4H12A

The crystal structure of methyltransferase domain of human set domain-containing protein 2 in complex with s-adenosyl-l-homocysteine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
233
Chain Sequence
b'PSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
molecule tags Transferase
source organism Homo sapiens
publication title Sinefungin Derivatives as Inhibitors and Structure Probes of Protein Lysine Methyltransferase SETD2.
pubmed doi rcsb
total genus 60
structure length 233
sequence length 245
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4h12A00
5CPRB 5CCLA 5T0KA 4QEOA 5KJLA 4LDGA 4Z4PA 3MO5A 3RAYA 4I51A 3EP0A 4YNPA 1ZKKA 3TG4A 2W5ZA 3S8PA 3TG5A 4QEPA 5F6KC 4AU7A 5EX0A 3S7DA 3MO2A 3F9ZA 1N6CA 3MEKA 4MI0A 5TTFA 5JINA 3CBPA 5LSZA 3QWPA 3KMTA 3SW9A 3CBMA 3M56A 4J8OA 1PEGA 3MO0A 2IGQA 4JLGA 4YNDA 3F9YA 3OXFA 4H12A 5KJMA 5TH7A 3RQ4A 3FPDA 5JJ0A 2O8JA 3RIBA 3M59A 3S7JA 5HQ8A 5KJNA 5EG2A 2RFIA 1XQHA 3OXLA 5JIYA 3DB5A 5CCMA 5LSXA 4YPEA 3S7BA 2QPWA 2R3AA 3K5KA 4O6FA 3QWWA 3HNAA 5JHNA 3OOIA 5HI7A 4BUPA 5F6LA 1H3IA 5KJKA 3RU0A 4E47A 3IHXA 4NJ5A 1N3JA 3M58A 3VUZA 3QWVA 5ARFA 1N6AA 3CBOA 3RJWA 2W5YA 4J7FA 3PDNA 3KMJA 4YNMA 5F5EA 2BQZA 3M54A 4J83A 4NVQA 3VV0A 2JV0A 4MI5A 1MVHA 4C1QA 4RZ0A 1O9SA 5T5GA 3F9WA 3F9XA 3BO5A 4FMUA 3M55A 4YPUA 5T0MA 1MVXA 3SWCA 3OPEA 3OXGA 3M5AA 4WUYA 4IJ8A 4JDSA 1ML9A 1MUFA 3N71A 1MT6A 5AYFA 3M57A 4O30A 4QENA 3KMAA 3S7FA 4J7IA 2F69A 4IJDA 4YPAA 2G46A 5F59A 3OS5A 5EX3A 5ARGA 5TEGA 3M53A 3DALA
chains in the Genus database with same CATH superfamily
5CPRB 5CCLA 5T0KA 4QEOA 5KJLA 4LDGA 4Z4PA 3MO5A 3RAYA 4I51A 3EP0A 4YNPA 1ZKKA 3TG4A 2W5ZA 3S8PA 3TG5A 4QEPA 5F6KC 4AU7A 5EX0A 3S7DA 3MO2A 3F9ZA 1N6CA 3MEKA 4MI0A 5TTFA 5JINA 3CBPA 5LSZA 3QWPA 3KMTA 3SW9A 3CBMA 3M56A 4J8OA 1PEGA 3MO0A 2IGQA 4JLGA 4YNDA 3F9YA 3OXFA 4H12A 5KJMA 5TH7A 3RQ4A 3FPDA 5JJ0A 2O8JA 3RIBA 3M59A 3S7JA 5HQ8A 5KJNA 5EG2A 2RFIA 1XQHA 3OXLA 5JIYA 3DB5A 5CCMA 5LSXA 4YPEA 3S7BA 2QPWA 2R3AA 3K5KA 4O6FA 3QWWA 3HNAA 5JHNA 3OOIA 5HI7A 4BUPA 5F6LA 1H3IA 5KJKA 3RU0A 4E47A 3IHXA 4NJ5A 1N3JA 3M58A 3VUZA 3QWVA 5ARFA 1N6AA 3CBOA 3RJWA 2W5YA 4J7FA 3PDNA 3KMJA 4YNMA 5F5EA 2BQZA 3M54A 4J83A 4NVQA 3VV0A 2JV0A 4MI5A 1MVHA 4C1QA 4RZ0A 1O9SA 5T5GA 3F9WA 3F9XA 3BO5A 4FMUA 3M55A 4YPUA 5T0MA 1MVXA 3SWCA 3OPEA 3OXGA 3M5AA 4WUYA 4IJ8A 4JDSA 1ML9A 1MUFA 3N71A 1MT6A 5AYFA 3M57A 4O30A 4QENA 3KMAA 3S7FA 4J7IA 2F69A 4IJDA 4YPAA 2G46A 5F59A 3OS5A 5EX3A 5ARGA 5TEGA 3M53A 3DALA
chains in the Genus database with same CATH topology
5CPRB 5CCLA 5T0KA 4QEOA 5KJLA 4LDGA 4Z4PA 3MO5A 3RAYA 4I51A 3EP0A 4YNPA 1ZKKA 3TG4A 2W5ZA 3S8PA 3TG5A 4QEPA 5F6KC 4AU7A 5EX0A 3S7DA 3MO2A 3F9ZA 1N6CA 3MEKA 4MI0A 5TTFA 5JINA 3CBPA 5LSZA 3QWPA 3KMTA 3SW9A 3CBMA 3M56A 4J8OA 1PEGA 3MO0A 2IGQA 4JLGA 4YNDA 3F9YA 3OXFA 4H12A 5KJMA 5TH7A 3RQ4A 3FPDA 5JJ0A 2O8JA 3RIBA 3M59A 3S7JA 5HQ8A 5KJNA 5EG2A 2RFIA 1XQHA 3OXLA 5JIYA 3DB5A 5CCMA 5LSXA 4YPEA 3S7BA 2QPWA 2R3AA 3K5KA 4O6FA 3QWWA 3HNAA 5JHNA 3OOIA 5HI7A 4BUPA 5F6LA 1H3IA 5KJKA 3RU0A 4E47A 3IHXA 4NJ5A 1N3JA 3M58A 3VUZA 3QWVA 5ARFA 1N6AA 3CBOA 3RJWA 2W5YA 4J7FA 3PDNA 3KMJA 4YNMA 5F5EA 2BQZA 3M54A 4J83A 4NVQA 3VV0A 2JV0A 4MI5A 1MVHA 4C1QA 4RZ0A 1O9SA 5T5GA 3F9WA 3F9XA 3BO5A 4FMUA 3M55A 4YPUA 5T0MA 1MVXA 3SWCA 3OPEA 3OXGA 3M5AA 4WUYA 4IJ8A 4JDSA 1ML9A 1MUFA 3N71A 1MT6A 5AYFA 3M57A 4O30A 4QENA 3KMAA 3S7FA 4J7IA 2F69A 4IJDA 4YPAA 2G46A 5F59A 3OS5A 5EX3A 5ARGA 5TEGA 3M53A 3DALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPR B;  5CCL A;  5T0K A;  4QEO A;  5KJL A;  4LDG A;  4Z4P A;  3MO5 A;  3RAY A;  4I51 A;  3EP0 A;  4YNP A;  1ZKK A;  3TG4 A;  2W5Z A;  3S8P A;  3TG5 A;  4QEP A;  5F6K C;  4AU7 A;  5EX0 A;  3S7D A;  3MO2 A;  3F9Z A;  1N6C A;  3MEK A;  4MI0 A;  5TTF A;  5JIN A;  3CBP A;  5LSZ A;  3QWP A;  3KMT A;  3SW9 A;  3CBM A;  3M56 A;  4J8O A;  1PEG A;  3MO0 A;  2IGQ A;  4JLG A;  4YND A;  3F9Y A;  3OXF A;  4H12 A;  5KJM A;  5TH7 A;  3RQ4 A;  3FPD A;  5JJ0 A;  2O8J A;  3RIB A;  3M59 A;  3S7J A;  5HQ8 A;  5KJN A;  5EG2 A;  2RFI A;  1XQH A;  3OXL A;  5JIY A;  3DB5 A;  5CCM A;  5LSX A;  4YPE A;  3S7B A;  2QPW A;  2R3A A;  3K5K A;  4O6F A;  3QWW A;  3HNA A;  5JHN A;  3OOI A;  5HI7 A;  4BUP A;  5F6L A;  1H3I A;  5KJK A;  3RU0 A;  4E47 A;  3IHX A;  4NJ5 A;  1N3J A;  3M58 A;  3VUZ A;  3QWV A;  5ARF A;  1N6A A;  3CBO A;  3RJW A;  2W5Y A;  4J7F A;  3PDN A;  3KMJ A;  4YNM A;  5F5E A;  2BQZ A;  3M54 A;  4J83 A;  4NVQ A;  3VV0 A;  2JV0 A;  4MI5 A;  1MVH A;  4C1Q A;  4RZ0 A;  1O9S A;  5T5G A;  3F9W A;  3F9X A;  3BO5 A;  4FMU A;  3M55 A;  4YPU A;  5T0M A;  1MVX A;  3SWC A;  3OPE A;  3OXG A;  3M5A A;  4WUY A;  4IJ8 A;  4JDS A;  1ML9 A;  1MUF A;  3N71 A;  1MT6 A;  5AYF A;  3M57 A;  4O30 A;  4QEN A;  3KMA A;  3S7F A;  4J7I A;  2F69 A;  4IJD A;  4YPA A;  2G46 A;  5F59 A;  3OS5 A;  5EX3 A;  5ARG A;  5TEG A;  3M53 A;  3DAL A; 
#chains in the Genus database with same CATH topology
 5CPR B;  5CCL A;  5T0K A;  4QEO A;  5KJL A;  4LDG A;  4Z4P A;  3MO5 A;  3RAY A;  4I51 A;  3EP0 A;  4YNP A;  1ZKK A;  3TG4 A;  2W5Z A;  3S8P A;  3TG5 A;  4QEP A;  5F6K C;  4AU7 A;  5EX0 A;  3S7D A;  3MO2 A;  3F9Z A;  1N6C A;  3MEK A;  4MI0 A;  5TTF A;  5JIN A;  3CBP A;  5LSZ A;  3QWP A;  3KMT A;  3SW9 A;  3CBM A;  3M56 A;  4J8O A;  1PEG A;  3MO0 A;  2IGQ A;  4JLG A;  4YND A;  3F9Y A;  3OXF A;  4H12 A;  5KJM A;  5TH7 A;  3RQ4 A;  3FPD A;  5JJ0 A;  2O8J A;  3RIB A;  3M59 A;  3S7J A;  5HQ8 A;  5KJN A;  5EG2 A;  2RFI A;  1XQH A;  3OXL A;  5JIY A;  3DB5 A;  5CCM A;  5LSX A;  4YPE A;  3S7B A;  2QPW A;  2R3A A;  3K5K A;  4O6F A;  3QWW A;  3HNA A;  5JHN A;  3OOI A;  5HI7 A;  4BUP A;  5F6L A;  1H3I A;  5KJK A;  3RU0 A;  4E47 A;  3IHX A;  4NJ5 A;  1N3J A;  3M58 A;  3VUZ A;  3QWV A;  5ARF A;  1N6A A;  3CBO A;  3RJW A;  2W5Y A;  4J7F A;  3PDN A;  3KMJ A;  4YNM A;  5F5E A;  2BQZ A;  3M54 A;  4J83 A;  4NVQ A;  3VV0 A;  2JV0 A;  4MI5 A;  1MVH A;  4C1Q A;  4RZ0 A;  1O9S A;  5T5G A;  3F9W A;  3F9X A;  3BO5 A;  4FMU A;  3M55 A;  4YPU A;  5T0M A;  1MVX A;  3SWC A;  3OPE A;  3OXG A;  3M5A A;  4WUY A;  4IJ8 A;  4JDS A;  1ML9 A;  1MUF A;  3N71 A;  1MT6 A;  5AYF A;  3M57 A;  4O30 A;  4QEN A;  3KMA A;  3S7F A;  4J7I A;  2F69 A;  4IJD A;  4YPA A;  2G46 A;  5F59 A;  3OS5 A;  5EX3 A;  5ARG A;  5TEG A;  3M53 A;  3DAL A; 
#chains in the Genus database with same CATH homology
 5CPR B;  5CCL A;  5T0K A;  4QEO A;  5KJL A;  4LDG A;  4Z4P A;  3MO5 A;  3RAY A;  4I51 A;  3EP0 A;  4YNP A;  1ZKK A;  3TG4 A;  2W5Z A;  3S8P A;  3TG5 A;  4QEP A;  5F6K C;  4AU7 A;  5EX0 A;  3S7D A;  3MO2 A;  3F9Z A;  1N6C A;  3MEK A;  4MI0 A;  5TTF A;  5JIN A;  3CBP A;  5LSZ A;  3QWP A;  3KMT A;  3SW9 A;  3CBM A;  3M56 A;  4J8O A;  1PEG A;  3MO0 A;  2IGQ A;  4JLG A;  4YND A;  3F9Y A;  3OXF A;  4H12 A;  5KJM A;  5TH7 A;  3RQ4 A;  3FPD A;  5JJ0 A;  2O8J A;  3RIB A;  3M59 A;  3S7J A;  5HQ8 A;  5KJN A;  5EG2 A;  2RFI A;  1XQH A;  3OXL A;  5JIY A;  3DB5 A;  5CCM A;  5LSX A;  4YPE A;  3S7B A;  2QPW A;  2R3A A;  3K5K A;  4O6F A;  3QWW A;  3HNA A;  5JHN A;  3OOI A;  5HI7 A;  4BUP A;  5F6L A;  1H3I A;  5KJK A;  3RU0 A;  4E47 A;  3IHX A;  4NJ5 A;  1N3J A;  3M58 A;  3VUZ A;  3QWV A;  5ARF A;  1N6A A;  3CBO A;  3RJW A;  2W5Y A;  4J7F A;  3PDN A;  3KMJ A;  4YNM A;  5F5E A;  2BQZ A;  3M54 A;  4J83 A;  4NVQ A;  3VV0 A;  2JV0 A;  4MI5 A;  1MVH A;  4C1Q A;  4RZ0 A;  1O9S A;  5T5G A;  3F9W A;  3F9X A;  3BO5 A;  4FMU A;  3M55 A;  4YPU A;  5T0M A;  1MVX A;  3SWC A;  3OPE A;  3OXG A;  3M5A A;  4WUY A;  4IJ8 A;  4JDS A;  1ML9 A;  1MUF A;  3N71 A;  1MT6 A;  5AYF A;  3M57 A;  4O30 A;  4QEN A;  3KMA A;  3S7F A;  4J7I A;  2F69 A;  4IJD A;  4YPA A;  2G46 A;  5F59 A;  3OS5 A;  5EX3 A;  5ARG A;  5TEG A;  3M53 A;  3DAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...