5LSZA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
266
structure length
243
Chain Sequence
GETSVPPGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLMQCECTPLIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 243
sequence length 266
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lszA00
4AU7A 4RZ0A 2QPWA 1MVHA 1MVXA 3M59A 1H3IA 3EP0A 4BUPA 5JHNA 4LDGA 3FPDA 4NJ5A 4NVQA 5TEGA 1MUFA 3RIBA 4MI0A 3F9YA 3M53A 3S8PA 1ML9A 4JLGA 3DALA 4QEOA 3QWPA 5JJ0A 1N3JA 3QWVA 4JDSA 5HI7A 3TG5A 2IGQA 5T0MA 1XQHA 5CPRB 1ZKKA 5TH7A 2F69A 3S7JA 4YPUA 3OXGA 3RAYA 5KJNA 5JINA 1MT6A 5F6LA 4QEPA 3RU0A 4C1QA 3F9XA 3QWWA 5TTFA 3SW9A 5KJMA 3OPEA 3HNAA 2R3AA 4YNMA 3KMAA 2W5ZA 2G46A 3OS5A 5ARGA 4H12A 5KJLA 3F9WA 4IJDA 3TG4A 4J8OA 3KMJA 4WUYA 3MEKA 1PEGA 1N6AA 5AYFA 3S7BA 3CBPA 4Z4PA 5LSZA 5T5GA 3DB5A 5LSXA 2W5YA 1N6CA 5F5EA 5T0KA 3MO5A 3KMTA 2RFIA 5CCMA 5F6KC 3N71A 4E47A 4QENA 3OXLA 3M55A 5EG2A 3M58A 4FMUA 4YPAA 3M5AA 3VV0A 4YNDA 2JV0A 4J7IA 3MO0A 5CCLA 4IJ8A 3CBOA 3PDNA 5ARFA 4YNPA 3RQ4A 4YPEA 3S7DA 3M56A 2O8JA 4I51A 5HQ8A 4O6FA 3F9ZA 3IHXA 3M57A 3S7FA 4MI5A 3CBMA 3OOIA 3MO2A 4J83A 5EX0A 4O30A 5F59A 5JIYA 3VUZA 5EX3A 3OXFA 1O9SA 3K5KA 3RJWA 5KJKA 4J7FA 3BO5A 3SWCA 2BQZA 3M54A
chains in the Genus database with same CATH superfamily
4AU7A 4RZ0A 2QPWA 1MVHA 1MVXA 3M59A 1H3IA 3EP0A 4BUPA 5JHNA 4LDGA 3FPDA 4NJ5A 4NVQA 5TEGA 1MUFA 3RIBA 4MI0A 3F9YA 3M53A 3S8PA 1ML9A 4JLGA 3DALA 4QEOA 3QWPA 5JJ0A 1N3JA 3QWVA 4JDSA 5HI7A 3TG5A 2IGQA 5T0MA 1XQHA 5CPRB 1ZKKA 5TH7A 2F69A 3S7JA 4YPUA 3OXGA 3RAYA 5KJNA 5JINA 1MT6A 5F6LA 4QEPA 3RU0A 4C1QA 3F9XA 3QWWA 5TTFA 3SW9A 5KJMA 3OPEA 3HNAA 2R3AA 4YNMA 3KMAA 2W5ZA 2G46A 3OS5A 5ARGA 4H12A 5KJLA 3F9WA 4IJDA 3TG4A 4J8OA 3KMJA 4WUYA 3MEKA 1PEGA 1N6AA 5AYFA 3S7BA 3CBPA 4Z4PA 5LSZA 5T5GA 3DB5A 5LSXA 2W5YA 1N6CA 5F5EA 5T0KA 3MO5A 3KMTA 2RFIA 5CCMA 5F6KC 3N71A 4E47A 4QENA 3OXLA 3M55A 5EG2A 3M58A 4FMUA 4YPAA 3M5AA 3VV0A 4YNDA 2JV0A 4J7IA 3MO0A 5CCLA 4IJ8A 3CBOA 3PDNA 5ARFA 4YNPA 3RQ4A 4YPEA 3S7DA 3M56A 2O8JA 4I51A 5HQ8A 4O6FA 3F9ZA 3IHXA 3M57A 3S7FA 4MI5A 3CBMA 3OOIA 3MO2A 4J83A 5EX0A 4O30A 5F59A 5JIYA 3VUZA 5EX3A 3OXFA 1O9SA 3K5KA 3RJWA 5KJKA 4J7FA 3BO5A 3SWCA 2BQZA 3M54A
chains in the Genus database with same CATH topology
4AU7A 4RZ0A 2QPWA 1MVHA 1MVXA 3M59A 1H3IA 3EP0A 4BUPA 5JHNA 4LDGA 3FPDA 4NJ5A 4NVQA 5TEGA 1MUFA 3RIBA 4MI0A 3F9YA 3M53A 3S8PA 1ML9A 4JLGA 3DALA 4QEOA 3QWPA 5JJ0A 1N3JA 3QWVA 4JDSA 5HI7A 3TG5A 2IGQA 5T0MA 1XQHA 5CPRB 1ZKKA 5TH7A 2F69A 3S7JA 4YPUA 3OXGA 3RAYA 5KJNA 5JINA 1MT6A 5F6LA 4QEPA 3RU0A 4C1QA 3F9XA 3QWWA 5TTFA 3SW9A 5KJMA 3OPEA 3HNAA 2R3AA 4YNMA 3KMAA 2W5ZA 2G46A 3OS5A 5ARGA 4H12A 5KJLA 3F9WA 4IJDA 3TG4A 4J8OA 3KMJA 4WUYA 3MEKA 1PEGA 1N6AA 5AYFA 3S7BA 3CBPA 4Z4PA 5LSZA 5T5GA 3DB5A 5LSXA 2W5YA 1N6CA 5F5EA 5T0KA 3MO5A 3KMTA 2RFIA 5CCMA 5F6KC 3N71A 4E47A 4QENA 3OXLA 3M55A 5EG2A 3M58A 4FMUA 4YPAA 3M5AA 3VV0A 4YNDA 2JV0A 4J7IA 3MO0A 5CCLA 4IJ8A 3CBOA 3PDNA 5ARFA 4YNPA 3RQ4A 4YPEA 3S7DA 3M56A 2O8JA 4I51A 5HQ8A 4O6FA 3F9ZA 3IHXA 3M57A 3S7FA 4MI5A 3CBMA 3OOIA 3MO2A 4J83A 5EX0A 4O30A 5F59A 5JIYA 3VUZA 5EX3A 3OXFA 1O9SA 3K5KA 3RJWA 5KJKA 4J7FA 3BO5A 3SWCA 2BQZA 3M54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AU7 A;  4RZ0 A;  2QPW A;  1MVH A;  1MVX A;  3M59 A;  1H3I A;  3EP0 A;  4BUP A;  5JHN A;  4LDG A;  3FPD A;  4NJ5 A;  4NVQ A;  5TEG A;  1MUF A;  3RIB A;  4MI0 A;  3F9Y A;  3M53 A;  3S8P A;  1ML9 A;  4JLG A;  3DAL A;  4QEO A;  3QWP A;  5JJ0 A;  1N3J A;  3QWV A;  4JDS A;  5HI7 A;  3TG5 A;  2IGQ A;  5T0M A;  1XQH A;  5CPR B;  1ZKK A;  5TH7 A;  2F69 A;  3S7J A;  4YPU A;  3OXG A;  3RAY A;  5KJN A;  5JIN A;  1MT6 A;  5F6L A;  4QEP A;  3RU0 A;  4C1Q A;  3F9X A;  3QWW A;  5TTF A;  3SW9 A;  5KJM A;  3OPE A;  3HNA A;  2R3A A;  4YNM A;  3KMA A;  2W5Z A;  2G46 A;  3OS5 A;  5ARG A;  4H12 A;  5KJL A;  3F9W A;  4IJD A;  3TG4 A;  4J8O A;  3KMJ A;  4WUY A;  3MEK A;  1PEG A;  1N6A A;  5AYF A;  3S7B A;  3CBP A;  4Z4P A;  5LSZ A;  5T5G A;  3DB5 A;  5LSX A;  2W5Y A;  1N6C A;  5F5E A;  5T0K A;  3MO5 A;  3KMT A;  2RFI A;  5CCM A;  5F6K C;  3N71 A;  4E47 A;  4QEN A;  3OXL A;  3M55 A;  5EG2 A;  3M58 A;  4FMU A;  4YPA A;  3M5A A;  3VV0 A;  4YND A;  2JV0 A;  4J7I A;  3MO0 A;  5CCL A;  4IJ8 A;  3CBO A;  3PDN A;  5ARF A;  4YNP A;  3RQ4 A;  4YPE A;  3S7D A;  3M56 A;  2O8J A;  4I51 A;  5HQ8 A;  4O6F A;  3F9Z A;  3IHX A;  3M57 A;  3S7F A;  4MI5 A;  3CBM A;  3OOI A;  3MO2 A;  4J83 A;  5EX0 A;  4O30 A;  5F59 A;  5JIY A;  3VUZ A;  5EX3 A;  3OXF A;  1O9S A;  3K5K A;  3RJW A;  5KJK A;  4J7F A;  3BO5 A;  3SWC A;  2BQZ A;  3M54 A; 
#chains in the Genus database with same CATH topology
 4AU7 A;  4RZ0 A;  2QPW A;  1MVH A;  1MVX A;  3M59 A;  1H3I A;  3EP0 A;  4BUP A;  5JHN A;  4LDG A;  3FPD A;  4NJ5 A;  4NVQ A;  5TEG A;  1MUF A;  3RIB A;  4MI0 A;  3F9Y A;  3M53 A;  3S8P A;  1ML9 A;  4JLG A;  3DAL A;  4QEO A;  3QWP A;  5JJ0 A;  1N3J A;  3QWV A;  4JDS A;  5HI7 A;  3TG5 A;  2IGQ A;  5T0M A;  1XQH A;  5CPR B;  1ZKK A;  5TH7 A;  2F69 A;  3S7J A;  4YPU A;  3OXG A;  3RAY A;  5KJN A;  5JIN A;  1MT6 A;  5F6L A;  4QEP A;  3RU0 A;  4C1Q A;  3F9X A;  3QWW A;  5TTF A;  3SW9 A;  5KJM A;  3OPE A;  3HNA A;  2R3A A;  4YNM A;  3KMA A;  2W5Z A;  2G46 A;  3OS5 A;  5ARG A;  4H12 A;  5KJL A;  3F9W A;  4IJD A;  3TG4 A;  4J8O A;  3KMJ A;  4WUY A;  3MEK A;  1PEG A;  1N6A A;  5AYF A;  3S7B A;  3CBP A;  4Z4P A;  5LSZ A;  5T5G A;  3DB5 A;  5LSX A;  2W5Y A;  1N6C A;  5F5E A;  5T0K A;  3MO5 A;  3KMT A;  2RFI A;  5CCM A;  5F6K C;  3N71 A;  4E47 A;  4QEN A;  3OXL A;  3M55 A;  5EG2 A;  3M58 A;  4FMU A;  4YPA A;  3M5A A;  3VV0 A;  4YND A;  2JV0 A;  4J7I A;  3MO0 A;  5CCL A;  4IJ8 A;  3CBO A;  3PDN A;  5ARF A;  4YNP A;  3RQ4 A;  4YPE A;  3S7D A;  3M56 A;  2O8J A;  4I51 A;  5HQ8 A;  4O6F A;  3F9Z A;  3IHX A;  3M57 A;  3S7F A;  4MI5 A;  3CBM A;  3OOI A;  3MO2 A;  4J83 A;  5EX0 A;  4O30 A;  5F59 A;  5JIY A;  3VUZ A;  5EX3 A;  3OXF A;  1O9S A;  3K5K A;  3RJW A;  5KJK A;  4J7F A;  3BO5 A;  3SWC A;  2BQZ A;  3M54 A; 
#chains in the Genus database with same CATH homology
 4AU7 A;  4RZ0 A;  2QPW A;  1MVH A;  1MVX A;  3M59 A;  1H3I A;  3EP0 A;  4BUP A;  5JHN A;  4LDG A;  3FPD A;  4NJ5 A;  4NVQ A;  5TEG A;  1MUF A;  3RIB A;  4MI0 A;  3F9Y A;  3M53 A;  3S8P A;  1ML9 A;  4JLG A;  3DAL A;  4QEO A;  3QWP A;  5JJ0 A;  1N3J A;  3QWV A;  4JDS A;  5HI7 A;  3TG5 A;  2IGQ A;  5T0M A;  1XQH A;  5CPR B;  1ZKK A;  5TH7 A;  2F69 A;  3S7J A;  4YPU A;  3OXG A;  3RAY A;  5KJN A;  5JIN A;  1MT6 A;  5F6L A;  4QEP A;  3RU0 A;  4C1Q A;  3F9X A;  3QWW A;  5TTF A;  3SW9 A;  5KJM A;  3OPE A;  3HNA A;  2R3A A;  4YNM A;  3KMA A;  2W5Z A;  2G46 A;  3OS5 A;  5ARG A;  4H12 A;  5KJL A;  3F9W A;  4IJD A;  3TG4 A;  4J8O A;  3KMJ A;  4WUY A;  3MEK A;  1PEG A;  1N6A A;  5AYF A;  3S7B A;  3CBP A;  4Z4P A;  5LSZ A;  5T5G A;  3DB5 A;  5LSX A;  2W5Y A;  1N6C A;  5F5E A;  5T0K A;  3MO5 A;  3KMT A;  2RFI A;  5CCM A;  5F6K C;  3N71 A;  4E47 A;  4QEN A;  3OXL A;  3M55 A;  5EG2 A;  3M58 A;  4FMU A;  4YPA A;  3M5A A;  3VV0 A;  4YND A;  2JV0 A;  4J7I A;  3MO0 A;  5CCL A;  4IJ8 A;  3CBO A;  3PDN A;  5ARF A;  4YNP A;  3RQ4 A;  4YPE A;  3S7D A;  3M56 A;  2O8J A;  4I51 A;  5HQ8 A;  4O6F A;  3F9Z A;  3IHX A;  3M57 A;  3S7F A;  4MI5 A;  3CBM A;  3OOI A;  3MO2 A;  4J83 A;  5EX0 A;  4O30 A;  5F59 A;  5JIY A;  3VUZ A;  5EX3 A;  3OXF A;  1O9S A;  3K5K A;  3RJW A;  5KJK A;  4J7F A;  3BO5 A;  3SWC A;  2BQZ A;  3M54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...