5LSZA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
266
structure length
243
Chain Sequence
GETSVPPGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLMQCECTPLIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 243
sequence length 266
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lszA00
4O30A 3DB5A 5EX0A 3F9WA 5LSXA 3F9ZA 3KMJA 4YNDA 5T0MA 3MO2A 4O6FA 4JLGA 1ML9A 2W5ZA 3M58A 5JINA 3RQ4A 5JHNA 5LSZA 3PDNA 4LDGA 3VUZA 5JIYA 4MI0A 5TEGA 3QWPA 4QEOA 4MI5A 2IGQA 4JDSA 3HNAA 4Z4PA 1N3JA 3N71A 2BQZA 4YPUA 3MO0A 3M53A 5TTFA 5AYFA 5HI7A 5JJ0A 5KJNA 4NJ5A 3FPDA 4IJ8A 1N6CA 3M57A 3SW9A 5CCLA 1ZKKA 3K5KA 5KJMA 4YPAA 3OXLA 5EG2A 4H12A 3F9YA 5T0KA 2G46A 4C1QA 5T5GA 3S7DA 3RIBA 4RZ0A 3M56A 4QENA 1MT6A 3TG5A 3VV0A 4WUYA 3S7FA 3QWVA 1MVHA 1O9SA 3F9XA 1MVXA 5F6LA 4J7FA 4J83A 5EX3A 1H3IA 2O8JA 4I51A 3CBMA 1MUFA 5F5EA 3CBPA 4AU7A 3M54A 4YNPA 2QPWA 3BO5A 3KMTA 2R3AA 3OOIA 4YNMA 3KMAA 5CCMA 3QWWA 5KJKA 5TH7A 3EP0A 3RAYA 2F69A 2RFIA 3OS5A 3SWCA 3MO5A 5ARGA 5F6KC 4IJDA 3IHXA 3M5AA 4FMUA 5HQ8A 3DALA 5KJLA 3OXFA 4J8OA 3S7JA 3RJWA 3OXGA 1N6AA 5CPRB 4YPEA 4E47A 3RU0A 5ARFA 3OPEA 2JV0A 1XQHA 4QEPA 3TG4A 3M55A 5F59A 3MEKA 3S8PA 3S7BA 3M59A 4BUPA 1PEGA 4NVQA 4J7IA 3CBOA 2W5YA
chains in the Genus database with same CATH superfamily
4O30A 3DB5A 5EX0A 3F9WA 5LSXA 3F9ZA 3KMJA 4YNDA 5T0MA 3MO2A 4O6FA 4JLGA 1ML9A 2W5ZA 3M58A 5JINA 3RQ4A 5JHNA 5LSZA 3PDNA 4LDGA 3VUZA 5JIYA 4MI0A 5TEGA 3QWPA 4QEOA 4MI5A 2IGQA 4JDSA 3HNAA 4Z4PA 1N3JA 3N71A 2BQZA 4YPUA 3MO0A 3M53A 5TTFA 5AYFA 5HI7A 5JJ0A 5KJNA 4NJ5A 3FPDA 4IJ8A 1N6CA 3M57A 3SW9A 5CCLA 1ZKKA 3K5KA 5KJMA 4YPAA 3OXLA 5EG2A 4H12A 3F9YA 5T0KA 2G46A 4C1QA 5T5GA 3S7DA 3RIBA 4RZ0A 3M56A 4QENA 1MT6A 3TG5A 3VV0A 4WUYA 3S7FA 3QWVA 1MVHA 1O9SA 3F9XA 1MVXA 5F6LA 4J7FA 4J83A 5EX3A 1H3IA 2O8JA 4I51A 3CBMA 1MUFA 5F5EA 3CBPA 4AU7A 3M54A 4YNPA 2QPWA 3BO5A 3KMTA 2R3AA 3OOIA 4YNMA 3KMAA 5CCMA 3QWWA 5KJKA 5TH7A 3EP0A 3RAYA 2F69A 2RFIA 3OS5A 3SWCA 3MO5A 5ARGA 5F6KC 4IJDA 3IHXA 3M5AA 4FMUA 5HQ8A 3DALA 5KJLA 3OXFA 4J8OA 3S7JA 3RJWA 3OXGA 1N6AA 5CPRB 4YPEA 4E47A 3RU0A 5ARFA 3OPEA 2JV0A 1XQHA 4QEPA 3TG4A 3M55A 5F59A 3MEKA 3S8PA 3S7BA 3M59A 4BUPA 1PEGA 4NVQA 4J7IA 3CBOA 2W5YA
chains in the Genus database with same CATH topology
4O30A 3DB5A 5EX0A 3F9WA 5LSXA 3F9ZA 3KMJA 4YNDA 5T0MA 3MO2A 4O6FA 4JLGA 1ML9A 2W5ZA 3M58A 5JINA 3RQ4A 5JHNA 5LSZA 3PDNA 4LDGA 3VUZA 5JIYA 4MI0A 5TEGA 3QWPA 4QEOA 4MI5A 2IGQA 4JDSA 3HNAA 4Z4PA 1N3JA 3N71A 2BQZA 4YPUA 3MO0A 3M53A 5TTFA 5AYFA 5HI7A 5JJ0A 5KJNA 4NJ5A 3FPDA 4IJ8A 1N6CA 3M57A 3SW9A 5CCLA 1ZKKA 3K5KA 5KJMA 4YPAA 3OXLA 5EG2A 4H12A 3F9YA 5T0KA 2G46A 4C1QA 5T5GA 3S7DA 3RIBA 4RZ0A 3M56A 4QENA 1MT6A 3TG5A 3VV0A 4WUYA 3S7FA 3QWVA 1MVHA 1O9SA 3F9XA 1MVXA 5F6LA 4J7FA 4J83A 5EX3A 1H3IA 2O8JA 4I51A 3CBMA 1MUFA 5F5EA 3CBPA 4AU7A 3M54A 4YNPA 2QPWA 3BO5A 3KMTA 2R3AA 3OOIA 4YNMA 3KMAA 5CCMA 3QWWA 5KJKA 5TH7A 3EP0A 3RAYA 2F69A 2RFIA 3OS5A 3SWCA 3MO5A 5ARGA 5F6KC 4IJDA 3IHXA 3M5AA 4FMUA 5HQ8A 3DALA 5KJLA 3OXFA 4J8OA 3S7JA 3RJWA 3OXGA 1N6AA 5CPRB 4YPEA 4E47A 3RU0A 5ARFA 3OPEA 2JV0A 1XQHA 4QEPA 3TG4A 3M55A 5F59A 3MEKA 3S8PA 3S7BA 3M59A 4BUPA 1PEGA 4NVQA 4J7IA 3CBOA 2W5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O30 A;  3DB5 A;  5EX0 A;  3F9W A;  5LSX A;  3F9Z A;  3KMJ A;  4YND A;  5T0M A;  3MO2 A;  4O6F A;  4JLG A;  1ML9 A;  2W5Z A;  3M58 A;  5JIN A;  3RQ4 A;  5JHN A;  5LSZ A;  3PDN A;  4LDG A;  3VUZ A;  5JIY A;  4MI0 A;  5TEG A;  3QWP A;  4QEO A;  4MI5 A;  2IGQ A;  4JDS A;  3HNA A;  4Z4P A;  1N3J A;  3N71 A;  2BQZ A;  4YPU A;  3MO0 A;  3M53 A;  5TTF A;  5AYF A;  5HI7 A;  5JJ0 A;  5KJN A;  4NJ5 A;  3FPD A;  4IJ8 A;  1N6C A;  3M57 A;  3SW9 A;  5CCL A;  1ZKK A;  3K5K A;  5KJM A;  4YPA A;  3OXL A;  5EG2 A;  4H12 A;  3F9Y A;  5T0K A;  2G46 A;  4C1Q A;  5T5G A;  3S7D A;  3RIB A;  4RZ0 A;  3M56 A;  4QEN A;  1MT6 A;  3TG5 A;  3VV0 A;  4WUY A;  3S7F A;  3QWV A;  1MVH A;  1O9S A;  3F9X A;  1MVX A;  5F6L A;  4J7F A;  4J83 A;  5EX3 A;  1H3I A;  2O8J A;  4I51 A;  3CBM A;  1MUF A;  5F5E A;  3CBP A;  4AU7 A;  3M54 A;  4YNP A;  2QPW A;  3BO5 A;  3KMT A;  2R3A A;  3OOI A;  4YNM A;  3KMA A;  5CCM A;  3QWW A;  5KJK A;  5TH7 A;  3EP0 A;  3RAY A;  2F69 A;  2RFI A;  3OS5 A;  3SWC A;  3MO5 A;  5ARG A;  5F6K C;  4IJD A;  3IHX A;  3M5A A;  4FMU A;  5HQ8 A;  3DAL A;  5KJL A;  3OXF A;  4J8O A;  3S7J A;  3RJW A;  3OXG A;  1N6A A;  5CPR B;  4YPE A;  4E47 A;  3RU0 A;  5ARF A;  3OPE A;  2JV0 A;  1XQH A;  4QEP A;  3TG4 A;  3M55 A;  5F59 A;  3MEK A;  3S8P A;  3S7B A;  3M59 A;  4BUP A;  1PEG A;  4NVQ A;  4J7I A;  3CBO A;  2W5Y A; 
#chains in the Genus database with same CATH topology
 4O30 A;  3DB5 A;  5EX0 A;  3F9W A;  5LSX A;  3F9Z A;  3KMJ A;  4YND A;  5T0M A;  3MO2 A;  4O6F A;  4JLG A;  1ML9 A;  2W5Z A;  3M58 A;  5JIN A;  3RQ4 A;  5JHN A;  5LSZ A;  3PDN A;  4LDG A;  3VUZ A;  5JIY A;  4MI0 A;  5TEG A;  3QWP A;  4QEO A;  4MI5 A;  2IGQ A;  4JDS A;  3HNA A;  4Z4P A;  1N3J A;  3N71 A;  2BQZ A;  4YPU A;  3MO0 A;  3M53 A;  5TTF A;  5AYF A;  5HI7 A;  5JJ0 A;  5KJN A;  4NJ5 A;  3FPD A;  4IJ8 A;  1N6C A;  3M57 A;  3SW9 A;  5CCL A;  1ZKK A;  3K5K A;  5KJM A;  4YPA A;  3OXL A;  5EG2 A;  4H12 A;  3F9Y A;  5T0K A;  2G46 A;  4C1Q A;  5T5G A;  3S7D A;  3RIB A;  4RZ0 A;  3M56 A;  4QEN A;  1MT6 A;  3TG5 A;  3VV0 A;  4WUY A;  3S7F A;  3QWV A;  1MVH A;  1O9S A;  3F9X A;  1MVX A;  5F6L A;  4J7F A;  4J83 A;  5EX3 A;  1H3I A;  2O8J A;  4I51 A;  3CBM A;  1MUF A;  5F5E A;  3CBP A;  4AU7 A;  3M54 A;  4YNP A;  2QPW A;  3BO5 A;  3KMT A;  2R3A A;  3OOI A;  4YNM A;  3KMA A;  5CCM A;  3QWW A;  5KJK A;  5TH7 A;  3EP0 A;  3RAY A;  2F69 A;  2RFI A;  3OS5 A;  3SWC A;  3MO5 A;  5ARG A;  5F6K C;  4IJD A;  3IHX A;  3M5A A;  4FMU A;  5HQ8 A;  3DAL A;  5KJL A;  3OXF A;  4J8O A;  3S7J A;  3RJW A;  3OXG A;  1N6A A;  5CPR B;  4YPE A;  4E47 A;  3RU0 A;  5ARF A;  3OPE A;  2JV0 A;  1XQH A;  4QEP A;  3TG4 A;  3M55 A;  5F59 A;  3MEK A;  3S8P A;  3S7B A;  3M59 A;  4BUP A;  1PEG A;  4NVQ A;  4J7I A;  3CBO A;  2W5Y A; 
#chains in the Genus database with same CATH homology
 4O30 A;  3DB5 A;  5EX0 A;  3F9W A;  5LSX A;  3F9Z A;  3KMJ A;  4YND A;  5T0M A;  3MO2 A;  4O6F A;  4JLG A;  1ML9 A;  2W5Z A;  3M58 A;  5JIN A;  3RQ4 A;  5JHN A;  5LSZ A;  3PDN A;  4LDG A;  3VUZ A;  5JIY A;  4MI0 A;  5TEG A;  3QWP A;  4QEO A;  4MI5 A;  2IGQ A;  4JDS A;  3HNA A;  4Z4P A;  1N3J A;  3N71 A;  2BQZ A;  4YPU A;  3MO0 A;  3M53 A;  5TTF A;  5AYF A;  5HI7 A;  5JJ0 A;  5KJN A;  4NJ5 A;  3FPD A;  4IJ8 A;  1N6C A;  3M57 A;  3SW9 A;  5CCL A;  1ZKK A;  3K5K A;  5KJM A;  4YPA A;  3OXL A;  5EG2 A;  4H12 A;  3F9Y A;  5T0K A;  2G46 A;  4C1Q A;  5T5G A;  3S7D A;  3RIB A;  4RZ0 A;  3M56 A;  4QEN A;  1MT6 A;  3TG5 A;  3VV0 A;  4WUY A;  3S7F A;  3QWV A;  1MVH A;  1O9S A;  3F9X A;  1MVX A;  5F6L A;  4J7F A;  4J83 A;  5EX3 A;  1H3I A;  2O8J A;  4I51 A;  3CBM A;  1MUF A;  5F5E A;  3CBP A;  4AU7 A;  3M54 A;  4YNP A;  2QPW A;  3BO5 A;  3KMT A;  2R3A A;  3OOI A;  4YNM A;  3KMA A;  5CCM A;  3QWW A;  5KJK A;  5TH7 A;  3EP0 A;  3RAY A;  2F69 A;  2RFI A;  3OS5 A;  3SWC A;  3MO5 A;  5ARG A;  5F6K C;  4IJD A;  3IHX A;  3M5A A;  4FMU A;  5HQ8 A;  3DAL A;  5KJL A;  3OXF A;  4J8O A;  3S7J A;  3RJW A;  3OXG A;  1N6A A;  5CPR B;  4YPE A;  4E47 A;  3RU0 A;  5ARF A;  3OPE A;  2JV0 A;  1XQH A;  4QEP A;  3TG4 A;  3M55 A;  5F59 A;  3MEK A;  3S8P A;  3S7B A;  3M59 A;  4BUP A;  1PEG A;  4NVQ A;  4J7I A;  3CBO A;  2W5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...