4H12A

The crystal structure of methyltransferase domain of human set domain-containing protein 2 in complex with s-adenosyl-l-homocysteine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
233
Chain Sequence
PSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Sinefungin Derivatives as Inhibitors and Structure Probes of Protein Lysine Methyltransferase SETD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 233
sequence length 245
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4h12A00
4J7FA 3M5AA 3EP0A 5HI7A 4O6FA 4E47A 3M59A 3CBMA 5ARFA 3RU0A 5AYFA 5ARGA 3S7DA 3BO5A 2QPWA 5CCLA 5JIYA 4WUYA 5KJMA 3MEKA 2JV0A 5LSXA 3M54A 2R3AA 3KMAA 4MI0A 3DB5A 3S7BA 3IHXA 5HQ8A 3S7FA 4YPAA 5T5GA 3QWPA 4QEOA 5T0KA 3F9XA 5TEGA 3MO0A 2IGQA 3RAYA 3QWWA 3SWCA 1N6AA 3KMJA 5TTFA 3RJWA 4H12A 5KJNA 2RFIA 4QENA 3F9YA 4NVQA 5F5EA 4JLGA 1ML9A 3M58A 4RZ0A 3OXLA 4I51A 4O30A 2BQZA 3M53A 1PEGA 4YNPA 5F6KC 4AU7A 3VV0A 3OPEA 5F6LA 3MO2A 4LDGA 5F59A 3F9ZA 3CBPA 5JJ0A 5JHNA 3QWVA 4IJ8A 2G46A 4YPEA 2F69A 5EX3A 4JDSA 5EX0A 1O9SA 3RQ4A 5CCMA 4C1QA 3S7JA 4J83A 3PDNA 2W5YA 5CPRB 4YNMA 1MVXA 4YPUA 3DALA 1MUFA 3HNAA 3CBOA 5LSZA 4IJDA 4NJ5A 1ZKKA 4YNDA 3S8PA 4FMUA 4QEPA 3RIBA 3VUZA 3M56A 3OXFA 1MT6A 5EG2A 3KMTA 1H3IA 3MO5A 5KJLA 1N3JA 3N71A 1N6CA 1MVHA 3K5KA 4J8OA 3OS5A 2O8JA 3OOIA 3TG4A 5T0MA 5KJKA 5TH7A 1XQHA 4MI5A 3SW9A 4J7IA 3TG5A 3OXGA 3M57A 3M55A 3FPDA 4Z4PA 3F9WA 2W5ZA 5JINA 4BUPA
chains in the Genus database with same CATH superfamily
4J7FA 3M5AA 3EP0A 5HI7A 4O6FA 4E47A 3M59A 3CBMA 5ARFA 3RU0A 5AYFA 5ARGA 3S7DA 3BO5A 2QPWA 5CCLA 5JIYA 4WUYA 5KJMA 3MEKA 2JV0A 5LSXA 3M54A 2R3AA 3KMAA 4MI0A 3DB5A 3S7BA 3IHXA 5HQ8A 3S7FA 4YPAA 5T5GA 3QWPA 4QEOA 5T0KA 3F9XA 5TEGA 3MO0A 2IGQA 3RAYA 3QWWA 3SWCA 1N6AA 3KMJA 5TTFA 3RJWA 4H12A 5KJNA 2RFIA 4QENA 3F9YA 4NVQA 5F5EA 4JLGA 1ML9A 3M58A 4RZ0A 3OXLA 4I51A 4O30A 2BQZA 3M53A 1PEGA 4YNPA 5F6KC 4AU7A 3VV0A 3OPEA 5F6LA 3MO2A 4LDGA 5F59A 3F9ZA 3CBPA 5JJ0A 5JHNA 3QWVA 4IJ8A 2G46A 4YPEA 2F69A 5EX3A 4JDSA 5EX0A 1O9SA 3RQ4A 5CCMA 4C1QA 3S7JA 4J83A 3PDNA 2W5YA 5CPRB 4YNMA 1MVXA 4YPUA 3DALA 1MUFA 3HNAA 3CBOA 5LSZA 4IJDA 4NJ5A 1ZKKA 4YNDA 3S8PA 4FMUA 4QEPA 3RIBA 3VUZA 3M56A 3OXFA 1MT6A 5EG2A 3KMTA 1H3IA 3MO5A 5KJLA 1N3JA 3N71A 1N6CA 1MVHA 3K5KA 4J8OA 3OS5A 2O8JA 3OOIA 3TG4A 5T0MA 5KJKA 5TH7A 1XQHA 4MI5A 3SW9A 4J7IA 3TG5A 3OXGA 3M57A 3M55A 3FPDA 4Z4PA 3F9WA 2W5ZA 5JINA 4BUPA
chains in the Genus database with same CATH topology
4J7FA 3M5AA 3EP0A 5HI7A 4O6FA 4E47A 3M59A 3CBMA 5ARFA 3RU0A 5AYFA 5ARGA 3S7DA 3BO5A 2QPWA 5CCLA 5JIYA 4WUYA 5KJMA 3MEKA 2JV0A 5LSXA 3M54A 2R3AA 3KMAA 4MI0A 3DB5A 3S7BA 3IHXA 5HQ8A 3S7FA 4YPAA 5T5GA 3QWPA 4QEOA 5T0KA 3F9XA 5TEGA 3MO0A 2IGQA 3RAYA 3QWWA 3SWCA 1N6AA 3KMJA 5TTFA 3RJWA 4H12A 5KJNA 2RFIA 4QENA 3F9YA 4NVQA 5F5EA 4JLGA 1ML9A 3M58A 4RZ0A 3OXLA 4I51A 4O30A 2BQZA 3M53A 1PEGA 4YNPA 5F6KC 4AU7A 3VV0A 3OPEA 5F6LA 3MO2A 4LDGA 5F59A 3F9ZA 3CBPA 5JJ0A 5JHNA 3QWVA 4IJ8A 2G46A 4YPEA 2F69A 5EX3A 4JDSA 5EX0A 1O9SA 3RQ4A 5CCMA 4C1QA 3S7JA 4J83A 3PDNA 2W5YA 5CPRB 4YNMA 1MVXA 4YPUA 3DALA 1MUFA 3HNAA 3CBOA 5LSZA 4IJDA 4NJ5A 1ZKKA 4YNDA 3S8PA 4FMUA 4QEPA 3RIBA 3VUZA 3M56A 3OXFA 1MT6A 5EG2A 3KMTA 1H3IA 3MO5A 5KJLA 1N3JA 3N71A 1N6CA 1MVHA 3K5KA 4J8OA 3OS5A 2O8JA 3OOIA 3TG4A 5T0MA 5KJKA 5TH7A 1XQHA 4MI5A 3SW9A 4J7IA 3TG5A 3OXGA 3M57A 3M55A 3FPDA 4Z4PA 3F9WA 2W5ZA 5JINA 4BUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7F A;  3M5A A;  3EP0 A;  5HI7 A;  4O6F A;  4E47 A;  3M59 A;  3CBM A;  5ARF A;  3RU0 A;  5AYF A;  5ARG A;  3S7D A;  3BO5 A;  2QPW A;  5CCL A;  5JIY A;  4WUY A;  5KJM A;  3MEK A;  2JV0 A;  5LSX A;  3M54 A;  2R3A A;  3KMA A;  4MI0 A;  3DB5 A;  3S7B A;  3IHX A;  5HQ8 A;  3S7F A;  4YPA A;  5T5G A;  3QWP A;  4QEO A;  5T0K A;  3F9X A;  5TEG A;  3MO0 A;  2IGQ A;  3RAY A;  3QWW A;  3SWC A;  1N6A A;  3KMJ A;  5TTF A;  3RJW A;  4H12 A;  5KJN A;  2RFI A;  4QEN A;  3F9Y A;  4NVQ A;  5F5E A;  4JLG A;  1ML9 A;  3M58 A;  4RZ0 A;  3OXL A;  4I51 A;  4O30 A;  2BQZ A;  3M53 A;  1PEG A;  4YNP A;  5F6K C;  4AU7 A;  3VV0 A;  3OPE A;  5F6L A;  3MO2 A;  4LDG A;  5F59 A;  3F9Z A;  3CBP A;  5JJ0 A;  5JHN A;  3QWV A;  4IJ8 A;  2G46 A;  4YPE A;  2F69 A;  5EX3 A;  4JDS A;  5EX0 A;  1O9S A;  3RQ4 A;  5CCM A;  4C1Q A;  3S7J A;  4J83 A;  3PDN A;  2W5Y A;  5CPR B;  4YNM A;  1MVX A;  4YPU A;  3DAL A;  1MUF A;  3HNA A;  3CBO A;  5LSZ A;  4IJD A;  4NJ5 A;  1ZKK A;  4YND A;  3S8P A;  4FMU A;  4QEP A;  3RIB A;  3VUZ A;  3M56 A;  3OXF A;  1MT6 A;  5EG2 A;  3KMT A;  1H3I A;  3MO5 A;  5KJL A;  1N3J A;  3N71 A;  1N6C A;  1MVH A;  3K5K A;  4J8O A;  3OS5 A;  2O8J A;  3OOI A;  3TG4 A;  5T0M A;  5KJK A;  5TH7 A;  1XQH A;  4MI5 A;  3SW9 A;  4J7I A;  3TG5 A;  3OXG A;  3M57 A;  3M55 A;  3FPD A;  4Z4P A;  3F9W A;  2W5Z A;  5JIN A;  4BUP A; 
#chains in the Genus database with same CATH topology
 4J7F A;  3M5A A;  3EP0 A;  5HI7 A;  4O6F A;  4E47 A;  3M59 A;  3CBM A;  5ARF A;  3RU0 A;  5AYF A;  5ARG A;  3S7D A;  3BO5 A;  2QPW A;  5CCL A;  5JIY A;  4WUY A;  5KJM A;  3MEK A;  2JV0 A;  5LSX A;  3M54 A;  2R3A A;  3KMA A;  4MI0 A;  3DB5 A;  3S7B A;  3IHX A;  5HQ8 A;  3S7F A;  4YPA A;  5T5G A;  3QWP A;  4QEO A;  5T0K A;  3F9X A;  5TEG A;  3MO0 A;  2IGQ A;  3RAY A;  3QWW A;  3SWC A;  1N6A A;  3KMJ A;  5TTF A;  3RJW A;  4H12 A;  5KJN A;  2RFI A;  4QEN A;  3F9Y A;  4NVQ A;  5F5E A;  4JLG A;  1ML9 A;  3M58 A;  4RZ0 A;  3OXL A;  4I51 A;  4O30 A;  2BQZ A;  3M53 A;  1PEG A;  4YNP A;  5F6K C;  4AU7 A;  3VV0 A;  3OPE A;  5F6L A;  3MO2 A;  4LDG A;  5F59 A;  3F9Z A;  3CBP A;  5JJ0 A;  5JHN A;  3QWV A;  4IJ8 A;  2G46 A;  4YPE A;  2F69 A;  5EX3 A;  4JDS A;  5EX0 A;  1O9S A;  3RQ4 A;  5CCM A;  4C1Q A;  3S7J A;  4J83 A;  3PDN A;  2W5Y A;  5CPR B;  4YNM A;  1MVX A;  4YPU A;  3DAL A;  1MUF A;  3HNA A;  3CBO A;  5LSZ A;  4IJD A;  4NJ5 A;  1ZKK A;  4YND A;  3S8P A;  4FMU A;  4QEP A;  3RIB A;  3VUZ A;  3M56 A;  3OXF A;  1MT6 A;  5EG2 A;  3KMT A;  1H3I A;  3MO5 A;  5KJL A;  1N3J A;  3N71 A;  1N6C A;  1MVH A;  3K5K A;  4J8O A;  3OS5 A;  2O8J A;  3OOI A;  3TG4 A;  5T0M A;  5KJK A;  5TH7 A;  1XQH A;  4MI5 A;  3SW9 A;  4J7I A;  3TG5 A;  3OXG A;  3M57 A;  3M55 A;  3FPD A;  4Z4P A;  3F9W A;  2W5Z A;  5JIN A;  4BUP A; 
#chains in the Genus database with same CATH homology
 4J7F A;  3M5A A;  3EP0 A;  5HI7 A;  4O6F A;  4E47 A;  3M59 A;  3CBM A;  5ARF A;  3RU0 A;  5AYF A;  5ARG A;  3S7D A;  3BO5 A;  2QPW A;  5CCL A;  5JIY A;  4WUY A;  5KJM A;  3MEK A;  2JV0 A;  5LSX A;  3M54 A;  2R3A A;  3KMA A;  4MI0 A;  3DB5 A;  3S7B A;  3IHX A;  5HQ8 A;  3S7F A;  4YPA A;  5T5G A;  3QWP A;  4QEO A;  5T0K A;  3F9X A;  5TEG A;  3MO0 A;  2IGQ A;  3RAY A;  3QWW A;  3SWC A;  1N6A A;  3KMJ A;  5TTF A;  3RJW A;  4H12 A;  5KJN A;  2RFI A;  4QEN A;  3F9Y A;  4NVQ A;  5F5E A;  4JLG A;  1ML9 A;  3M58 A;  4RZ0 A;  3OXL A;  4I51 A;  4O30 A;  2BQZ A;  3M53 A;  1PEG A;  4YNP A;  5F6K C;  4AU7 A;  3VV0 A;  3OPE A;  5F6L A;  3MO2 A;  4LDG A;  5F59 A;  3F9Z A;  3CBP A;  5JJ0 A;  5JHN A;  3QWV A;  4IJ8 A;  2G46 A;  4YPE A;  2F69 A;  5EX3 A;  4JDS A;  5EX0 A;  1O9S A;  3RQ4 A;  5CCM A;  4C1Q A;  3S7J A;  4J83 A;  3PDN A;  2W5Y A;  5CPR B;  4YNM A;  1MVX A;  4YPU A;  3DAL A;  1MUF A;  3HNA A;  3CBO A;  5LSZ A;  4IJD A;  4NJ5 A;  1ZKK A;  4YND A;  3S8P A;  4FMU A;  4QEP A;  3RIB A;  3VUZ A;  3M56 A;  3OXF A;  1MT6 A;  5EG2 A;  3KMT A;  1H3I A;  3MO5 A;  5KJL A;  1N3J A;  3N71 A;  1N6C A;  1MVH A;  3K5K A;  4J8O A;  3OS5 A;  2O8J A;  3OOI A;  3TG4 A;  5T0M A;  5KJK A;  5TH7 A;  1XQH A;  4MI5 A;  3SW9 A;  4J7I A;  3TG5 A;  3OXG A;  3M57 A;  3M55 A;  3FPD A;  4Z4P A;  3F9W A;  2W5Z A;  5JIN A;  4BUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...