4H12A

The crystal structure of methyltransferase domain of human set domain-containing protein 2 in complex with s-adenosyl-l-homocysteine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
233
Chain Sequence
b'PSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Sinefungin Derivatives as Inhibitors and Structure Probes of Protein Lysine Methyltransferase SETD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 60
structure length 233
sequence length 245
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4h12A00
4J83A 2R3AA 5HQ8A 3M58A 3CBOA 4MI0A 5JINA 3M5AA 1ZKKA 5F59A 3SW9A 4MI5A 1XQHA 5ARGA 5KJKA 1N3JA 5LSXA 4YNMA 5T0MA 5EG2A 4QEPA 4I51A 5CCLA 2RFIA 5AYFA 1N6AA 4C1QA 3KMAA 4WUYA 2IGQA 3M59A 5T5GA 4YNDA 4J7IA 5CCMA 3MO0A 3DB5A 1N6CA 2F69A 5EX0A 5HI7A 2JV0A 1MT6A 4JDSA 5JJ0A 3SWCA 3MO2A 3S7DA 4H12A 3S7FA 5T0KA 3CBMA 5TH7A 3N71A 3S7BA 3BO5A 4QEOA 3RQ4A 5JIYA 5CPRB 3F9WA 4E47A 3FPDA 3KMTA 5KJNA 4J7FA 3CBPA 2O8JA 3S7JA 3F9YA 4YPEA 3M53A 3OXFA 3M57A 4RZ0A 1ML9A 3M56A 3TG4A 4QENA 4YPUA 4LDGA 3OXLA 3OPEA 3MO5A 5TEGA 1MUFA 5F6LA 2G46A 4AU7A 4IJDA 5F6KC 3PDNA 5ARFA 5LSZA 3RJWA 4FMUA 3EP0A 3K5KA 3M55A 5KJMA 3TG5A 3RU0A 2QPWA 2BQZA 5JHNA 3QWWA 1H3IA 3OXGA 1O9SA 2W5YA 3F9XA 2W5ZA 3QWPA 3IHXA 3S8PA 4J8OA 4O6FA 3HNAA 5EX3A 4NVQA 3QWVA 4NJ5A 3KMJA 3RAYA 1PEGA 3VUZA 1MVHA 4BUPA 1MVXA 3RIBA 5KJLA 4O30A 3DALA 3MEKA 3VV0A 5F5EA 3OS5A 4JLGA 4Z4PA 4YNPA 3F9ZA 3M54A 4YPAA 4IJ8A 3OOIA 5TTFA
chains in the Genus database with same CATH superfamily
4J83A 2R3AA 5HQ8A 3M58A 3CBOA 4MI0A 5JINA 3M5AA 1ZKKA 5F59A 3SW9A 4MI5A 1XQHA 5ARGA 5KJKA 1N3JA 5LSXA 4YNMA 5T0MA 5EG2A 4QEPA 4I51A 5CCLA 2RFIA 5AYFA 1N6AA 4C1QA 3KMAA 4WUYA 2IGQA 3M59A 5T5GA 4YNDA 4J7IA 5CCMA 3MO0A 3DB5A 1N6CA 2F69A 5EX0A 5HI7A 2JV0A 1MT6A 4JDSA 5JJ0A 3SWCA 3MO2A 3S7DA 4H12A 3S7FA 5T0KA 3CBMA 5TH7A 3N71A 3S7BA 3BO5A 4QEOA 3RQ4A 5JIYA 5CPRB 3F9WA 4E47A 3FPDA 3KMTA 5KJNA 4J7FA 3CBPA 2O8JA 3S7JA 3F9YA 4YPEA 3M53A 3OXFA 3M57A 4RZ0A 1ML9A 3M56A 3TG4A 4QENA 4YPUA 4LDGA 3OXLA 3OPEA 3MO5A 5TEGA 1MUFA 5F6LA 2G46A 4AU7A 4IJDA 5F6KC 3PDNA 5ARFA 5LSZA 3RJWA 4FMUA 3EP0A 3K5KA 3M55A 5KJMA 3TG5A 3RU0A 2QPWA 2BQZA 5JHNA 3QWWA 1H3IA 3OXGA 1O9SA 2W5YA 3F9XA 2W5ZA 3QWPA 3IHXA 3S8PA 4J8OA 4O6FA 3HNAA 5EX3A 4NVQA 3QWVA 4NJ5A 3KMJA 3RAYA 1PEGA 3VUZA 1MVHA 4BUPA 1MVXA 3RIBA 5KJLA 4O30A 3DALA 3MEKA 3VV0A 5F5EA 3OS5A 4JLGA 4Z4PA 4YNPA 3F9ZA 3M54A 4YPAA 4IJ8A 3OOIA 5TTFA
chains in the Genus database with same CATH topology
4J83A 2R3AA 5HQ8A 3M58A 3CBOA 4MI0A 5JINA 3M5AA 1ZKKA 5F59A 3SW9A 4MI5A 1XQHA 5ARGA 5KJKA 1N3JA 5LSXA 4YNMA 5T0MA 5EG2A 4QEPA 4I51A 5CCLA 2RFIA 5AYFA 1N6AA 4C1QA 3KMAA 4WUYA 2IGQA 3M59A 5T5GA 4YNDA 4J7IA 5CCMA 3MO0A 3DB5A 1N6CA 2F69A 5EX0A 5HI7A 2JV0A 1MT6A 4JDSA 5JJ0A 3SWCA 3MO2A 3S7DA 4H12A 3S7FA 5T0KA 3CBMA 5TH7A 3N71A 3S7BA 3BO5A 4QEOA 3RQ4A 5JIYA 5CPRB 3F9WA 4E47A 3FPDA 3KMTA 5KJNA 4J7FA 3CBPA 2O8JA 3S7JA 3F9YA 4YPEA 3M53A 3OXFA 3M57A 4RZ0A 1ML9A 3M56A 3TG4A 4QENA 4YPUA 4LDGA 3OXLA 3OPEA 3MO5A 5TEGA 1MUFA 5F6LA 2G46A 4AU7A 4IJDA 5F6KC 3PDNA 5ARFA 5LSZA 3RJWA 4FMUA 3EP0A 3K5KA 3M55A 5KJMA 3TG5A 3RU0A 2QPWA 2BQZA 5JHNA 3QWWA 1H3IA 3OXGA 1O9SA 2W5YA 3F9XA 2W5ZA 3QWPA 3IHXA 3S8PA 4J8OA 4O6FA 3HNAA 5EX3A 4NVQA 3QWVA 4NJ5A 3KMJA 3RAYA 1PEGA 3VUZA 1MVHA 4BUPA 1MVXA 3RIBA 5KJLA 4O30A 3DALA 3MEKA 3VV0A 5F5EA 3OS5A 4JLGA 4Z4PA 4YNPA 3F9ZA 3M54A 4YPAA 4IJ8A 3OOIA 5TTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J83 A;  2R3A A;  5HQ8 A;  3M58 A;  3CBO A;  4MI0 A;  5JIN A;  3M5A A;  1ZKK A;  5F59 A;  3SW9 A;  4MI5 A;  1XQH A;  5ARG A;  5KJK A;  1N3J A;  5LSX A;  4YNM A;  5T0M A;  5EG2 A;  4QEP A;  4I51 A;  5CCL A;  2RFI A;  5AYF A;  1N6A A;  4C1Q A;  3KMA A;  4WUY A;  2IGQ A;  3M59 A;  5T5G A;  4YND A;  4J7I A;  5CCM A;  3MO0 A;  3DB5 A;  1N6C A;  2F69 A;  5EX0 A;  5HI7 A;  2JV0 A;  1MT6 A;  4JDS A;  5JJ0 A;  3SWC A;  3MO2 A;  3S7D A;  4H12 A;  3S7F A;  5T0K A;  3CBM A;  5TH7 A;  3N71 A;  3S7B A;  3BO5 A;  4QEO A;  3RQ4 A;  5JIY A;  5CPR B;  3F9W A;  4E47 A;  3FPD A;  3KMT A;  5KJN A;  4J7F A;  3CBP A;  2O8J A;  3S7J A;  3F9Y A;  4YPE A;  3M53 A;  3OXF A;  3M57 A;  4RZ0 A;  1ML9 A;  3M56 A;  3TG4 A;  4QEN A;  4YPU A;  4LDG A;  3OXL A;  3OPE A;  3MO5 A;  5TEG A;  1MUF A;  5F6L A;  2G46 A;  4AU7 A;  4IJD A;  5F6K C;  3PDN A;  5ARF A;  5LSZ A;  3RJW A;  4FMU A;  3EP0 A;  3K5K A;  3M55 A;  5KJM A;  3TG5 A;  3RU0 A;  2QPW A;  2BQZ A;  5JHN A;  3QWW A;  1H3I A;  3OXG A;  1O9S A;  2W5Y A;  3F9X A;  2W5Z A;  3QWP A;  3IHX A;  3S8P A;  4J8O A;  4O6F A;  3HNA A;  5EX3 A;  4NVQ A;  3QWV A;  4NJ5 A;  3KMJ A;  3RAY A;  1PEG A;  3VUZ A;  1MVH A;  4BUP A;  1MVX A;  3RIB A;  5KJL A;  4O30 A;  3DAL A;  3MEK A;  3VV0 A;  5F5E A;  3OS5 A;  4JLG A;  4Z4P A;  4YNP A;  3F9Z A;  3M54 A;  4YPA A;  4IJ8 A;  3OOI A;  5TTF A; 
#chains in the Genus database with same CATH topology
 4J83 A;  2R3A A;  5HQ8 A;  3M58 A;  3CBO A;  4MI0 A;  5JIN A;  3M5A A;  1ZKK A;  5F59 A;  3SW9 A;  4MI5 A;  1XQH A;  5ARG A;  5KJK A;  1N3J A;  5LSX A;  4YNM A;  5T0M A;  5EG2 A;  4QEP A;  4I51 A;  5CCL A;  2RFI A;  5AYF A;  1N6A A;  4C1Q A;  3KMA A;  4WUY A;  2IGQ A;  3M59 A;  5T5G A;  4YND A;  4J7I A;  5CCM A;  3MO0 A;  3DB5 A;  1N6C A;  2F69 A;  5EX0 A;  5HI7 A;  2JV0 A;  1MT6 A;  4JDS A;  5JJ0 A;  3SWC A;  3MO2 A;  3S7D A;  4H12 A;  3S7F A;  5T0K A;  3CBM A;  5TH7 A;  3N71 A;  3S7B A;  3BO5 A;  4QEO A;  3RQ4 A;  5JIY A;  5CPR B;  3F9W A;  4E47 A;  3FPD A;  3KMT A;  5KJN A;  4J7F A;  3CBP A;  2O8J A;  3S7J A;  3F9Y A;  4YPE A;  3M53 A;  3OXF A;  3M57 A;  4RZ0 A;  1ML9 A;  3M56 A;  3TG4 A;  4QEN A;  4YPU A;  4LDG A;  3OXL A;  3OPE A;  3MO5 A;  5TEG A;  1MUF A;  5F6L A;  2G46 A;  4AU7 A;  4IJD A;  5F6K C;  3PDN A;  5ARF A;  5LSZ A;  3RJW A;  4FMU A;  3EP0 A;  3K5K A;  3M55 A;  5KJM A;  3TG5 A;  3RU0 A;  2QPW A;  2BQZ A;  5JHN A;  3QWW A;  1H3I A;  3OXG A;  1O9S A;  2W5Y A;  3F9X A;  2W5Z A;  3QWP A;  3IHX A;  3S8P A;  4J8O A;  4O6F A;  3HNA A;  5EX3 A;  4NVQ A;  3QWV A;  4NJ5 A;  3KMJ A;  3RAY A;  1PEG A;  3VUZ A;  1MVH A;  4BUP A;  1MVX A;  3RIB A;  5KJL A;  4O30 A;  3DAL A;  3MEK A;  3VV0 A;  5F5E A;  3OS5 A;  4JLG A;  4Z4P A;  4YNP A;  3F9Z A;  3M54 A;  4YPA A;  4IJ8 A;  3OOI A;  5TTF A; 
#chains in the Genus database with same CATH homology
 4J83 A;  2R3A A;  5HQ8 A;  3M58 A;  3CBO A;  4MI0 A;  5JIN A;  3M5A A;  1ZKK A;  5F59 A;  3SW9 A;  4MI5 A;  1XQH A;  5ARG A;  5KJK A;  1N3J A;  5LSX A;  4YNM A;  5T0M A;  5EG2 A;  4QEP A;  4I51 A;  5CCL A;  2RFI A;  5AYF A;  1N6A A;  4C1Q A;  3KMA A;  4WUY A;  2IGQ A;  3M59 A;  5T5G A;  4YND A;  4J7I A;  5CCM A;  3MO0 A;  3DB5 A;  1N6C A;  2F69 A;  5EX0 A;  5HI7 A;  2JV0 A;  1MT6 A;  4JDS A;  5JJ0 A;  3SWC A;  3MO2 A;  3S7D A;  4H12 A;  3S7F A;  5T0K A;  3CBM A;  5TH7 A;  3N71 A;  3S7B A;  3BO5 A;  4QEO A;  3RQ4 A;  5JIY A;  5CPR B;  3F9W A;  4E47 A;  3FPD A;  3KMT A;  5KJN A;  4J7F A;  3CBP A;  2O8J A;  3S7J A;  3F9Y A;  4YPE A;  3M53 A;  3OXF A;  3M57 A;  4RZ0 A;  1ML9 A;  3M56 A;  3TG4 A;  4QEN A;  4YPU A;  4LDG A;  3OXL A;  3OPE A;  3MO5 A;  5TEG A;  1MUF A;  5F6L A;  2G46 A;  4AU7 A;  4IJD A;  5F6K C;  3PDN A;  5ARF A;  5LSZ A;  3RJW A;  4FMU A;  3EP0 A;  3K5K A;  3M55 A;  5KJM A;  3TG5 A;  3RU0 A;  2QPW A;  2BQZ A;  5JHN A;  3QWW A;  1H3I A;  3OXG A;  1O9S A;  2W5Y A;  3F9X A;  2W5Z A;  3QWP A;  3IHX A;  3S8P A;  4J8O A;  4O6F A;  3HNA A;  5EX3 A;  4NVQ A;  3QWV A;  4NJ5 A;  3KMJ A;  3RAY A;  1PEG A;  3VUZ A;  1MVH A;  4BUP A;  1MVX A;  3RIB A;  5KJL A;  4O30 A;  3DAL A;  3MEK A;  3VV0 A;  5F5E A;  3OS5 A;  4JLG A;  4Z4P A;  4YNP A;  3F9Z A;  3M54 A;  4YPA A;  4IJ8 A;  3OOI A;  5TTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...