5KJNA

Smyd2 in complex with az506
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 147
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjnA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjnA01
4WNGA 4G26A 4G24A 5ARGA 3HYMB 5JIYA 5BT1A 3M5AA 4E47A 4N3AA 5TH7A 5FTPA 2PQNA 2KCKA 1E96B 1TJCA 5CCMA 4XI9A 4B94A 2NC9A 3AS5A 2Y4UA 1N6AA 1KT1A 2L6JA 3LKUA 4EQFA 5CPRB 3QDNA 2VSNA 1WM5A 2FBNA 3RJVA 5FT9A 2RFIA 2XGOA 4KBQA 4AY5A 1ML9A 5G05C 2XCBA 1ZU2A 3Q4AB 3GZ1A 3O48A 3OOIA 3LY9A 3M56A 3FWVA 4YPAA 3NF1A 3S7FA 2JV0A 4H7XA 3ZPJA 5KJNA 3CKBA 4HOQA 5D0QD 2FO7A 3VTXA 4JA7A 4IN3B 2LSUA 2UWJG 4BT8A 3EDTB 4HORA 5G05J 5HI7A 4FMUA 2F69A 5D0OD 4UQZA 4BWRA 4ABNA 2V5FA 1H3IA 3GW4A 1ELWA 4J0UA 2ONDA 3AS8A 3CBOA 3DB5A 1PEGA 4G25A 5LCWC 1MVHA 4GYWA 3CV0A 3CVNA 3WXXA 2E2EA 5F5EA 5DIZA 4N5CA 4I9CA 4GYOA 2KATA 1FCHA 4AY6A 3IEGA 5LCWJ 1A17A 3ZN3A 4HOSA 3MO0A 5CCLA 2J9QA 2QFCA 2PZIA 4J7IA 4I1AA 3URZA 3IHXA 5FJYA 3FFLA 5EG2A 2Q7FA 5EX3A 4APOA 4NQ0A 4GZ6A 1P5QA 3EP0A 4GYYA 1OUVA 4I17A 3OXGA 3Q5MA 4G23A 1HZ4A 2Y4TA 3PDNA 4YPEA 4A1SA 3K5KA 4UI9J 4MI0A 4QENA 3TG4A 4O30A 1IHGA 2P58C 2OOEA 3N71A 2O8JA 3CKCA 4G1TA 4GA1A 3MV2B 1B89A 3MKRA 3RKVA 4BTBA 5EKQD 3ASHA 3MEKA 1ZBPA 4N3BA 3Q47B 3CEQA 3F9YA 3UQ3A 1QQEA 3CVQA 5AYFA 1PC2A 4W9RA 2VSYA 3ESKA 5T0KA 4N2SA 5F6LA 2AVPA 1WAO1 1YA0A 5ARFA 4UQYA 3KMAA 2C0MA 3MO5A 2XEVA 5CHEE 1O9SA 2C0LA 2C2LA 4YNPA 4AU7A 3LY8A 4Z4PA 1ELRA 3F9ZA 3KMTA 5KJKA 3VTYA 3R9AB 4JHRA 3ASDA 2MHKA 5G04C 2W5YA 3FPDA 1MVXA 4UQXA 4GCOA 4J8EA 5BW8C 1KLXA 4BUPA 5FZSA 3U3WA 4J83A 3QOUA 1KT0A 4QEOA 4U07A 3OPEA 3SZ7A 3M53A 2I6HA 4GZ5A 2IFUA 4YVOA 2VGYA 3VUZA 3CVLA 5G04J 2KCVA 2BUGA 4WNFA 2FI7A 3LPZA 1IYGA 5T0MA 5LSZA 3QWWA 3ASGA 3AS4A 2DBAA 4F3VA 3M54A 4JDSA 3ASFA 3GZ2A 4N2QA 3M57A 3PE3A 4UI9C 5LSXA 3TGOA 4AM9A 4WNEA 1XQHA 3TAXA 4JLGA 3RO3A 3RJWA 4J8FA 3DALA 1Y8MA 3Q49B 4GCNA 4HOTA 3RAYA 1NZNA 4YPUA 4GA2A 4RG6A 2HR2A 4CGVA 1XNFA 5F6KC 1MT6A 3KAEA 2JLBA 4ME2A 4U0ZA 3KD7A 4LDGA 2HYZA 5AYWD 3LYAA 3ULQA 4I9EA 4U04A 3PE4A 3JYSA 4KXKB 4GZ3A 5EX0A 2HO1A 4U0UA 2YQ8A 3CBPA 3QWVA 3FP3A 5JJ6A 4XI0A 1W3BA 3S7BA 4J8DA 4NVQA 1MUFA 3BEEA 5HQ8A 4NRHB 2IF4A 2KCLA 5F59A 4BT9A 2LSVA 3QKYA 2W5ZA 2XCCA 5FZQA 4IJDA 3OS5A 4RZ0A 3RIBA 4H7YA 3S8PA 4Y6CA 3ZFWA 5BNWA 3MV3B 5A7DB 3SWCA 2XPIA 2VGXB 4WNDA 2IGQA 4CGWA 4J7FA 3M59A 2UY1B 2R5SA 3CBMA 3CK9A 2BQZA 5C1DA 3ZGQA 5JINA 4U0SA 4CDRA 4BTAA 3LY7A 2VQ2A 2VYIA 3U4TA 3KMJA 3CK8A 2PQRA 3S7DA 3SF4A 3K9IA 3F9XA 3VV0A 2WQHA 3RQ4A 2KC7A 5M72A 4I51A 3HNAA 3UPVA 3ZHEA 2GW1A 5TTFA 4UI9K 3RU0A 1HH8A 4AIFA 3MA5A 4GA0A 1HXIA 1ZKKA 5JJTA 3UUXA 1N3JA 4NJ5A 3SW9A 4C1QA 4IJ8A 2XGMA 4G2VA 3Q15A 3F9WA 1N6CA 3QWPA 5DBKA 5JJ7A 2G46A 4H12A 1QZ2A 3TG5A 4YNMA 4JA9A 4HOUA 2XGSA 5JJ0A 4MI5A 4O6FA 4QEPA 5TEGA 4RG9A 3KS2A 3GYZA 4JL0A 2WPVA 4I2ZA 4YNDA 4GPKA 2VGXA 3BO5A 5JHNA 3S7JA 4KYOB 3OXLA 2UY1A 4WUYA 3MO2A 4J8OA 2QPWA 5T5GA 3CK7A 4N39A 4LEUA 1NA3A 3E4BA 3M58A 2YHCA 4I2WA 3OXFA 4Y6WA 4N3CA 3ZHEB 2FEZA 5KJMA 5A6CA 5FZRA 3M55A 2LNIA 2PL2A 3CVPA 2FF4A 3RO2A 5KJLA 1NA0A 3LCAA 4XIFA 2R3AA 4YVQC
chains in the Genus database with same CATH superfamily
3BUAA 2ETCA 3DPYA 2RD0A 4I6GA 4WWNA 3DSWA 3FDHA 2KCKA 1TNUA 5CCMA 1Q2ZA 2WXPA 2AXVA 5ENRD 2NC9A 3AS5A 4HI9A 2Y4UA 2M63A 1KT1A 2L6JA 4MBGA 1E8WA 4DLQA 2KXPC 3CVXA 2WXFA 3QDNA 3IBEA 5ENQD 4ANXA 3R7QA 4QFVA 1ML9A 3LS8A 5G05C 1UG3A 4EHMA 3GZ1A 3HXFA 3M56A 2B6CA 3NF1A 2JV0A 3ZPJA 3CKBA 2LO6A 1JCRA 3FTWA 3TWRA 2FO7A 3HXCA 4JHJA 4IN3B 4YDWA 3OTNA 3ASNE 3ENEA 4A1GA 4DUIA 5CERB 2F69A 1E7UA 1SA5A 4I6JA 3SGHA 2DIWA 4BWRA 3ZW3A 4FLHA 3FU3A 1HG5A 3T8KA 3EHRA 4J0UA 2ONDA 2BTDA 4G8KA 3CBOA 3PZ1A 1PEGA 5LCWC 5ANLA 2OVBA 5A23A 4TUUA 1WDYA 2E2EA 2MYOA 3HVEA 4PS3A 4RLYA 3PZ2A 2F37A 1N4SA 1UJJA 3MZLB 5C2YA 3TWXA 4AY6A 1JCSA 3UT7A 3NAWA 1TN8A 3FU0A 4HOSA 1HU3A 2QFCA 4I1AA 3URZA 3ISMC 1ELKA 2DCPA 2Q7FA 4GZ6A 3VLFA 2DZNA 2H6IA 3DXMG 2XZDG 1HZ4A 2BEDA 2XEEA 3CQCB 3AAAC 3D9PA 5EYPF 3V31A 4YPEA 1SA4A 1K3ZD 3K5KA 4AV7A 3J5PA 5EIDA 1S70B 4ANVA 2B0OE 1IHGA 3N71A 2O8JA 3HDXA 4O60A 3D9KA 3MV2B 4HNAD 3HVEB 2CG3A 3B7SA 3RKVA 4N3BA 3Q47B 3EJNA 5FWQA 2L0IA 3CVQA 4OVVA 2WB2A 3ESKA 1LTXA 3D9OA 2AVPA 4JHKA 2OV8A 5AENA 4GZCA 4UQYA 2L6BA 2XEVA 4LNGA 4I1OB 1H0AA 2C2LA 4AU7A 3L13A 5D2MC 1ELRA 2X6IA 4TXPA 3V79K 3F9ZA 5KJKA 4AVXA 3R9AB 1JPLA 5HKPA 4IRUA 4J8EA 1IQRA 4HI8A 1TNOA 1BD8A 3ZRHA 1KT0A 4LCTA 4U07A 4G11A 3SZ7A 4URKA 3LVRE 4TXQA 3DPDA 2KCVA 2PM7A 4AOFA 1K1AA 1OCCE 2H6HA 5LSZA 4OAVB 4I6EA 4CDMA 4TXRA 2DBAA 3EU9A 2V8SE 4A55A 4N2QA 3M57A 1JWFA 1SZAA 2IO2C 3UIOC 3QK0A 3RJWA 3TWTA 1Y8MA 4GCNA 3RAYA 1NZNA 4YPUA 5AQBA 1U2VG 1DNPA 5G2NA 3Q7AA 1TNZA 3PH0C 5F6KC 4UWLA 1MT6A 5AN8A 1Z5SC 2JLBA 4ANWA 3LYAA 3PE4A 4ILIA 4GZ3A 3E32A 3CBPA 5JJ6A 3FH5A 1EF1C 3ONKA 5HQ8A 3ZEFA 3FEXA 1O1SA 2LSVA 2YINA 1OT8A 3OS5A 3RIBA 4H7YA 3S8PA 3ZFWA 3JCKC 5BNWA 3JUIA 4HBDA 3UM0A 3PRZA 4J8SA 2KBXA 2L0TB 4XE0A 4QQIA 3ZXPA 3PZ3A 3D9LA 2XENA 3M59A 5JINA 3S2AA 4CDRA 4I43A 2NXPA 4B0ZA 1MQSA 1N95A 3QB2A 3SHFA 1FT2A 2BKGA 3ZHEA 4KMOA 4HB5A 4AIFA 4DX2A 3ZIMA 3D9NA 2ZU6B 4B89A 3HXDA 3Q7FA 4GA0A 3CHPA 3G2UA 3JXJA 4Z68A 1U3CA 3TWSA 4EBAG 2CFZA 3BU8A 2I2OA 4DJAA 2ZISA 2OEWA 3CIAA 4IJ8A 5JMND 4P29A 3Q15A 4HQDA 3F9WA 3B13A 4JEHA 4CRWA 5JJ7A 4H12A 4JA9A 2QC9A 1WG0A 4B8AA 4DX5D 4GTPA 4QEPA 4RG9A 4YNDA 4NURA 1LF8A 4BESA 3TWVA 4AP2A 3S7JA 1H2TC 2V0PA 4WUYA 2QPWA 4LNBA 3CK7A 1OCRE 3APCA 5JA4D 2YHCA 5FQ6A 4HRMB 4XX5A 2R03A 1MZCA 4GAAA 3APFA 3ZHEB 1MHQA 2WXLA 2LNIA 4DI4A 3RO2A 5KJLA 2PNNA 5CMYA 3LJ3A 3LCAA 3HXEA 2QYJA 1Z3YA 4G26A 4G24A 5JIYA 1H19A 2NSZA 5B1AE 4E47A 3LJNA 2PQNA 2VSOE 1H6PA 1TJCA 3C72A 2CHZA 4EZJA 4K5BA 3ML9A 4GZDA 4IULA 3APDA 1N6AA 5CPRB 2VSNA 3CVWA 1TN6A 3P2BA 3B7BA 1U3DA 5FT9A 4OYSA 2XCBA 2VSXE 4J7WA 5H7PA 3C98A 2RG8A 2EIJE 4PS8A 3MKQA 4MS6A 3TXNA 3I4GA 3EDTB 3UM3A 3FUJA 2F0YA 3SBSA 2WQ7A 4L23A 1ZB1A 3TXMA 2AXZA 3L82A 4UWHA 2P2CP 4UQZA 4LNUD 4YDYA 2RFMA 3DEPA 3CSTA 4F53A 4G25A 1MVHA 2XS8A 4FJZA 3WXXA 5T8IA 5DIZA 3ABME 4I9CA 2LXMA 2ZXWE 4GYOA 5BXOA 4RSYA 5KCMA 3AJIA 3IEGA 3FU6A 3UKRG 1A17A 4JEUA 1TR4A 3MKQB 5BPPA 2J9QA 1YMPA 1EDUA 3FFLA 3FUFA 1V55E 2J08A 1OUVA 4I17A 3B7UX 4G23A 3HHMA 5AAOA 2Y4TA 3E34A 3FH7A 4GMLA 2GRNB 3P1UA 4MI0A 2WVIA 3TG4A 4GPMA 2R02A 4ACLA 2A5EA 4BTBA 5EKQD 3ASHA 1ZBPA 4BSZB 3UQ3A 4YDEA 1QQEA 4EZLA 2R05A 4MLPA 4W9RA 3FUHA 4ZHBA 5F6LA 1WAO1 3D3MA 4PDXA 1YA0A 2WXGA 5ARFA 4R7LA 2EIME 2C0MA 1S63A 4C9BB 2F8XK 1NFIE 4FC8A 3CHQA 3FULA 3MGBA 5ENNA 3ZUVB 2ILRA 1S64A 3LY8A 4Z4PA 4AEZC 2J09A 2XHEA 3EUVA 4JHRA 3FPDA 4BETA 1OXJA 4UQXA 4GCOA 4MRUA 1KLXA 5FZSA 3U3WA 4B93B 3QOUA 2IO3C 4QEOA 3ABKE 2IFUA 4YVOA 2VGYA 4GTTA 3NBNB 4LRZA 3SY2A 2AJAA 4WNFA 3DRAA 2FI7A 3IKOB 3RRUA 3FTZA 2WM9A 3QAQA 3LPZA 3CHSA 2X6FA 4DRXE 5T0MA 3WG7E 2X6KA 2OCCE 4DX6D 3Q73A 4L7TA 4OVUA 4F3VA 4XEIG 3L08A 3PZ4A 1OCOE 2J49A 1E90A 3ESLA 1SZ9A 3ZYMA 3GZ2A 1UOHA 2LUHA 4UI9C 5LSXA 3TGOA 4WNEA 2P9KG 1XQHA 2P9SG 3TAXA 3FUKA 4JD2G 4BSXA 3LDZA 4HOTA 3Q9NC 5CRVA 4GTOA 2HR2A 5B3SE 3RRMB 4U0ZA 3KD7A 2I9CA 4CYMD 4KXKB 5LP0A 4JZYA 3SFXA 2GRRB 2GRLA 3BEEA 4L1BA 4APFA 4NRHB 4FP7A 5CBNA 3FH8A 3QKYA 2XCCA 1AWCB 3CHRA 3LEWA 4HRNA 4JXTA 1QYMA 3R9MA 4DX7D 3SWCA 2LXLA 1H6OA 2X38A 4Q96A 4WNDA 1X5BA 4CGWA 2DYRE 3NOCD 5ENOD 2R5SA 3CK9A 4EZKA 1O1RA 4K03A 2EQXA 1WY6A 3U4TA 3CK8A 2PQRA 3SF4A 3K9IA 2V4HC 3RQ4A 2KC7A 4U8VD 2X6JA 2YHEA 3UPVA 3HNAA 2GW1A 4UI9K 3RU0A 1HH8A 4HVBA 5BXUA 4TUMA 3DXKG 1E8XA 4DLOA 5EIBE 5CBOA 3AG4E 4LSZE 2J8SD 1HXIA 5LOZA 4NJ5A 2XQ0A 3SW9A 4C1QA 4BERA 4HLEA 3NQPA 2ETAA 2WXOA 4GB9A 1Z3XA 1N6CA 2EINE 4KVMA 2G46A 4E85A 4YNMA 5CECB 4HOUA 2XGSA 1MX4A 4MI5A 4O6FA 1KPSB 4JL0A 2WPVA 1N52A 4B8CB 5JHNA 4KYOB 3OXLA 2JEKA 1JUQA 4RQIA 2J07A 4O1PA 5T5GA 4N39A 1NA3A 3E4BA 3TL5A 4I2WA 3C3OA 4GTRA 4K5CA 3CHOA 4O1OA 3OXFA 4L2YA 1OWOA 4Y6WA 1UJKA 4N3CA 2DWZA 4K0RA 5JHBA 5KJMA 5A6CA 5FZRA 3M55A 3OAWA 4GMJA 2FF4A 5FIOA 3CVUA 1NA0A 4FLBA 4XIFA 2RFAA 2F8YA 4WNGA 2H6FA 4C0MA 3FU5A 3LVQE 1N4PA 4BFRA 5TH7A 4I1MA 3UT4A 4U8HA 3FTSA 2IOLA 4GTMA 4BX9A 4KZCA 3CVYA 3RK6A 2XS1A 3LKUA 1IHBA 2FBNA 3RJVA 1K1BA 3VLDA 2XGOA 4KBQA 3Q4AB 1YCSB 3GZSA 3O48A 3OOIA 3FWVA 3FUIA 4YPAA 5T3RA 3S7FA 3L9TA 3CVVA 3FTYA 1N4RA 4HOQA 2A5UA 2LSUA 3UX4A 2QYUA 3C3RA 5HI7A 1HFAA 4JB8P 1N94A 4FMUA 2J4DA 5D0OD 2ZIRA 1UN9A 4ABNA 1EPUA 2A4ZA 2J4BA 3MX3A 2ETBA 3CV0A 1OWPA 3KSLA 2RKKA 1IXVA 1BLXB 1TJFA 1FCHA 1N0RA 2OVFA 3IV0A 3KSQA 1EYHA 3ZN3A 3BQOA 3UM2A 3IHVA 4E6HA 2R17C 3IHXA 5EG2A 2NYJA 1OWLA 2GROB 3AG2E 4NQ0A 1P5QA 4LERA 4JVSA 4PH4B 3OXGA 3MJWA 2KM4A 4KZ0A 2Y1LE 3KEZA 3QNKA 5ENSD 1MX2A 3PDNA 1HE8A 2AW6A 4TRQA 2XRZA 4EPZA 4O30A 1MX6A 4BEPA 3CKCA 4GA1A 5KNHD 1H2VC 1B89A 1RZ4A 3MKRA 2P9PG 3F9YA 3C3QA 1AP7A 1DVPA 5AYFA 1JCQA 1PC2A 4N2SA 4HRLA 1SW6A 3FUEA 4AXHA 5FQ8A 5CRUA 2FULA 3EIJA 5EILA 2C0LA 1NI1A 3PUKA 4CDNA 4YNPA 3FHEA 5EYLA 4Q94A 2IY0C 3KMTA 3AU5A 3ML8A 2WXHA 2W5YA 2MHKA 3JXIA 1MVXA 1D9SA 2KZTA 3NZSA 4WWPA 4J83A 4CT0A 3OPEA 2IOSA 3IXEA 3ASOE 3T5XA 1OCZE 4GZ5A 3VLEA 3CVLA 1E7VA 5G04J 2WQ6A 2BUGA 5T4YA 5ITZF 5KBAA 3I5PA 3FTXA 1IYGA 3D9MA 3QWWA 2IU1A 4WAFA 2WXQA 4C0EA 3Q78A 3AS4A 3ZYKA 5AIJA 3M54A 5FINA 4FJYA 2LAHA 4JDSA 3SI5A 3ASFA 3Q79A 3DBSA 3L16A 3HXBA 3PE3A 4CT4A 1JWGA 2QY7A 3ZU7B 1K8KG 3RO3A 3DALA 1H6KA 5E76A 1A5EA 2V5QC 2KZTB 4GA2A 4RG6A 4FHJA 3KAEA 3W9GA 4DI3A 4DX1A 4ME2A 2OEVA 4LDGA 3B7RL 2HYZA 4Q69A 5AYWD 3ULQA 2ZGDA 4I9EA 4U04A 3JYSA 2WMOA 4GU5A 2HO1A 2YQ8A 3FP3A 1W3BA 4F6RD 5FQ4A 2WXNA 3X2QE 2IF4A 4F1SA 5F59A 4BT9A 3JQ1A 2R59A 3E33A 4IJDA 4RZ0A 2WXKA 4Y6CA 4XKBA 2MOWA 3G2WA 4GTVA 4CCAA 3EU5A 2WMNA 2XPIA 1DCQA 2VGXB 1TNYA 3SFZA 3TWQA 2IGQA 2MRIA 2UY1B 1FT1A 3J5QB 5C1DA 3PZDA 3ZGQA 2DZOA 4U0SA 4BTAA 3AG3E 1TN7A 3LY7A 5AQAA 3S7DA 3CR3A 3DWLG 3R7RA 5M72A 4I51A 3QJZA 5TTFA 4PUCA 5E75A 5IY5E 1V54E 3MA5A 2CHXA 5KWDA 1N4QA 2IJGX 1QBQA 3EIQC 3G2TA 1NP7A 1HO8A 2X3MA 1UN8A 5JJTA 3BG1B 1N3JA 2XGMA 4G2VA 3D9JA 4JPSA 3ZKJA 3QWPA 3PNLB 1QZ2A 2WXMA 2DYSE 3V2OA 5JJ0A 4L9PA 3UTMA 2WXJA 3GYZA 2L9BA 1TEZA 5CEAA 1N9AA 4LUNU 1XGWA 3SFYA 3F6QA 4U95D 3W9FA 3M58A 2Y69E 3SBTB 1FPPA 4F7AA 1HS6A 1SVXA 3UIPC 2FEZA 1GW6A 1VDYA 3CVPA 1IQUA 3MYVA 3U64A 1FVHA 4U63A 2R3AA 5ARGA 3HYMB 4ILGA 5AJDA 5BT1A 3M5AA 4N3AA 5FTPA 1E96B 4TV3A 1L5JA 3UXGA 4XI9A 4KT6B 4B94A 3JQ0A 3EHMA 3Q75A 4YDOA 4EQFA 5AQ7A 1WM5A 2E0IA 1TNBA 3JUEA 2RFIA 2FO1E 4AY5A 5EN5D 2GRMA 2IONA 4U8YD 1ZU2A 3IHYA 3RSEG 4GTQA 3LY9A 4HLLA 3CHMA 4G8LA 4H7XA 5KJNA 5D0QD 3CSFA 2GRPB 3VTXA 3FUDA 3PEVB 3FY4A 4JA7A 2UWJG 4BT8A 4HORA 5G05J 4N5QA 3SQVA 3ABLE 4JW1A 4XZ4A 2HM8A 2V5FA 1H3IA 3B95A 3GW4A 1ELWA 3E30A 3TJPA 3UINC 3KEAA 4FULA 3AS8A 3DB5A 4GYWA 3B7TA 3CVNA 5LFAA 5F5EA 3ZXSA 4N5CA 4A63B 1N11A 5BV0A 2X6HA 2KATA 5HS0A 4RVBA 3Q9UC 4X8QA 3PS6A 5LCWJ 5KNGA 3MO0A 5CCLA 4BY6A 4EECA 2HE0A 2PZIA 4J7IA 1BPOA 5FJYA 3HRAA 5EX3A 4APOA 5AARA 3EP0A 4GYYA 4ILHB 2DVWA 2IEJA 2WXIA 3Q5MA 3CGHA 4ANUA 5EDSA 3DSVA 2I1KA 3UI2A 5CEDB 1S0PA 2P9UG 2VJ8A 4A1SA 3ZVVA 4UI9J 4M3OA 3CLJA 4FU3A 5AJLA 4QENA 3HG0D 2P58C 2OOEA 4G1TA 2R2LA 3DEOA 1NL4A 2I1JA 3L22A 5ANRA 2Y3AA 3TWWA 5CMWA 3MEKA 2XRYA 1IKND 3RRNB 3CEQA 2V4LA 3TWUA 3RAUA 3FTVA 4PS7A 1E8ZA 3PREA 4C48B 2VSYA 1D8DA 3D9HA 5T0KA 2P9LG 3E37A 3KMAA 4BX8A 1N54A 3MO5A 5CHEE 2IQCA 1QNFA 1O9SA 4MKTA 1RW2A 5LX8A 1H2UA 4HS2A 4UUCA 3FEYA 3V2XA 1KZPA 1OWNA 4GMRA 2VGEA 5FQ7A 3VTYA 5G04C 3ASDA 3DSSA 4JC8A 5BW8C 4BUPA 1LD7A 2P9IG 1HG2A 2QZAA 1Z6TA 1PY1A 3L6AA 4IYPA 3O4ZA 3M53A 2I6HA 4ATGA 1HF8A 3UMVA 3VUZA 3DSUA 3AG1E 3UT8A 4ACKA 4F1PA 4UWFA 2XPZA 3FUNA 4UWKA 4FA6A 3U66A 1UW4B 3NZUA 4GTSA 4K5AB 1BI8B 4KVOA 4ZFHA 2GRQB 4UWGA 3ASGA 4DK5A 1DC2A 3PUJA 3UKUG 1PAQA 4HFGA 4OAUC 4AM9A 1FVFA 4JLGA 4J8FA 3D9IA 3Q49B 2BKKB 5BUZA 3DSTA 2VTBA 2XZTG 4DPRA 1N0QA 1MJ0A 1XNFA 2EIKE 3PNTB 4CGVA 3EHNA 4LG6A 5AQ9A 3T5VA 3BG0B 3UM1A 4A3VA 3QARA 5EX0A 4ATZD 4U0UA 1OWMA 3QWVA 4XI0A 4CEMA 2CHWA 3S7BA 1HX8A 3AU4A 4J8DA 4NVQA 1MUFA 3QC1A 4AJWA 3I4RB 1MYOA 2BF0X 2KCLA 3MCXA 2W5ZA 5FZQA 1OY3D 4WWOA 4NIKA 2JABA 3FUMA 2XPYA 3MV3B 2CG2A 4J8YA 1Y6IA 5A7DB 2AWIA 3ONLA 2AXUA 2PM6A 1BI7B 2GGFA 4U96D 4J7FA 1O5MA 1TYQG 3CBMA 3SD5A 2BQZA 3G2VA 4FHKA 2VTBB 5ENTD 1G3NB 2VQ2A 2VYIA 3T8MA 4A3TA 3KMJA 3F9XA 3VV0A 2WQHA 3CQGB 5BV1A 3ZYLA 4J6IA 3FTUA 3PEUB 2H6GA 3EHQA 3I3NA 5B1BE 2Y0BG 2P9NG 3NOGD 1BU9A 1ZKKA 4L2LA 5JHAA 3UUXA 3SNXA 1YYHA 1X81A 4NACA 3L54A 4HXIA 2WXRA 5G55A 3ZNGA 5HRYA 1D8EA 5DBKA 5D66A 4M7CA 3TG5A 3L17A 4XKCA 3ULYA 4D10C 3NB2A 3G2SA 3HIZA 5TEGA 3KS2A 4EBAA 4I2ZA 3ULEG 4GPKA 2LAIA 2VGXA 3C5RA 2ZGGA 3BO5A 1KZOA 3ZYQA 4U7EB 3T9KA 2UY1A 3PVLA 3MO2A 4J8OA 4CZ2D 3U9WA 2EILE 4LEUA 2XEHA 3SO8A 3V30A 1O1TA 1INZA 5J90A 5J08A 2CFUA 3LXUX 4FADA 2YNQA 4V3IA 2PL2A 1LD8A 3DSXA 1SQMA 5ENPD 1E8YA 1DCEA 4YVQC
chains in the Genus database with same CATH topology
4WNGA 4C0MA 1Z3YA 3FU5A 4G24A 2RD0A 4G26A 4I6GA 3HYMB 4WWNA 5ARGA 4ILGA 5JIYA 3LVQE 1H19A 2NSZA 5AJDA 4BFRA 5BT1A 3M5AA 4E47A 4N3AA 5TH7A 5FTPA 2PQNA 2VSOE 3FDHA 2KCKA 1E96B 4I1MA 1TJCA 4TV3A 3UT4A 1L5JA 4U8HA 5CCMA 4XI9A 3FTSA 2WXPA 4KT6B 2IOLA 2CHZA 4EZJA 2AXVA 3ML9A 4B94A 4BX9A 2NC9A 3AS5A 3JQ0A 4KZCA 3CVYA 4GZDA 4IULA 3EHMA 3RK6A 3APDA 2Y4UA 2M63A 1KT1A 2L6JA 4DLQA 1E8WA 3LKUA 1N6AA 3CVXA 2WXFA 4EQFA 5CPRB 3QDNA 2VSNA 3IBEA 3CVWA 1WM5A 3P2BA 2FBNA 4ANXA 3RJVA 1U3DA 5FT9A 2E0IA 4OYSA 3R7QA 3VLDA 2RFIA 2XGOA 4KBQA 4QFVA 4AY5A 1ML9A 3LS8A 5G05C 2GRMA 2IONA 2XCBA 2VSXE 1UG3A 1ZU2A 3Q4AB 3GZSA 3GZ1A 3IHYA 3O48A 3OOIA 3LY9A 3M56A 3FWVA 3FUIA 3NF1A 5T3RA 3S7FA 4YPAA 2JV0A 3CHMA 4H7XA 3ZPJA 3C98A 3FTYA 3CVVA 5KJNA 2RG8A 3CKBA 4HOQA 2LO6A 5D0QD 3FTWA 3CSFA 2A5UA 4PS8A 3MKQA 2FO7A 3FUDA 4JHJA 3VTXA 4MS6A 3PEVB 3FY4A 4JA7A 3TXNA 4IN3B 2LSUA 3UX4A 3OTNA 2UWJG 4BT8A 3I4GA 3EDTB 3ENEA 3FUJA 4HORA 4A1GA 5G05J 1HFAA 5HI7A 3SBSA 2WQ7A 4L23A 3TXMA 4FMUA 2J4DA 5D0OD 2F69A 1E7UA 4I6JA 2AXZA 3SGHA 4JW1A 4UWHA 2DIWA 4UQZA 4BWRA 3ZW3A 4XZ4A 1UN9A 4ABNA 2HM8A 4FLHA 2V5FA 1EPUA 3FU3A 1H3IA 1HG5A 3GW4A 1ELWA 4J0UA 2A4ZA 3TJPA 2ONDA 2J4BA 3MX3A 2BTDA 3CSTA 4FULA 3AS8A 3CBOA 3DB5A 4F53A 1PEGA 4G25A 5LCWC 1MVHA 4GYWA 3B7TA 3CV0A 3CVNA 5ANLA 2OVBA 4FJZA 3WXXA 4TUUA 5A23A 5LFAA 5T8IA 2E2EA 5F5EA 5DIZA 1OWPA 3ZXSA 4N5CA 4I9CA 3HVEA 4PS3A 5BV0A 2X6HA 4GYOA 2KATA 1TJFA 1UJJA 1FCHA 4RVBA 3MZLB 2OVFA 4RSYA 5C2YA 3IV0A 5KCMA 4AY6A 1EYHA 3UT7A 3IEGA 3FU6A 3PS6A 5LCWJ 1A17A 4JEUA 3FU0A 3ZN3A 4HOSA 3MO0A 5CCLA 1HU3A 4BY6A 4EECA 3IHVA 3MKQB 4E6HA 5BPPA 2J9QA 2QFCA 2PZIA 4J7IA 4I1AA 2R17C 3URZA 3IHXA 1EDUA 1BPOA 5FJYA 3FFLA 1ELKA 3FUFA 5EG2A 2DCPA 1OWLA 2Q7FA 5EX3A 4APOA 4NQ0A 4GZ6A 3VLFA 1P5QA 3EP0A 4GYYA 2J08A 4LERA 4ILHB 4JVSA 4PH4B 1OUVA 4I17A 3OXGA 2WXIA 3MJWA 3Q5MA 3B7UX 4G23A 2KM4A 1HZ4A 3CGHA 4ANUA 5EDSA 4KZ0A 2I1KA 3CQCB 3KEZA 3HHMA 3QNKA 3D9PA 2Y4TA 1S0PA 2VJ8A 3FH7A 3PDNA 4YPEA 1HE8A 4A1SA 4GMLA 3ZVVA 4AV7A 3P1UA 4M3OA 2AW6A 4UI9J 3CLJA 3K5KA 4FU3A 4TRQA 4MI0A 2XRZA 5AJLA 4ANVA 4EPZA 4QENA 2WVIA 3TG4A 4O30A 1IHGA 2P58C 2OOEA 3N71A 2O8JA 3HDXA 3CKCA 4G1TA 4GA1A 3D9KA 3MV2B 2I1JA 3L22A 5ANRA 1H2VC 4ACLA 3HVEB 2Y3AA 1B89A 3MKRA 2CG3A 3B7SA 5CMWA 3RKVA 4BTBA 5EKQD 3ASHA 3MEKA 1ZBPA 2XRYA 3RRNB 4N3BA 3Q47B 3CEQA 3EJNA 2V4LA 3UQ3A 3F9YA 5FWQA 2L0IA 3FTVA 1DVPA 1QQEA 3CVQA 4EZLA 5AYFA 1PC2A 4PS7A 1E8ZA 4MLPA 4OVVA 3PREA 2WB2A 4W9RA 2VSYA 3FUHA 3ESKA 5T0KA 4N2SA 5F6LA 3D9OA 2AVPA 1WAO1 3D3MA 4JHKA 4PDXA 2OV8A 1YA0A 2WXGA 4GZCA 5ARFA 3FUEA 4UQYA 4AXHA 5AENA 5FQ8A 4R7LA 4BX8A 3KMAA 1N54A 2C0MA 4C9BB 2FULA 3EIJA 3MO5A 2XEVA 5CHEE 1QNFA 2IQCA 1O9SA 4FC8A 4I1OB 4MKTA 1H0AA 3CHQA 5LX8A 1H2UA 3FULA 2C0LA 3MGBA 4HS2A 3PUKA 2C2LA 5ENNA 4CDNA 2ILRA 4YNPA 3FHEA 3FEYA 4AU7A 1OWNA 3LY8A 3L13A 4Q94A 4Z4PA 1ELRA 2X6IA 3F9ZA 4AEZC 2J09A 3KMTA 5FQ7A 3AU5A 2XHEA 5KJKA 3ML8A 2WXHA 4AVXA 3VTYA 3R9AB 4JHRA 3ASDA 2MHKA 1JPLA 5G04C 2W5YA 1MVXA 3FPDA 4UQXA 4GCOA 4IRUA 4J8EA 2KZTA 4JC8A 1IQRA 5BW8C 4MRUA 1KLXA 3NZSA 4BUPA 5FZSA 3U3WA 4WWPA 4J83A 3QOUA 4CT0A 3ZRHA 1HG2A 1KT0A 4LCTA 1Z6TA 1PY1A 4QEOA 4U07A 3OPEA 2IOSA 3L6AA 4IYPA 4G11A 3SZ7A 3O4ZA 3T5XA 3M53A 2I6HA 4ATGA 4URKA 3LVRE 1HF8A 2IFUA 4GZ5A 4YVOA 2VGYA 3UMVA 3VUZA 4LRZA 3VLEA 3CVLA 3DPDA 1E7VA 3UT8A 4ACKA 5G04J 2KCVA 2WQ6A 2BUGA 2PM7A 4UWFA 4WNFA 5T4YA 4AOFA 2FI7A 3IKOB 3RRUA 2XPZA 3FTZA 2WM9A 3FUNA 3LPZA 3QAQA 4UWKA 4FA6A 3U66A 3I5PA 1UW4B 3CHSA 2X6FA 3FTXA 3NZUA 1IYGA 4KVOA 5T0MA 5LSZA 2X6KA 3D9MA 2IU1A 3QWWA 4WAFA 4UWGA 2WXQA 3ASGA 4L7TA 4I6EA 4C0EA 4CDMA 3AS4A 2DBAA 4OVUA 4DK5A 3ZYKA 3PUJA 4F3VA 5AIJA 3L08A 3M54A 2J49A 4FJYA 2LAHA 4JDSA 2V8SE 1E90A 3ESLA 1SZ9A 3ZYMA 4A55A 3ASFA 3GZ2A 3SI5A 1PAQA 3DBSA 3L16A 4HFGA 4N2QA 3PE3A 1JWFA 3M57A 4UI9C 1SZAA 4CT4A 3TGOA 5LSXA 4AM9A 4WNEA 1JWGA 2QY7A 1XQHA 1FVFA 3QK0A 3TAXA 4JLGA 3RO3A 3FUKA 3RJWA 4J8FA 3D9IA 4BSXA 3DALA 1Y8MA 3Q49B 3LDZA 4GCNA 1H6KA 4HOTA 5E76A 3RAYA 1NZNA 5BUZA 2KZTB 2VTBA 4YPUA 1DNPA 4GA2A 5G2NA 4DPRA 4RG6A 2HR2A 3PH0C 3PNTB 1XNFA 4CGVA 4UWLA 5F6KC 3RRMB 3EHNA 1MT6A 4FHJA 3KAEA 2JLBA 4DI3A 3T5VA 3BG0B 4ME2A 4U0ZA 3KD7A 4LDGA 3B7RL 4A3VA 4ANWA 2HYZA 4Q69A 5AYWD 3LYAA 3ULQA 4I9EA 2I9CA 4U04A 3PE4A 3JYSA 4KXKB 3QARA 4GZ3A 4ILIA 5EX0A 2WMOA 4GU5A 2HO1A 5LP0A 4U0UA 2YQ8A 3CBPA 1OWMA 3QWVA 4JZYA 3FP3A 5JJ6A 4XI0A 3FH5A 1EF1C 4CEMA 1W3BA 2CHWA 1HX8A 3S7BA 3AU4A 3ONKA 4J8DA 1MUFA 3QC1A 4NVQA 2GRLA 3BEEA 4AJWA 4L1BA 5HQ8A 3I4RB 4APFA 3ZEFA 4NRHB 3FEXA 5FQ4A 4FP7A 2WXNA 4F1SA 2IF4A 2BF0X 2KCLA 3MCXA 5F59A 4BT9A 3FH8A 3JQ1A 2LSVA 2R59A 3QKYA 2XCCA 2YINA 5FZQA 3CHRA 3LEWA 4WWOA 2W5ZA 3OS5A 4IJDA 4RZ0A 4JXTA 3RIBA 3FUMA 2XPYA 4H7YA 2WXKA 3S8PA 4Y6CA 4XKBA 3ZFWA 3JCKC 5BNWA 3MV3B 3JUIA 2CG2A 3PRZA 4J8SA 1Y6IA 2MOWA 5A7DB 3G2WA 4CCAA 3SWCA 2L0TB 4XE0A 2AWIA 3ONLA 2WMNA 2XPIA 2AXUA 2PM6A 2X38A 2VGXB 4Q96A 2GGFA 4WNDA 3SFZA 2IGQA 1X5BA 2MRIA 4CGWA 4J7FA 3D9LA 3M59A 2UY1B 2R5SA 3CBMA 3SD5A 3CK9A 4EZKA 2BQZA 5C1DA 3G2VA 3PZDA 4FHKA 3ZGQA 2VTBB 5JINA 4K03A 4U0SA 3S2AA 4CDRA 4BTAA 2EQXA 4I43A 2NXPA 4B0ZA 3LY7A 1WY6A 2VQ2A 2VYIA 3T8MA 3U4TA 3CK8A 1MQSA 4A3TA 2PQRA 3S7DA 3KMJA 3SF4A 3K9IA 3F9XA 3CR3A 3VV0A 2WQHA 3RQ4A 3CQGB 5BV1A 3ZYLA 2KC7A 3QB2A 3SHFA 3R7RA 4J6IA 5M72A 4I51A 3FTUA 2X6JA 2YHEA 3UPVA 3HNAA 3QJZA 2GW1A 3PEUB 4UI9K 3ZHEA 4KMOA 5TTFA 3RU0A 1HH8A 4PUCA 5E75A 4AIFA 4HVBA 3ZIMA 1E8XA 3MA5A 4DLOA 3D9NA 3I3NA 2ZU6B 4B89A 2CHXA 4GA0A 3CHPA 2IJGX 3EIQC 3G2UA 3G2TA 1HXIA 1ZKKA 1NP7A 1HO8A 1U3CA 4EBAG 2X3MA 5LOZA 2CFZA 1UN8A 4L2LA 5JHAA 5JJTA 3BG1B 3UUXA 1N3JA 4NJ5A 3SNXA 2I2OA 4DJAA 2XQ0A 3SW9A 3CIAA 4C1QA 4NACA 4HLEA 3L54A 4HXIA 4IJ8A 2WXRA 5G55A 3NQPA 2XGMA 4G2VA 4P29A 3D9JA 3Q15A 2WXOA 4GB9A 1Z3XA 3F9WA 3B13A 4JPSA 1N6CA 3QWPA 4JEHA 3PNLB 4CRWA 5DBKA 5JJ7A 4KVMA 2G46A 4H12A 1QZ2A 2WXMA 3TG5A 3L17A 4XKCA 4E85A 4YNMA 4JA9A 4D10C 4HOUA 2XGSA 5JJ0A 3G2SA 4B8AA 3HIZA 4O6FA 4MI5A 5TEGA 4QEPA 4RG9A 3KS2A 2WXJA 3GYZA 2L9BA 4JL0A 2WPVA 4I2ZA 4EBAA 1TEZA 4YNDA 4GPKA 2LAIA 2VGXA 1N52A 1LF8A 4NURA 4LUNU 4B8CB 3BO5A 1XGWA 4AP2A 3S7JA 5JHNA 3ZYQA 4KYOB 1H2TC 3OXLA 2JEKA 1JUQA 2UY1A 3PVLA 2V0PA 4WUYA 2J07A 3MO2A 4J8OA 2QPWA 5T5GA 3U9WA 3CK7A 4N39A 3APCA 4LEUA 1NA3A 3E4BA 3TL5A 2YHCA 4I2WA 3M58A 3SBTB 3CHOA 3OXFA 1INZA 5FQ6A 4L2YA 1OWOA 4F7AA 4XX5A 4Y6WA 1UJKA 5J90A 4N3CA 1HS6A 4GAAA 5J08A 2CFUA 3APFA 3LXUX 3ZHEB 2FEZA 4K0RA 5JHBA 1MHQA 2YNQA 4FADA 1GW6A 2WXLA 5KJMA 5A6CA 5FZRA 3M55A 1VDYA 2LNIA 2PL2A 3CVPA 3OAWA 4V3IA 4GMJA 2FF4A 3RO2A 1IQUA 4DI4A 3MYVA 5KJLA 3CVUA 1SQMA 3U64A 1FVHA 5CMYA 1NA0A 4U63A 4FLBA 3LJ3A 3LCAA 1E8YA 4XIFA 2R3AA 4YVQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNG A;  4G26 A;  4G24 A;  5ARG A;  3HYM B;  5JIY A;  5BT1 A;  3M5A A;  4E47 A;  4N3A A;  5TH7 A;  5FTP A;  2PQN A;  2KCK A;  1E96 B;  1TJC A;  5CCM A;  4XI9 A;  4B94 A;  2NC9 A;  3AS5 A;  2Y4U A;  1N6A A;  1KT1 A;  2L6J A;  3LKU A;  4EQF A;  5CPR B;  3QDN A;  2VSN A;  1WM5 A;  2FBN A;  3RJV A;  5FT9 A;  2RFI A;  2XGO A;  4KBQ A;  4AY5 A;  1ML9 A;  5G05 C;  2XCB A;  1ZU2 A;  3Q4A B;  3GZ1 A;  3O48 A;  3OOI A;  3LY9 A;  3M56 A;  3FWV A;  4YPA A;  3NF1 A;  3S7F A;  2JV0 A;  4H7X A;  3ZPJ A;  5KJN A;  3CKB A;  4HOQ A;  5D0Q D;  2FO7 A;  3VTX A;  4JA7 A;  4IN3 B;  2LSU A;  2UWJ G;  4BT8 A;  3EDT B;  4HOR A;  5G05 J;  5HI7 A;  4FMU A;  2F69 A;  5D0O D;  4UQZ A;  4BWR A;  4ABN A;  2V5F A;  1H3I A;  3GW4 A;  1ELW A;  4J0U A;  2OND A;  3AS8 A;  3CBO A;  3DB5 A;  1PEG A;  4G25 A;  5LCW C;  1MVH A;  4GYW A;  3CV0 A;  3CVN A;  3WXX A;  2E2E A;  5F5E A;  5DIZ A;  4N5C A;  4I9C A;  4GYO A;  2KAT A;  1FCH A;  4AY6 A;  3IEG A;  5LCW J;  1A17 A;  3ZN3 A;  4HOS A;  3MO0 A;  5CCL A;  2J9Q A;  2QFC A;  2PZI A;  4J7I A;  4I1A A;  3URZ A;  3IHX A;  5FJY A;  3FFL A;  5EG2 A;  2Q7F A;  5EX3 A;  4APO A;  4NQ0 A;  4GZ6 A;  1P5Q A;  3EP0 A;  4GYY A;  1OUV A;  4I17 A;  3OXG A;  3Q5M A;  4G23 A;  1HZ4 A;  2Y4T A;  3PDN A;  4YPE A;  4A1S A;  3K5K A;  4UI9 J;  4MI0 A;  4QEN A;  3TG4 A;  4O30 A;  1IHG A;  2P58 C;  2OOE A;  3N71 A;  2O8J A;  3CKC A;  4G1T A;  4GA1 A;  3MV2 B;  1B89 A;  3MKR A;  3RKV A;  4BTB A;  5EKQ D;  3ASH A;  3MEK A;  1ZBP A;  4N3B A;  3Q47 B;  3CEQ A;  3F9Y A;  3UQ3 A;  1QQE A;  3CVQ A;  5AYF A;  1PC2 A;  4W9R A;  2VSY A;  3ESK A;  5T0K A;  4N2S A;  5F6L A;  2AVP A;  1WAO 1;  1YA0 A;  5ARF A;  4UQY A;  3KMA A;  2C0M A;  3MO5 A;  2XEV A;  5CHE E;  1O9S A;  2C0L A;  2C2L A;  4YNP A;  4AU7 A;  3LY8 A;  4Z4P A;  1ELR A;  3F9Z A;  3KMT A;  5KJK A;  3VTY A;  3R9A B;  4JHR A;  3ASD A;  2MHK A;  5G04 C;  2W5Y A;  3FPD A;  1MVX A;  4UQX A;  4GCO A;  4J8E A;  5BW8 C;  1KLX A;  4BUP A;  5FZS A;  3U3W A;  4J83 A;  3QOU A;  1KT0 A;  4QEO A;  4U07 A;  3OPE A;  3SZ7 A;  3M53 A;  2I6H A;  4GZ5 A;  2IFU A;  4YVO A;  2VGY A;  3VUZ A;  3CVL A;  5G04 J;  2KCV A;  2BUG A;  4WNF A;  2FI7 A;  3LPZ A;  1IYG A;  5T0M A;  5LSZ A;  3QWW A;  3ASG A;  3AS4 A;  2DBA A;  4F3V A;  3M54 A;  4JDS A;  3ASF A;  3GZ2 A;  4N2Q A;  3M57 A;  3PE3 A;  4UI9 C;  5LSX A;  3TGO A;  4AM9 A;  4WNE A;  1XQH A;  3TAX A;  4JLG A;  3RO3 A;  3RJW A;  4J8F A;  3DAL A;  1Y8M A;  3Q49 B;  4GCN A;  4HOT A;  3RAY A;  1NZN A;  4YPU A;  4GA2 A;  4RG6 A;  2HR2 A;  4CGV A;  1XNF A;  5F6K C;  1MT6 A;  3KAE A;  2JLB A;  4ME2 A;  4U0Z A;  3KD7 A;  4LDG A;  2HYZ A;  5AYW D;  3LYA A;  3ULQ A;  4I9E A;  4U04 A;  3PE4 A;  3JYS A;  4KXK B;  4GZ3 A;  5EX0 A;  2HO1 A;  4U0U A;  2YQ8 A;  3CBP A;  3QWV A;  3FP3 A;  5JJ6 A;  4XI0 A;  1W3B A;  3S7B A;  4J8D A;  4NVQ A;  1MUF A;  3BEE A;  5HQ8 A;  4NRH B;  2IF4 A;  2KCL A;  5F59 A;  4BT9 A;  2LSV A;  3QKY A;  2W5Z A;  2XCC A;  5FZQ A;  4IJD A;  3OS5 A;  4RZ0 A;  3RIB A;  4H7Y A;  3S8P A;  4Y6C A;  3ZFW A;  5BNW A;  3MV3 B;  5A7D B;  3SWC A;  2XPI A;  2VGX B;  4WND A;  2IGQ A;  4CGW A;  4J7F A;  3M59 A;  2UY1 B;  2R5S A;  3CBM A;  3CK9 A;  2BQZ A;  5C1D A;  3ZGQ A;  5JIN A;  4U0S A;  4CDR A;  4BTA A;  3LY7 A;  2VQ2 A;  2VYI A;  3U4T A;  3KMJ A;  3CK8 A;  2PQR A;  3S7D A;  3SF4 A;  3K9I A;  3F9X A;  3VV0 A;  2WQH A;  3RQ4 A;  2KC7 A;  5M72 A;  4I51 A;  3HNA A;  3UPV A;  3ZHE A;  2GW1 A;  5TTF A;  4UI9 K;  3RU0 A;  1HH8 A;  4AIF A;  3MA5 A;  4GA0 A;  1HXI A;  1ZKK A;  5JJT A;  3UUX A;  1N3J A;  4NJ5 A;  3SW9 A;  4C1Q A;  4IJ8 A;  2XGM A;  4G2V A;  3Q15 A;  3F9W A;  1N6C A;  3QWP A;  5DBK A;  5JJ7 A;  2G46 A;  4H12 A;  1QZ2 A;  3TG5 A;  4YNM A;  4JA9 A;  4HOU A;  2XGS A;  5JJ0 A;  4MI5 A;  4O6F A;  4QEP A;  5TEG A;  4RG9 A;  3KS2 A;  3GYZ A;  4JL0 A;  2WPV A;  4I2Z A;  4YND A;  4GPK A;  2VGX A;  3BO5 A;  5JHN A;  3S7J A;  4KYO B;  3OXL A;  2UY1 A;  4WUY A;  3MO2 A;  4J8O A;  2QPW A;  5T5G A;  3CK7 A;  4N39 A;  4LEU A;  1NA3 A;  3E4B A;  3M58 A;  2YHC A;  4I2W A;  3OXF A;  4Y6W A;  4N3C A;  3ZHE B;  2FEZ A;  5KJM A;  5A6C A;  5FZR A;  3M55 A;  2LNI A;  2PL2 A;  3CVP A;  2FF4 A;  3RO2 A;  5KJL A;  1NA0 A;  3LCA A;  4XIF A;  2R3A A;  4YVQ C; 
#chains in the Genus database with same CATH topology
 3BUA A;  2ETC A;  3DPY A;  2RD0 A;  4I6G A;  4WWN A;  3DSW A;  3FDH A;  2KCK A;  1TNU A;  5CCM A;  1Q2Z A;  2WXP A;  2AXV A;  5ENR D;  2NC9 A;  3AS5 A;  4HI9 A;  2Y4U A;  2M63 A;  1KT1 A;  2L6J A;  4MBG A;  1E8W A;  4DLQ A;  2KXP C;  3CVX A;  2WXF A;  3QDN A;  3IBE A;  5ENQ D;  4ANX A;  3R7Q A;  4QFV A;  1ML9 A;  3LS8 A;  5G05 C;  1UG3 A;  4EHM A;  3GZ1 A;  3HXF A;  3M56 A;  2B6C A;  3NF1 A;  2JV0 A;  3ZPJ A;  3CKB A;  2LO6 A;  1JCR A;  3FTW A;  3TWR A;  2FO7 A;  3HXC A;  4JHJ A;  4IN3 B;  4YDW A;  3OTN A;  3ASN E;  3ENE A;  4A1G A;  4DUI A;  5CER B;  2F69 A;  1E7U A;  1SA5 A;  4I6J A;  3SGH A;  2DIW A;  4BWR A;  3ZW3 A;  4FLH A;  3FU3 A;  1HG5 A;  3T8K A;  3EHR A;  4J0U A;  2OND A;  2BTD A;  4G8K A;  3CBO A;  3PZ1 A;  1PEG A;  5LCW C;  5ANL A;  2OVB A;  5A23 A;  4TUU A;  1WDY A;  2E2E A;  2MYO A;  3HVE A;  4PS3 A;  4RLY A;  3PZ2 A;  2F37 A;  1N4S A;  1UJJ A;  3MZL B;  5C2Y A;  3TWX A;  4AY6 A;  1JCS A;  3UT7 A;  3NAW A;  1TN8 A;  3FU0 A;  4HOS A;  1HU3 A;  2QFC A;  4I1A A;  3URZ A;  3ISM C;  1ELK A;  2DCP A;  2Q7F A;  4GZ6 A;  3VLF A;  2DZN A;  2H6I A;  3DXM G;  2XZD G;  1HZ4 A;  2BED A;  2XEE A;  3CQC B;  3AAA C;  3D9P A;  5EYP F;  3V31 A;  4YPE A;  1SA4 A;  1K3Z D;  3K5K A;  4AV7 A;  3J5P A;  5EID A;  1S70 B;  4ANV A;  2B0O E;  1IHG A;  3N71 A;  2O8J A;  3HDX A;  4O60 A;  3D9K A;  3MV2 B;  4HNA D;  3HVE B;  2CG3 A;  3B7S A;  3RKV A;  4N3B A;  3Q47 B;  3EJN A;  5FWQ A;  2L0I A;  3CVQ A;  4OVV A;  2WB2 A;  3ESK A;  1LTX A;  3D9O A;  2AVP A;  4JHK A;  2OV8 A;  5AEN A;  4GZC A;  4UQY A;  2L6B A;  2XEV A;  4LNG A;  4I1O B;  1H0A A;  2C2L A;  4AU7 A;  3L13 A;  5D2M C;  1ELR A;  2X6I A;  4TXP A;  3V79 K;  3F9Z A;  5KJK A;  4AVX A;  3R9A B;  1JPL A;  5HKP A;  4IRU A;  4J8E A;  1IQR A;  4HI8 A;  1TNO A;  1BD8 A;  3ZRH A;  1KT0 A;  4LCT A;  4U07 A;  4G11 A;  3SZ7 A;  4URK A;  3LVR E;  4TXQ A;  3DPD A;  2KCV A;  2PM7 A;  4AOF A;  1K1A A;  1OCC E;  2H6H A;  5LSZ A;  4OAV B;  4I6E A;  4CDM A;  4TXR A;  2DBA A;  3EU9 A;  2V8S E;  4A55 A;  4N2Q A;  3M57 A;  1JWF A;  1SZA A;  2IO2 C;  3UIO C;  3QK0 A;  3RJW A;  3TWT A;  1Y8M A;  4GCN A;  3RAY A;  1NZN A;  4YPU A;  5AQB A;  1U2V G;  1DNP A;  5G2N A;  3Q7A A;  1TNZ A;  3PH0 C;  5F6K C;  4UWL A;  1MT6 A;  5AN8 A;  1Z5S C;  2JLB A;  4ANW A;  3LYA A;  3PE4 A;  4ILI A;  4GZ3 A;  3E32 A;  3CBP A;  5JJ6 A;  3FH5 A;  1EF1 C;  3ONK A;  5HQ8 A;  3ZEF A;  3FEX A;  1O1S A;  2LSV A;  2YIN A;  1OT8 A;  3OS5 A;  3RIB A;  4H7Y A;  3S8P A;  3ZFW A;  3JCK C;  5BNW A;  3JUI A;  4HBD A;  3UM0 A;  3PRZ A;  4J8S A;  2KBX A;  2L0T B;  4XE0 A;  4QQI A;  3ZXP A;  3PZ3 A;  3D9L A;  2XEN A;  3M59 A;  5JIN A;  3S2A A;  4CDR A;  4I43 A;  2NXP A;  4B0Z A;  1MQS A;  1N95 A;  3QB2 A;  3SHF A;  1FT2 A;  2BKG A;  3ZHE A;  4KMO A;  4HB5 A;  4AIF A;  4DX2 A;  3ZIM A;  3D9N A;  2ZU6 B;  4B89 A;  3HXD A;  3Q7F A;  4GA0 A;  3CHP A;  3G2U A;  3JXJ A;  4Z68 A;  1U3C A;  3TWS A;  4EBA G;  2CFZ A;  3BU8 A;  2I2O A;  4DJA A;  2ZIS A;  2OEW A;  3CIA A;  4IJ8 A;  5JMN D;  4P29 A;  3Q15 A;  4HQD A;  3F9W A;  3B13 A;  4JEH A;  4CRW A;  5JJ7 A;  4H12 A;  4JA9 A;  2QC9 A;  1WG0 A;  4B8A A;  4DX5 D;  4GTP A;  4QEP A;  4RG9 A;  4YND A;  4NUR A;  1LF8 A;  4BES A;  3TWV A;  4AP2 A;  3S7J A;  1H2T C;  2V0P A;  4WUY A;  2QPW A;  4LNB A;  3CK7 A;  1OCR E;  3APC A;  5JA4 D;  2YHC A;  5FQ6 A;  4HRM B;  4XX5 A;  2R03 A;  1MZC A;  4GAA A;  3APF A;  3ZHE B;  1MHQ A;  2WXL A;  2LNI A;  4DI4 A;  3RO2 A;  5KJL A;  2PNN A;  5CMY A;  3LJ3 A;  3LCA A;  3HXE A;  2QYJ A;  1Z3Y A;  4G26 A;  4G24 A;  5JIY A;  1H19 A;  2NSZ A;  5B1A E;  4E47 A;  3LJN A;  2PQN A;  2VSO E;  1H6P A;  1TJC A;  3C72 A;  2CHZ A;  4EZJ A;  4K5B A;  3ML9 A;  4GZD A;  4IUL A;  3APD A;  1N6A A;  5CPR B;  2VSN A;  3CVW A;  1TN6 A;  3P2B A;  3B7B A;  1U3D A;  5FT9 A;  4OYS A;  2XCB A;  2VSX E;  4J7W A;  5H7P A;  3C98 A;  2RG8 A;  2EIJ E;  4PS8 A;  3MKQ A;  4MS6 A;  3TXN A;  3I4G A;  3EDT B;  3UM3 A;  3FUJ A;  2F0Y A;  3SBS A;  2WQ7 A;  4L23 A;  1ZB1 A;  3TXM A;  2AXZ A;  3L82 A;  4UWH A;  2P2C P;  4UQZ A;  4LNU D;  4YDY A;  2RFM A;  3DEP A;  3CST A;  4F53 A;  4G25 A;  1MVH A;  2XS8 A;  4FJZ A;  3WXX A;  5T8I A;  5DIZ A;  3ABM E;  4I9C A;  2LXM A;  2ZXW E;  4GYO A;  5BXO A;  4RSY A;  5KCM A;  3AJI A;  3IEG A;  3FU6 A;  3UKR G;  1A17 A;  4JEU A;  1TR4 A;  3MKQ B;  5BPP A;  2J9Q A;  1YMP A;  1EDU A;  3FFL A;  3FUF A;  1V55 E;  2J08 A;  1OUV A;  4I17 A;  3B7U X;  4G23 A;  3HHM A;  5AAO A;  2Y4T A;  3E34 A;  3FH7 A;  4GML A;  2GRN B;  3P1U A;  4MI0 A;  2WVI A;  3TG4 A;  4GPM A;  2R02 A;  4ACL A;  2A5E A;  4BTB A;  5EKQ D;  3ASH A;  1ZBP A;  4BSZ B;  3UQ3 A;  4YDE A;  1QQE A;  4EZL A;  2R05 A;  4MLP A;  4W9R A;  3FUH A;  4ZHB A;  5F6L A;  1WAO 1;  3D3M A;  4PDX A;  1YA0 A;  2WXG A;  5ARF A;  4R7L A;  2EIM E;  2C0M A;  1S63 A;  4C9B B;  2F8X K;  1NFI E;  4FC8 A;  3CHQ A;  3FUL A;  3MGB A;  5ENN A;  3ZUV B;  2ILR A;  1S64 A;  3LY8 A;  4Z4P A;  4AEZ C;  2J09 A;  2XHE A;  3EUV A;  4JHR A;  3FPD A;  4BET A;  1OXJ A;  4UQX A;  4GCO A;  4MRU A;  1KLX A;  5FZS A;  3U3W A;  4B93 B;  3QOU A;  2IO3 C;  4QEO A;  3ABK E;  2IFU A;  4YVO A;  2VGY A;  4GTT A;  3NBN B;  4LRZ A;  3SY2 A;  2AJA A;  4WNF A;  3DRA A;  2FI7 A;  3IKO B;  3RRU A;  3FTZ A;  2WM9 A;  3QAQ A;  3LPZ A;  3CHS A;  2X6F A;  4DRX E;  5T0M A;  3WG7 E;  2X6K A;  2OCC E;  4DX6 D;  3Q73 A;  4L7T A;  4OVU A;  4F3V A;  4XEI G;  3L08 A;  3PZ4 A;  1OCO E;  2J49 A;  1E90 A;  3ESL A;  1SZ9 A;  3ZYM A;  3GZ2 A;  1UOH A;  2LUH A;  4UI9 C;  5LSX A;  3TGO A;  4WNE A;  2P9K G;  1XQH A;  2P9S G;  3TAX A;  3FUK A;  4JD2 G;  4BSX A;  3LDZ A;  4HOT A;  3Q9N C;  5CRV A;  4GTO A;  2HR2 A;  5B3S E;  3RRM B;  4U0Z A;  3KD7 A;  2I9C A;  4CYM D;  4KXK B;  5LP0 A;  4JZY A;  3SFX A;  2GRR B;  2GRL A;  3BEE A;  4L1B A;  4APF A;  4NRH B;  4FP7 A;  5CBN A;  3FH8 A;  3QKY A;  2XCC A;  1AWC B;  3CHR A;  3LEW A;  4HRN A;  4JXT A;  1QYM A;  3R9M A;  4DX7 D;  3SWC A;  2LXL A;  1H6O A;  2X38 A;  4Q96 A;  4WND A;  1X5B A;  4CGW A;  2DYR E;  3NOC D;  5ENO D;  2R5S A;  3CK9 A;  4EZK A;  1O1R A;  4K03 A;  2EQX A;  1WY6 A;  3U4T A;  3CK8 A;  2PQR A;  3SF4 A;  3K9I A;  2V4H C;  3RQ4 A;  2KC7 A;  4U8V D;  2X6J A;  2YHE A;  3UPV A;  3HNA A;  2GW1 A;  4UI9 K;  3RU0 A;  1HH8 A;  4HVB A;  5BXU A;  4TUM A;  3DXK G;  1E8X A;  4DLO A;  5EIB E;  5CBO A;  3AG4 E;  4LSZ E;  2J8S D;  1HXI A;  5LOZ A;  4NJ5 A;  2XQ0 A;  3SW9 A;  4C1Q A;  4BER A;  4HLE A;  3NQP A;  2ETA A;  2WXO A;  4GB9 A;  1Z3X A;  1N6C A;  2EIN E;  4KVM A;  2G46 A;  4E85 A;  4YNM A;  5CEC B;  4HOU A;  2XGS A;  1MX4 A;  4MI5 A;  4O6F A;  1KPS B;  4JL0 A;  2WPV A;  1N52 A;  4B8C B;  5JHN A;  4KYO B;  3OXL A;  2JEK A;  1JUQ A;  4RQI A;  2J07 A;  4O1P A;  5T5G A;  4N39 A;  1NA3 A;  3E4B A;  3TL5 A;  4I2W A;  3C3O A;  4GTR A;  4K5C A;  3CHO A;  4O1O A;  3OXF A;  4L2Y A;  1OWO A;  4Y6W A;  1UJK A;  4N3C A;  2DWZ A;  4K0R A;  5JHB A;  5KJM A;  5A6C A;  5FZR A;  3M55 A;  3OAW A;  4GMJ A;  2FF4 A;  5FIO A;  3CVU A;  1NA0 A;  4FLB A;  4XIF A;  2RFA A;  2F8Y A;  4WNG A;  2H6F A;  4C0M A;  3FU5 A;  3LVQ E;  1N4P A;  4BFR A;  5TH7 A;  4I1M A;  3UT4 A;  4U8H A;  3FTS A;  2IOL A;  4GTM A;  4BX9 A;  4KZC A;  3CVY A;  3RK6 A;  2XS1 A;  3LKU A;  1IHB A;  2FBN A;  3RJV A;  1K1B A;  3VLD A;  2XGO A;  4KBQ A;  3Q4A B;  1YCS B;  3GZS A;  3O48 A;  3OOI A;  3FWV A;  3FUI A;  4YPA A;  5T3R A;  3S7F A;  3L9T A;  3CVV A;  3FTY A;  1N4R A;  4HOQ A;  2A5U A;  2LSU A;  3UX4 A;  2QYU A;  3C3R A;  5HI7 A;  1HFA A;  4JB8 P;  1N94 A;  4FMU A;  2J4D A;  5D0O D;  2ZIR A;  1UN9 A;  4ABN A;  1EPU A;  2A4Z A;  2J4B A;  3MX3 A;  2ETB A;  3CV0 A;  1OWP A;  3KSL A;  2RKK A;  1IXV A;  1BLX B;  1TJF A;  1FCH A;  1N0R A;  2OVF A;  3IV0 A;  3KSQ A;  1EYH A;  3ZN3 A;  3BQO A;  3UM2 A;  3IHV A;  4E6H A;  2R17 C;  3IHX A;  5EG2 A;  2NYJ A;  1OWL A;  2GRO B;  3AG2 E;  4NQ0 A;  1P5Q A;  4LER A;  4JVS A;  4PH4 B;  3OXG A;  3MJW A;  2KM4 A;  4KZ0 A;  2Y1L E;  3KEZ A;  3QNK A;  5ENS D;  1MX2 A;  3PDN A;  1HE8 A;  2AW6 A;  4TRQ A;  2XRZ A;  4EPZ A;  4O30 A;  1MX6 A;  4BEP A;  3CKC A;  4GA1 A;  5KNH D;  1H2V C;  1B89 A;  1RZ4 A;  3MKR A;  2P9P G;  3F9Y A;  3C3Q A;  1AP7 A;  1DVP A;  5AYF A;  1JCQ A;  1PC2 A;  4N2S A;  4HRL A;  1SW6 A;  3FUE A;  4AXH A;  5FQ8 A;  5CRU A;  2FUL A;  3EIJ A;  5EIL A;  2C0L A;  1NI1 A;  3PUK A;  4CDN A;  4YNP A;  3FHE A;  5EYL A;  4Q94 A;  2IY0 C;  3KMT A;  3AU5 A;  3ML8 A;  2WXH A;  2W5Y A;  2MHK A;  3JXI A;  1MVX A;  1D9S A;  2KZT A;  3NZS A;  4WWP A;  4J83 A;  4CT0 A;  3OPE A;  2IOS A;  3IXE A;  3ASO E;  3T5X A;  1OCZ E;  4GZ5 A;  3VLE A;  3CVL A;  1E7V A;  5G04 J;  2WQ6 A;  2BUG A;  5T4Y A;  5ITZ F;  5KBA A;  3I5P A;  3FTX A;  1IYG A;  3D9M A;  3QWW A;  2IU1 A;  4WAF A;  2WXQ A;  4C0E A;  3Q78 A;  3AS4 A;  3ZYK A;  5AIJ A;  3M54 A;  5FIN A;  4FJY A;  2LAH A;  4JDS A;  3SI5 A;  3ASF A;  3Q79 A;  3DBS A;  3L16 A;  3HXB A;  3PE3 A;  4CT4 A;  1JWG A;  2QY7 A;  3ZU7 B;  1K8K G;  3RO3 A;  3DAL A;  1H6K A;  5E76 A;  1A5E A;  2V5Q C;  2KZT B;  4GA2 A;  4RG6 A;  4FHJ A;  3KAE A;  3W9G A;  4DI3 A;  4DX1 A;  4ME2 A;  2OEV A;  4LDG A;  3B7R L;  2HYZ A;  4Q69 A;  5AYW D;  3ULQ A;  2ZGD A;  4I9E A;  4U04 A;  3JYS A;  2WMO A;  4GU5 A;  2HO1 A;  2YQ8 A;  3FP3 A;  1W3B A;  4F6R D;  5FQ4 A;  2WXN A;  3X2Q E;  2IF4 A;  4F1S A;  5F59 A;  4BT9 A;  3JQ1 A;  2R59 A;  3E33 A;  4IJD A;  4RZ0 A;  2WXK A;  4Y6C A;  4XKB A;  2MOW A;  3G2W A;  4GTV A;  4CCA A;  3EU5 A;  2WMN A;  2XPI A;  1DCQ A;  2VGX B;  1TNY A;  3SFZ A;  3TWQ A;  2IGQ A;  2MRI A;  2UY1 B;  1FT1 A;  3J5Q B;  5C1D A;  3PZD A;  3ZGQ A;  2DZO A;  4U0S A;  4BTA A;  3AG3 E;  1TN7 A;  3LY7 A;  5AQA A;  3S7D A;  3CR3 A;  3DWL G;  3R7R A;  5M72 A;  4I51 A;  3QJZ A;  5TTF A;  4PUC A;  5E75 A;  5IY5 E;  1V54 E;  3MA5 A;  2CHX A;  5KWD A;  1N4Q A;  2IJG X;  1QBQ A;  3EIQ C;  3G2T A;  1NP7 A;  1HO8 A;  2X3M A;  1UN8 A;  5JJT A;  3BG1 B;  1N3J A;  2XGM A;  4G2V A;  3D9J A;  4JPS A;  3ZKJ A;  3QWP A;  3PNL B;  1QZ2 A;  2WXM A;  2DYS E;  3V2O A;  5JJ0 A;  4L9P A;  3UTM A;  2WXJ A;  3GYZ A;  2L9B A;  1TEZ A;  5CEA A;  1N9A A;  4LUN U;  1XGW A;  3SFY A;  3F6Q A;  4U95 D;  3W9F A;  3M58 A;  2Y69 E;  3SBT B;  1FPP A;  4F7A A;  1HS6 A;  1SVX A;  3UIP C;  2FEZ A;  1GW6 A;  1VDY A;  3CVP A;  1IQU A;  3MYV A;  3U64 A;  1FVH A;  4U63 A;  2R3A A;  5ARG A;  3HYM B;  4ILG A;  5AJD A;  5BT1 A;  3M5A A;  4N3A A;  5FTP A;  1E96 B;  4TV3 A;  1L5J A;  3UXG A;  4XI9 A;  4KT6 B;  4B94 A;  3JQ0 A;  3EHM A;  3Q75 A;  4YDO A;  4EQF A;  5AQ7 A;  1WM5 A;  2E0I A;  1TNB A;  3JUE A;  2RFI A;  2FO1 E;  4AY5 A;  5EN5 D;  2GRM A;  2ION A;  4U8Y D;  1ZU2 A;  3IHY A;  3RSE G;  4GTQ A;  3LY9 A;  4HLL A;  3CHM A;  4G8L A;  4H7X A;  5KJN A;  5D0Q D;  3CSF A;  2GRP B;  3VTX A;  3FUD A;  3PEV B;  3FY4 A;  4JA7 A;  2UWJ G;  4BT8 A;  4HOR A;  5G05 J;  4N5Q A;  3SQV A;  3ABL E;  4JW1 A;  4XZ4 A;  2HM8 A;  2V5F A;  1H3I A;  3B95 A;  3GW4 A;  1ELW A;  3E30 A;  3TJP A;  3UIN C;  3KEA A;  4FUL A;  3AS8 A;  3DB5 A;  4GYW A;  3B7T A;  3CVN A;  5LFA A;  5F5E A;  3ZXS A;  4N5C A;  4A63 B;  1N11 A;  5BV0 A;  2X6H A;  2KAT A;  5HS0 A;  4RVB A;  3Q9U C;  4X8Q A;  3PS6 A;  5LCW J;  5KNG A;  3MO0 A;  5CCL A;  4BY6 A;  4EEC A;  2HE0 A;  2PZI A;  4J7I A;  1BPO A;  5FJY A;  3HRA A;  5EX3 A;  4APO A;  5AAR A;  3EP0 A;  4GYY A;  4ILH B;  2DVW A;  2IEJ A;  2WXI A;  3Q5M A;  3CGH A;  4ANU A;  5EDS A;  3DSV A;  2I1K A;  3UI2 A;  5CED B;  1S0P A;  2P9U G;  2VJ8 A;  4A1S A;  3ZVV A;  4UI9 J;  4M3O A;  3CLJ A;  4FU3 A;  5AJL A;  4QEN A;  3HG0 D;  2P58 C;  2OOE A;  4G1T A;  2R2L A;  3DEO A;  1NL4 A;  2I1J A;  3L22 A;  5ANR A;  2Y3A A;  3TWW A;  5CMW A;  3MEK A;  2XRY A;  1IKN D;  3RRN B;  3CEQ A;  2V4L A;  3TWU A;  3RAU A;  3FTV A;  4PS7 A;  1E8Z A;  3PRE A;  4C48 B;  2VSY A;  1D8D A;  3D9H A;  5T0K A;  2P9L G;  3E37 A;  3KMA A;  4BX8 A;  1N54 A;  3MO5 A;  5CHE E;  2IQC A;  1QNF A;  1O9S A;  4MKT A;  1RW2 A;  5LX8 A;  1H2U A;  4HS2 A;  4UUC A;  3FEY A;  3V2X A;  1KZP A;  1OWN A;  4GMR A;  2VGE A;  5FQ7 A;  3VTY A;  5G04 C;  3ASD A;  3DSS A;  4JC8 A;  5BW8 C;  4BUP A;  1LD7 A;  2P9I G;  1HG2 A;  2QZA A;  1Z6T A;  1PY1 A;  3L6A A;  4IYP A;  3O4Z A;  3M53 A;  2I6H A;  4ATG A;  1HF8 A;  3UMV A;  3VUZ A;  3DSU A;  3AG1 E;  3UT8 A;  4ACK A;  4F1P A;  4UWF A;  2XPZ A;  3FUN A;  4UWK A;  4FA6 A;  3U66 A;  1UW4 B;  3NZU A;  4GTS A;  4K5A B;  1BI8 B;  4KVO A;  4ZFH A;  2GRQ B;  4UWG A;  3ASG A;  4DK5 A;  1DC2 A;  3PUJ A;  3UKU G;  1PAQ A;  4HFG A;  4OAU C;  4AM9 A;  1FVF A;  4JLG A;  4J8F A;  3D9I A;  3Q49 B;  2BKK B;  5BUZ A;  3DST A;  2VTB A;  2XZT G;  4DPR A;  1N0Q A;  1MJ0 A;  1XNF A;  2EIK E;  3PNT B;  4CGV A;  3EHN A;  4LG6 A;  5AQ9 A;  3T5V A;  3BG0 B;  3UM1 A;  4A3V A;  3QAR A;  5EX0 A;  4ATZ D;  4U0U A;  1OWM A;  3QWV A;  4XI0 A;  4CEM A;  2CHW A;  3S7B A;  1HX8 A;  3AU4 A;  4J8D A;  4NVQ A;  1MUF A;  3QC1 A;  4AJW A;  3I4R B;  1MYO A;  2BF0 X;  2KCL A;  3MCX A;  2W5Z A;  5FZQ A;  1OY3 D;  4WWO A;  4NIK A;  2JAB A;  3FUM A;  2XPY A;  3MV3 B;  2CG2 A;  4J8Y A;  1Y6I A;  5A7D B;  2AWI A;  3ONL A;  2AXU A;  2PM6 A;  1BI7 B;  2GGF A;  4U96 D;  4J7F A;  1O5M A;  1TYQ G;  3CBM A;  3SD5 A;  2BQZ A;  3G2V A;  4FHK A;  2VTB B;  5ENT D;  1G3N B;  2VQ2 A;  2VYI A;  3T8M A;  4A3T A;  3KMJ A;  3F9X A;  3VV0 A;  2WQH A;  3CQG B;  5BV1 A;  3ZYL A;  4J6I A;  3FTU A;  3PEU B;  2H6G A;  3EHQ A;  3I3N A;  5B1B E;  2Y0B G;  2P9N G;  3NOG D;  1BU9 A;  1ZKK A;  4L2L A;  5JHA A;  3UUX A;  3SNX A;  1YYH A;  1X81 A;  4NAC A;  3L54 A;  4HXI A;  2WXR A;  5G55 A;  3ZNG A;  5HRY A;  1D8E A;  5DBK A;  5D66 A;  4M7C A;  3TG5 A;  3L17 A;  4XKC A;  3ULY A;  4D10 C;  3NB2 A;  3G2S A;  3HIZ A;  5TEG A;  3KS2 A;  4EBA A;  4I2Z A;  3ULE G;  4GPK A;  2LAI A;  2VGX A;  3C5R A;  2ZGG A;  3BO5 A;  1KZO A;  3ZYQ A;  4U7E B;  3T9K A;  2UY1 A;  3PVL A;  3MO2 A;  4J8O A;  4CZ2 D;  3U9W A;  2EIL E;  4LEU A;  2XEH A;  3SO8 A;  3V30 A;  1O1T A;  1INZ A;  5J90 A;  5J08 A;  2CFU A;  3LXU X;  4FAD A;  2YNQ A;  4V3I A;  2PL2 A;  1LD8 A;  3DSX A;  1SQM A;  5ENP D;  1E8Y A;  1DCE A;  4YVQ C; 
#chains in the Genus database with same CATH homology
 4WNG A;  4C0M A;  1Z3Y A;  3FU5 A;  4G24 A;  2RD0 A;  4G26 A;  4I6G A;  3HYM B;  4WWN A;  5ARG A;  4ILG A;  5JIY A;  3LVQ E;  1H19 A;  2NSZ A;  5AJD A;  4BFR A;  5BT1 A;  3M5A A;  4E47 A;  4N3A A;  5TH7 A;  5FTP A;  2PQN A;  2VSO E;  3FDH A;  2KCK A;  1E96 B;  4I1M A;  1TJC A;  4TV3 A;  3UT4 A;  1L5J A;  4U8H A;  5CCM A;  4XI9 A;  3FTS A;  2WXP A;  4KT6 B;  2IOL A;  2CHZ A;  4EZJ A;  2AXV A;  3ML9 A;  4B94 A;  4BX9 A;  2NC9 A;  3AS5 A;  3JQ0 A;  4KZC A;  3CVY A;  4GZD A;  4IUL A;  3EHM A;  3RK6 A;  3APD A;  2Y4U A;  2M63 A;  1KT1 A;  2L6J A;  4DLQ A;  1E8W A;  3LKU A;  1N6A A;  3CVX A;  2WXF A;  4EQF A;  5CPR B;  3QDN A;  2VSN A;  3IBE A;  3CVW A;  1WM5 A;  3P2B A;  2FBN A;  4ANX A;  3RJV A;  1U3D A;  5FT9 A;  2E0I A;  4OYS A;  3R7Q A;  3VLD A;  2RFI A;  2XGO A;  4KBQ A;  4QFV A;  4AY5 A;  1ML9 A;  3LS8 A;  5G05 C;  2GRM A;  2ION A;  2XCB A;  2VSX E;  1UG3 A;  1ZU2 A;  3Q4A B;  3GZS A;  3GZ1 A;  3IHY A;  3O48 A;  3OOI A;  3LY9 A;  3M56 A;  3FWV A;  3FUI A;  3NF1 A;  5T3R A;  3S7F A;  4YPA A;  2JV0 A;  3CHM A;  4H7X A;  3ZPJ A;  3C98 A;  3FTY A;  3CVV A;  5KJN A;  2RG8 A;  3CKB A;  4HOQ A;  2LO6 A;  5D0Q D;  3FTW A;  3CSF A;  2A5U A;  4PS8 A;  3MKQ A;  2FO7 A;  3FUD A;  4JHJ A;  3VTX A;  4MS6 A;  3PEV B;  3FY4 A;  4JA7 A;  3TXN A;  4IN3 B;  2LSU A;  3UX4 A;  3OTN A;  2UWJ G;  4BT8 A;  3I4G A;  3EDT B;  3ENE A;  3FUJ A;  4HOR A;  4A1G A;  5G05 J;  1HFA A;  5HI7 A;  3SBS A;  2WQ7 A;  4L23 A;  3TXM A;  4FMU A;  2J4D A;  5D0O D;  2F69 A;  1E7U A;  4I6J A;  2AXZ A;  3SGH A;  4JW1 A;  4UWH A;  2DIW A;  4UQZ A;  4BWR A;  3ZW3 A;  4XZ4 A;  1UN9 A;  4ABN A;  2HM8 A;  4FLH A;  2V5F A;  1EPU A;  3FU3 A;  1H3I A;  1HG5 A;  3GW4 A;  1ELW A;  4J0U A;  2A4Z A;  3TJP A;  2OND A;  2J4B A;  3MX3 A;  2BTD A;  3CST A;  4FUL A;  3AS8 A;  3CBO A;  3DB5 A;  4F53 A;  1PEG A;  4G25 A;  5LCW C;  1MVH A;  4GYW A;  3B7T A;  3CV0 A;  3CVN A;  5ANL A;  2OVB A;  4FJZ A;  3WXX A;  4TUU A;  5A23 A;  5LFA A;  5T8I A;  2E2E A;  5F5E A;  5DIZ A;  1OWP A;  3ZXS A;  4N5C A;  4I9C A;  3HVE A;  4PS3 A;  5BV0 A;  2X6H A;  4GYO A;  2KAT A;  1TJF A;  1UJJ A;  1FCH A;  4RVB A;  3MZL B;  2OVF A;  4RSY A;  5C2Y A;  3IV0 A;  5KCM A;  4AY6 A;  1EYH A;  3UT7 A;  3IEG A;  3FU6 A;  3PS6 A;  5LCW J;  1A17 A;  4JEU A;  3FU0 A;  3ZN3 A;  4HOS A;  3MO0 A;  5CCL A;  1HU3 A;  4BY6 A;  4EEC A;  3IHV A;  3MKQ B;  4E6H A;  5BPP A;  2J9Q A;  2QFC A;  2PZI A;  4J7I A;  4I1A A;  2R17 C;  3URZ A;  3IHX A;  1EDU A;  1BPO A;  5FJY A;  3FFL A;  1ELK A;  3FUF A;  5EG2 A;  2DCP A;  1OWL A;  2Q7F A;  5EX3 A;  4APO A;  4NQ0 A;  4GZ6 A;  3VLF A;  1P5Q A;  3EP0 A;  4GYY A;  2J08 A;  4LER A;  4ILH B;  4JVS A;  4PH4 B;  1OUV A;  4I17 A;  3OXG A;  2WXI A;  3MJW A;  3Q5M A;  3B7U X;  4G23 A;  2KM4 A;  1HZ4 A;  3CGH A;  4ANU A;  5EDS A;  4KZ0 A;  2I1K A;  3CQC B;  3KEZ A;  3HHM A;  3QNK A;  3D9P A;  2Y4T A;  1S0P A;  2VJ8 A;  3FH7 A;  3PDN A;  4YPE A;  1HE8 A;  4A1S A;  4GML A;  3ZVV A;  4AV7 A;  3P1U A;  4M3O A;  2AW6 A;  4UI9 J;  3CLJ A;  3K5K A;  4FU3 A;  4TRQ A;  4MI0 A;  2XRZ A;  5AJL A;  4ANV A;  4EPZ A;  4QEN A;  2WVI A;  3TG4 A;  4O30 A;  1IHG A;  2P58 C;  2OOE A;  3N71 A;  2O8J A;  3HDX A;  3CKC A;  4G1T A;  4GA1 A;  3D9K A;  3MV2 B;  2I1J A;  3L22 A;  5ANR A;  1H2V C;  4ACL A;  3HVE B;  2Y3A A;  1B89 A;  3MKR A;  2CG3 A;  3B7S A;  5CMW A;  3RKV A;  4BTB A;  5EKQ D;  3ASH A;  3MEK A;  1ZBP A;  2XRY A;  3RRN B;  4N3B A;  3Q47 B;  3CEQ A;  3EJN A;  2V4L A;  3UQ3 A;  3F9Y A;  5FWQ A;  2L0I A;  3FTV A;  1DVP A;  1QQE A;  3CVQ A;  4EZL A;  5AYF A;  1PC2 A;  4PS7 A;  1E8Z A;  4MLP A;  4OVV A;  3PRE A;  2WB2 A;  4W9R A;  2VSY A;  3FUH A;  3ESK A;  5T0K A;  4N2S A;  5F6L A;  3D9O A;  2AVP A;  1WAO 1;  3D3M A;  4JHK A;  4PDX A;  2OV8 A;  1YA0 A;  2WXG A;  4GZC A;  5ARF A;  3FUE A;  4UQY A;  4AXH A;  5AEN A;  5FQ8 A;  4R7L A;  4BX8 A;  3KMA A;  1N54 A;  2C0M A;  4C9B B;  2FUL A;  3EIJ A;  3MO5 A;  2XEV A;  5CHE E;  1QNF A;  2IQC A;  1O9S A;  4FC8 A;  4I1O B;  4MKT A;  1H0A A;  3CHQ A;  5LX8 A;  1H2U A;  3FUL A;  2C0L A;  3MGB A;  4HS2 A;  3PUK A;  2C2L A;  5ENN A;  4CDN A;  2ILR A;  4YNP A;  3FHE A;  3FEY A;  4AU7 A;  1OWN A;  3LY8 A;  3L13 A;  4Q94 A;  4Z4P A;  1ELR A;  2X6I A;  3F9Z A;  4AEZ C;  2J09 A;  3KMT A;  5FQ7 A;  3AU5 A;  2XHE A;  5KJK A;  3ML8 A;  2WXH A;  4AVX A;  3VTY A;  3R9A B;  4JHR A;  3ASD A;  2MHK A;  1JPL A;  5G04 C;  2W5Y A;  1MVX A;  3FPD A;  4UQX A;  4GCO A;  4IRU A;  4J8E A;  2KZT A;  4JC8 A;  1IQR A;  5BW8 C;  4MRU A;  1KLX A;  3NZS A;  4BUP A;  5FZS A;  3U3W A;  4WWP A;  4J83 A;  3QOU A;  4CT0 A;  3ZRH A;  1HG2 A;  1KT0 A;  4LCT A;  1Z6T A;  1PY1 A;  4QEO A;  4U07 A;  3OPE A;  2IOS A;  3L6A A;  4IYP A;  4G11 A;  3SZ7 A;  3O4Z A;  3T5X A;  3M53 A;  2I6H A;  4ATG A;  4URK A;  3LVR E;  1HF8 A;  2IFU A;  4GZ5 A;  4YVO A;  2VGY A;  3UMV A;  3VUZ A;  4LRZ A;  3VLE A;  3CVL A;  3DPD A;  1E7V A;  3UT8 A;  4ACK A;  5G04 J;  2KCV A;  2WQ6 A;  2BUG A;  2PM7 A;  4UWF A;  4WNF A;  5T4Y A;  4AOF A;  2FI7 A;  3IKO B;  3RRU A;  2XPZ A;  3FTZ A;  2WM9 A;  3FUN A;  3LPZ A;  3QAQ A;  4UWK A;  4FA6 A;  3U66 A;  3I5P A;  1UW4 B;  3CHS A;  2X6F A;  3FTX A;  3NZU A;  1IYG A;  4KVO A;  5T0M A;  5LSZ A;  2X6K A;  3D9M A;  2IU1 A;  3QWW A;  4WAF A;  4UWG A;  2WXQ A;  3ASG A;  4L7T A;  4I6E A;  4C0E A;  4CDM A;  3AS4 A;  2DBA A;  4OVU A;  4DK5 A;  3ZYK A;  3PUJ A;  4F3V A;  5AIJ A;  3L08 A;  3M54 A;  2J49 A;  4FJY A;  2LAH A;  4JDS A;  2V8S E;  1E90 A;  3ESL A;  1SZ9 A;  3ZYM A;  4A55 A;  3ASF A;  3GZ2 A;  3SI5 A;  1PAQ A;  3DBS A;  3L16 A;  4HFG A;  4N2Q A;  3PE3 A;  1JWF A;  3M57 A;  4UI9 C;  1SZA A;  4CT4 A;  3TGO A;  5LSX A;  4AM9 A;  4WNE A;  1JWG A;  2QY7 A;  1XQH A;  1FVF A;  3QK0 A;  3TAX A;  4JLG A;  3RO3 A;  3FUK A;  3RJW A;  4J8F A;  3D9I A;  4BSX A;  3DAL A;  1Y8M A;  3Q49 B;  3LDZ A;  4GCN A;  1H6K A;  4HOT A;  5E76 A;  3RAY A;  1NZN A;  5BUZ A;  2KZT B;  2VTB A;  4YPU A;  1DNP A;  4GA2 A;  5G2N A;  4DPR A;  4RG6 A;  2HR2 A;  3PH0 C;  3PNT B;  1XNF A;  4CGV A;  4UWL A;  5F6K C;  3RRM B;  3EHN A;  1MT6 A;  4FHJ A;  3KAE A;  2JLB A;  4DI3 A;  3T5V A;  3BG0 B;  4ME2 A;  4U0Z A;  3KD7 A;  4LDG A;  3B7R L;  4A3V A;  4ANW A;  2HYZ A;  4Q69 A;  5AYW D;  3LYA A;  3ULQ A;  4I9E A;  2I9C A;  4U04 A;  3PE4 A;  3JYS A;  4KXK B;  3QAR A;  4GZ3 A;  4ILI A;  5EX0 A;  2WMO A;  4GU5 A;  2HO1 A;  5LP0 A;  4U0U A;  2YQ8 A;  3CBP A;  1OWM A;  3QWV A;  4JZY A;  3FP3 A;  5JJ6 A;  4XI0 A;  3FH5 A;  1EF1 C;  4CEM A;  1W3B A;  2CHW A;  1HX8 A;  3S7B A;  3AU4 A;  3ONK A;  4J8D A;  1MUF A;  3QC1 A;  4NVQ A;  2GRL A;  3BEE A;  4AJW A;  4L1B A;  5HQ8 A;  3I4R B;  4APF A;  3ZEF A;  4NRH B;  3FEX A;  5FQ4 A;  4FP7 A;  2WXN A;  4F1S A;  2IF4 A;  2BF0 X;  2KCL A;  3MCX A;  5F59 A;  4BT9 A;  3FH8 A;  3JQ1 A;  2LSV A;  2R59 A;  3QKY A;  2XCC A;  2YIN A;  5FZQ A;  3CHR A;  3LEW A;  4WWO A;  2W5Z A;  3OS5 A;  4IJD A;  4RZ0 A;  4JXT A;  3RIB A;  3FUM A;  2XPY A;  4H7Y A;  2WXK A;  3S8P A;  4Y6C A;  4XKB A;  3ZFW A;  3JCK C;  5BNW A;  3MV3 B;  3JUI A;  2CG2 A;  3PRZ A;  4J8S A;  1Y6I A;  2MOW A;  5A7D B;  3G2W A;  4CCA A;  3SWC A;  2L0T B;  4XE0 A;  2AWI A;  3ONL A;  2WMN A;  2XPI A;  2AXU A;  2PM6 A;  2X38 A;  2VGX B;  4Q96 A;  2GGF A;  4WND A;  3SFZ A;  2IGQ A;  1X5B A;  2MRI A;  4CGW A;  4J7F A;  3D9L A;  3M59 A;  2UY1 B;  2R5S A;  3CBM A;  3SD5 A;  3CK9 A;  4EZK A;  2BQZ A;  5C1D A;  3G2V A;  3PZD A;  4FHK A;  3ZGQ A;  2VTB B;  5JIN A;  4K03 A;  4U0S A;  3S2A A;  4CDR A;  4BTA A;  2EQX A;  4I43 A;  2NXP A;  4B0Z A;  3LY7 A;  1WY6 A;  2VQ2 A;  2VYI A;  3T8M A;  3U4T A;  3CK8 A;  1MQS A;  4A3T A;  2PQR A;  3S7D A;  3KMJ A;  3SF4 A;  3K9I A;  3F9X A;  3CR3 A;  3VV0 A;  2WQH A;  3RQ4 A;  3CQG B;  5BV1 A;  3ZYL A;  2KC7 A;  3QB2 A;  3SHF A;  3R7R A;  4J6I A;  5M72 A;  4I51 A;  3FTU A;  2X6J A;  2YHE A;  3UPV A;  3HNA A;  3QJZ A;  2GW1 A;  3PEU B;  4UI9 K;  3ZHE A;  4KMO A;  5TTF A;  3RU0 A;  1HH8 A;  4PUC A;  5E75 A;  4AIF A;  4HVB A;  3ZIM A;  1E8X A;  3MA5 A;  4DLO A;  3D9N A;  3I3N A;  2ZU6 B;  4B89 A;  2CHX A;  4GA0 A;  3CHP A;  2IJG X;  3EIQ C;  3G2U A;  3G2T A;  1HXI A;  1ZKK A;  1NP7 A;  1HO8 A;  1U3C A;  4EBA G;  2X3M A;  5LOZ A;  2CFZ A;  1UN8 A;  4L2L A;  5JHA A;  5JJT A;  3BG1 B;  3UUX A;  1N3J A;  4NJ5 A;  3SNX A;  2I2O A;  4DJA A;  2XQ0 A;  3SW9 A;  3CIA A;  4C1Q A;  4NAC A;  4HLE A;  3L54 A;  4HXI A;  4IJ8 A;  2WXR A;  5G55 A;  3NQP A;  2XGM A;  4G2V A;  4P29 A;  3D9J A;  3Q15 A;  2WXO A;  4GB9 A;  1Z3X A;  3F9W A;  3B13 A;  4JPS A;  1N6C A;  3QWP A;  4JEH A;  3PNL B;  4CRW A;  5DBK A;  5JJ7 A;  4KVM A;  2G46 A;  4H12 A;  1QZ2 A;  2WXM A;  3TG5 A;  3L17 A;  4XKC A;  4E85 A;  4YNM A;  4JA9 A;  4D10 C;  4HOU A;  2XGS A;  5JJ0 A;  3G2S A;  4B8A A;  3HIZ A;  4O6F A;  4MI5 A;  5TEG A;  4QEP A;  4RG9 A;  3KS2 A;  2WXJ A;  3GYZ A;  2L9B A;  4JL0 A;  2WPV A;  4I2Z A;  4EBA A;  1TEZ A;  4YND A;  4GPK A;  2LAI A;  2VGX A;  1N52 A;  1LF8 A;  4NUR A;  4LUN U;  4B8C B;  3BO5 A;  1XGW A;  4AP2 A;  3S7J A;  5JHN A;  3ZYQ A;  4KYO B;  1H2T C;  3OXL A;  2JEK A;  1JUQ A;  2UY1 A;  3PVL A;  2V0P A;  4WUY A;  2J07 A;  3MO2 A;  4J8O A;  2QPW A;  5T5G A;  3U9W A;  3CK7 A;  4N39 A;  3APC A;  4LEU A;  1NA3 A;  3E4B A;  3TL5 A;  2YHC A;  4I2W A;  3M58 A;  3SBT B;  3CHO A;  3OXF A;  1INZ A;  5FQ6 A;  4L2Y A;  1OWO A;  4F7A A;  4XX5 A;  4Y6W A;  1UJK A;  5J90 A;  4N3C A;  1HS6 A;  4GAA A;  5J08 A;  2CFU A;  3APF A;  3LXU X;  3ZHE B;  2FEZ A;  4K0R A;  5JHB A;  1MHQ A;  2YNQ A;  4FAD A;  1GW6 A;  2WXL A;  5KJM A;  5A6C A;  5FZR A;  3M55 A;  1VDY A;  2LNI A;  2PL2 A;  3CVP A;  3OAW A;  4V3I A;  4GMJ A;  2FF4 A;  3RO2 A;  1IQU A;  4DI4 A;  3MYV A;  5KJL A;  3CVU A;  1SQM A;  3U64 A;  1FVH A;  5CMY A;  1NA0 A;  4U63 A;  4FLB A;  3LJ3 A;  3LCA A;  1E8Y A;  4XIF A;  2R3A A;  4YVQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...