4H12A

The crystal structure of methyltransferase domain of human set domain-containing protein 2 in complex with s-adenosyl-l-homocysteine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
233
Chain Sequence
PSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Sinefungin Derivatives as Inhibitors and Structure Probes of Protein Lysine Methyltransferase SETD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 60
structure length 233
sequence length 245
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4h12A00
4AU7A 5T0MA 2W5YA 3TG4A 4BUPA 1N3JA 5LSXA 4QEOA 3M55A 3N71A 4YPUA 1MUFA 4YNDA 3MO2A 4WUYA 4YNPA 2G46A 3OPEA 4NJ5A 5F6KC 4NVQA 1ZKKA 5CPRB 3MEKA 5KJKA 3HNAA 5ARGA 5EG2A 4YPEA 5JINA 1H3IA 3FPDA 3SWCA 5JIYA 4J7IA 5T5GA 3M53A 4J7FA 4LDGA 5TTFA 3K5KA 1ML9A 5F5EA 3KMTA 3M58A 2F69A 4YNMA 3DB5A 3OOIA 1N6AA 3RQ4A 5HQ8A 3KMJA 5TEGA 3EP0A 4MI0A 3TG5A 4E47A 3BO5A 4RZ0A 5KJLA 5CCLA 1XQHA 3M5AA 4JDSA 3RJWA 4J83A 3QWVA 1PEGA 4FMUA 2JV0A 3M59A 4O30A 5CCMA 5EX3A 4QEPA 3CBOA 1MVXA 3OXLA 3M56A 2QPWA 5F59A 5LSZA 3IHXA 4MI5A 3S7FA 3DALA 4YPAA 4QENA 5T0KA 3RAYA 1MVHA 3M57A 3PDNA 5JHNA 3F9YA 3CBPA 5EX0A 4JLGA 2O8JA 4C1QA 3S7DA 3MO5A 3OXFA 3F9XA 3S7JA 3S8PA 1MT6A 5KJMA 3RIBA 2IGQA 3MO0A 3VUZA 3F9WA 3KMAA 2W5ZA 3QWPA 5ARFA 3SW9A 5HI7A 3S7BA 3M54A 3RU0A 2BQZA 3CBMA 4IJ8A 2RFIA 3QWWA 4IJDA 4Z4PA 3VV0A 1O9SA 2R3AA 5KJNA 4I51A 5TH7A 4J8OA 3F9ZA 5AYFA 3OS5A 5JJ0A 1N6CA 5F6LA 4H12A 3OXGA 4O6FA
chains in the Genus database with same CATH superfamily
4AU7A 5T0MA 2W5YA 3TG4A 4BUPA 1N3JA 5LSXA 4QEOA 3M55A 3N71A 4YPUA 1MUFA 4YNDA 3MO2A 4WUYA 4YNPA 2G46A 3OPEA 4NJ5A 5F6KC 4NVQA 1ZKKA 5CPRB 3MEKA 5KJKA 3HNAA 5ARGA 5EG2A 4YPEA 5JINA 1H3IA 3FPDA 3SWCA 5JIYA 4J7IA 5T5GA 3M53A 4J7FA 4LDGA 5TTFA 3K5KA 1ML9A 5F5EA 3KMTA 3M58A 2F69A 4YNMA 3DB5A 3OOIA 1N6AA 3RQ4A 5HQ8A 3KMJA 5TEGA 3EP0A 4MI0A 3TG5A 4E47A 3BO5A 4RZ0A 5KJLA 5CCLA 1XQHA 3M5AA 4JDSA 3RJWA 4J83A 3QWVA 1PEGA 4FMUA 2JV0A 3M59A 4O30A 5CCMA 5EX3A 4QEPA 3CBOA 1MVXA 3OXLA 3M56A 2QPWA 5F59A 5LSZA 3IHXA 4MI5A 3S7FA 3DALA 4YPAA 4QENA 5T0KA 3RAYA 1MVHA 3M57A 3PDNA 5JHNA 3F9YA 3CBPA 5EX0A 4JLGA 2O8JA 4C1QA 3S7DA 3MO5A 3OXFA 3F9XA 3S7JA 3S8PA 1MT6A 5KJMA 3RIBA 2IGQA 3MO0A 3VUZA 3F9WA 3KMAA 2W5ZA 3QWPA 5ARFA 3SW9A 5HI7A 3S7BA 3M54A 3RU0A 2BQZA 3CBMA 4IJ8A 2RFIA 3QWWA 4IJDA 4Z4PA 3VV0A 1O9SA 2R3AA 5KJNA 4I51A 5TH7A 4J8OA 3F9ZA 5AYFA 3OS5A 5JJ0A 1N6CA 5F6LA 4H12A 3OXGA 4O6FA
chains in the Genus database with same CATH topology
4AU7A 5T0MA 2W5YA 3TG4A 4BUPA 1N3JA 5LSXA 4QEOA 3M55A 3N71A 4YPUA 1MUFA 4YNDA 3MO2A 4WUYA 4YNPA 2G46A 3OPEA 4NJ5A 5F6KC 4NVQA 1ZKKA 5CPRB 3MEKA 5KJKA 3HNAA 5ARGA 5EG2A 4YPEA 5JINA 1H3IA 3FPDA 3SWCA 5JIYA 4J7IA 5T5GA 3M53A 4J7FA 4LDGA 5TTFA 3K5KA 1ML9A 5F5EA 3KMTA 3M58A 2F69A 4YNMA 3DB5A 3OOIA 1N6AA 3RQ4A 5HQ8A 3KMJA 5TEGA 3EP0A 4MI0A 3TG5A 4E47A 3BO5A 4RZ0A 5KJLA 5CCLA 1XQHA 3M5AA 4JDSA 3RJWA 4J83A 3QWVA 1PEGA 4FMUA 2JV0A 3M59A 4O30A 5CCMA 5EX3A 4QEPA 3CBOA 1MVXA 3OXLA 3M56A 2QPWA 5F59A 5LSZA 3IHXA 4MI5A 3S7FA 3DALA 4YPAA 4QENA 5T0KA 3RAYA 1MVHA 3M57A 3PDNA 5JHNA 3F9YA 3CBPA 5EX0A 4JLGA 2O8JA 4C1QA 3S7DA 3MO5A 3OXFA 3F9XA 3S7JA 3S8PA 1MT6A 5KJMA 3RIBA 2IGQA 3MO0A 3VUZA 3F9WA 3KMAA 2W5ZA 3QWPA 5ARFA 3SW9A 5HI7A 3S7BA 3M54A 3RU0A 2BQZA 3CBMA 4IJ8A 2RFIA 3QWWA 4IJDA 4Z4PA 3VV0A 1O9SA 2R3AA 5KJNA 4I51A 5TH7A 4J8OA 3F9ZA 5AYFA 3OS5A 5JJ0A 1N6CA 5F6LA 4H12A 3OXGA 4O6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AU7 A;  5T0M A;  2W5Y A;  3TG4 A;  4BUP A;  1N3J A;  5LSX A;  4QEO A;  3M55 A;  3N71 A;  4YPU A;  1MUF A;  4YND A;  3MO2 A;  4WUY A;  4YNP A;  2G46 A;  3OPE A;  4NJ5 A;  5F6K C;  4NVQ A;  1ZKK A;  5CPR B;  3MEK A;  5KJK A;  3HNA A;  5ARG A;  5EG2 A;  4YPE A;  5JIN A;  1H3I A;  3FPD A;  3SWC A;  5JIY A;  4J7I A;  5T5G A;  3M53 A;  4J7F A;  4LDG A;  5TTF A;  3K5K A;  1ML9 A;  5F5E A;  3KMT A;  3M58 A;  2F69 A;  4YNM A;  3DB5 A;  3OOI A;  1N6A A;  3RQ4 A;  5HQ8 A;  3KMJ A;  5TEG A;  3EP0 A;  4MI0 A;  3TG5 A;  4E47 A;  3BO5 A;  4RZ0 A;  5KJL A;  5CCL A;  1XQH A;  3M5A A;  4JDS A;  3RJW A;  4J83 A;  3QWV A;  1PEG A;  4FMU A;  2JV0 A;  3M59 A;  4O30 A;  5CCM A;  5EX3 A;  4QEP A;  3CBO A;  1MVX A;  3OXL A;  3M56 A;  2QPW A;  5F59 A;  5LSZ A;  3IHX A;  4MI5 A;  3S7F A;  3DAL A;  4YPA A;  4QEN A;  5T0K A;  3RAY A;  1MVH A;  3M57 A;  3PDN A;  5JHN A;  3F9Y A;  3CBP A;  5EX0 A;  4JLG A;  2O8J A;  4C1Q A;  3S7D A;  3MO5 A;  3OXF A;  3F9X A;  3S7J A;  3S8P A;  1MT6 A;  5KJM A;  3RIB A;  2IGQ A;  3MO0 A;  3VUZ A;  3F9W A;  3KMA A;  2W5Z A;  3QWP A;  5ARF A;  3SW9 A;  5HI7 A;  3S7B A;  3M54 A;  3RU0 A;  2BQZ A;  3CBM A;  4IJ8 A;  2RFI A;  3QWW A;  4IJD A;  4Z4P A;  3VV0 A;  1O9S A;  2R3A A;  5KJN A;  4I51 A;  5TH7 A;  4J8O A;  3F9Z A;  5AYF A;  3OS5 A;  5JJ0 A;  1N6C A;  5F6L A;  4H12 A;  3OXG A;  4O6F A; 
#chains in the Genus database with same CATH topology
 4AU7 A;  5T0M A;  2W5Y A;  3TG4 A;  4BUP A;  1N3J A;  5LSX A;  4QEO A;  3M55 A;  3N71 A;  4YPU A;  1MUF A;  4YND A;  3MO2 A;  4WUY A;  4YNP A;  2G46 A;  3OPE A;  4NJ5 A;  5F6K C;  4NVQ A;  1ZKK A;  5CPR B;  3MEK A;  5KJK A;  3HNA A;  5ARG A;  5EG2 A;  4YPE A;  5JIN A;  1H3I A;  3FPD A;  3SWC A;  5JIY A;  4J7I A;  5T5G A;  3M53 A;  4J7F A;  4LDG A;  5TTF A;  3K5K A;  1ML9 A;  5F5E A;  3KMT A;  3M58 A;  2F69 A;  4YNM A;  3DB5 A;  3OOI A;  1N6A A;  3RQ4 A;  5HQ8 A;  3KMJ A;  5TEG A;  3EP0 A;  4MI0 A;  3TG5 A;  4E47 A;  3BO5 A;  4RZ0 A;  5KJL A;  5CCL A;  1XQH A;  3M5A A;  4JDS A;  3RJW A;  4J83 A;  3QWV A;  1PEG A;  4FMU A;  2JV0 A;  3M59 A;  4O30 A;  5CCM A;  5EX3 A;  4QEP A;  3CBO A;  1MVX A;  3OXL A;  3M56 A;  2QPW A;  5F59 A;  5LSZ A;  3IHX A;  4MI5 A;  3S7F A;  3DAL A;  4YPA A;  4QEN A;  5T0K A;  3RAY A;  1MVH A;  3M57 A;  3PDN A;  5JHN A;  3F9Y A;  3CBP A;  5EX0 A;  4JLG A;  2O8J A;  4C1Q A;  3S7D A;  3MO5 A;  3OXF A;  3F9X A;  3S7J A;  3S8P A;  1MT6 A;  5KJM A;  3RIB A;  2IGQ A;  3MO0 A;  3VUZ A;  3F9W A;  3KMA A;  2W5Z A;  3QWP A;  5ARF A;  3SW9 A;  5HI7 A;  3S7B A;  3M54 A;  3RU0 A;  2BQZ A;  3CBM A;  4IJ8 A;  2RFI A;  3QWW A;  4IJD A;  4Z4P A;  3VV0 A;  1O9S A;  2R3A A;  5KJN A;  4I51 A;  5TH7 A;  4J8O A;  3F9Z A;  5AYF A;  3OS5 A;  5JJ0 A;  1N6C A;  5F6L A;  4H12 A;  3OXG A;  4O6F A; 
#chains in the Genus database with same CATH homology
 4AU7 A;  5T0M A;  2W5Y A;  3TG4 A;  4BUP A;  1N3J A;  5LSX A;  4QEO A;  3M55 A;  3N71 A;  4YPU A;  1MUF A;  4YND A;  3MO2 A;  4WUY A;  4YNP A;  2G46 A;  3OPE A;  4NJ5 A;  5F6K C;  4NVQ A;  1ZKK A;  5CPR B;  3MEK A;  5KJK A;  3HNA A;  5ARG A;  5EG2 A;  4YPE A;  5JIN A;  1H3I A;  3FPD A;  3SWC A;  5JIY A;  4J7I A;  5T5G A;  3M53 A;  4J7F A;  4LDG A;  5TTF A;  3K5K A;  1ML9 A;  5F5E A;  3KMT A;  3M58 A;  2F69 A;  4YNM A;  3DB5 A;  3OOI A;  1N6A A;  3RQ4 A;  5HQ8 A;  3KMJ A;  5TEG A;  3EP0 A;  4MI0 A;  3TG5 A;  4E47 A;  3BO5 A;  4RZ0 A;  5KJL A;  5CCL A;  1XQH A;  3M5A A;  4JDS A;  3RJW A;  4J83 A;  3QWV A;  1PEG A;  4FMU A;  2JV0 A;  3M59 A;  4O30 A;  5CCM A;  5EX3 A;  4QEP A;  3CBO A;  1MVX A;  3OXL A;  3M56 A;  2QPW A;  5F59 A;  5LSZ A;  3IHX A;  4MI5 A;  3S7F A;  3DAL A;  4YPA A;  4QEN A;  5T0K A;  3RAY A;  1MVH A;  3M57 A;  3PDN A;  5JHN A;  3F9Y A;  3CBP A;  5EX0 A;  4JLG A;  2O8J A;  4C1Q A;  3S7D A;  3MO5 A;  3OXF A;  3F9X A;  3S7J A;  3S8P A;  1MT6 A;  5KJM A;  3RIB A;  2IGQ A;  3MO0 A;  3VUZ A;  3F9W A;  3KMA A;  2W5Z A;  3QWP A;  5ARF A;  3SW9 A;  5HI7 A;  3S7B A;  3M54 A;  3RU0 A;  2BQZ A;  3CBM A;  4IJ8 A;  2RFI A;  3QWW A;  4IJD A;  4Z4P A;  3VV0 A;  1O9S A;  2R3A A;  5KJN A;  4I51 A;  5TH7 A;  4J8O A;  3F9Z A;  5AYF A;  3OS5 A;  5JJ0 A;  1N6C A;  5F6L A;  4H12 A;  3OXG A;  4O6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...