5LSZA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
266
structure length
243
Chain Sequence
GETSVPPGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLMQCECTPLIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 243
sequence length 266
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lszA00
5LSXA 4YNDA 4NJ5A 3PDNA 3OS5A 3FPDA 2IGQA 3M53A 4H12A 1XQHA 4J83A 4RZ0A 5EX3A 5T0MA 5EG2A 2JV0A 4IJDA 3VV0A 4J7FA 3S7BA 5F6KC 3DALA 5T0KA 3F9YA 1O9SA 3RIBA 4J8OA 4YPAA 1N3JA 4C1QA 3OXFA 4YNMA 3M57A 4LDGA 3MO5A 4JLGA 3SW9A 4YPEA 1N6AA 3K5KA 4WUYA 3CBMA 5ARGA 3SWCA 2R3AA 5F5EA 4MI5A 5KJLA 1ML9A 3TG4A 3KMAA 4O6FA 5TEGA 1H3IA 3S7JA 3RQ4A 2O8JA 3MO0A 3M54A 3RAYA 3F9ZA 3M59A 5HQ8A 3S8PA 4I51A 1MUFA 3OPEA 5HI7A 4J7IA 5ARFA 4YPUA 4O30A 3MEKA 1PEGA 3M56A 3VUZA 2BQZA 4Z4PA 3RJWA 5EX0A 4QENA 3DB5A 3S7DA 5JJ0A 2W5YA 5F59A 3OXLA 1ZKKA 1MT6A 3OXGA 5JIYA 3N71A 3HNAA 3KMTA 5F6LA 3CBPA 4MI0A 3TG5A 3F9WA 2RFIA 3QWVA 5AYFA 3S7FA 4FMUA 4QEOA 1MVXA 5CPRB 2G46A 4QEPA 5LSZA 4BUPA 3M5AA 1N6CA 3M55A 3BO5A 4AU7A 3F9XA 3CBOA 1MVHA 3EP0A 2W5ZA 3M58A 2F69A 5KJKA 3OOIA 3QWWA 5CCLA 4JDSA 3IHXA 3RU0A 4IJ8A 4E47A 5KJMA 2QPWA 3MO2A 4YNPA 5KJNA 5TH7A 3KMJA 5JHNA 3QWPA 4NVQA 5TTFA 5CCMA 5T5GA 5JINA
chains in the Genus database with same CATH superfamily
5LSXA 4YNDA 4NJ5A 3PDNA 3OS5A 3FPDA 2IGQA 3M53A 4H12A 1XQHA 4J83A 4RZ0A 5EX3A 5T0MA 5EG2A 2JV0A 4IJDA 3VV0A 4J7FA 3S7BA 5F6KC 3DALA 5T0KA 3F9YA 1O9SA 3RIBA 4J8OA 4YPAA 1N3JA 4C1QA 3OXFA 4YNMA 3M57A 4LDGA 3MO5A 4JLGA 3SW9A 4YPEA 1N6AA 3K5KA 4WUYA 3CBMA 5ARGA 3SWCA 2R3AA 5F5EA 4MI5A 5KJLA 1ML9A 3TG4A 3KMAA 4O6FA 5TEGA 1H3IA 3S7JA 3RQ4A 2O8JA 3MO0A 3M54A 3RAYA 3F9ZA 3M59A 5HQ8A 3S8PA 4I51A 1MUFA 3OPEA 5HI7A 4J7IA 5ARFA 4YPUA 4O30A 3MEKA 1PEGA 3M56A 3VUZA 2BQZA 4Z4PA 3RJWA 5EX0A 4QENA 3DB5A 3S7DA 5JJ0A 2W5YA 5F59A 3OXLA 1ZKKA 1MT6A 3OXGA 5JIYA 3N71A 3HNAA 3KMTA 5F6LA 3CBPA 4MI0A 3TG5A 3F9WA 2RFIA 3QWVA 5AYFA 3S7FA 4FMUA 4QEOA 1MVXA 5CPRB 2G46A 4QEPA 5LSZA 4BUPA 3M5AA 1N6CA 3M55A 3BO5A 4AU7A 3F9XA 3CBOA 1MVHA 3EP0A 2W5ZA 3M58A 2F69A 5KJKA 3OOIA 3QWWA 5CCLA 4JDSA 3IHXA 3RU0A 4IJ8A 4E47A 5KJMA 2QPWA 3MO2A 4YNPA 5KJNA 5TH7A 3KMJA 5JHNA 3QWPA 4NVQA 5TTFA 5CCMA 5T5GA 5JINA
chains in the Genus database with same CATH topology
5LSXA 4YNDA 4NJ5A 3PDNA 3OS5A 3FPDA 2IGQA 3M53A 4H12A 1XQHA 4J83A 4RZ0A 5EX3A 5T0MA 5EG2A 2JV0A 4IJDA 3VV0A 4J7FA 3S7BA 5F6KC 3DALA 5T0KA 3F9YA 1O9SA 3RIBA 4J8OA 4YPAA 1N3JA 4C1QA 3OXFA 4YNMA 3M57A 4LDGA 3MO5A 4JLGA 3SW9A 4YPEA 1N6AA 3K5KA 4WUYA 3CBMA 5ARGA 3SWCA 2R3AA 5F5EA 4MI5A 5KJLA 1ML9A 3TG4A 3KMAA 4O6FA 5TEGA 1H3IA 3S7JA 3RQ4A 2O8JA 3MO0A 3M54A 3RAYA 3F9ZA 3M59A 5HQ8A 3S8PA 4I51A 1MUFA 3OPEA 5HI7A 4J7IA 5ARFA 4YPUA 4O30A 3MEKA 1PEGA 3M56A 3VUZA 2BQZA 4Z4PA 3RJWA 5EX0A 4QENA 3DB5A 3S7DA 5JJ0A 2W5YA 5F59A 3OXLA 1ZKKA 1MT6A 3OXGA 5JIYA 3N71A 3HNAA 3KMTA 5F6LA 3CBPA 4MI0A 3TG5A 3F9WA 2RFIA 3QWVA 5AYFA 3S7FA 4FMUA 4QEOA 1MVXA 5CPRB 2G46A 4QEPA 5LSZA 4BUPA 3M5AA 1N6CA 3M55A 3BO5A 4AU7A 3F9XA 3CBOA 1MVHA 3EP0A 2W5ZA 3M58A 2F69A 5KJKA 3OOIA 3QWWA 5CCLA 4JDSA 3IHXA 3RU0A 4IJ8A 4E47A 5KJMA 2QPWA 3MO2A 4YNPA 5KJNA 5TH7A 3KMJA 5JHNA 3QWPA 4NVQA 5TTFA 5CCMA 5T5GA 5JINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LSX A;  4YND A;  4NJ5 A;  3PDN A;  3OS5 A;  3FPD A;  2IGQ A;  3M53 A;  4H12 A;  1XQH A;  4J83 A;  4RZ0 A;  5EX3 A;  5T0M A;  5EG2 A;  2JV0 A;  4IJD A;  3VV0 A;  4J7F A;  3S7B A;  5F6K C;  3DAL A;  5T0K A;  3F9Y A;  1O9S A;  3RIB A;  4J8O A;  4YPA A;  1N3J A;  4C1Q A;  3OXF A;  4YNM A;  3M57 A;  4LDG A;  3MO5 A;  4JLG A;  3SW9 A;  4YPE A;  1N6A A;  3K5K A;  4WUY A;  3CBM A;  5ARG A;  3SWC A;  2R3A A;  5F5E A;  4MI5 A;  5KJL A;  1ML9 A;  3TG4 A;  3KMA A;  4O6F A;  5TEG A;  1H3I A;  3S7J A;  3RQ4 A;  2O8J A;  3MO0 A;  3M54 A;  3RAY A;  3F9Z A;  3M59 A;  5HQ8 A;  3S8P A;  4I51 A;  1MUF A;  3OPE A;  5HI7 A;  4J7I A;  5ARF A;  4YPU A;  4O30 A;  3MEK A;  1PEG A;  3M56 A;  3VUZ A;  2BQZ A;  4Z4P A;  3RJW A;  5EX0 A;  4QEN A;  3DB5 A;  3S7D A;  5JJ0 A;  2W5Y A;  5F59 A;  3OXL A;  1ZKK A;  1MT6 A;  3OXG A;  5JIY A;  3N71 A;  3HNA A;  3KMT A;  5F6L A;  3CBP A;  4MI0 A;  3TG5 A;  3F9W A;  2RFI A;  3QWV A;  5AYF A;  3S7F A;  4FMU A;  4QEO A;  1MVX A;  5CPR B;  2G46 A;  4QEP A;  5LSZ A;  4BUP A;  3M5A A;  1N6C A;  3M55 A;  3BO5 A;  4AU7 A;  3F9X A;  3CBO A;  1MVH A;  3EP0 A;  2W5Z A;  3M58 A;  2F69 A;  5KJK A;  3OOI A;  3QWW A;  5CCL A;  4JDS A;  3IHX A;  3RU0 A;  4IJ8 A;  4E47 A;  5KJM A;  2QPW A;  3MO2 A;  4YNP A;  5KJN A;  5TH7 A;  3KMJ A;  5JHN A;  3QWP A;  4NVQ A;  5TTF A;  5CCM A;  5T5G A;  5JIN A; 
#chains in the Genus database with same CATH topology
 5LSX A;  4YND A;  4NJ5 A;  3PDN A;  3OS5 A;  3FPD A;  2IGQ A;  3M53 A;  4H12 A;  1XQH A;  4J83 A;  4RZ0 A;  5EX3 A;  5T0M A;  5EG2 A;  2JV0 A;  4IJD A;  3VV0 A;  4J7F A;  3S7B A;  5F6K C;  3DAL A;  5T0K A;  3F9Y A;  1O9S A;  3RIB A;  4J8O A;  4YPA A;  1N3J A;  4C1Q A;  3OXF A;  4YNM A;  3M57 A;  4LDG A;  3MO5 A;  4JLG A;  3SW9 A;  4YPE A;  1N6A A;  3K5K A;  4WUY A;  3CBM A;  5ARG A;  3SWC A;  2R3A A;  5F5E A;  4MI5 A;  5KJL A;  1ML9 A;  3TG4 A;  3KMA A;  4O6F A;  5TEG A;  1H3I A;  3S7J A;  3RQ4 A;  2O8J A;  3MO0 A;  3M54 A;  3RAY A;  3F9Z A;  3M59 A;  5HQ8 A;  3S8P A;  4I51 A;  1MUF A;  3OPE A;  5HI7 A;  4J7I A;  5ARF A;  4YPU A;  4O30 A;  3MEK A;  1PEG A;  3M56 A;  3VUZ A;  2BQZ A;  4Z4P A;  3RJW A;  5EX0 A;  4QEN A;  3DB5 A;  3S7D A;  5JJ0 A;  2W5Y A;  5F59 A;  3OXL A;  1ZKK A;  1MT6 A;  3OXG A;  5JIY A;  3N71 A;  3HNA A;  3KMT A;  5F6L A;  3CBP A;  4MI0 A;  3TG5 A;  3F9W A;  2RFI A;  3QWV A;  5AYF A;  3S7F A;  4FMU A;  4QEO A;  1MVX A;  5CPR B;  2G46 A;  4QEP A;  5LSZ A;  4BUP A;  3M5A A;  1N6C A;  3M55 A;  3BO5 A;  4AU7 A;  3F9X A;  3CBO A;  1MVH A;  3EP0 A;  2W5Z A;  3M58 A;  2F69 A;  5KJK A;  3OOI A;  3QWW A;  5CCL A;  4JDS A;  3IHX A;  3RU0 A;  4IJ8 A;  4E47 A;  5KJM A;  2QPW A;  3MO2 A;  4YNP A;  5KJN A;  5TH7 A;  3KMJ A;  5JHN A;  3QWP A;  4NVQ A;  5TTF A;  5CCM A;  5T5G A;  5JIN A; 
#chains in the Genus database with same CATH homology
 5LSX A;  4YND A;  4NJ5 A;  3PDN A;  3OS5 A;  3FPD A;  2IGQ A;  3M53 A;  4H12 A;  1XQH A;  4J83 A;  4RZ0 A;  5EX3 A;  5T0M A;  5EG2 A;  2JV0 A;  4IJD A;  3VV0 A;  4J7F A;  3S7B A;  5F6K C;  3DAL A;  5T0K A;  3F9Y A;  1O9S A;  3RIB A;  4J8O A;  4YPA A;  1N3J A;  4C1Q A;  3OXF A;  4YNM A;  3M57 A;  4LDG A;  3MO5 A;  4JLG A;  3SW9 A;  4YPE A;  1N6A A;  3K5K A;  4WUY A;  3CBM A;  5ARG A;  3SWC A;  2R3A A;  5F5E A;  4MI5 A;  5KJL A;  1ML9 A;  3TG4 A;  3KMA A;  4O6F A;  5TEG A;  1H3I A;  3S7J A;  3RQ4 A;  2O8J A;  3MO0 A;  3M54 A;  3RAY A;  3F9Z A;  3M59 A;  5HQ8 A;  3S8P A;  4I51 A;  1MUF A;  3OPE A;  5HI7 A;  4J7I A;  5ARF A;  4YPU A;  4O30 A;  3MEK A;  1PEG A;  3M56 A;  3VUZ A;  2BQZ A;  4Z4P A;  3RJW A;  5EX0 A;  4QEN A;  3DB5 A;  3S7D A;  5JJ0 A;  2W5Y A;  5F59 A;  3OXL A;  1ZKK A;  1MT6 A;  3OXG A;  5JIY A;  3N71 A;  3HNA A;  3KMT A;  5F6L A;  3CBP A;  4MI0 A;  3TG5 A;  3F9W A;  2RFI A;  3QWV A;  5AYF A;  3S7F A;  4FMU A;  4QEO A;  1MVX A;  5CPR B;  2G46 A;  4QEP A;  5LSZ A;  4BUP A;  3M5A A;  1N6C A;  3M55 A;  3BO5 A;  4AU7 A;  3F9X A;  3CBO A;  1MVH A;  3EP0 A;  2W5Z A;  3M58 A;  2F69 A;  5KJK A;  3OOI A;  3QWW A;  5CCL A;  4JDS A;  3IHX A;  3RU0 A;  4IJ8 A;  4E47 A;  5KJM A;  2QPW A;  3MO2 A;  4YNP A;  5KJN A;  5TH7 A;  3KMJ A;  5JHN A;  3QWP A;  4NVQ A;  5TTF A;  5CCM A;  5T5G A;  5JIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...