  2LSV A;  4URK A;  2P9I G;  5BXO A;  3EP0 A;  5F5E A;  2QZA A;  5EG2 A;  2QY7 A;  3PNL B;  3PEU B;  4KYO B;  2L9B A;  2FO7 A;  2NSZ A;  5LFA A;  3O48 A;  3SHF A;  2AWI A;  4U8V D;  3UM2 A;  5JHA A;  2J49 A;  3PH0 C;  5KCM A;  3FPD A;  2J09 A;  3UIN C;  3ASN E;  5JJ7 A;  3MO0 A;  1NA0 A;  1U3D A;  5CCM A;  1N4R A;  2RKK A;  2GRL A;  2P2C P;  2JEK A;  4WWO A;  4QEP A;  2DCP A;  4RSY A;  3SFX A;  3GYZ A;  3CBO A;  3V31 A;  3DSU A;  3UI2 A;  3DAL A;  2J07 A;  3FUJ A;  4JD2 G;  3B7T A;  4JZY A;  3GZ2 A;  3B13 A;  1PAQ A;  3FU6 A;  1MVX A;  5G04 J;  5AYW D;  3QKY A;  4I6E A;  1OWM A;  2IFU A;  5FQ4 A;  2A4Z A;  3PVL A;  2IEJ A;  3PE4 A;  2MYO A;  4J7W A;  4BX8 A;  4GA1 A;  4ILG A;  4UQZ A;  4GZC A;  2Y1L E;  2A5E A;  3HXE A;  2EIL E;  3NOC D;  1KT1 A;  4KZC A;  2CHZ A;  3ZIM A;  3RO3 A;  4ACL A;  5HKP A;  3SD5 A;  4ANV A;  4DX6 D;  2BF0 X;  4YNM A;  4TXP A;  2GRR B;  3URZ A;  4UI9 J;  1KZO A;  1TN7 A;  3FH8 A;  3UKU G;  1MX4 A;  4JEH A;  2W5Y A;  4BET A;  4DPR A;  1ML9 A;  5JJT A;  3AG3 E;  4MI0 A;  4BFR A;  4GZD A;  5T5G A;  5LCW C;  1N9A A;  4CYM D;  4HOT A;  3F9Z A;  5CCL A;  4DX1 A;  3QWW A;  5EIB E;  2EIJ E;  1UN8 A;  4TXR A;  3L13 A;  2WVI A;  2F8Y A;  2XS8 A;  4ACK A;  3IKO B;  5H7P A;  3MYV A;  5M72 A;  3FTV A;  5JIN A;  2VGY A;  1YYH A;  3BEE A;  2P58 C;  5LP0 A;  2CG2 A;  3FUF A;  3CVV A;  4H12 A;  3FWV A;  5TEG A;  2VTB A;  4WWN A;  3SQV A;  3ULQ A;  2WXH A;  4UWL A;  3GZ1 A;  3D9P A;  1N6A A;  3RIB A;  3CR3 A;  3LY7 A;  2F0Y A;  3TAX A;  4U0U A;  4M7C A;  2V0P A;  1OCC E;  4AIF A;  1L5J A;  3BU8 A;  2ION A;  2Y4T A;  3DST A;  4AJW A;  2XS1 A;  5ITZ F;  4IN3 B;  2ZIS A;  4A63 B;  1WG0 A;  2I1K A;  2NXP A;  1HO8 A;  3DXK G;  3CQC B;  2I1J A;  4Z68 A;  2AXU A;  2BQZ A;  4CDM A;  1UN9 A;  5AQA A;  4N5C A;  1Z3Y A;  2CFZ A;  3CBM A;  3EU9 A;  4JVS A;  2BED A;  4M3O A;  1HG2 A;  2P9L G;  3FTY A;  4JHK A;  4I51 A;  3CHM A;  2GRQ B;  3KSQ A;  5FWQ A;  2J4D A;  3FHE A;  1A17 A;  2FF4 A;  2B0O E;  4GMJ A;  1BPO A;  3DSS A;  3NZS A;  3BG1 B;  1MYO A;  4JW1 A;  5KBA A;  1MQS A;  2LXM A;  3CVN A;  2HM8 A;  4A55 A;  3S8P A;  4NVQ A;  5F6L A;  3TXN A;  5F6K C;  3P2B A;  4FJZ A;  3X2Q E;  4AVX A;  1N3J A;  1SW6 A;  2XPY A;  1HFA A;  1PY1 A;  1O5M A;  3LJN A;  2IOS A;  4U07 A;  5AIJ A;  2E0I A;  2KZT B;  4GTQ A;  3W9G A;  4EZL A;  2XEV A;  2J9Q A;  5CHE E;  4HI8 A;  3ZYL A;  4KMO A;  4U8Y D;  3SO8 A;  4PS8 A;  1NA3 A;  3FUM A;  4GCN A;  4N3B A;  3R9M A;  2R03 A;  3D9N A;  3DWL G;  3DPY A;  3PUJ A;  1S70 B;  1HX8 A;  3ZPJ A;  4KXK B;  1K3Z D;  3APD A;  3ULY A;  4CCA A;  3ASO E;  4N3A A;  3LVQ E;  3FEX A;  4HNA D;  4J8Y A;  4CGV A;  2Y4U A;  1E96 B;  2HR2 A;  3LKU A;  3MX3 A;  5FZR A;  4AXH A;  3QAQ A;  1TJC A;  3D9I A;  3CVU A;  3ULE G;  3PZ4 A;  2JLB A;  3QNK A;  3CHQ A;  1SA4 A;  2WPV A;  4EBA A;  3U3W A;  2X3M A;  3HNA A;  3FTZ A;  1H2U A;  4ATZ D;  2QC9 A;  4FLB A;  4YVO A;  3CHR A;  4KBQ A;  2P9S G;  2UY1 B;  4E85 A;  1E90 A;  4UQX A;  2P9P G;  2EQX A;  3CST A;  3QDN A;  3G2W A;  3S7D A;  3APF A;  3PRZ A;  4L23 A;  4EPZ A;  1ELR A;  2DWZ A;  3IHY A;  4CT0 A;  4L9P A;  4I9C A;  4DI3 A;  3E34 A;  2JAB A;  4GYY A;  4XEI G;  5FQ7 A;  3O4Z A;  3SI5 A;  2KBX A;  4TV3 A;  2PQR A;  3UT4 A;  1JCQ A;  2Q7F A;  3TWV A;  3RJW A;  3IV0 A;  2J08 A;  3D9L A;  1FPP A;  4A1G A;  1QZ2 A;  3E4B A;  4HB5 A;  4U63 A;  3PZD A;  5FQ6 A;  4U8H A;  2FO1 E;  1X81 A;  3SGH A;  1B89 A;  2XQ0 A;  4G24 A;  4GCO A;  4O30 A;  4Y6W A;  3TWS A;  3AG2 E;  2E2E A;  3HDX A;  1UW4 B;  3DBS A;  2UWJ G;  4C0M A;  4KZ0 A;  4RLY A;  3JXJ A;  1H19 A;  3FUL A;  3JCK C;  3MA5 A;  1LF8 A;  1G3N B;  1H6O A;  4MS6 A;  2KCL A;  3SW9 A;  1OWO A;  3PZ1 A;  2NYJ A;  3CV0 A;  3SY2 A;  4LCT A;  2EIN E;  4BEP A;  5D0O D;  2KXP C;  5KNH D;  3EHQ A;  3ZVV A;  3HG0 D;  1N0R A;  2GRO B;  5EYL A;  4JHR A;  4QEN A;  5TH7 A;  4TRQ A;  4HOU A;  2X6H A;  5BT1 A;  1V55 E;  4HOR A;  3QWP A;  1TN8 A;  2AVP A;  3R7Q A;  4FU3 A;  3RU0 A;  1BI8 B;  2VGE A;  3E37 A;  4UWF A;  4GTP A;  4P29 A;  3ESK A;  5JHB A;  3B95 A;  3RRM B;  2KM4 A;  4DLO A;  4ILH B;  4J8E A;  5KNG A;  3DSX A;  2YQ8 A;  1P5Q A;  3AS8 A;  3T8M A;  3B7B A;  4HFG A;  1KLX A;  1OWL A;  2FI7 A;  3F6Q A;  2BKG A;  5KJM A;  3MJW A;  3DRA A;  3Q75 A;  3RO2 A;  2X6I A;  3NOG D;  2PM6 A;  4CDN A;  3BUA A;  3CK8 A;  4IJD A;  2XEE A;  3QOU A;  1E8X A;  4ZHB A;  2H6I A;  3KS2 A;  5TTF A;  4H7Y A;  3FU5 A;  4BTB A;  5ENS D;  5BPP A;  5D66 A;  4AM9 A;  4U7E B;  3TWQ A;  4N3C A;  2F8X K;  4XE0 A;  5FZS A;  1EPU A;  3ZU7 B;  1IQU A;  4DI4 A;  2OEV A;  3PUK A;  1QYM A;  2WXI A;  3OS5 A;  3LY9 A;  3DEO A;  4O1O A;  4DK5 A;  5CEA A;  3M54 A;  2IOL A;  2L6J A;  1QBQ A;  2F37 A;  4MRU A;  3GZS A;  2R3A A;  3Q73 A;  1O9S A;  1O1S A;  1HS6 A;  4B0Z A;  4UI9 C;  4BT8 A;  5C1D A;  4HLE A;  3D9M A;  1HZ4 A;  2BKK B;  3KEA A;  4GA2 A;  2XPZ A;  3CVX A;  4XKB A;  3R9A B;  4YDY A;  2I9C A;  2R2L A;  3CQG B;  1HG5 A;  2OV8 A;  2IY0 C;  2Y69 E;  2VGX A;  5CED B;  3FUE A;  4XI0 A;  1K8K G; 
#chains in the Genus database with same CATH homology
 4XKC A;  2WXP A;  3FUF A;  5JJ0 A;  5EX0 A;  3CVV A;  4H12 A;  3FWV A;  5TEG A;  4MKT A;  4L2Y A;  4L2L A;  3RRU A;  4LDG A;  3S7B A;  2VTB A;  4WWN A;  1FCH A;  5KJN A;  4JPS A;  3ZYM A;  3ULQ A;  3BO5 A;  4N39 A;  4ATG A;  3LYA A;  2WXH A;  3AS5 A;  2CHW A;  4UWL A;  3JQ1 A;  4XZ4 A;  4YPE A;  4JLG A;  3GZ1 A;  3D9P A;  3HVE B;  4G1T A;  1N6A A;  1E8Y A;  3TGO A;  3OOI A;  4MLP A;  2XGO A;  3G2V A;  3UT8 A;  3ONK A;  3R7R A;  2G46 A;  1UJJ A;  1FVF A;  1OWP A;  2WQ7 A;  1WY6 A;  3RIB A;  4FC8 A;  3SF4 A;  3FUN A;  3KMJ A;  3CR3 A;  4K03 A;  5ARG A;  3LY7 A;  3M58 A;  4WNG A;  4KVM A;  5E76 A;  4HVB A;  4BT9 A;  3TAX A;  2V8S E;  4U0U A;  2V0P A;  4QEO A;  4AIF A;  1L5J A;  2PZI A;  4PDX A;  2ION A;  2CFU A;  2RFI A;  2WXK A;  2Y4T A;  5JIY A;  2JV0 A;  4HXI A;  4IYP A;  4AJW A;  4F7A A;  3MO5 A;  3F9X A;  3MZL B;  3PDN A;  4EEC A;  4IN3 B;  4GML A;  4F1S A;  3RK6 A;  5HQ8 A;  4FJY A;  4NQ0 A;  5KJK A;  2I1K A;  4RZ0 A;  3JUI A;  4I6G A;  3SNX A;  5BUZ A;  3MKR A;  3CKB A;  2FUL A;  2NXP A;  3ZYQ A;  1HO8 A;  4JA7 A;  5J08 A;  4IJ8 A;  3OAW A;  3MV3 B;  3CQC B;  5C2Y A;  1UG3 A;  2I1J A;  2OVF A;  2AXU A;  4OVV A;  2BQZ A;  3NF1 A;  4B94 A;  4CDM A;  4NAC A;  2RD0 A;  3TJP A;  1UN9 A;  2WXR A;  3ZN3 A;  3DPD A;  2MRI A;  4PH4 B;  1ELK A;  1H2V C;  4N2S A;  4LRZ A;  4YPA A;  3I4G A;  4H7X A;  4N5C A;  4AOF A;  5ARF A;  3APC A;  1Z3Y A;  3LEW A;  2CFZ A;  3CBM A;  3ZGQ A;  4JVS A;  4WNF A;  5JHN A;  3OXG A;  3CVQ A;  3FDH A;  1HG2 A;  3ENE A;  3FTY A;  3BG0 B;  4JHK A;  4M3O A;  5LSX A;  1N6C A;  3L16 A;  4I51 A;  2V5F A;  2YHC A;  4RVB A;  3CHM A;  2IJG X;  5G55 A;  4J7F A;  3L6A A;  4NUR A;  3L08 A;  3FUH A;  5FWQ A;  3TG4 A;  4EZK A;  2J4D A;  4GA0 A;  3FHE A;  1MHQ A;  1A17 A;  2FF4 A;  3CKC A;  5CMY A;  3RRN B;  4J6I A;  3CVW A;  4G23 A;  4F53 A;  1E8W A;  4GMJ A;  5CMW A;  1BPO A;  2BUG A;  4FP7 A;  3U64 A;  4G26 A;  5J90 A;  1PEG A;  2W5Z A;  1ZBP A;  3NZS A;  4WNE A;  3UT7 A;  3BG1 B;  1NP7 A;  3ASG A;  4JW1 A;  1MQS A;  4LEU A;  5A7D B;  1DVP A;  1SQM A;  2L0T B;  3PEV B;  4Z4P A;  3CVN A;  1XNF A;  2X6J A;  2HM8 A;  5EX3 A;  3T5X A;  4A55 A;  4BY6 A;  4JDS A;  4JEU A;  4NVQ A;  3S8P A;  5F6L A;  3TXN A;  5F6K C;  3LCA A;  3UQ3 A;  3RQ4 A;  3P2B A;  4FJZ A;  4AVX A;  3AS4 A;  4XI9 A;  4PUC A;  2XPY A;  1N3J A;  2DBA A;  1HFA A;  1PY1 A;  4U0S A;  4I17 A;  5T0K A;  1NZN A;  4GU5 A;  3JQ0 A;  3CHO A;  3S7F A;  3CEQ A;  2XGM A;  3L22 A;  4F3V A;  1H3I A;  1XGW A;  2CG3 A;  4QFV A;  4IRU A;  2IOS A;  3TL5 A;  4U07 A;  5BV1 A;  4C0E A;  1QNF A;  1IYG A;  3IHV A;  2E0I A;  2KZT B;  3CIA A;  4AP2 A;  2XHE A;  5AIJ A;  3CK7 A;  5G2N A;  4EZL A;  3M5A A;  4FHJ A;  2RG8 A;  3U4T A;  5BW8 C;  3ZW3 A;  3NQP A;  2XEV A;  4BUP A;  2J9Q A;  5CHE E;  2WXJ A;  3AU4 A;  2GRM A;  2VSY A;  4BWR A;  5AJL A;  4KMO A;  3ZYL A;  1SZA A;  3K5K A;  1QQE A;  3M53 A;  2KZT A;  3EHN A;  4PS8 A;  1NA3 A;  3FUM A;  4GCN A;  2C0M A;  5CPR B;  1IQR A;  4N3B A;  1EYH A;  3HHM A;  4G25 A;  4XIF A;  1W3B A;  3D9N A;  2M63 A;  4K0R A;  5ANR A;  4I9E A;  4O6F A;  4YPU A;  3PUJ A;  3FY4 A;  2MOW A;  2WQH A;  3ONL A;  3D9K A;  1HX8 A;  3ZPJ A;  3FP3 A;  5FTP A;  4HS2 A;  4KXK B;  4J8D A;  4Q96 A;  5FQ8 A;  4CGW A;  4UI9 K;  1ZKK A;  3GW4 A;  4APF A;  3AU5 A;  3APD A;  4C1Q A;  2MHK A;  1X5B A;  3CHS A;  1HF8 A;  3TXM A;  4CCA A;  4N3A A;  3M55 A;  3RAY A;  3LVQ E;  2OVB A;  2VJ8 A;  3FEX A;  4IUL A;  3SBS A;  4CGV A;  2Y4U A;  4W9R A;  4I2Z A;  1E96 B;  2HR2 A;  2KCV A;  3LKU A;  4LUN U;  1VDY A;  3QC1 A;  5LOZ A;  1XQH A;  1WM5 A;  2ILR A;  1EF1 C;  3ESL A;  3MX3 A;  5FZR A;  4AXH A;  5D0Q D;  3Q49 B;  2F69 A;  1JWG A;  2FEZ A;  3OPE A;  2AXV A;  3IEG A;  3QAQ A;  1TJC A;  3TG5 A;  1HE8 A;  3D9I A;  4CRW A;  3CVU A;  4I6J A;  4RG6 A;  2X6K A;  1SZ9 A;  2JLB A;  4Q94 A;  4JXT A;  1H6K A;  3Q4A B;  3MGB A;  3QNK A;  4HOQ A;  5KJL A;  4JL0 A;  2DIW A;  3PRE A;  3CHQ A;  5E75 A;  2IU1 A;  3U66 A;  2WPV A;  3OXL A;  4EBA A;  3U3W A;  2X3M A;  3HNA A;  3FTZ A;  3LS8 A;  5FZQ A;  5LCW J;  3ZHE A;  4UWG A;  1H2U A;  2PM7 A;  4FLH A;  5ENN A;  1Z6T A;  2XCB A;  2GGF A;  4FUL A;  3VLF A;  3F9Y A;  4FLB A;  4JHJ A;  4YVO A;  2R17 C;  3ZEF A;  3B7U X;  1TEZ A;  3CHR A;  2WXM A;  2WMO A;  4KBQ A;  3QWV A;  4L1B A;  1ELW A;  2XRZ A;  3FU3 A;  2UY1 B;  4E85 A;  4FA6 A;  5A6C A;  2Y3A A;  5DIZ A;  3CVP A;  4FHK A;  4U04 A;  5AJD A;  1HXI A;  4UWK A;  3WXX A;  1E90 A;  4UQX A;  3MO2 A;  3QDN A;  2EQX A;  3CST A;  5T4Y A;  3G2W A;  3S7D A;  2KAT A;  1DNP A;  3APF A;  1MVH A;  2HYZ A;  2OOE A;  3PRZ A;  3ASD A;  1GW6 A;  2VSO E;  1KT0 A;  2LAI A;  3B7R L;  4L23 A;  4EPZ A;  1ELR A;  3RKV A;  4HOS A;  4YVQ C;  3G2T A;  4JC8 A;  3IHY A;  3PE3 A;  2C0L A;  4CT0 A;  3C98 A;  4I9C A;  1HH8 A;  4DI3 A;  3CHP A;  2VSX E;  4GYY A;  5DBK A;  4G2V A;  5G04 C;  1YA0 A;  3FTW A;  1MT6 A;  2KCK A;  2WM9 A;  4APO A;  3EJN A;  5FQ7 A;  4CDR A;  4DLQ A;  3O4Z A;  3SI5 A;  4MI5 A;  4TV3 A;  2PQR A;  2WXN A;  1TJF A;  2LSU A;  3HVE A;  3KD7 A;  4J83 A;  3UT4 A;  2Q7F A;  2AXZ A;  3RJW A;  4PS7 A;  2LNI A;  2VTB B;  3FEY A;  4WND A;  3IV0 A;  5EDS A;  3LXU X;  1ZU2 A;  2J08 A;  3D9L A;  3Q47 B;  2O8J A;  1N54 A;  1N52 A;  3OXF A;  4CEM A;  4GAA A;  1JWF A;  3FH5 A;  3SBT B;  4A1G A;  4ANU A;  1QZ2 A;  3SFZ A;  2KC7 A;  1EDU A;  3E4B A;  3EIQ C;  3MCX A;  3CK9 A;  4AY6 A;  2IQC A;  4TUU A;  3CVL A;  4U63 A;  3JYS A;  3PZD A;  5FT9 A;  3UMV A;  3LPZ A;  5FQ6 A;  4U8H A;  3SGH A;  1B89 A;  3PNT B;  2XQ0 A;  3FUI A;  4G24 A;  4B8C B;  4GCO A;  4LER A;  5LX8 A;  3NZU A;  4UWH A;  4O30 A;  2J4B A;  3D3M A;  4I1M A;  4Y6W A;  4N2Q A;  2E2E A;  3QAR A;  2X6F A;  1E8Z A;  4WAF A;  3ZRH A;  4NJ5 A;  3Q15 A;  3ZXS A;  3Q5M A;  3HDX A;  2XCC A;  2QPW A;  1Z3X A;  3OTN A;  1UW4 B;  3M57 A;  3DBS A;  2UWJ G;  4Y6C A;  1S0P A;  4KZ0 A;  4C0M A;  4D10 C;  3L54 A;  5T8I A;  3MV2 B;  5T3R A;  3G2U A;  1INZ A;  1Y8M A;  4CT4 A;  3IHX A;  4FMU A;  3L17 A;  4UQY A;  4GYW A;  4C9B B;  2LSV A;  1H19 A;  3FUL A;  3PS6 A;  2IF4 A;  3JCK C;  4OVU A;  4B8A A;  4DJA A;  3MA5 A;  2QFC A;  4URK A;  1LF8 A;  4BTA A;  3UPV A;  3MKQ A;  3QB2 A;  3EP0 A;  3FTX A;  4MS6 A;  3VTY A;  5F5E A;  5EG2 A;  4JA9 A;  2QY7 A;  2XPI A;  2KCL A;  3PNL B;  3PEU B;  4KYO B;  3SW9 A;  1OWO A;  2L9B A;  4R7L A;  2FO7 A;  4BSX A;  2NSZ A;  4B89 A;  3CV0 A;  4LCT A;  5LFA A;  3O48 A;  5D0O D;  4A1S A;  4I2W A;  3ZVV A;  3SHF A;  2ZU6 B;  1PC2 A;  1JUQ A;  2L0I A;  3M59 A;  3SWC A;  2AWI A;  4Q69 A;  3D9J A;  3HIZ A;  4JHR A;  3VUZ A;  4QEN A;  5TH7 A;  4TRQ A;  5JHA A;  4HOU A;  3VLE A;  2X6H A;  4I1A A;  1HU3 A;  5BT1 A;  2I6H A;  2J49 A;  3PH0 C;  4L7T A;  4HOR A;  5F59 A;  5KCM A;  4A3T A;  3QWP A;  3FPD A;  5BNW A;  2J09 A;  5HI7 A;  1OUV A;  2AVP A;  3FTS A;  3ML8 A;  4WWP A;  3R7Q A;  4GZ6 A;  5JJ7 A;  3MO0 A;  4FU3 A;  3RU0 A;  2NC9 A;  4ANX A;  1NA0 A;  1U3C A;  1U3D A;  4I43 A;  4J8F A;  4UWF A;  5ANL A;  4P29 A;  5CCM A;  4XX5 A;  4GPK A;  3ESK A;  5JHB A;  4EZJ A;  2GRL A;  5A23 A;  2CHX A;  3FUK A;  2JEK A;  3I5P A;  4WWO A;  3VLD A;  2VYI A;  3RRM B;  2KM4 A;  3VTX A;  2C2L A;  4QEP A;  4DLO A;  4ILH B;  4J8E A;  2DCP A;  3K9I A;  4RSY A;  3MKQ B;  2XRY A;  3ASH A;  2WXQ A;  3S7J A;  3GYZ A;  4ABN A;  2YQ8 A;  1P5Q A;  3CBO A;  3AS8 A;  4FAD A;  5AYF A;  5FJY A;  2VQ2 A;  3T8M A;  3DAL A;  4HFG A;  5G05 C;  1KLX A;  1OWL A;  2FI7 A;  2J07 A;  3EDT B;  3FUJ A;  3FUD A;  4A3V A;  2LAH A;  2A5U A;  3B7T A;  1MUF A;  5LSZ A;  4JZY A;  5KJM A;  3GZ2 A;  3MJW A;  3B13 A;  5AEN A;  1PAQ A;  1UJK A;  3RO2 A;  3EHM A;  3FU6 A;  2YHE A;  2OND A;  2X6I A;  1MVX A;  2PM6 A;  3CLJ A;  5G04 J;  5AYW D;  3CVY A;  3FTU A;  3QKY A;  4CDN A;  4I6E A;  5BV0 A;  1OWM A;  1Y6I A;  2IFU A;  5FQ4 A;  2A4Z A;  3CK8 A;  3PVL A;  4G11 A;  4IJD A;  3PE4 A;  3QOU A;  4BX8 A;  4GYO A;  4ANW A;  2BTD A;  2I2O A;  1E8X A;  3KS2 A;  5TTF A;  4KVO A;  3IBE A;  4J8S A;  4GA1 A;  4H7Y A;  4ILG A;  4UQZ A;  4J7I A;  4GZC A;  3FU5 A;  4WUY A;  2WXG A;  4RG9 A;  4AEZ C;  3P1U A;  4BTB A;  1KT1 A;  4KZC A;  3HYM B;  3F9W A;  3SZ7 A;  3ML9 A;  4NRH B;  3LDZ A;  5BPP A;  3KEZ A;  2CHZ A;  4GB9 A;  1E7V A;  2WXL A;  4AM9 A;  3MEK A;  3ZIM A;  4ILI A;  3DB5 A;  3LVR E;  1H2T C;  3RO3 A;  4N3C A;  4ACL A;  3N71 A;  5EKQ D;  2XGS A;  3FFL A;  4XE0 A;  5FZS A;  5G05 J;  3SD5 A;  4ANV A;  2WQ6 A;  1EPU A;  4E47 A;  2BF0 X;  2WXO A;  4YNM A;  3KMA A;  2X38 A;  1IQU A;  3S2A A;  3UUX A;  4DI4 A;  5T0M A;  3URZ A;  3PUK A;  3OS5 A;  1JPL A;  2WXI A;  3LY9 A;  4UI9 J;  3M56 A;  3LY8 A;  4V3I A;  2FBN A;  2R5S A;  3FH8 A;  3D9O A;  1H0A A;  4DK5 A;  4JEH A;  3M54 A;  2IOL A;  4AU7 A;  3VV0 A;  2L6J A;  1OWN A;  3I4R B;  3LJ3 A;  2W5Y A;  4MRU A;  4U0Z A;  3GZS A;  4DPR A;  1IHG A;  2AW6 A;  4EQF A;  5JJT A;  1ML9 A;  1O9S A;  2R3A A;  4MI0 A;  1HS6 A;  4BFR A;  2GW1 A;  4GZD A;  4B0Z A;  2UY1 A;  4GZ3 A;  5T5G A;  4AV7 A;  4UI9 C;  4BT8 A;  5LCW C;  5C1D A;  3RJV A;  4HLE A;  3T5V A;  4HOT A;  4KT6 B;  3D9M A;  3F9Z A;  4J8O A;  4AY5 A;  5CCL A;  1WAO 1;  4EBA G;  3QWW A;  1HZ4 A;  2R59 A;  2VSN A;  2V4L A;  1UN8 A;  3ZYK A;  2YIN A;  2WB2 A;  3ASF A;  3ZHE B;  4GA2 A;  2XPZ A;  3L13 A;  3ZFW A;  2PQN A;  2WVI A;  3FH7 A;  4ACK A;  3KAE A;  3CVX A;  4XKB A;  3R9A B;  2WXF A;  4ME2 A;  3FU0 A;  3IKO B;  3U9W A;  2I9C A;  3MYV A;  3G2S A;  5M72 A;  4YNP A;  3FTV A;  3CBP A;  4GZ5 A;  3I3N A;  3CQG B;  4J0U A;  5JIN A;  2VGY A;  2YNQ A;  2VGX B;  1HG5 A;  5JJ6 A;  2OV8 A;  2HO1 A;  3BEE A;  3CSF A;  2LO6 A;  2IGQ A;  2P58 C;  4YND A;  4BX9 A;  2WMN A;  3EIJ A;  3B7S A;  3QJZ A;  1E7U A;  3QK0 A;  4PS3 A;  3CGH A;  5LP0 A;  2VGX A;  3KMT A;  1FVH A;  3UX4 A;  4I1O B;  2CG2 A;  4OYS A;  4E6H A;  3FUE A;  4XI0 A;  2PL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...