5KJNA

Smyd2 in complex with az506
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
total genus 147
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjnA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjnA01
4YNMA 5F6KC 4I2WA 5G05J 3Q4AB 1OUVA 3IEGA 4CGVA 4NRHB 5TH7A 5TEGA 4Z4PA 4H12A 2IF4A 3MEKA 3SWCA 1ELRA 4N3AA 4GZ5A 4GYWA 2XGSA 4U0ZA 1WAO1 3PE3A 3N71A 3MKRA 3FP3A 2KCVA 3KAEA 3DB5A 4J83A 3WXXA 5JHNA 2YQ8A 3DALA 5T0MA 2OOEA 4NJ5A 4J0UA 4YVOA 4JA9A 2E2EA 2DBAA 3RJWA 3VV0A 3MV2B 3CVQA 1WM5A 5BW8C 4JA7A 5FZSA 4JHRA 4FMUA 4HOUA 3ASFA 3BO5A 3TG4A 5F6LA 3RJVA 3ASDA 3M59A 5JJ6A 2JV0A 2I6HA 2VQ2A 2KCLA 4ABNA 2XGMA 2IFUA 2HO1A 1KT1A 2C0LA 3M55A 4B94A 5HI7A 2UY1A 3LYAA 1HZ4A 2VYIA 2FO7A 4XIFA 2XPIA 2AVPA 3CKCA 2PZIA 4UQZA 5BT1A 4UI9C 5JJ7A 4EQFA 4UI9K 4U07A 2R3AA 3R9AB 4N2SA 2FBNA 5G04C 3LY9A 4J8FA 3SZ7A 3M54A 2G46A 2LNIA 4I9EA 4N5CA 5EX3A 4GA1A 3SW9A 1ZBPA 1ZU2A 4F3VA 5C1DA 4GCNA 1ELWA 2KATA 4GA0A 3ASHA 3OXFA 4LDGA 3OXLA 4G2VA 5FZRA 4BUPA 4APOA 2R5SA 3VUZA 2QFCA 3AS4A 4HOQA 4KBQA 3QWVA 3CK8A 2XEVA 5T0KA 2VGXB 3UUXA 2XCCA 5D0QD 2FEZA 3Q15A 4G26A 4HOTA 1MUFA 3Q49B 3CVLA 3CBOA 3CBPA 4YPUA 2Q7FA 5CHEE 4JLGA 1FCHA 4GZ3A 4UQXA 5F5EA 3CKBA 5LCWJ 3K5KA 5ARGA 4IJDA 2KC7A 2HR2A 2W5ZA 1IYGA 3E4BA 1QZ2A 2VSNA 2LSUA 1NZNA 3CK9A 4N39A 2O8JA 1YA0A 4G25A 3CBMA 3K9IA 5JJ0A 4RZ0A 4I2ZA 3KS2A 4BTBA 1N6CA 4RG9A 3GZ2A 1KLXA 5CCLA 2QPWA 3ZGQA 3MO2A 1PEGA 3URZA 4N3BA 4YPAA 3LY7A 4QENA 1HXIA 3QWPA 4J8DA 3S8PA 3M5AA 5LSZA 3OPEA 3AS5A 2XGOA 1W3BA 1XQHA 4BT8A 2IGQA 5JJTA 5AYWD 2UY1B 3HYMB 2Y4TA 1H3IA 3JYSA 3LPZA 5LSXA 2C0MA 3MA5A 4UQYA 3RU0A 3RO2A 3S7JA 3TAXA 5F59A 4NQ0A 4Y6WA 3ASGA 2MHKA 3EP0A 5M72A 2HYZA 4I9CA 5G05C 4W9RA 5CCMA 1HH8A 3VTXA 1Y8MA 4QEOA 4C1QA 4UI9J 2BUGA 4O6FA 5D0OD 2PL2A 3EDTB 3F9WA 5EX0A 3FFLA 1B89A 4AU7A 4N2QA 2W5YA 4HORA 3GW4A 4U0UA 3ZHEB 1P5QA 4XI0A 3ZFWA 4G1TA 2KCKA 3OOIA 4MI0A 1E96B 4JL0A 1MT6A 1A17A 2VGYA 3M56A 5HQ8A 2J9QA 3CVPA 4WNDA 4AIFA 4GYOA 3S7BA 3LKUA 5EKQD 2P58C 3M53A 2PQNA 4N3CA 3ULQA 1IHGA 2RFIA 2V5FA 3SF4A 1PC2A 2YHCA 3AS8A 2NC9A 4LEUA 3ZHEA 4G23A 2PQRA 3BEEA 4J7IA 3LY8A 5DBKA 3OXGA 3QDNA 4GA2A 3U4TA 3F9ZA 4H7YA 1MVXA 3M57A 3FWVA 4H7XA 1N3JA 1QQEA 5KJLA 3KMTA 5JIYA 2ONDA 4BTAA 5FT9A 5G04J 1O9SA 4I17A 3VTYA 4J7FA 3QWWA 3ZPJA 3IHXA 5EG2A 4AY6A 3FPDA 2C2LA 4XI9A 4AM9A 2UWJG 2BQZA 5KJKA 3Q5MA 3QKYA 3UPVA 2LSVA 4YVQC 5AYFA 3S7FA 4YPEA 3RQ4A 1N6AA 1ML9A 4I1AA 3GZ1A 3PE4A 3M58A 4KXKB 2GW1A 3KD7A 3ESKA 3O48A 3Q47B 3CK7A 4O30A 5FTPA 3QOUA 5KJMA 4J8OA 4GZ6A 1NA0A 3LCAA 4Y6CA 4AY5A 3MO0A 4GCOA 3S7DA 4QEPA 3RAYA 3CV0A 4YNPA 5DIZA 5KJNA 2WPVA 5T5GA 3KMAA 4HOSA 2VSYA 2FI7A 3CVNA 2FF4A 3TGOA 3F9XA 3MV3B 3NF1A 4BT9A 2WQHA 4G24A 5CPRB 1KT0A 4BWRA 5A7DB 4E47A 3OS5A 2Y4UA 4MI5A 3UQ3A 4WNFA 4U04A 4WUYA 2L6JA 4A1SA 3F9YA 5ARFA 4IJ8A 5LCWC 4J8EA 2F69A 5A6CA 5FZQA 4IN3B 2XCBA 3HNAA 4CGWA 4WNEA 4KYOB 1TJCA 4JDSA 5FJYA 5BNWA 5TTFA 3KMJA 3RKVA 3GYZA 4U0SA 3RO3A 1XNFA 4CDRA 4YNDA 1NA3A 2JLBA 2VGXA 4GPKA 5JINA 4I51A 4WNGA 1ZKKA 1MVHA 3ZN3A 4ME2A 3TG5A 4NVQA 3MO5A 4RG6A 3RIBA 3U3WA 3CEQA 3PDNA 4GYYA
chains in the Genus database with same CATH superfamily
2VGEA 4HRMB 4YNMA 1E8WA 4RQIA 1E90A 4A1GA 3G2WA 3MX3A 4Z4PA 3BG1B 1NI1A 2RKKA 3PS6A 4DRXE 4HB5A 4N3AA 4PS7A 3ONLA 4GYWA 4EBAG 1FVFA 3PE3A 1U3CA 1ZB1A 5A23A 1OWPA 4TUMA 2KCVA 3TWRA 2YQ8A 4MKTA 1A5EA 3UM1A 4YVOA 4JA9A 4FHKA 4M7CA 4PDXA 3RJWA 2F37A 3CVQA 4AJWA 3DSTA 1SZ9A 3SGHA 5FZSA 1N9AA 4U7EB 4HOUA 2XZTG 3CVYA 1TNYA 5JJ6A 2I6HA 4OYSA 4ABNA 4B93B 1Y6IA 1NFIE 2DVWA 1KT1A 2J08A 3IBEA 2EIJE 1HZ4A 2VYIA 3AG2E 3UINC 1O1RA 4XIFA 1Z3XA 3JUEA 2AVPA 4J6IA 1TN6A 2A5EA 4UQZA 3R9AB 1H6PA 1EYHA 2XHEA 4DX7D 3DBSA 4YDYA 2XRYA 2G46A 3Q9UC 4I9EA 4N5CA 5EX3A 2R02A 3SW9A 3ABME 2ETBA 2OCCE 3QNKA 4LDGA 1DCQA 2VJ8A 3HXCA 3OXLA 4BERA 3ASOE 4JHJA 3FH8A 2R5SA 3DSUA 2QFCA 3OAWA 4KBQA 1TN7A 3QWVA 5CMWA 4E6HA 5T0KA 5D0QD 2L0TB 3CVLA 4IYPA 3CBOA 1KPSB 2Q7FA 5CHEE 4GZ3A 2IJGX 4TUUA 1OT8A 3SBTB 5F5EA 2XPZA 3K5KA 2HR2A 2W5ZA 3QARA 3F6QA 2VSNA 1N4QA 3ZKJA 2LSUA 4A3VA 5E76A 2GRRB 3L54A 2MYOA 2A4ZA 3DSVA 3HXEA 3K9IA 5JJ0A 2EIKE 2X6FA 3KS2A 4DX6D 4BTBA 3ABKE 3G2UA 3SO8A 1N6CA 2CHWA 2GRPB 2QPWA 3ZGQA 1OY3D 2F8XK 3LY7A 2XS8A 1XGWA 3Q9NC 3SY2A 3QWPA 3DWLG 4J8DA 4TXPA 2CG3A 4HXIA 2EIME 5ENSD 2WMNA 3D9IA 2IGQA 2ETCA 2P9IG 4YDEA 2X6KA 3LPZA 1H3IA 5FWQA 3MA5A 1NL4A 4LG6A 3HHMA 3FUKA 1DNPA 5D66A 5KNHD 4XE0A 4BFRA 5CBOA 1UN9A 1HH8A 4QEOA 3Q79A 2IOSA 3PEVB 1E8ZA 5AENA 4C1QA 4AVXA 3EUVA 3HRAA 3EDTB 3D3MA 3UT8A 5EX0A 5ENPD 2ETAA 1TN8A 3LVQE 4EECA 3PNLB 3FU5A 4G1TA 4MLPA 2OVBA 1E96B 4JL0A 1A17A 2FO1E 4WNDA 5EYLA 4AIFA 3DPDA 4GYOA 3S7BA 1O1TA 3PUJA 5ENRD 4N3CA 2CHXA 5CMYA 3QAQA 3SF4A 1BI8B 5ANLA 1FVHA 3ISMC 3ZHEA 4G23A 4BY6A 5DBKA 3UMVA 3FULA 4N5QA 2V8SE 3FWVA 1HF8A 3TWTA 1N3JA 1QQEA 1BLXB 1H0AA 2R59A 5JIYA 3FTWA 4IRUA 1N95A 4FP7A 5AAOA 1H2VC 3VTYA 4GZCA 4J7FA 3CIAA 4Q96A 4L9PA 3FPDA 5AIJA 4J7WA 4XI9A 2UWJG 1LD7A 4FULA 1L5JA 3QKYA 1O1SA 3UPVA 4YVQC 3FTUA 2CG2A 4AOFA 4ANXA 4FC8A 4I1AA 3UIOC 2E0IA 4KXKB 3ZYKA 2WXGA 2Y3AA 4DUIA 4O30A 3CK7A 4LNBA 2GROB 2WXRA 4XZ4A 1VDYA 4HLLA 3AJIA 3L13A 4KVOA 2Y1LE 1DCEA 2HM8A 4JW1A 5FTPA 5KJMA 1NA0A 4Y6CA 4AY5A 2A5UA 3MO0A 4GCOA 4QEPA 3CHPA 3JQ1A 5KJNA 4HOSA 1E7VA 2FI7A 3HG0D 4BSXA 2WXLA 3MZLB 3APFA 2HE0A 3NF1A 2WQHA 1Q2ZA 3IHVA 4BWRA 2WXFA 3IHYA 3UQ3A 2WXJA 3ZEFA 4JZYA 3SQVA 3Q78A 2EQXA 2R2LA 5LCWC 4XKBA 3L22A 2J09A 4JXTA 5BPPA 3IXEA 3ZU7B 3FUDA 4D10C 2IU1A 4K0RA 2AXVA 5AARA 1Z3YA 5BNWA 3RRUA 2X6IA 3FUFA 4K5AB 2AWIA 3RKVA 1MX2A 1XNFA 4JHKA 1PAQA 1BU9A 4CDRA 1FT2A 3AU4A 1DC2A 2VSXE 5JINA 3ESLA 1K1BA 1SQMA 4Q69A 4NVQA 2R03A 2PQRA 4L2YA 5AQ9A 3C72A 5G05J 5ENQD 4NRHB 4GTVA 3W9GA 1JWGA 5TEGA 5BV0A 1N54A 1OCCE 1S64A 2IO3C 1TEZA 3X2QE 5AJLA 5G2NA 4CDMA 4GZ5A 3RSEG 2XGSA 3V31A 1H2UA 3MKQA 3FP3A 3MCXA 3ZXSA 4J83A 4IULA 4UWKA 1N4SA 1OWOA 3PNTB 3W9FA 4J0UA 3D9JA 1HE8A 3VV0A 3QK0A 3DSXA 3CHSA 3ML8A 4JHRA 4FMUA 3L9TA 4YDWA 4DI3A 3LVRE 1D8DA 1OWNA 3ASDA 2XGMA 1E7UA 4EZKA 2DYRE 2IFUA 3R7QA 1N0RA 2C0LA 4B94A 5HI7A 3LYAA 3APDA 2XZDG 4NIKA 2H6GA 2Y69E 1H6OA 4CT4A 4OAVB 2PZIA 4A63B 4U8HA 4UI9C 1OWMA 1EF1C 2LXMA 3SZ7A 3M54A 2LNIA 2ZU6B 3UI2A 4F3VA 3HVEA 3UM2A 3UX4A 3E30A 1ELWA 2KATA 3ASHA 4KT6B 4HLEA 5FZRA 4BUPA 4DX5D 3PZ3A 3TWUA 4APOA 1IXVA 2R17C 2DIWA 4G8KA 2OEVA 2I9CA 4F1SA 3QC1A 1UJJA 4I6JA 2XRZA 2WXPA 3CK8A 4RSYA 3Q15A 4G26A 3SFXA 4HRNA 2DYSE 4EBAA 4JLGA 4I6GA 3FTYA 2F0YA 1RW2A 2VSOE 4U95D 3FU6A 4UWLA 4FJYA 3ZXPA 1FPPA 4N39A 4NACA 1YA0A 2DCPA 4G25A 5B3SE 3CBMA 1JUQA 3EJNA 4MRUA 4RZ0A 2RD0A 2JEKA 4GMRA 3UM0A 3PRZA 3G2TA 3AG1E 3U9WA 1IHBA 3JXIA 3BQOA 1HU3A 3I3NA 4N3BA 4QENA 5HRYA 3BU8A 3ULYA 5ENNA 1WY6A 1H19A 3T9KA 3AS5A 4F7AA 4MBGA 2YHEA 5AYWD 4HBDA 2FULA 3RO2A 3EHMA 4C0MA 2WM9A 2X3MA 1MQSA 3NBNB 3NOCD 4JVSA 3ENEA 4JEUA 1N11A 2MHKA 3TXMA 3CR3A 5CCMA 2PM7A 3DSWA 1Y8MA 2V4HC 4UI9J 3SFYA 3E37A 4RLYA 4O6FA 5D0OD 5B1BE 1KZPA 3E33A 1QYMA 2PL2A 3F9WA 2WXNA 2V0PA 3C5RA 4N2QA 2WQ6A 2X6HA 1IQRA 1P5QA 3ZW3A 1JCSA 1JCQA 4XI0A 2KCKA 2L0IA 3UKRG 4JD2G 1LF8A 3M56A 2NSZA 2ZGGA 2J9QA 5CERB 3ABLE 5ITZF 2P58C 3Q75A 1H6KA 5IY5E 3ULQA 2RFIA 1PC2A 2KZTA 2NC9A 5FQ7A 4B8AA 1MJ0A 3UT4A 2ZISA 3LJNA 4H7YA 4H7XA 3FEYA 3DPYA 3Q73A 4YDOA 3PZ4A 3Q7FA 2P9LG 3B95A 2ONDA 4BTAA 2H6HA 1TNUA 2J07A 4I17A 3FDHA 3QWWA 3KEAA 2C2LA 5H7PA 3FTXA 4BX8A 4P29A 4GZDA 3T8MA 1QNFA 2LAIA 2BQZA 5AYFA 4PS8A 3S7FA 1N6AA 4HI8A 2GW1A 3KD7A 3Q47B 1FT1A 3CQGB 2NXPA 3NZSA 3O4ZA 4OVUA 4J8OA 3I5PA 3RAYA 4YNPA 2BKKB 5DIZA 2WPVA 4F53A 3CVNA 3TGOA 3F9XA 1AP7A 5LFAA 4BT9A 3FTZA 5A7DB 2J49A 1HFAA 2ZIRA 4K03A 3UM3A 3D9NA 3TWQA 4EZJA 2IONA 3AU5A 3D9LA 1RZ4A 3SD5A 1HS6A 4JEHA 2L6JA 4A1SA 4PH4B 3TWWA 2KXPC 2QY7A 4ANWA 5FZQA 3SNXA 4CGWA 1UOHA 4JDSA 5FJYA 2LUHA 3NQPA 4ILIA 3JUIA 4U0SA 3RO3A 4CYMD 2I2OA 1HX8A 4CT0A 1SW6A 3V30A 2JLBA 3TJPA 4HFGA 4EHMA 3QB2A 3NZUA 4WNGA 1ZKKA 4APFA 2XEHA 4ANVA 5AN8A 2OV8A 3RIBA 3FH7A 3L6AA 5AQ7A 5F6KC 4I2WA 3Q4AB 1OUVA 3ZIMA 2GRNB 3MJWA 3APCA 5KBAA 5BXOA 2IF4A 3MEKA 2PM6A 2WXQA 3J5PA 5FINA 4HS2A 4A3TA 3SHFA 1ELRA 4GPMA 4U63A 4U0ZA 1WAO1 5LOZA 3MKRA 3V79K 4U96D 5LX8A 3WXXA 5JHNA 3DALA 4C0EA 3ZVVA 4DI4A 4XX5A 4NJ5A 3CSFA 3MV2B 4JC8A 3MYVA 2BKGA 2WXHA 3JCKC 4JA7A 3ONKA 2V4LA 2L6BA 3ASFA 3C3RA 3TG4A 4FA6A 3BO5A 3M59A 4GTOA 2JV0A 2VQ2A 4WAFA 2KCLA 4QQIA 4HI9A 4NURA 1MX4A 4UWGA 3C98A 4UWFA 1BD8A 5KCMA 2X6JA 1KZOA 2FO7A 3B7BA 1EPUA 3CKCA 3EHRA 3FH5A 5BT1A 4HQDA 3ZRHA 4EQFA 2KM4A 1Z6TA 2R3AA 2M63A 4N2SA 4FU3A 3B7UX 4ANUA 2LAHA 2FBNA 3R7RA 5BXUA 3LY9A 3ZYLA 4J8FA 3VLFA 2XQ0A 4J8SA 4GA1A 1ZU2A 4WWOA 3B7RL 2AW6A 2GRLA 4GA0A 1D9SA 3B13A 2B6CA 1LTXA 3PZDA 3AS4A 5AJDA 4ACKA 2Y0BG 5CRVA 2IY0C 1H2TC 1SA4A 4L2LA 2VGXB 3UUXA 2XCCA 3UTMA 2FEZA 1MUFA 4YPUA 1S0PA 1FCHA 5EYPF 1TR4A 5LCWJ 4IJDA 2KC7A 4O1PA 1IYGA 3E4BA 1K3ZD 5JMND 2WQ7A 3PEUB 4DLOA 5JHAA 1OCOE 3ULEG 3S2AA 3CK9A 2O8JA 3CHOA 1SA5A 5T3RA 1N4PA 2P9UG 4KZ0A 3DEOA 3J5QB 4I2ZA 4XEIG 4CDNA 5FQ4A 2WXOA 2P9SG 3PH0C 3GZ2A 5CCLA 4AEZC 5ENTD 4C9BB 1TNOA 1PEGA 2RFAA 5C2YA 3URZA 4DX1A 3U64A 1WG0A 3M5AA 2L9BA 1UJKA 1UN8A 3OPEA 1ELKA 2DWZA 1XQHA 4BT8A 1INZA 3MGBA 3AG3E 3HXBA 2UY1B 3P1UA 2Y4TA 4ATZD 5LSXA 3D9OA 2C0MA 4FLBA 3HXFA 4UQYA 3S7JA 3TAXA 5F59A 3CVVA 1DVPA 3GZSA 4KZCA 4I43A 4HVBA 4Y6WA 4GTTA 5E75A 3EP0A 2HYZA 4W9RA 4ZHBA 5EIDA 4AP2A 5BV1A 3DSSA 4OVVA 4L1BA 3SBSA 5HS0A 4CEMA 3FFLA 2J4BA 4HORA 3T8KA 2R05A 4U0UA 1QBQA 3ZFWA 3FUIA 3OOIA 4UUCA 2YINA 3CVPA 1N94A 2F8YA 1JWFA 4B8CB 2PQNA 4B0ZA 2VTBB 1IHGA 4KVMA 4Z68A 2V5FA 2YHCA 4BESA 4G8LA 4J7IA 4WWPA 4FADA 3M57A 3NOGD 1S70B 4ILGA 1NP7A 3FUNA 2I1KA 2XPYA 4L7TA 3U66A 4GMJA 5FT9A 1O9SA 1AWCB 3FUHA 4KMOA 2KZTB 2AJAA 3IKOB 3ZPJA 3B7SA 2BTDA 2P9NG 4AM9A 5KJKA 2LSVA 5HKPA 4O1OA 4U8VD 3RQ4A 3FEXA 3NAWA 1O5MA 4C48B 3M58A 5B1AE 3O48A 1V55E 4HRLA 3TXNA 1IKND 4CZ2D 3R9MA 3LDZA 3QOUA 3LCAA 3C3OA 1JCRA 1K8KG 3S7DA 4CCAA 1D8EA 4JPSA 1EDUA 5T5GA 2VSYA 1TJFA 2FF4A 3FTVA 3MV3B 4WWNA 3EU5A 3TWVA 5CPRB 3OTNA 3ZYMA 3ZYQA 3D9MA 3KSQA 3PZ1A 3ASNE 4MI5A 2GGFA 5T4YA 4WNFA 5CBNA 1V54E 4GMLA 2QYUA 2OEWA 3ZNGA 2JABA 3F9YA 4DK5A 4A55A 4IJ8A 3L17A 5FQ6A 5EN5D 4J8EA 3CVXA 1N52A 3HVEB 2XCBA 3DEPA 4WNEA 1TJCA 2LXLA 5TTFA 3KMJA 4CRWA 4GTSA 4QFVA 4L23A 1UW4B 1JPLA 5BUZA 4GB9A 2XS1A 3KEZA 4GPKA 5KNGA 3V2XA 4ACLA 2CFUA 1MVHA 4I51A 3ZN3A 3U3WA 3TG5A 2P9PG 4RG6A 3ZUVB 3CEQA 1MT6A 3PDNA 4UWHA 3JQ0A 3IEGA 4CGVA 5TH7A 4H12A 3SWCA 2WXIA 2WB2A 2CFZA 4R7LA 2IO2C 1N0QA 2J8SD 3LXUX 3N71A 3VLDA 3EIQC 1OXJA 3EIJA 3KAEA 3DB5A 2ZXWE 4DLQA 1TYQG 2IQCA 5T0MA 3CGHA 2OOEA 3FU3A 4HNAD 4M3OA 3NB2A 4B89A 3CVWA 2E2EA 2DBAA 2PNNA 1WM5A 5BW8C 3BG0B 5F6LA 3RJVA 3TL5A 2B0OE 4X8QA 5FIOA 2ILRA 3UT7A 2HO1A 1SVXA 4F1PA 3M55A 3LEWA 2UY1A 4LSZE 4U8YD 3CHRA 2XPIA 5EDSA 3UXGA 5JJ7A 3FY4A 4FHJA 4UI9K 4U07A 5AQBA 4LERA 5G04C 3LJ3A 3DXMG 3FUMA 3UIPC 3AG4E 2EINE 1ZBPA 4ATGA 1OWLA 5C1DA 4GCNA 3OXFA 2IEJA 1YMPA 5CEDB 3VUZA 2DZNA 4TXRA 4HOQA 2WMOA 3E32A 1S63A 2OVFA 4I6EA 2XEVA 3D9KA 1UG3A 3QJZA 2H6IA 4FJZA 1MX6A 1BPOA 4HOTA 3Q49B 3CBPA 3Q7AA 2WVIA 4UQXA 1E8XA 3CKBA 5ARGA 3HXDA 1QZ2A 4I1OB 4BSZB 5EIBE 1NZNA 2BEDA 3HIZA 4Q94A 3I4GA 3CHQA 3WG7E 2V5QC 3CVUA 4E85A 2MRIA 1HG5A 4K5CA 4XKCA 4RG9A 1KLXA 2P9KG 1HO8A 3P2BA 3RK6A 3MO2A 2GRMA 4GU5A 4YPAA 2WXKA 3BUAA 1HXIA 3RAUA 4JB8P 3S8PA 4LNUD 5LSZA 3RRMB 3CSTA 1SZAA 4BETA 4G11A 1YYHA 4OAUC 2XGOA 1W3BA 4J8YA 4K5BA 5JJTA 3E34A 4DJAA 3HYMB 2XENA 3JYSA 1BI7B 3I4RB 1MHQA 3RU0A 2NYJA 5JA4D 4NQ0A 3ASGA 4FLHA 5M72A 4I9CA 4PS3A 5G05C 1N4RA 3DRAA 3VTXA 4TRQA 4LUNU 4RVBA 4DX2A 3PUKA 1U2VG 2BUGA 2MOWA 5JHBA 2WXMA 2QYJA 5J90A 4GAAA 2I1JA 3EU9A 1TNZA 3C3QA 3HDXA 1B89A 4AU7A 2EILE 2W5YA 3EHQA 3GW4A 4GTPA 3TWXA 3ZHEB 4LRZA 1K1AA 4MI0A 4URKA 2VGYA 4V3IA 5KWDA 2AXUA 5HQ8A 5EILA 3FTSA 4MS6A 3L16A 3AAAC 3JXJA 3PVLA 5ANRA 3D9HA 3LKUA 5EKQD 3M53A 3FUJA 3G2SA 2P2CP 1TNBA 5LP0A 1MYOA 3L08A 3CQCB 3AS8A 4GTMA 5AQAA 3EHNA 4LEUA 2CHZA 3TWSA 3BEEA 3LY8A 3OXGA 3QDNA 4GA2A 3U4TA 4DPRA 2AXZA 4I1MA 1MVXA 3F9ZA 4O60A 5CRUA 2QC9A 3B7TA 5KJLA 3KMTA 4LCTA 2VTBA 5G04J 1OCZE 2XEEA 3LS8A 5CEAA 3DXKG 1PY1A 3IHXA 5EG2A 4AY6A 1Z5SC 2YNQA 2H6FA 5D2MC 4BX9A 1X5BA 3Q5MA 5ENOD 3VLEA 3SFZA 4YPEA 1IQUA 1U3DA 1X81A 1ML9A 2KBXA 3KSLA 2J4DA 3L82A 3GZ1A 3PE4A 3ESKA 2RG8A 5CECB 1MZCA 3PREA 4GZ6A 4GTQA 4TXQA 2LO6A 2GRQB 3CV0A 3FU0A 5J08A 3KMAA 3IV0A 3ML9A 4G24A 2X38A 1YCSB 3PZ2A 1KT0A 4E47A 2DZOA 4ZFHA 3OS5A 2Y4UA 4LNGA 4U04A 3SI5A 1HG2A 4WUYA 2BF0X 1WDYA 4GTRA 5FQ8A 5ARFA 4EPZA 2IOLA 4F6RD 2ZGDA 2F69A 1OCRE 5G55A 5A6CA 1E8YA 4IN3B 3HNAA 4AXHA 4KYOB 4ILHB 1GW6A 5T8IA 2RFMA 3D9PA 2QZAA 1G3NB 3GYZA 3RRNB 4BEPA 1LD8A 4PUCA 4YNDA 3CLJA 1NA3A 3CHMA 2VGXA 3T5VA 3T5XA 3FUEA 4ME2A 3UKUG 3FHEA 3G2VA 4TV3A 3V2OA 3MKQB 4EZLA 3MO5A 4G2VA 4AV7A 4GYYA
chains in the Genus database with same CATH topology
4L2YA 4UWHA 3JQ0A 4YNMA 4I2WA 5G05J 3Q4AB 5F6KC 1E8WA 1OUVA 3IEGA 4CGVA 4NRHB 1E90A 4A1GA 3ZIMA 3G2WA 3MX3A 3MJWA 1JWGA 3APCA 5TEGA 5TH7A 4Z4PA 4H12A 3BG1B 2IF4A 3MEKA 2PM6A 3PS6A 2WXQA 5BV0A 1N54A 3SWCA 4HS2A 4A3TA 2WXIA 1TEZA 5AJLA 3SHFA 1ELRA 2WB2A 4N3AA 2CFZA 4R7LA 5G2NA 4CDMA 4GZ5A 4PS7A 3ONLA 4GYWA 4U63A 2XGSA 4EBAG 4U0ZA 1H2UA 1FVFA 1WAO1 3PE3A 1U3CA 5LOZA 5A23A 3LXUX 3N71A 3VLDA 1OWPA 3EIQC 3MKRA 3EIJA 3MKQA 3FP3A 3MCXA 2KCVA 3ZXSA 3KAEA 5LX8A 3DB5A 4J83A 3WXXA 4IULA 2YQ8A 4DLQA 2IQCA 4UWKA 3DALA 5JHNA 1OWOA 3PNTB 4C0EA 5T0MA 3CGHA 3ZVVA 2OOEA 3FU3A 4M3OA 4MKTA 4J0UA 4XX5A 4YVOA 4JA9A 3D9JA 4DI4A 4NJ5A 3CSFA 4B89A 4FHKA 3CVWA 1HE8A 2DBAA 2E2EA 4PDXA 3RJWA 3VV0A 3MV2B 3CVQA 3MYVA 4JC8A 1WM5A 3QK0A 5BW8C 2WXHA 3JCKC 4AJWA 1SZ9A 4JA7A 3CHSA 3ML8A 5FZSA 3ONKA 3SGHA 4JHRA 4FMUA 3BG0B 2V4LA 4HOUA 3ASFA 3BO5A 3TG4A 4DI3A 4FA6A 5F6LA 3RJVA 3LVRE 3CVYA 3TL5A 1OWNA 3ASDA 5JJ6A 2JV0A 2I6HA 2VQ2A 3M59A 4WAFA 2ILRA 2KCLA 4OYSA 4ABNA 2XGMA 1E7UA 4EZKA 4NURA 2IFUA 1Y6IA 4UWGA 3UT7A 2HO1A 3C98A 4UWFA 1KT1A 3R7QA 2J08A 2C0LA 3IBEA 3M55A 4B94A 3LEWA 5KCMA 2X6JA 5HI7A 2UY1A 3LYAA 1HZ4A 2VYIA 2FO7A 3APDA 4XIFA 1Z3XA 3CHRA 2XPIA 1EPUA 2AVPA 4J6IA 5EDSA 3CKCA 4CT4A 2PZIA 4UQZA 3FH5A 4U8HA 5BT1A 4UI9C 5JJ7A 3FY4A 4FHJA 3ZRHA 4EQFA 2KM4A 4UI9K 1Z6TA 4U07A 2R3AA 1OWMA 2M63A 3R9AB 4N2SA 4FU3A 3B7UX 1EYHA 4LERA 2XHEA 4ANUA 2LAHA 2FBNA 5G04C 3R7RA 1EF1C 3LY9A 3LJ3A 3ZYLA 4J8FA 3DBSA 3FUMA 2XRYA 3SZ7A 1ZKKA 3VLFA 2G46A 2XQ0A 3M54A 2LNIA 4I9EA 4J8SA 4N5CA 2ZU6B 5EX3A 4GA1A 3SW9A 1ZBPA 1ZU2A 4F3VA 3HVEA 3B7RL 4WWOA 4ATGA 1OWLA 3QNKA 3UX4A 4GCNA 5C1DA 2AW6A 2GRLA 1ELWA 2KATA 4GA0A 3ASHA 3OXFA 4LDGA 4KT6B 2VJ8A 3OXLA 4HLEA 4I51A 3B13A 5FZRA 4BUPA 4JHJA 4APOA 3FH8A 2R5SA 3PZDA 3VUZA 2QFCA 3AS4A 2R17C 5AJDA 2DIWA 3OAWA 4ACKA 4HOQA 2WMOA 4KBQA 3QWVA 2I9CA 4F1SA 5CMWA 3QC1A 1UJJA 4I6JA 2XRZA 2OVFA 2WXPA 4I6EA 1H2TC 3CK8A 2XEVA 3D9KA 4L2LA 4E6HA 1UG3A 2VGXB 3QJZA 2XCCA 3UUXA 4FJZA 5T0KA 5D0QD 2FEZA 4RSYA 1BPOA 3Q15A 4G26A 4HOTA 2L0TB 1MUFA 3Q49B 3CVLA 4IYPA 3CBOA 3CBPA 4YPUA 4EBAA 2Q7FA 1S0PA 2WVIA 5CHEE 4JLGA 1FCHA 4GZ3A 2IJGX 4I6GA 4TUUA 3FTYA 4UQXA 3SBTB 5F5EA 2XPZA 1E8XA 3CKBA 5LCWJ 3K5KA 5ARGA 4IJDA 2KC7A 2HR2A 2W5ZA 3QARA 1IYGA 2VSOE 1QZ2A 3E4BA 2VSNA 3FU6A 4I1OB 2WQ7A 4UWLA 3PEUB 4DLOA 4FJYA 5JHAA 2LSUA 4A3VA 3S2AA 1NZNA 3CK9A 4N39A 2O8JA 3CHOA 3HIZA 5E76A 4Q94A 3L54A 3I4GA 4NACA 1YA0A 2DCPA 2A4ZA 4G25A 5T3RA 3CHQA 3CBMA 1JUQA 3K9IA 4KZ0A 3EJNA 4MRUA 4AV7A 3CVUA 5JJ0A 4RZ0A 2RD0A 2X6FA 2JEKA 4I2ZA 4E85A 4CDNA 3PRZA 3G2TA 2MRIA 5FQ4A 2WXOA 3KS2A 4BTBA 1HG5A 3U9WA 3PH0C 3G2UA 4XKCA 1N6CA 2CHWA 4RG9A 3GZ2A 1KLXA 5CCLA 4AEZC 3ZGQA 1HO8A 2QPWA 3P2BA 4C9BB 3RK6A 3MO2A 3I3NA 1HU3A 2GRMA 1PEGA 4GU5A 5C2YA 3URZA 4N3BA 4YPAA 3LY7A 2WXKA 3U64A 1XGWA 4QENA 1HXIA 3QWPA 4J8DA 3S8PA 3M5AA 5LSZA 2CG3A 2L9BA 5ENNA 1WY6A 3RRMB 1UJKA 1H19A 1UN8A 3OPEA 3CSTA 1SZAA 3AS5A 1ELKA 4G11A 4F7AA 4HXIA 2XGOA 1W3BA 1XQHA 2WMNA 3D9IA 4BT8A 3MGBA 2YHEA 1INZA 5JJTA 5AYWD 3P1UA 2UY1B 2IGQA 4DJAA 2FULA 3HYMB 2Y4TA 2X6KA 3JYSA 3D9OA 3LPZA 1H3IA 2C0MA 4FLBA 5FWQA 5LSXA 3MA5A 4UQYA 3I4RB 1MHQA 3RU0A 3RO2A 3S7JA 3TAXA 5F59A 3CVVA 3EHMA 4C0MA 2WM9A 1DVPA 3GZSA 4KZCA 2X3MA 1MQSA 4I43A 3HHMA 4HVBA 3FUKA 3RAYA 4NQ0A 4JVSA 3ENEA 4JEUA 4Y6WA 3ASGA 1DNPA 5E75A 2MHKA 3TXMA 3EP0A 4XE0A 4FLHA 5M72A 2HYZA 3CR3A 4I9CA 4PS3A 4W9RA 5G05C 4BFRA 5CCMA 1UN9A 2PM7A 1HH8A 3VTXA 1Y8MA 4AP2A 4QEOA 2IOSA 3PEVB 1E8ZA 4LUNU 4TRQA 4RVBA 5AENA 5BV1A 4UI9J 3PUKA 4C1QA 4OVVA 4AVXA 4L1BA 2BUGA 2MOWA 3SBSA 4O6FA 5D0OD 5JHBA 2WXMA 2PL2A 3EDTB 3F9WA 5J90A 3D3MA 3UT8A 4CEMA 2WXNA 4GAAA 2I1JA 5EX0A 2V0PA 3FFLA 3HDXA 1B89A 4AU7A 4N2QA 2J4BA 2W5YA 2WQ6A 3LVQE 4HORA 2X6HA 3GW4A 4EECA 4U0UA 3ZHEB 3PNLB 4LRZA 1IQRA 3FU5A 1P5QA 3ZW3A 4XI0A 3FUIA 3ZFWA 4G1TA 2KCKA 2OVBA 4MLPA 3OOIA 4MI0A 1E96B 2L0IA 4JL0A 1MT6A 1A17A 1LF8A 2VGYA 4URKA 2YINA 4V3IA 3M56A 2NSZA 2AXUA 5HQ8A 2J9QA 3CVPA 3FTSA 4WNDA 4MS6A 3L16A 4AIFA 3DPDA 3PVLA 4GYOA 5ANRA 3S7BA 3LKUA 5EKQD 2P58C 3M53A 1JWFA 3FUJA 4B8CB 2PQNA 3G2SA 3PUJA 4B0ZA 4N3CA 1H6KA 3ULQA 2VTBB 1IHGA 2CHXA 4KVMA 5LP0A 5CMYA 2RFIA 2V5FA 3L08A 3QAQA 3CQCB 1PC2A 3SF4A 2YHCA 3AS8A 5ANLA 2KZTA 1FVHA 2NC9A 3EHNA 5FQ7A 4LEUA 3ZHEA 2CHZA 2PQRA 4G23A 4B8AA 4BY6A 3BEEA 4J7IA 3LY8A 5DBKA 4WWPA 3UT4A 3UMVA 4FADA 3OXGA 3QDNA 4GA2A 3U4TA 3FULA 4DPRA 2AXZA 4I1MA 4H7YA 1MVXA 3F9ZA 2V8SE 3M57A 3FWVA 4H7XA 1HF8A 1N3JA 1QQEA 4ILGA 3B7TA 1NP7A 3FEYA 1H0AA 3FUNA 5KJLA 3KMTA 2I1KA 2R59A 2XPYA 4L7TA 4LCTA 3U66A 5JIYA 2ONDA 4BTAA 2VTBA 3FTWA 4GMJA 2J07A 4IRUA 4FP7A 5FT9A 5G04J 1O9SA 1H2VC 4I17A 3VTYA 4GZCA 3FUHA 3FDHA 3LS8A 4KMOA 3CIAA 4J7FA 2KZTB 4Q96A 3IKOB 3QWWA 1PY1A 3ZPJA 3IHXA 5EG2A 3B7SA 4AY6A 3FPDA 5AIJA 2C2LA 3FTXA 4BX8A 4XI9A 2BTDA 2YNQA 4P29A 4AM9A 4GZDA 1X5BA 1QNFA 2UWJG 3T8MA 4BX9A 2LAIA 4FULA 2BQZA 5KJKA 1L5JA 1MVHA 3Q5MA 3VLEA 3QKYA 3UPVA 2LSVA 4YVQC 3FTUA 2CG2A 5AYFA 4PS8A 3S7FA 3SFZA 4YPEA 3RQ4A 4AOFA 1IQUA 1N6AA 1U3DA 1ML9A 3FEXA 4ANXA 4FC8A 2J4DA 4I1AA 3GZ1A 3PE4A 3M58A 2E0IA 4KXKB 3ZYKA 2WXGA 2GW1A 2Y3AA 3KD7A 3ESKA 3O48A 3Q47B 3CK7A 3CQGB 4O30A 2WXRA 3TXNA 2RG8A 2NXPA 1VDYA 3NZSA 4XZ4A 3L13A 3O4ZA 4KVOA 4OVUA 5FTPA 2HM8A 4JW1A 3LDZA 3QOUA 3PREA 4GZ6A 5KJMA 4J8OA 1NA0A 3LCAA 4Y6CA 4AY5A 2A5UA 3MO0A 4GCOA 2LO6A 3S7DA 4QEPA 4CCAA 3I5PA 3CHPA 3CV0A 3JQ1A 4JPSA 5DIZA 1EDUA 2WPVA 3FU0A 5J08A 5KJNA 4YNPA 5T5GA 3KMAA 4HOSA 2VSYA 1TJFA 1E7VA 2FI7A 4F53A 3CVNA 2FF4A 4BSXA 2WXLA 3IV0A 3TGOA 3MZLB 3F9XA 3FTVA 3MV3B 3APFA 4WWNA 3NF1A 5LFAA 3ML9A 4BT9A 3FTZA 2WQHA 4G24A 5CPRB 2X38A 3OTNA 3ZYMA 1KT0A 3ZYQA 3IHVA 4BWRA 2WXFA 3D9MA 5A7DB 2J49A 3OS5A 1HFAA 4K03A 3IHYA 4E47A 3D9NA 2Y4UA 4MI5A 4EZJA 2IONA 3UQ3A 3AU5A 2GGFA 5T4YA 4WNFA 2WXJA 4U04A 4GMLA 3D9LA 3SI5A 3SD5A 3ZEFA 1HG2A 1HS6A 4JZYA 4JEHA 4WUYA 2BF0X 2L6JA 4A1SA 3F9YA 5FQ8A 2EQXA 5ARFA 4A55A 4DK5A 4EPZA 4IJ8A 5LCWC 3L17A 4PH4B 3L22A 4XKBA 2IOLA 2J09A 2QY7A 4JXTA 5FQ6A 5BPPA 4J8EA 4ANWA 3CVXA 2F69A 3FUDA 1N52A 3HVEB 5G55A 4D10C 5FZQA 1E8YA 2IU1A 4IN3B 2AXVA 4K0RA 5A6CA 2XCBA 3HNAA 3SNXA 4CGWA 4WNEA 1Z3YA 4AXHA 4KYOB 1TJCA 4ILHB 4JDSA 5FJYA 1GW6A 5T8IA 3RRUA 2X6IA 5BNWA 5TTFA 3KMJA 3FUFA 4CRWA 3D9PA 3NQPA 4QFVA 2AWIA 3RKVA 3GYZA 3RRNB 4L23A 4ILIA 3JUIA 4U0SA 3RO3A 1XNFA 1UW4B 4JHKA 1PAQA 3PDNA 2I2OA 4PUCA 4CDRA 1HX8A 4YNDA 3CLJA 1JPLA 1NA3A 4CT0A 5BUZA 2JLBA 3AU4A 3TJPA 4GB9A 4HFGA 3CHMA 3KEZA 2VGXA 3T5VA 2VSXE 4GPKA 3QB2A 3NZUA 3T5XA 5JINA 3ESLA 3FUEA 2CFUA 4WNGA 4ACLA 4APFA 1SQMA 4ME2A 3TG5A 3ZN3A 3FHEA 4Q69A 3G2VA 3U3WA 4TV3A 4ANVA 3MKQB 4NVQA 4EZLA 3MO5A 2OV8A 4RG6A 3RIBA 3FH7A 4G2VA 3CEQA 3L6AA 4GYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YNM A;  5F6K C;  4I2W A;  5G05 J;  3Q4A B;  1OUV A;  3IEG A;  4CGV A;  4NRH B;  5TH7 A;  5TEG A;  4Z4P A;  4H12 A;  2IF4 A;  3MEK A;  3SWC A;  1ELR A;  4N3A A;  4GZ5 A;  4GYW A;  2XGS A;  4U0Z A;  1WAO 1;  3PE3 A;  3N71 A;  3MKR A;  3FP3 A;  2KCV A;  3KAE A;  3DB5 A;  4J83 A;  3WXX A;  5JHN A;  2YQ8 A;  3DAL A;  5T0M A;  2OOE A;  4NJ5 A;  4J0U A;  4YVO A;  4JA9 A;  2E2E A;  2DBA A;  3RJW A;  3VV0 A;  3MV2 B;  3CVQ A;  1WM5 A;  5BW8 C;  4JA7 A;  5FZS A;  4JHR A;  4FMU A;  4HOU A;  3ASF A;  3BO5 A;  3TG4 A;  5F6L A;  3RJV A;  3ASD A;  3M59 A;  5JJ6 A;  2JV0 A;  2I6H A;  2VQ2 A;  2KCL A;  4ABN A;  2XGM A;  2IFU A;  2HO1 A;  1KT1 A;  2C0L A;  3M55 A;  4B94 A;  5HI7 A;  2UY1 A;  3LYA A;  1HZ4 A;  2VYI A;  2FO7 A;  4XIF A;  2XPI A;  2AVP A;  3CKC A;  2PZI A;  4UQZ A;  5BT1 A;  4UI9 C;  5JJ7 A;  4EQF A;  4UI9 K;  4U07 A;  2R3A A;  3R9A B;  4N2S A;  2FBN A;  5G04 C;  3LY9 A;  4J8F A;  3SZ7 A;  3M54 A;  2G46 A;  2LNI A;  4I9E A;  4N5C A;  5EX3 A;  4GA1 A;  3SW9 A;  1ZBP A;  1ZU2 A;  4F3V A;  5C1D A;  4GCN A;  1ELW A;  2KAT A;  4GA0 A;  3ASH A;  3OXF A;  4LDG A;  3OXL A;  4G2V A;  5FZR A;  4BUP A;  4APO A;  2R5S A;  3VUZ A;  2QFC A;  3AS4 A;  4HOQ A;  4KBQ A;  3QWV A;  3CK8 A;  2XEV A;  5T0K A;  2VGX B;  3UUX A;  2XCC A;  5D0Q D;  2FEZ A;  3Q15 A;  4G26 A;  4HOT A;  1MUF A;  3Q49 B;  3CVL A;  3CBO A;  3CBP A;  4YPU A;  2Q7F A;  5CHE E;  4JLG A;  1FCH A;  4GZ3 A;  4UQX A;  5F5E A;  3CKB A;  5LCW J;  3K5K A;  5ARG A;  4IJD A;  2KC7 A;  2HR2 A;  2W5Z A;  1IYG A;  3E4B A;  1QZ2 A;  2VSN A;  2LSU A;  1NZN A;  3CK9 A;  4N39 A;  2O8J A;  1YA0 A;  4G25 A;  3CBM A;  3K9I A;  5JJ0 A;  4RZ0 A;  4I2Z A;  3KS2 A;  4BTB A;  1N6C A;  4RG9 A;  3GZ2 A;  1KLX A;  5CCL A;  2QPW A;  3ZGQ A;  3MO2 A;  1PEG A;  3URZ A;  4N3B A;  4YPA A;  3LY7 A;  4QEN A;  1HXI A;  3QWP A;  4J8D A;  3S8P A;  3M5A A;  5LSZ A;  3OPE A;  3AS5 A;  2XGO A;  1W3B A;  1XQH A;  4BT8 A;  2IGQ A;  5JJT A;  5AYW D;  2UY1 B;  3HYM B;  2Y4T A;  1H3I A;  3JYS A;  3LPZ A;  5LSX A;  2C0M A;  3MA5 A;  4UQY A;  3RU0 A;  3RO2 A;  3S7J A;  3TAX A;  5F59 A;  4NQ0 A;  4Y6W A;  3ASG A;  2MHK A;  3EP0 A;  5M72 A;  2HYZ A;  4I9C A;  5G05 C;  4W9R A;  5CCM A;  1HH8 A;  3VTX A;  1Y8M A;  4QEO A;  4C1Q A;  4UI9 J;  2BUG A;  4O6F A;  5D0O D;  2PL2 A;  3EDT B;  3F9W A;  5EX0 A;  3FFL A;  1B89 A;  4AU7 A;  4N2Q A;  2W5Y A;  4HOR A;  3GW4 A;  4U0U A;  3ZHE B;  1P5Q A;  4XI0 A;  3ZFW A;  4G1T A;  2KCK A;  3OOI A;  4MI0 A;  1E96 B;  4JL0 A;  1MT6 A;  1A17 A;  2VGY A;  3M56 A;  5HQ8 A;  2J9Q A;  3CVP A;  4WND A;  4AIF A;  4GYO A;  3S7B A;  3LKU A;  5EKQ D;  2P58 C;  3M53 A;  2PQN A;  4N3C A;  3ULQ A;  1IHG A;  2RFI A;  2V5F A;  3SF4 A;  1PC2 A;  2YHC A;  3AS8 A;  2NC9 A;  4LEU A;  3ZHE A;  4G23 A;  2PQR A;  3BEE A;  4J7I A;  3LY8 A;  5DBK A;  3OXG A;  3QDN A;  4GA2 A;  3U4T A;  3F9Z A;  4H7Y A;  1MVX A;  3M57 A;  3FWV A;  4H7X A;  1N3J A;  1QQE A;  5KJL A;  3KMT A;  5JIY A;  2OND A;  4BTA A;  5FT9 A;  5G04 J;  1O9S A;  4I17 A;  3VTY A;  4J7F A;  3QWW A;  3ZPJ A;  3IHX A;  5EG2 A;  4AY6 A;  3FPD A;  2C2L A;  4XI9 A;  4AM9 A;  2UWJ G;  2BQZ A;  5KJK A;  3Q5M A;  3QKY A;  3UPV A;  2LSV A;  4YVQ C;  5AYF A;  3S7F A;  4YPE A;  3RQ4 A;  1N6A A;  1ML9 A;  4I1A A;  3GZ1 A;  3PE4 A;  3M58 A;  4KXK B;  2GW1 A;  3KD7 A;  3ESK A;  3O48 A;  3Q47 B;  3CK7 A;  4O30 A;  5FTP A;  3QOU A;  5KJM A;  4J8O A;  4GZ6 A;  1NA0 A;  3LCA A;  4Y6C A;  4AY5 A;  3MO0 A;  4GCO A;  3S7D A;  4QEP A;  3RAY A;  3CV0 A;  4YNP A;  5DIZ A;  5KJN A;  2WPV A;  5T5G A;  3KMA A;  4HOS A;  2VSY A;  2FI7 A;  3CVN A;  2FF4 A;  3TGO A;  3F9X A;  3MV3 B;  3NF1 A;  4BT9 A;  2WQH A;  4G24 A;  5CPR B;  1KT0 A;  4BWR A;  5A7D B;  4E47 A;  3OS5 A;  2Y4U A;  4MI5 A;  3UQ3 A;  4WNF A;  4U04 A;  4WUY A;  2L6J A;  4A1S A;  3F9Y A;  5ARF A;  4IJ8 A;  5LCW C;  4J8E A;  2F69 A;  5A6C A;  5FZQ A;  4IN3 B;  2XCB A;  3HNA A;  4CGW A;  4WNE A;  4KYO B;  1TJC A;  4JDS A;  5FJY A;  5BNW A;  5TTF A;  3KMJ A;  3RKV A;  3GYZ A;  4U0S A;  3RO3 A;  1XNF A;  4CDR A;  4YND A;  1NA3 A;  2JLB A;  2VGX A;  4GPK A;  5JIN A;  4I51 A;  4WNG A;  1ZKK A;  1MVH A;  3ZN3 A;  4ME2 A;  3TG5 A;  4NVQ A;  3MO5 A;  4RG6 A;  3RIB A;  3U3W A;  3CEQ A;  3PDN A;  4GYY A; 
#chains in the Genus database with same CATH topology
 2VGE A;  4HRM B;  4YNM A;  1E8W A;  4RQI A;  1E90 A;  4A1G A;  3G2W A;  3MX3 A;  4Z4P A;  3BG1 B;  1NI1 A;  2RKK A;  3PS6 A;  4DRX E;  4HB5 A;  4N3A A;  4PS7 A;  3ONL A;  4GYW A;  4EBA G;  1FVF A;  3PE3 A;  1U3C A;  1ZB1 A;  5A23 A;  1OWP A;  4TUM A;  2KCV A;  3TWR A;  2YQ8 A;  4MKT A;  1A5E A;  3UM1 A;  4YVO A;  4JA9 A;  4FHK A;  4M7C A;  4PDX A;  3RJW A;  2F37 A;  3CVQ A;  4AJW A;  3DST A;  1SZ9 A;  3SGH A;  5FZS A;  1N9A A;  4U7E B;  4HOU A;  2XZT G;  3CVY A;  1TNY A;  5JJ6 A;  2I6H A;  4OYS A;  4ABN A;  4B93 B;  1Y6I A;  1NFI E;  2DVW A;  1KT1 A;  2J08 A;  3IBE A;  2EIJ E;  1HZ4 A;  2VYI A;  3AG2 E;  3UIN C;  1O1R A;  4XIF A;  1Z3X A;  3JUE A;  2AVP A;  4J6I A;  1TN6 A;  2A5E A;  4UQZ A;  3R9A B;  1H6P A;  1EYH A;  2XHE A;  4DX7 D;  3DBS A;  4YDY A;  2XRY A;  2G46 A;  3Q9U C;  4I9E A;  4N5C A;  5EX3 A;  2R02 A;  3SW9 A;  3ABM E;  2ETB A;  2OCC E;  3QNK A;  4LDG A;  1DCQ A;  2VJ8 A;  3HXC A;  3OXL A;  4BER A;  3ASO E;  4JHJ A;  3FH8 A;  2R5S A;  3DSU A;  2QFC A;  3OAW A;  4KBQ A;  1TN7 A;  3QWV A;  5CMW A;  4E6H A;  5T0K A;  5D0Q D;  2L0T B;  3CVL A;  4IYP A;  3CBO A;  1KPS B;  2Q7F A;  5CHE E;  4GZ3 A;  2IJG X;  4TUU A;  1OT8 A;  3SBT B;  5F5E A;  2XPZ A;  3K5K A;  2HR2 A;  2W5Z A;  3QAR A;  3F6Q A;  2VSN A;  1N4Q A;  3ZKJ A;  2LSU A;  4A3V A;  5E76 A;  2GRR B;  3L54 A;  2MYO A;  2A4Z A;  3DSV A;  3HXE A;  3K9I A;  5JJ0 A;  2EIK E;  2X6F A;  3KS2 A;  4DX6 D;  4BTB A;  3ABK E;  3G2U A;  3SO8 A;  1N6C A;  2CHW A;  2GRP B;  2QPW A;  3ZGQ A;  1OY3 D;  2F8X K;  3LY7 A;  2XS8 A;  1XGW A;  3Q9N C;  3SY2 A;  3QWP A;  3DWL G;  4J8D A;  4TXP A;  2CG3 A;  4HXI A;  2EIM E;  5ENS D;  2WMN A;  3D9I A;  2IGQ A;  2ETC A;  2P9I G;  4YDE A;  2X6K A;  3LPZ A;  1H3I A;  5FWQ A;  3MA5 A;  1NL4 A;  4LG6 A;  3HHM A;  3FUK A;  1DNP A;  5D66 A;  5KNH D;  4XE0 A;  4BFR A;  5CBO A;  1UN9 A;  1HH8 A;  4QEO A;  3Q79 A;  2IOS A;  3PEV B;  1E8Z A;  5AEN A;  4C1Q A;  4AVX A;  3EUV A;  3HRA A;  3EDT B;  3D3M A;  3UT8 A;  5EX0 A;  5ENP D;  2ETA A;  1TN8 A;  3LVQ E;  4EEC A;  3PNL B;  3FU5 A;  4G1T A;  4MLP A;  2OVB A;  1E96 B;  4JL0 A;  1A17 A;  2FO1 E;  4WND A;  5EYL A;  4AIF A;  3DPD A;  4GYO A;  3S7B A;  1O1T A;  3PUJ A;  5ENR D;  4N3C A;  2CHX A;  5CMY A;  3QAQ A;  3SF4 A;  1BI8 B;  5ANL A;  1FVH A;  3ISM C;  3ZHE A;  4G23 A;  4BY6 A;  5DBK A;  3UMV A;  3FUL A;  4N5Q A;  2V8S E;  3FWV A;  1HF8 A;  3TWT A;  1N3J A;  1QQE A;  1BLX B;  1H0A A;  2R59 A;  5JIY A;  3FTW A;  4IRU A;  1N95 A;  4FP7 A;  5AAO A;  1H2V C;  3VTY A;  4GZC A;  4J7F A;  3CIA A;  4Q96 A;  4L9P A;  3FPD A;  5AIJ A;  4J7W A;  4XI9 A;  2UWJ G;  1LD7 A;  4FUL A;  1L5J A;  3QKY A;  1O1S A;  3UPV A;  4YVQ C;  3FTU A;  2CG2 A;  4AOF A;  4ANX A;  4FC8 A;  4I1A A;  3UIO C;  2E0I A;  4KXK B;  3ZYK A;  2WXG A;  2Y3A A;  4DUI A;  4O30 A;  3CK7 A;  4LNB A;  2GRO B;  2WXR A;  4XZ4 A;  1VDY A;  4HLL A;  3AJI A;  3L13 A;  4KVO A;  2Y1L E;  1DCE A;  2HM8 A;  4JW1 A;  5FTP A;  5KJM A;  1NA0 A;  4Y6C A;  4AY5 A;  2A5U A;  3MO0 A;  4GCO A;  4QEP A;  3CHP A;  3JQ1 A;  5KJN A;  4HOS A;  1E7V A;  2FI7 A;  3HG0 D;  4BSX A;  2WXL A;  3MZL B;  3APF A;  2HE0 A;  3NF1 A;  2WQH A;  1Q2Z A;  3IHV A;  4BWR A;  2WXF A;  3IHY A;  3UQ3 A;  2WXJ A;  3ZEF A;  4JZY A;  3SQV A;  3Q78 A;  2EQX A;  2R2L A;  5LCW C;  4XKB A;  3L22 A;  2J09 A;  4JXT A;  5BPP A;  3IXE A;  3ZU7 B;  3FUD A;  4D10 C;  2IU1 A;  4K0R A;  2AXV A;  5AAR A;  1Z3Y A;  5BNW A;  3RRU A;  2X6I A;  3FUF A;  4K5A B;  2AWI A;  3RKV A;  1MX2 A;  1XNF A;  4JHK A;  1PAQ A;  1BU9 A;  4CDR A;  1FT2 A;  3AU4 A;  1DC2 A;  2VSX E;  5JIN A;  3ESL A;  1K1B A;  1SQM A;  4Q69 A;  4NVQ A;  2R03 A;  2PQR A;  4L2Y A;  5AQ9 A;  3C72 A;  5G05 J;  5ENQ D;  4NRH B;  4GTV A;  3W9G A;  1JWG A;  5TEG A;  5BV0 A;  1N54 A;  1OCC E;  1S64 A;  2IO3 C;  1TEZ A;  3X2Q E;  5AJL A;  5G2N A;  4CDM A;  4GZ5 A;  3RSE G;  2XGS A;  3V31 A;  1H2U A;  3MKQ A;  3FP3 A;  3MCX A;  3ZXS A;  4J83 A;  4IUL A;  4UWK A;  1N4S A;  1OWO A;  3PNT B;  3W9F A;  4J0U A;  3D9J A;  1HE8 A;  3VV0 A;  3QK0 A;  3DSX A;  3CHS A;  3ML8 A;  4JHR A;  4FMU A;  3L9T A;  4YDW A;  4DI3 A;  3LVR E;  1D8D A;  1OWN A;  3ASD A;  2XGM A;  1E7U A;  4EZK A;  2DYR E;  2IFU A;  3R7Q A;  1N0R A;  2C0L A;  4B94 A;  5HI7 A;  3LYA A;  3APD A;  2XZD G;  4NIK A;  2H6G A;  2Y69 E;  1H6O A;  4CT4 A;  4OAV B;  2PZI A;  4A63 B;  4U8H A;  4UI9 C;  1OWM A;  1EF1 C;  2LXM A;  3SZ7 A;  3M54 A;  2LNI A;  2ZU6 B;  3UI2 A;  4F3V A;  3HVE A;  3UM2 A;  3UX4 A;  3E30 A;  1ELW A;  2KAT A;  3ASH A;  4KT6 B;  4HLE A;  5FZR A;  4BUP A;  4DX5 D;  3PZ3 A;  3TWU A;  4APO A;  1IXV A;  2R17 C;  2DIW A;  4G8K A;  2OEV A;  2I9C A;  4F1S A;  3QC1 A;  1UJJ A;  4I6J A;  2XRZ A;  2WXP A;  3CK8 A;  4RSY A;  3Q15 A;  4G26 A;  3SFX A;  4HRN A;  2DYS E;  4EBA A;  4JLG A;  4I6G A;  3FTY A;  2F0Y A;  1RW2 A;  2VSO E;  4U95 D;  3FU6 A;  4UWL A;  4FJY A;  3ZXP A;  1FPP A;  4N39 A;  4NAC A;  1YA0 A;  2DCP A;  4G25 A;  5B3S E;  3CBM A;  1JUQ A;  3EJN A;  4MRU A;  4RZ0 A;  2RD0 A;  2JEK A;  4GMR A;  3UM0 A;  3PRZ A;  3G2T A;  3AG1 E;  3U9W A;  1IHB A;  3JXI A;  3BQO A;  1HU3 A;  3I3N A;  4N3B A;  4QEN A;  5HRY A;  3BU8 A;  3ULY A;  5ENN A;  1WY6 A;  1H19 A;  3T9K A;  3AS5 A;  4F7A A;  4MBG A;  2YHE A;  5AYW D;  4HBD A;  2FUL A;  3RO2 A;  3EHM A;  4C0M A;  2WM9 A;  2X3M A;  1MQS A;  3NBN B;  3NOC D;  4JVS A;  3ENE A;  4JEU A;  1N11 A;  2MHK A;  3TXM A;  3CR3 A;  5CCM A;  2PM7 A;  3DSW A;  1Y8M A;  2V4H C;  4UI9 J;  3SFY A;  3E37 A;  4RLY A;  4O6F A;  5D0O D;  5B1B E;  1KZP A;  3E33 A;  1QYM A;  2PL2 A;  3F9W A;  2WXN A;  2V0P A;  3C5R A;  4N2Q A;  2WQ6 A;  2X6H A;  1IQR A;  1P5Q A;  3ZW3 A;  1JCS A;  1JCQ A;  4XI0 A;  2KCK A;  2L0I A;  3UKR G;  4JD2 G;  1LF8 A;  3M56 A;  2NSZ A;  2ZGG A;  2J9Q A;  5CER B;  3ABL E;  5ITZ F;  2P58 C;  3Q75 A;  1H6K A;  5IY5 E;  3ULQ A;  2RFI A;  1PC2 A;  2KZT A;  2NC9 A;  5FQ7 A;  4B8A A;  1MJ0 A;  3UT4 A;  2ZIS A;  3LJN A;  4H7Y A;  4H7X A;  3FEY A;  3DPY A;  3Q73 A;  4YDO A;  3PZ4 A;  3Q7F A;  2P9L G;  3B95 A;  2OND A;  4BTA A;  2H6H A;  1TNU A;  2J07 A;  4I17 A;  3FDH A;  3QWW A;  3KEA A;  2C2L A;  5H7P A;  3FTX A;  4BX8 A;  4P29 A;  4GZD A;  3T8M A;  1QNF A;  2LAI A;  2BQZ A;  5AYF A;  4PS8 A;  3S7F A;  1N6A A;  4HI8 A;  2GW1 A;  3KD7 A;  3Q47 B;  1FT1 A;  3CQG B;  2NXP A;  3NZS A;  3O4Z A;  4OVU A;  4J8O A;  3I5P A;  3RAY A;  4YNP A;  2BKK B;  5DIZ A;  2WPV A;  4F53 A;  3CVN A;  3TGO A;  3F9X A;  1AP7 A;  5LFA A;  4BT9 A;  3FTZ A;  5A7D B;  2J49 A;  1HFA A;  2ZIR A;  4K03 A;  3UM3 A;  3D9N A;  3TWQ A;  4EZJ A;  2ION A;  3AU5 A;  3D9L A;  1RZ4 A;  3SD5 A;  1HS6 A;  4JEH A;  2L6J A;  4A1S A;  4PH4 B;  3TWW A;  2KXP C;  2QY7 A;  4ANW A;  5FZQ A;  3SNX A;  4CGW A;  1UOH A;  4JDS A;  5FJY A;  2LUH A;  3NQP A;  4ILI A;  3JUI A;  4U0S A;  3RO3 A;  4CYM D;  2I2O A;  1HX8 A;  4CT0 A;  1SW6 A;  3V30 A;  2JLB A;  3TJP A;  4HFG A;  4EHM A;  3QB2 A;  3NZU A;  4WNG A;  1ZKK A;  4APF A;  2XEH A;  4ANV A;  5AN8 A;  2OV8 A;  3RIB A;  3FH7 A;  3L6A A;  5AQ7 A;  5F6K C;  4I2W A;  3Q4A B;  1OUV A;  3ZIM A;  2GRN B;  3MJW A;  3APC A;  5KBA A;  5BXO A;  2IF4 A;  3MEK A;  2PM6 A;  2WXQ A;  3J5P A;  5FIN A;  4HS2 A;  4A3T A;  3SHF A;  1ELR A;  4GPM A;  4U63 A;  4U0Z A;  1WAO 1;  5LOZ A;  3MKR A;  3V79 K;  4U96 D;  5LX8 A;  3WXX A;  5JHN A;  3DAL A;  4C0E A;  3ZVV A;  4DI4 A;  4XX5 A;  4NJ5 A;  3CSF A;  3MV2 B;  4JC8 A;  3MYV A;  2BKG A;  2WXH A;  3JCK C;  4JA7 A;  3ONK A;  2V4L A;  2L6B A;  3ASF A;  3C3R A;  3TG4 A;  4FA6 A;  3BO5 A;  3M59 A;  4GTO A;  2JV0 A;  2VQ2 A;  4WAF A;  2KCL A;  4QQI A;  4HI9 A;  4NUR A;  1MX4 A;  4UWG A;  3C98 A;  4UWF A;  1BD8 A;  5KCM A;  2X6J A;  1KZO A;  2FO7 A;  3B7B A;  1EPU A;  3CKC A;  3EHR A;  3FH5 A;  5BT1 A;  4HQD A;  3ZRH A;  4EQF A;  2KM4 A;  1Z6T A;  2R3A A;  2M63 A;  4N2S A;  4FU3 A;  3B7U X;  4ANU A;  2LAH A;  2FBN A;  3R7R A;  5BXU A;  3LY9 A;  3ZYL A;  4J8F A;  3VLF A;  2XQ0 A;  4J8S A;  4GA1 A;  1ZU2 A;  4WWO A;  3B7R L;  2AW6 A;  2GRL A;  4GA0 A;  1D9S A;  3B13 A;  2B6C A;  1LTX A;  3PZD A;  3AS4 A;  5AJD A;  4ACK A;  2Y0B G;  5CRV A;  2IY0 C;  1H2T C;  1SA4 A;  4L2L A;  2VGX B;  3UUX A;  2XCC A;  3UTM A;  2FEZ A;  1MUF A;  4YPU A;  1S0P A;  1FCH A;  5EYP F;  1TR4 A;  5LCW J;  4IJD A;  2KC7 A;  4O1P A;  1IYG A;  3E4B A;  1K3Z D;  5JMN D;  2WQ7 A;  3PEU B;  4DLO A;  5JHA A;  1OCO E;  3ULE G;  3S2A A;  3CK9 A;  2O8J A;  3CHO A;  1SA5 A;  5T3R A;  1N4P A;  2P9U G;  4KZ0 A;  3DEO A;  3J5Q B;  4I2Z A;  4XEI G;  4CDN A;  5FQ4 A;  2WXO A;  2P9S G;  3PH0 C;  3GZ2 A;  5CCL A;  4AEZ C;  5ENT D;  4C9B B;  1TNO A;  1PEG A;  2RFA A;  5C2Y A;  3URZ A;  4DX1 A;  3U64 A;  1WG0 A;  3M5A A;  2L9B A;  1UJK A;  1UN8 A;  3OPE A;  1ELK A;  2DWZ A;  1XQH A;  4BT8 A;  1INZ A;  3MGB A;  3AG3 E;  3HXB A;  2UY1 B;  3P1U A;  2Y4T A;  4ATZ D;  5LSX A;  3D9O A;  2C0M A;  4FLB A;  3HXF A;  4UQY A;  3S7J A;  3TAX A;  5F59 A;  3CVV A;  1DVP A;  3GZS A;  4KZC A;  4I43 A;  4HVB A;  4Y6W A;  4GTT A;  5E75 A;  3EP0 A;  2HYZ A;  4W9R A;  4ZHB A;  5EID A;  4AP2 A;  5BV1 A;  3DSS A;  4OVV A;  4L1B A;  3SBS A;  5HS0 A;  4CEM A;  3FFL A;  2J4B A;  4HOR A;  3T8K A;  2R05 A;  4U0U A;  1QBQ A;  3ZFW A;  3FUI A;  3OOI A;  4UUC A;  2YIN A;  3CVP A;  1N94 A;  2F8Y A;  1JWF A;  4B8C B;  2PQN A;  4B0Z A;  2VTB B;  1IHG A;  4KVM A;  4Z68 A;  2V5F A;  2YHC A;  4BES A;  4G8L A;  4J7I A;  4WWP A;  4FAD A;  3M57 A;  3NOG D;  1S70 B;  4ILG A;  1NP7 A;  3FUN A;  2I1K A;  2XPY A;  4L7T A;  3U66 A;  4GMJ A;  5FT9 A;  1O9S A;  1AWC B;  3FUH A;  4KMO A;  2KZT B;  2AJA A;  3IKO B;  3ZPJ A;  3B7S A;  2BTD A;  2P9N G;  4AM9 A;  5KJK A;  2LSV A;  5HKP A;  4O1O A;  4U8V D;  3RQ4 A;  3FEX A;  3NAW A;  1O5M A;  4C48 B;  3M58 A;  5B1A E;  3O48 A;  1V55 E;  4HRL A;  3TXN A;  1IKN D;  4CZ2 D;  3R9M A;  3LDZ A;  3QOU A;  3LCA A;  3C3O A;  1JCR A;  1K8K G;  3S7D A;  4CCA A;  1D8E A;  4JPS A;  1EDU A;  5T5G A;  2VSY A;  1TJF A;  2FF4 A;  3FTV A;  3MV3 B;  4WWN A;  3EU5 A;  3TWV A;  5CPR B;  3OTN A;  3ZYM A;  3ZYQ A;  3D9M A;  3KSQ A;  3PZ1 A;  3ASN E;  4MI5 A;  2GGF A;  5T4Y A;  4WNF A;  5CBN A;  1V54 E;  4GML A;  2QYU A;  2OEW A;  3ZNG A;  2JAB A;  3F9Y A;  4DK5 A;  4A55 A;  4IJ8 A;  3L17 A;  5FQ6 A;  5EN5 D;  4J8E A;  3CVX A;  1N52 A;  3HVE B;  2XCB A;  3DEP A;  4WNE A;  1TJC A;  2LXL A;  5TTF A;  3KMJ A;  4CRW A;  4GTS A;  4QFV A;  4L23 A;  1UW4 B;  1JPL A;  5BUZ A;  4GB9 A;  2XS1 A;  3KEZ A;  4GPK A;  5KNG A;  3V2X A;  4ACL A;  2CFU A;  1MVH A;  4I51 A;  3ZN3 A;  3U3W A;  3TG5 A;  2P9P G;  4RG6 A;  3ZUV B;  3CEQ A;  1MT6 A;  3PDN A;  4UWH A;  3JQ0 A;  3IEG A;  4CGV A;  5TH7 A;  4H12 A;  3SWC A;  2WXI A;  2WB2 A;  2CFZ A;  4R7L A;  2IO2 C;  1N0Q A;  2J8S D;  3LXU X;  3N71 A;  3VLD A;  3EIQ C;  1OXJ A;  3EIJ A;  3KAE A;  3DB5 A;  2ZXW E;  4DLQ A;  1TYQ G;  2IQC A;  5T0M A;  3CGH A;  2OOE A;  3FU3 A;  4HNA D;  4M3O A;  3NB2 A;  4B89 A;  3CVW A;  2E2E A;  2DBA A;  2PNN A;  1WM5 A;  5BW8 C;  3BG0 B;  5F6L A;  3RJV A;  3TL5 A;  2B0O E;  4X8Q A;  5FIO A;  2ILR A;  3UT7 A;  2HO1 A;  1SVX A;  4F1P A;  3M55 A;  3LEW A;  2UY1 A;  4LSZ E;  4U8Y D;  3CHR A;  2XPI A;  5EDS A;  3UXG A;  5JJ7 A;  3FY4 A;  4FHJ A;  4UI9 K;  4U07 A;  5AQB A;  4LER A;  5G04 C;  3LJ3 A;  3DXM G;  3FUM A;  3UIP C;  3AG4 E;  2EIN E;  1ZBP A;  4ATG A;  1OWL A;  5C1D A;  4GCN A;  3OXF A;  2IEJ A;  1YMP A;  5CED B;  3VUZ A;  2DZN A;  4TXR A;  4HOQ A;  2WMO A;  3E32 A;  1S63 A;  2OVF A;  4I6E A;  2XEV A;  3D9K A;  1UG3 A;  3QJZ A;  2H6I A;  4FJZ A;  1MX6 A;  1BPO A;  4HOT A;  3Q49 B;  3CBP A;  3Q7A A;  2WVI A;  4UQX A;  1E8X A;  3CKB A;  5ARG A;  3HXD A;  1QZ2 A;  4I1O B;  4BSZ B;  5EIB E;  1NZN A;  2BED A;  3HIZ A;  4Q94 A;  3I4G A;  3CHQ A;  3WG7 E;  2V5Q C;  3CVU A;  4E85 A;  2MRI A;  1HG5 A;  4K5C A;  4XKC A;  4RG9 A;  1KLX A;  2P9K G;  1HO8 A;  3P2B A;  3RK6 A;  3MO2 A;  2GRM A;  4GU5 A;  4YPA A;  2WXK A;  3BUA A;  1HXI A;  3RAU A;  4JB8 P;  3S8P A;  4LNU D;  5LSZ A;  3RRM B;  3CST A;  1SZA A;  4BET A;  4G11 A;  1YYH A;  4OAU C;  2XGO A;  1W3B A;  4J8Y A;  4K5B A;  5JJT A;  3E34 A;  4DJA A;  3HYM B;  2XEN A;  3JYS A;  1BI7 B;  3I4R B;  1MHQ A;  3RU0 A;  2NYJ A;  5JA4 D;  4NQ0 A;  3ASG A;  4FLH A;  5M72 A;  4I9C A;  4PS3 A;  5G05 C;  1N4R A;  3DRA A;  3VTX A;  4TRQ A;  4LUN U;  4RVB A;  4DX2 A;  3PUK A;  1U2V G;  2BUG A;  2MOW A;  5JHB A;  2WXM A;  2QYJ A;  5J90 A;  4GAA A;  2I1J A;  3EU9 A;  1TNZ A;  3C3Q A;  3HDX A;  1B89 A;  4AU7 A;  2EIL E;  2W5Y A;  3EHQ A;  3GW4 A;  4GTP A;  3TWX A;  3ZHE B;  4LRZ A;  1K1A A;  4MI0 A;  4URK A;  2VGY A;  4V3I A;  5KWD A;  2AXU A;  5HQ8 A;  5EIL A;  3FTS A;  4MS6 A;  3L16 A;  3AAA C;  3JXJ A;  3PVL A;  5ANR A;  3D9H A;  3LKU A;  5EKQ D;  3M53 A;  3FUJ A;  3G2S A;  2P2C P;  1TNB A;  5LP0 A;  1MYO A;  3L08 A;  3CQC B;  3AS8 A;  4GTM A;  5AQA A;  3EHN A;  4LEU A;  2CHZ A;  3TWS A;  3BEE A;  3LY8 A;  3OXG A;  3QDN A;  4GA2 A;  3U4T A;  4DPR A;  2AXZ A;  4I1M A;  1MVX A;  3F9Z A;  4O60 A;  5CRU A;  2QC9 A;  3B7T A;  5KJL A;  3KMT A;  4LCT A;  2VTB A;  5G04 J;  1OCZ E;  2XEE A;  3LS8 A;  5CEA A;  3DXK G;  1PY1 A;  3IHX A;  5EG2 A;  4AY6 A;  1Z5S C;  2YNQ A;  2H6F A;  5D2M C;  4BX9 A;  1X5B A;  3Q5M A;  5ENO D;  3VLE A;  3SFZ A;  4YPE A;  1IQU A;  1U3D A;  1X81 A;  1ML9 A;  2KBX A;  3KSL A;  2J4D A;  3L82 A;  3GZ1 A;  3PE4 A;  3ESK A;  2RG8 A;  5CEC B;  1MZC A;  3PRE A;  4GZ6 A;  4GTQ A;  4TXQ A;  2LO6 A;  2GRQ B;  3CV0 A;  3FU0 A;  5J08 A;  3KMA A;  3IV0 A;  3ML9 A;  4G24 A;  2X38 A;  1YCS B;  3PZ2 A;  1KT0 A;  4E47 A;  2DZO A;  4ZFH A;  3OS5 A;  2Y4U A;  4LNG A;  4U04 A;  3SI5 A;  1HG2 A;  4WUY A;  2BF0 X;  1WDY A;  4GTR A;  5FQ8 A;  5ARF A;  4EPZ A;  2IOL A;  4F6R D;  2ZGD A;  2F69 A;  1OCR E;  5G55 A;  5A6C A;  1E8Y A;  4IN3 B;  3HNA A;  4AXH A;  4KYO B;  4ILH B;  1GW6 A;  5T8I A;  2RFM A;  3D9P A;  2QZA A;  1G3N B;  3GYZ A;  3RRN B;  4BEP A;  1LD8 A;  4PUC A;  4YND A;  3CLJ A;  1NA3 A;  3CHM A;  2VGX A;  3T5V A;  3T5X A;  3FUE A;  4ME2 A;  3UKU G;  3FHE A;  3G2V A;  4TV3 A;  3V2O A;  3MKQ B;  4EZL A;  3MO5 A;  4G2V A;  4AV7 A;  4GYY A; 
#chains in the Genus database with same CATH homology
 4L2Y A;  4UWH A;  3JQ0 A;  4YNM A;  4I2W A;  5G05 J;  3Q4A B;  5F6K C;  1E8W A;  1OUV A;  3IEG A;  4CGV A;  4NRH B;  1E90 A;  4A1G A;  3ZIM A;  3G2W A;  3MX3 A;  3MJW A;  1JWG A;  3APC A;  5TEG A;  5TH7 A;  4Z4P A;  4H12 A;  3BG1 B;  2IF4 A;  3MEK A;  2PM6 A;  3PS6 A;  2WXQ A;  5BV0 A;  1N54 A;  3SWC A;  4HS2 A;  4A3T A;  2WXI A;  1TEZ A;  5AJL A;  3SHF A;  1ELR A;  2WB2 A;  4N3A A;  2CFZ A;  4R7L A;  5G2N A;  4CDM A;  4GZ5 A;  4PS7 A;  3ONL A;  4GYW A;  4U63 A;  2XGS A;  4EBA G;  4U0Z A;  1H2U A;  1FVF A;  1WAO 1;  3PE3 A;  1U3C A;  5LOZ A;  5A23 A;  3LXU X;  3N71 A;  3VLD A;  1OWP A;  3EIQ C;  3MKR A;  3EIJ A;  3MKQ A;  3FP3 A;  3MCX A;  2KCV A;  3ZXS A;  3KAE A;  5LX8 A;  3DB5 A;  4J83 A;  3WXX A;  4IUL A;  2YQ8 A;  4DLQ A;  2IQC A;  4UWK A;  3DAL A;  5JHN A;  1OWO A;  3PNT B;  4C0E A;  5T0M A;  3CGH A;  3ZVV A;  2OOE A;  3FU3 A;  4M3O A;  4MKT A;  4J0U A;  4XX5 A;  4YVO A;  4JA9 A;  3D9J A;  4DI4 A;  4NJ5 A;  3CSF A;  4B89 A;  4FHK A;  3CVW A;  1HE8 A;  2DBA A;  2E2E A;  4PDX A;  3RJW A;  3VV0 A;  3MV2 B;  3CVQ A;  3MYV A;  4JC8 A;  1WM5 A;  3QK0 A;  5BW8 C;  2WXH A;  3JCK C;  4AJW A;  1SZ9 A;  4JA7 A;  3CHS A;  3ML8 A;  5FZS A;  3ONK A;  3SGH A;  4JHR A;  4FMU A;  3BG0 B;  2V4L A;  4HOU A;  3ASF A;  3BO5 A;  3TG4 A;  4DI3 A;  4FA6 A;  5F6L A;  3RJV A;  3LVR E;  3CVY A;  3TL5 A;  1OWN A;  3ASD A;  5JJ6 A;  2JV0 A;  2I6H A;  2VQ2 A;  3M59 A;  4WAF A;  2ILR A;  2KCL A;  4OYS A;  4ABN A;  2XGM A;  1E7U A;  4EZK A;  4NUR A;  2IFU A;  1Y6I A;  4UWG A;  3UT7 A;  2HO1 A;  3C98 A;  4UWF A;  1KT1 A;  3R7Q A;  2J08 A;  2C0L A;  3IBE A;  3M55 A;  4B94 A;  3LEW A;  5KCM A;  2X6J A;  5HI7 A;  2UY1 A;  3LYA A;  1HZ4 A;  2VYI A;  2FO7 A;  3APD A;  4XIF A;  1Z3X A;  3CHR A;  2XPI A;  1EPU A;  2AVP A;  4J6I A;  5EDS A;  3CKC A;  4CT4 A;  2PZI A;  4UQZ A;  3FH5 A;  4U8H A;  5BT1 A;  4UI9 C;  5JJ7 A;  3FY4 A;  4FHJ A;  3ZRH A;  4EQF A;  2KM4 A;  4UI9 K;  1Z6T A;  4U07 A;  2R3A A;  1OWM A;  2M63 A;  3R9A B;  4N2S A;  4FU3 A;  3B7U X;  1EYH A;  4LER A;  2XHE A;  4ANU A;  2LAH A;  2FBN A;  5G04 C;  3R7R A;  1EF1 C;  3LY9 A;  3LJ3 A;  3ZYL A;  4J8F A;  3DBS A;  3FUM A;  2XRY A;  3SZ7 A;  1ZKK A;  3VLF A;  2G46 A;  2XQ0 A;  3M54 A;  2LNI A;  4I9E A;  4J8S A;  4N5C A;  2ZU6 B;  5EX3 A;  4GA1 A;  3SW9 A;  1ZBP A;  1ZU2 A;  4F3V A;  3HVE A;  3B7R L;  4WWO A;  4ATG A;  1OWL A;  3QNK A;  3UX4 A;  4GCN A;  5C1D A;  2AW6 A;  2GRL A;  1ELW A;  2KAT A;  4GA0 A;  3ASH A;  3OXF A;  4LDG A;  4KT6 B;  2VJ8 A;  3OXL A;  4HLE A;  4I51 A;  3B13 A;  5FZR A;  4BUP A;  4JHJ A;  4APO A;  3FH8 A;  2R5S A;  3PZD A;  3VUZ A;  2QFC A;  3AS4 A;  2R17 C;  5AJD A;  2DIW A;  3OAW A;  4ACK A;  4HOQ A;  2WMO A;  4KBQ A;  3QWV A;  2I9C A;  4F1S A;  5CMW A;  3QC1 A;  1UJJ A;  4I6J A;  2XRZ A;  2OVF A;  2WXP A;  4I6E A;  1H2T C;  3CK8 A;  2XEV A;  3D9K A;  4L2L A;  4E6H A;  1UG3 A;  2VGX B;  3QJZ A;  2XCC A;  3UUX A;  4FJZ A;  5T0K A;  5D0Q D;  2FEZ A;  4RSY A;  1BPO A;  3Q15 A;  4G26 A;  4HOT A;  2L0T B;  1MUF A;  3Q49 B;  3CVL A;  4IYP A;  3CBO A;  3CBP A;  4YPU A;  4EBA A;  2Q7F A;  1S0P A;  2WVI A;  5CHE E;  4JLG A;  1FCH A;  4GZ3 A;  2IJG X;  4I6G A;  4TUU A;  3FTY A;  4UQX A;  3SBT B;  5F5E A;  2XPZ A;  1E8X A;  3CKB A;  5LCW J;  3K5K A;  5ARG A;  4IJD A;  2KC7 A;  2HR2 A;  2W5Z A;  3QAR A;  1IYG A;  2VSO E;  1QZ2 A;  3E4B A;  2VSN A;  3FU6 A;  4I1O B;  2WQ7 A;  4UWL A;  3PEU B;  4DLO A;  4FJY A;  5JHA A;  2LSU A;  4A3V A;  3S2A A;  1NZN A;  3CK9 A;  4N39 A;  2O8J A;  3CHO A;  3HIZ A;  5E76 A;  4Q94 A;  3L54 A;  3I4G A;  4NAC A;  1YA0 A;  2DCP A;  2A4Z A;  4G25 A;  5T3R A;  3CHQ A;  3CBM A;  1JUQ A;  3K9I A;  4KZ0 A;  3EJN A;  4MRU A;  4AV7 A;  3CVU A;  5JJ0 A;  4RZ0 A;  2RD0 A;  2X6F A;  2JEK A;  4I2Z A;  4E85 A;  4CDN A;  3PRZ A;  3G2T A;  2MRI A;  5FQ4 A;  2WXO A;  3KS2 A;  4BTB A;  1HG5 A;  3U9W A;  3PH0 C;  3G2U A;  4XKC A;  1N6C A;  2CHW A;  4RG9 A;  3GZ2 A;  1KLX A;  5CCL A;  4AEZ C;  3ZGQ A;  1HO8 A;  2QPW A;  3P2B A;  4C9B B;  3RK6 A;  3MO2 A;  3I3N A;  1HU3 A;  2GRM A;  1PEG A;  4GU5 A;  5C2Y A;  3URZ A;  4N3B A;  4YPA A;  3LY7 A;  2WXK A;  3U64 A;  1XGW A;  4QEN A;  1HXI A;  3QWP A;  4J8D A;  3S8P A;  3M5A A;  5LSZ A;  2CG3 A;  2L9B A;  5ENN A;  1WY6 A;  3RRM B;  1UJK A;  1H19 A;  1UN8 A;  3OPE A;  3CST A;  1SZA A;  3AS5 A;  1ELK A;  4G11 A;  4F7A A;  4HXI A;  2XGO A;  1W3B A;  1XQH A;  2WMN A;  3D9I A;  4BT8 A;  3MGB A;  2YHE A;  1INZ A;  5JJT A;  5AYW D;  3P1U A;  2UY1 B;  2IGQ A;  4DJA A;  2FUL A;  3HYM B;  2Y4T A;  2X6K A;  3JYS A;  3D9O A;  3LPZ A;  1H3I A;  2C0M A;  4FLB A;  5FWQ A;  5LSX A;  3MA5 A;  4UQY A;  3I4R B;  1MHQ A;  3RU0 A;  3RO2 A;  3S7J A;  3TAX A;  5F59 A;  3CVV A;  3EHM A;  4C0M A;  2WM9 A;  1DVP A;  3GZS A;  4KZC A;  2X3M A;  1MQS A;  4I43 A;  3HHM A;  4HVB A;  3FUK A;  3RAY A;  4NQ0 A;  4JVS A;  3ENE A;  4JEU A;  4Y6W A;  3ASG A;  1DNP A;  5E75 A;  2MHK A;  3TXM A;  3EP0 A;  4XE0 A;  4FLH A;  5M72 A;  2HYZ A;  3CR3 A;  4I9C A;  4PS3 A;  4W9R A;  5G05 C;  4BFR A;  5CCM A;  1UN9 A;  2PM7 A;  1HH8 A;  3VTX A;  1Y8M A;  4AP2 A;  4QEO A;  2IOS A;  3PEV B;  1E8Z A;  4LUN U;  4TRQ A;  4RVB A;  5AEN A;  5BV1 A;  4UI9 J;  3PUK A;  4C1Q A;  4OVV A;  4AVX A;  4L1B A;  2BUG A;  2MOW A;  3SBS A;  4O6F A;  5D0O D;  5JHB A;  2WXM A;  2PL2 A;  3EDT B;  3F9W A;  5J90 A;  3D3M A;  3UT8 A;  4CEM A;  2WXN A;  4GAA A;  2I1J A;  5EX0 A;  2V0P A;  3FFL A;  3HDX A;  1B89 A;  4AU7 A;  4N2Q A;  2J4B A;  2W5Y A;  2WQ6 A;  3LVQ E;  4HOR A;  2X6H A;  3GW4 A;  4EEC A;  4U0U A;  3ZHE B;  3PNL B;  4LRZ A;  1IQR A;  3FU5 A;  1P5Q A;  3ZW3 A;  4XI0 A;  3FUI A;  3ZFW A;  4G1T A;  2KCK A;  2OVB A;  4MLP A;  3OOI A;  4MI0 A;  1E96 B;  2L0I A;  4JL0 A;  1MT6 A;  1A17 A;  1LF8 A;  2VGY A;  4URK A;  2YIN A;  4V3I A;  3M56 A;  2NSZ A;  2AXU A;  5HQ8 A;  2J9Q A;  3CVP A;  3FTS A;  4WND A;  4MS6 A;  3L16 A;  4AIF A;  3DPD A;  3PVL A;  4GYO A;  5ANR A;  3S7B A;  3LKU A;  5EKQ D;  2P58 C;  3M53 A;  1JWF A;  3FUJ A;  4B8C B;  2PQN A;  3G2S A;  3PUJ A;  4B0Z A;  4N3C A;  1H6K A;  3ULQ A;  2VTB B;  1IHG A;  2CHX A;  4KVM A;  5LP0 A;  5CMY A;  2RFI A;  2V5F A;  3L08 A;  3QAQ A;  3CQC B;  1PC2 A;  3SF4 A;  2YHC A;  3AS8 A;  5ANL A;  2KZT A;  1FVH A;  2NC9 A;  3EHN A;  5FQ7 A;  4LEU A;  3ZHE A;  2CHZ A;  2PQR A;  4G23 A;  4B8A A;  4BY6 A;  3BEE A;  4J7I A;  3LY8 A;  5DBK A;  4WWP A;  3UT4 A;  3UMV A;  4FAD A;  3OXG A;  3QDN A;  4GA2 A;  3U4T A;  3FUL A;  4DPR A;  2AXZ A;  4I1M A;  4H7Y A;  1MVX A;  3F9Z A;  2V8S E;  3M57 A;  3FWV A;  4H7X A;  1HF8 A;  1N3J A;  1QQE A;  4ILG A;  3B7T A;  1NP7 A;  3FEY A;  1H0A A;  3FUN A;  5KJL A;  3KMT A;  2I1K A;  2R59 A;  2XPY A;  4L7T A;  4LCT A;  3U66 A;  5JIY A;  2OND A;  4BTA A;  2VTB A;  3FTW A;  4GMJ A;  2J07 A;  4IRU A;  4FP7 A;  5FT9 A;  5G04 J;  1O9S A;  1H2V C;  4I17 A;  3VTY A;  4GZC A;  3FUH A;  3FDH A;  3LS8 A;  4KMO A;  3CIA A;  4J7F A;  2KZT B;  4Q96 A;  3IKO B;  3QWW A;  1PY1 A;  3ZPJ A;  3IHX A;  5EG2 A;  3B7S A;  4AY6 A;  3FPD A;  5AIJ A;  2C2L A;  3FTX A;  4BX8 A;  4XI9 A;  2BTD A;  2YNQ A;  4P29 A;  4AM9 A;  4GZD A;  1X5B A;  1QNF A;  2UWJ G;  3T8M A;  4BX9 A;  2LAI A;  4FUL A;  2BQZ A;  5KJK A;  1L5J A;  1MVH A;  3Q5M A;  3VLE A;  3QKY A;  3UPV A;  2LSV A;  4YVQ C;  3FTU A;  2CG2 A;  5AYF A;  4PS8 A;  3S7F A;  3SFZ A;  4YPE A;  3RQ4 A;  4AOF A;  1IQU A;  1N6A A;  1U3D A;  1ML9 A;  3FEX A;  4ANX A;  4FC8 A;  2J4D A;  4I1A A;  3GZ1 A;  3PE4 A;  3M58 A;  2E0I A;  4KXK B;  3ZYK A;  2WXG A;  2GW1 A;  2Y3A A;  3KD7 A;  3ESK A;  3O48 A;  3Q47 B;  3CK7 A;  3CQG B;  4O30 A;  2WXR A;  3TXN A;  2RG8 A;  2NXP A;  1VDY A;  3NZS A;  4XZ4 A;  3L13 A;  3O4Z A;  4KVO A;  4OVU A;  5FTP A;  2HM8 A;  4JW1 A;  3LDZ A;  3QOU A;  3PRE A;  4GZ6 A;  5KJM A;  4J8O A;  1NA0 A;  3LCA A;  4Y6C A;  4AY5 A;  2A5U A;  3MO0 A;  4GCO A;  2LO6 A;  3S7D A;  4QEP A;  4CCA A;  3I5P A;  3CHP A;  3CV0 A;  3JQ1 A;  4JPS A;  5DIZ A;  1EDU A;  2WPV A;  3FU0 A;  5J08 A;  5KJN A;  4YNP A;  5T5G A;  3KMA A;  4HOS A;  2VSY A;  1TJF A;  1E7V A;  2FI7 A;  4F53 A;  3CVN A;  2FF4 A;  4BSX A;  2WXL A;  3IV0 A;  3TGO A;  3MZL B;  3F9X A;  3FTV A;  3MV3 B;  3APF A;  4WWN A;  3NF1 A;  5LFA A;  3ML9 A;  4BT9 A;  3FTZ A;  2WQH A;  4G24 A;  5CPR B;  2X38 A;  3OTN A;  3ZYM A;  1KT0 A;  3ZYQ A;  3IHV A;  4BWR A;  2WXF A;  3D9M A;  5A7D B;  2J49 A;  3OS5 A;  1HFA A;  4K03 A;  3IHY A;  4E47 A;  3D9N A;  2Y4U A;  4MI5 A;  4EZJ A;  2ION A;  3UQ3 A;  3AU5 A;  2GGF A;  5T4Y A;  4WNF A;  2WXJ A;  4U04 A;  4GML A;  3D9L A;  3SI5 A;  3SD5 A;  3ZEF A;  1HG2 A;  1HS6 A;  4JZY A;  4JEH A;  4WUY A;  2BF0 X;  2L6J A;  4A1S A;  3F9Y A;  5FQ8 A;  2EQX A;  5ARF A;  4A55 A;  4DK5 A;  4EPZ A;  4IJ8 A;  5LCW C;  3L17 A;  4PH4 B;  3L22 A;  4XKB A;  2IOL A;  2J09 A;  2QY7 A;  4JXT A;  5FQ6 A;  5BPP A;  4J8E A;  4ANW A;  3CVX A;  2F69 A;  3FUD A;  1N52 A;  3HVE B;  5G55 A;  4D10 C;  5FZQ A;  1E8Y A;  2IU1 A;  4IN3 B;  2AXV A;  4K0R A;  5A6C A;  2XCB A;  3HNA A;  3SNX A;  4CGW A;  4WNE A;  1Z3Y A;  4AXH A;  4KYO B;  1TJC A;  4ILH B;  4JDS A;  5FJY A;  1GW6 A;  5T8I A;  3RRU A;  2X6I A;  5BNW A;  5TTF A;  3KMJ A;  3FUF A;  4CRW A;  3D9P A;  3NQP A;  4QFV A;  2AWI A;  3RKV A;  3GYZ A;  3RRN B;  4L23 A;  4ILI A;  3JUI A;  4U0S A;  3RO3 A;  1XNF A;  1UW4 B;  4JHK A;  1PAQ A;  3PDN A;  2I2O A;  4PUC A;  4CDR A;  1HX8 A;  4YND A;  3CLJ A;  1JPL A;  1NA3 A;  4CT0 A;  5BUZ A;  2JLB A;  3AU4 A;  3TJP A;  4GB9 A;  4HFG A;  3CHM A;  3KEZ A;  2VGX A;  3T5V A;  2VSX E;  4GPK A;  3QB2 A;  3NZU A;  3T5X A;  5JIN A;  3ESL A;  3FUE A;  2CFU A;  4WNG A;  4ACL A;  4APF A;  1SQM A;  4ME2 A;  3TG5 A;  3ZN3 A;  3FHE A;  4Q69 A;  3G2V A;  3U3W A;  4TV3 A;  4ANV A;  3MKQ B;  4NVQ A;  4EZL A;  3MO5 A;  2OV8 A;  4RG6 A;  3RIB A;  3FH7 A;  4G2V A;  3CEQ A;  3L6A A;  4GYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...