5LSZA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
266
structure length
243
Chain Sequence
GETSVPPGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLMQCECTPLIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD2
total genus 59
structure length 243
sequence length 266
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lszA00
1MT6A 3M58A 3MEKA 2O8JA 4IJDA 3M59A 4O6FA 5JHNA 2W5YA 5HI7A 5T5GA 5EG2A 3IHXA 5KJLA 3OXGA 5HQ8A 3SW9A 1ZKKA 3RQ4A 3OXFA 3KMTA 4YPUA 4J7FA 4AU7A 1ML9A 3DALA 3KMJA 2QPWA 5AYFA 5EX0A 4QEOA 3CBPA 3MO0A 3EP0A 4LDGA 5JJ0A 4YNDA 3QWWA 3RJWA 4J8OA 4E47A 2BQZA 4JDSA 4NJ5A 1MVHA 5KJMA 3RAYA 3M55A 3M53A 5F6KC 4MI0A 3MO5A 4JLGA 1N6CA 3CBMA 3M54A 4I51A 3TG5A 4IJ8A 1MUFA 3S8PA 4YNPA 5F6LA 3MO2A 5TTFA 4J83A 3OXLA 1N6AA 5ARFA 4QEPA 3DB5A 3VUZA 3FPDA 3F9YA 4YNMA 4O30A 3HNAA 4MI5A 5T0KA 2R3AA 3VV0A 2F69A 2RFIA 5F59A 5LSZA 3RU0A 3F9ZA 1O9SA 3QWVA 3F9WA 1MVXA 1PEGA 2W5ZA 4H12A 3RIBA 3M56A 1N3JA 4J7IA 3BO5A 3S7BA 5KJKA 4FMUA 4Z4PA 3OOIA 1H3IA 4YPAA 3S7JA 4WUYA 3M57A 3TG4A 3S7DA 3CBOA 2IGQA 2JV0A 4C1QA 3K5KA 3OS5A 5CCMA 3PDNA 3KMAA 5KJNA 3QWPA 5EX3A 3M5AA 3N71A 4BUPA 1XQHA 3OPEA 5ARGA 3SWCA 4RZ0A 5LSXA 3S7FA 4YPEA 5TEGA 5TH7A 4NVQA 5CCLA 5JINA 5JIYA 5CPRB 4QENA 5F5EA 3F9XA 2G46A 5T0MA
chains in the Genus database with same CATH superfamily
1MT6A 3M58A 3MEKA 2O8JA 4IJDA 3M59A 4O6FA 5JHNA 2W5YA 5HI7A 5T5GA 5EG2A 3IHXA 5KJLA 3OXGA 5HQ8A 3SW9A 1ZKKA 3RQ4A 3OXFA 3KMTA 4YPUA 4J7FA 4AU7A 1ML9A 3DALA 3KMJA 2QPWA 5AYFA 5EX0A 4QEOA 3CBPA 3MO0A 3EP0A 4LDGA 5JJ0A 4YNDA 3QWWA 3RJWA 4J8OA 4E47A 2BQZA 4JDSA 4NJ5A 1MVHA 5KJMA 3RAYA 3M55A 3M53A 5F6KC 4MI0A 3MO5A 4JLGA 1N6CA 3CBMA 3M54A 4I51A 3TG5A 4IJ8A 1MUFA 3S8PA 4YNPA 5F6LA 3MO2A 5TTFA 4J83A 3OXLA 1N6AA 5ARFA 4QEPA 3DB5A 3VUZA 3FPDA 3F9YA 4YNMA 4O30A 3HNAA 4MI5A 5T0KA 2R3AA 3VV0A 2F69A 2RFIA 5F59A 5LSZA 3RU0A 3F9ZA 1O9SA 3QWVA 3F9WA 1MVXA 1PEGA 2W5ZA 4H12A 3RIBA 3M56A 1N3JA 4J7IA 3BO5A 3S7BA 5KJKA 4FMUA 4Z4PA 3OOIA 1H3IA 4YPAA 3S7JA 4WUYA 3M57A 3TG4A 3S7DA 3CBOA 2IGQA 2JV0A 4C1QA 3K5KA 3OS5A 5CCMA 3PDNA 3KMAA 5KJNA 3QWPA 5EX3A 3M5AA 3N71A 4BUPA 1XQHA 3OPEA 5ARGA 3SWCA 4RZ0A 5LSXA 3S7FA 4YPEA 5TEGA 5TH7A 4NVQA 5CCLA 5JINA 5JIYA 5CPRB 4QENA 5F5EA 3F9XA 2G46A 5T0MA
chains in the Genus database with same CATH topology
1MT6A 3M58A 3MEKA 2O8JA 4IJDA 3M59A 4O6FA 5JHNA 2W5YA 5HI7A 5T5GA 5EG2A 3IHXA 5KJLA 3OXGA 5HQ8A 3SW9A 1ZKKA 3RQ4A 3OXFA 3KMTA 4YPUA 4J7FA 4AU7A 1ML9A 3DALA 3KMJA 2QPWA 5AYFA 5EX0A 4QEOA 3CBPA 3MO0A 3EP0A 4LDGA 5JJ0A 4YNDA 3QWWA 3RJWA 4J8OA 4E47A 2BQZA 4JDSA 4NJ5A 1MVHA 5KJMA 3RAYA 3M55A 3M53A 5F6KC 4MI0A 3MO5A 4JLGA 1N6CA 3CBMA 3M54A 4I51A 3TG5A 4IJ8A 1MUFA 3S8PA 4YNPA 5F6LA 3MO2A 5TTFA 4J83A 3OXLA 1N6AA 5ARFA 4QEPA 3DB5A 3VUZA 3FPDA 3F9YA 4YNMA 4O30A 3HNAA 4MI5A 5T0KA 2R3AA 3VV0A 2F69A 2RFIA 5F59A 5LSZA 3RU0A 3F9ZA 1O9SA 3QWVA 3F9WA 1MVXA 1PEGA 2W5ZA 4H12A 3RIBA 3M56A 1N3JA 4J7IA 3BO5A 3S7BA 5KJKA 4FMUA 4Z4PA 3OOIA 1H3IA 4YPAA 3S7JA 4WUYA 3M57A 3TG4A 3S7DA 3CBOA 2IGQA 2JV0A 4C1QA 3K5KA 3OS5A 5CCMA 3PDNA 3KMAA 5KJNA 3QWPA 5EX3A 3M5AA 3N71A 4BUPA 1XQHA 3OPEA 5ARGA 3SWCA 4RZ0A 5LSXA 3S7FA 4YPEA 5TEGA 5TH7A 4NVQA 5CCLA 5JINA 5JIYA 5CPRB 4QENA 5F5EA 3F9XA 2G46A 5T0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MT6 A;  3M58 A;  3MEK A;  2O8J A;  4IJD A;  3M59 A;  4O6F A;  5JHN A;  2W5Y A;  5HI7 A;  5T5G A;  5EG2 A;  3IHX A;  5KJL A;  3OXG A;  5HQ8 A;  3SW9 A;  1ZKK A;  3RQ4 A;  3OXF A;  3KMT A;  4YPU A;  4J7F A;  4AU7 A;  1ML9 A;  3DAL A;  3KMJ A;  2QPW A;  5AYF A;  5EX0 A;  4QEO A;  3CBP A;  3MO0 A;  3EP0 A;  4LDG A;  5JJ0 A;  4YND A;  3QWW A;  3RJW A;  4J8O A;  4E47 A;  2BQZ A;  4JDS A;  4NJ5 A;  1MVH A;  5KJM A;  3RAY A;  3M55 A;  3M53 A;  5F6K C;  4MI0 A;  3MO5 A;  4JLG A;  1N6C A;  3CBM A;  3M54 A;  4I51 A;  3TG5 A;  4IJ8 A;  1MUF A;  3S8P A;  4YNP A;  5F6L A;  3MO2 A;  5TTF A;  4J83 A;  3OXL A;  1N6A A;  5ARF A;  4QEP A;  3DB5 A;  3VUZ A;  3FPD A;  3F9Y A;  4YNM A;  4O30 A;  3HNA A;  4MI5 A;  5T0K A;  2R3A A;  3VV0 A;  2F69 A;  2RFI A;  5F59 A;  5LSZ A;  3RU0 A;  3F9Z A;  1O9S A;  3QWV A;  3F9W A;  1MVX A;  1PEG A;  2W5Z A;  4H12 A;  3RIB A;  3M56 A;  1N3J A;  4J7I A;  3BO5 A;  3S7B A;  5KJK A;  4FMU A;  4Z4P A;  3OOI A;  1H3I A;  4YPA A;  3S7J A;  4WUY A;  3M57 A;  3TG4 A;  3S7D A;  3CBO A;  2IGQ A;  2JV0 A;  4C1Q A;  3K5K A;  3OS5 A;  5CCM A;  3PDN A;  3KMA A;  5KJN A;  3QWP A;  5EX3 A;  3M5A A;  3N71 A;  4BUP A;  1XQH A;  3OPE A;  5ARG A;  3SWC A;  4RZ0 A;  5LSX A;  3S7F A;  4YPE A;  5TEG A;  5TH7 A;  4NVQ A;  5CCL A;  5JIN A;  5JIY A;  5CPR B;  4QEN A;  5F5E A;  3F9X A;  2G46 A;  5T0M A; 
#chains in the Genus database with same CATH topology
 1MT6 A;  3M58 A;  3MEK A;  2O8J A;  4IJD A;  3M59 A;  4O6F A;  5JHN A;  2W5Y A;  5HI7 A;  5T5G A;  5EG2 A;  3IHX A;  5KJL A;  3OXG A;  5HQ8 A;  3SW9 A;  1ZKK A;  3RQ4 A;  3OXF A;  3KMT A;  4YPU A;  4J7F A;  4AU7 A;  1ML9 A;  3DAL A;  3KMJ A;  2QPW A;  5AYF A;  5EX0 A;  4QEO A;  3CBP A;  3MO0 A;  3EP0 A;  4LDG A;  5JJ0 A;  4YND A;  3QWW A;  3RJW A;  4J8O A;  4E47 A;  2BQZ A;  4JDS A;  4NJ5 A;  1MVH A;  5KJM A;  3RAY A;  3M55 A;  3M53 A;  5F6K C;  4MI0 A;  3MO5 A;  4JLG A;  1N6C A;  3CBM A;  3M54 A;  4I51 A;  3TG5 A;  4IJ8 A;  1MUF A;  3S8P A;  4YNP A;  5F6L A;  3MO2 A;  5TTF A;  4J83 A;  3OXL A;  1N6A A;  5ARF A;  4QEP A;  3DB5 A;  3VUZ A;  3FPD A;  3F9Y A;  4YNM A;  4O30 A;  3HNA A;  4MI5 A;  5T0K A;  2R3A A;  3VV0 A;  2F69 A;  2RFI A;  5F59 A;  5LSZ A;  3RU0 A;  3F9Z A;  1O9S A;  3QWV A;  3F9W A;  1MVX A;  1PEG A;  2W5Z A;  4H12 A;  3RIB A;  3M56 A;  1N3J A;  4J7I A;  3BO5 A;  3S7B A;  5KJK A;  4FMU A;  4Z4P A;  3OOI A;  1H3I A;  4YPA A;  3S7J A;  4WUY A;  3M57 A;  3TG4 A;  3S7D A;  3CBO A;  2IGQ A;  2JV0 A;  4C1Q A;  3K5K A;  3OS5 A;  5CCM A;  3PDN A;  3KMA A;  5KJN A;  3QWP A;  5EX3 A;  3M5A A;  3N71 A;  4BUP A;  1XQH A;  3OPE A;  5ARG A;  3SWC A;  4RZ0 A;  5LSX A;  3S7F A;  4YPE A;  5TEG A;  5TH7 A;  4NVQ A;  5CCL A;  5JIN A;  5JIY A;  5CPR B;  4QEN A;  5F5E A;  3F9X A;  2G46 A;  5T0M A; 
#chains in the Genus database with same CATH homology
 1MT6 A;  3M58 A;  3MEK A;  2O8J A;  4IJD A;  3M59 A;  4O6F A;  5JHN A;  2W5Y A;  5HI7 A;  5T5G A;  5EG2 A;  3IHX A;  5KJL A;  3OXG A;  5HQ8 A;  3SW9 A;  1ZKK A;  3RQ4 A;  3OXF A;  3KMT A;  4YPU A;  4J7F A;  4AU7 A;  1ML9 A;  3DAL A;  3KMJ A;  2QPW A;  5AYF A;  5EX0 A;  4QEO A;  3CBP A;  3MO0 A;  3EP0 A;  4LDG A;  5JJ0 A;  4YND A;  3QWW A;  3RJW A;  4J8O A;  4E47 A;  2BQZ A;  4JDS A;  4NJ5 A;  1MVH A;  5KJM A;  3RAY A;  3M55 A;  3M53 A;  5F6K C;  4MI0 A;  3MO5 A;  4JLG A;  1N6C A;  3CBM A;  3M54 A;  4I51 A;  3TG5 A;  4IJ8 A;  1MUF A;  3S8P A;  4YNP A;  5F6L A;  3MO2 A;  5TTF A;  4J83 A;  3OXL A;  1N6A A;  5ARF A;  4QEP A;  3DB5 A;  3VUZ A;  3FPD A;  3F9Y A;  4YNM A;  4O30 A;  3HNA A;  4MI5 A;  5T0K A;  2R3A A;  3VV0 A;  2F69 A;  2RFI A;  5F59 A;  5LSZ A;  3RU0 A;  3F9Z A;  1O9S A;  3QWV A;  3F9W A;  1MVX A;  1PEG A;  2W5Z A;  4H12 A;  3RIB A;  3M56 A;  1N3J A;  4J7I A;  3BO5 A;  3S7B A;  5KJK A;  4FMU A;  4Z4P A;  3OOI A;  1H3I A;  4YPA A;  3S7J A;  4WUY A;  3M57 A;  3TG4 A;  3S7D A;  3CBO A;  2IGQ A;  2JV0 A;  4C1Q A;  3K5K A;  3OS5 A;  5CCM A;  3PDN A;  3KMA A;  5KJN A;  3QWP A;  5EX3 A;  3M5A A;  3N71 A;  4BUP A;  1XQH A;  3OPE A;  5ARG A;  3SWC A;  4RZ0 A;  5LSX A;  3S7F A;  4YPE A;  5TEG A;  5TH7 A;  4NVQ A;  5CCL A;  5JIN A;  5JIY A;  5CPR B;  4QEN A;  5F5E A;  3F9X A;  2G46 A;  5T0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...