5KJNA

Smyd2 in complex with az506
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
429
structure length
429
Chain Sequence
b'GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 147
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjnA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjnA01
2F69A 3IHXA 4F3VA 2C0MA 2XCBA 4UI9K 3ZHEB 5F5EA 3CKBA 5EKQD 1O9SA 2VQ2A 2RFIA 3CKCA 4KBQA 2IFUA 3Q47B 4JL0A 2Y4UA 4U0SA 5AYFA 2FF4A 3SW9A 1NZNA 3MO2A 1P5QA 5LSXA 4G23A 2WQHA 3LYAA 3JYSA 3QOUA 2XEVA 4H7XA 4HOQA 5F59A 1HZ4A 4JA9A 4J8DA 3ASFA 3RO3A 3M57A 4J7IA 3LY7A 2IF4A 5G04J 4YPEA 4NVQA 3KS2A 5FJYA 2UY1A 2JV0A 3CBMA 2Y4TA 1XNFA 3EP0A 4AU7A 4GA0A 2KCVA 2HR2A 2VSNA 5DBKA 2J9QA 3ASGA 2L6JA 1NA3A 4NQ0A 2VGXA 3CVLA 4I2WA 4GPKA 3VTXA 4EQFA 4GA1A 2HYZA 4N2SA 3ASHA 2VGYA 4MI5A 2FI7A 4B94A 3KMJA 2C2LA 4GYWA 5JHNA 4I51A 4N2QA 4GCNA 4Y6CA 4YPAA 4CGVA 2NC9A 2WPVA 5G04C 2LSVA 4J0UA 4FMUA 4JDSA 3TG4A 3GZ2A 4E47A 5F6LA 5ARFA 3OXLA 4J8FA 3M53A 3AS5A 1ELWA 1IHGA 4BUPA 2FEZA 3IEGA 4GZ5A 3U3WA 3TG5A 5LSZA 3PE3A 4XI9A 3VV0A 3Q4AB 2XGSA 4BT9A 3FFLA 2G46A 3LY9A 2FO7A 4U07A 4Z4PA 4RG6A 4AY5A 3SZ7A 3RIBA 4G2VA 4RZ0A 4N3CA 3S7JA 5T5GA 4I17A 4G1TA 2VGXB 2E2EA 2IGQA 3MEKA 1PEGA 4BT8A 1IYGA 1A17A 3QWPA 4WUYA 5KJMA 2DBAA 3KAEA 4WNGA 4J8EA 3SF4A 3S7DA 4BWRA 5TH7A 5FTPA 2XGOA 5CPRB 3UQ3A 3WXXA 5FZRA 5JIYA 4AY6A 1HH8A 4JLGA 1XQHA 3BO5A 3SWCA 3S7FA 5TTFA 3KMAA 3OS5A 1ZBPA 3OXFA 2QFCA 2KCKA 4G24A 3PE4A 4YPUA 3E4BA 5A7DB 3OOIA 3ESKA 2I6HA 4BTBA 3LPZA 1KT1A 5EX3A 2V5FA 3QWVA 4CGWA 1YA0A 1MT6A 4MI0A 4CDRA 3GYZA 4UQZA 5KJNA 3MO5A 2BQZA 4HOUA 5BT1A 3GW4A 5JINA 1OUVA 4HORA 2AVPA 2KATA 5KJKA 4UQYA 4XIFA 4JA7A 5CCMA 4U0ZA 4N39A 4BTAA 5T0KA 5D0QD 4APOA 4YNMA 4GYYA 2Q7FA 4YNDA 3AS4A 1MUFA 4C1QA 3K9IA 2YQ8A 2W5ZA 2JLBA 3CVNA 1N3JA 5AYWD 4U04A 2R3AA 1KLXA 2MHKA 1N6AA 3LY8A 4I2ZA 2GW1A 4G26A 5LCWJ 2KC7A 4NJ5A 4O6FA 2C0LA 3M54A 2UY1B 4A1SA 3MV2B 4XI0A 3MO0A 2ONDA 3VTYA 3ZN3A 5HI7A 5FZSA 5CCLA 4W9RA 3QKYA 3ZHEA 1Y8MA 3F9ZA 3RU0A 2FBNA 2HO1A 3DB5A 3CEQA 4YVQC 2QPWA 4RG9A 3ZGQA 3CK8A 4U0UA 4IN3B 4LDGA 4QENA 3QDNA 4WNFA 5HQ8A 3OPEA 4HOSA 3CBPA 3M59A 3RJWA 5G05J 3DALA 5EX0A 1NA0A 5LCWC 3LCAA 1MVXA 3FPDA 3ASDA 3ZFWA 1H3IA 4AIFA 2PQNA 2VYIA 1FCHA 3GZ1A 3M58A 3RO2A 4J8OA 4H7YA 3BEEA 3FP3A 3Q5MA 5ARGA 2UWJG 2XGMA 4O30A 2OOEA 4KYOB 2P58C 3F9XA 4IJDA 3CVPA 3QWWA 3PDNA 3M56A 2PQRA 5FZQA 5DIZA 2VSYA 4J83A 4WNEA 3EDTB 4H12A 3UUXA 1HXIA 2LSUA 3HNAA 5G05C 4QEPA 4I9EA 4NRHB 3F9YA 4N3BA 2XCCA 4IJ8A 2BUGA 1ZKKA 3S7BA 1W3BA 2LNIA 5T0MA 3Q15A 4JHRA 3ZPJA 5F6KC 2O8JA 4N5CA 3K5KA 4GYOA 3LKUA 4UQXA 1ZU2A 4G25A 4AM9A 5JJ0A 3RJVA 3CK7A 1N6CA 2W5YA 4YVOA 5TEGA 1QZ2A 5D0OD 4GZ3A 4YNPA 5C1DA 3KMTA 1QQEA 3RQ4A 3URZA 5M72A 1KT0A 1TJCA 3MA5A 1PC2A 3AS8A 3OXGA 1WAO1 5BNWA 3TAXA 3CK9A 4HOTA 3HYMB 4J7FA 3Q49B 3R9AB 4GZ6A 4UI9J 5KJLA 3M55A 3M5AA 5CHEE 4KXKB 5A6CA 3CVQA 3ULQA 1E96B 3S8PA 3N71A 3UPVA 2PZIA 4GCOA 1WM5A 2R5SA 3NF1A 4I1AA 2XPIA 3CV0A 3CBOA 5EG2A 2KCLA 4ME2A 3U4TA 5BW8C 5JJTA 4N3AA 3TGOA 4LEUA 3FWVA 5FT9A 4ABNA 4WNDA 2YHCA 4Y6WA 1ELRA 3RAYA 3MKRA 1B89A 3RKVA 3MV3B 4I9CA 4GA2A 1ML9A 3O48A 4UI9C 5JJ7A 3F9WA 5JJ6A 2PL2A 3KD7A 1MVHA 4QEOA 3VUZA
chains in the Genus database with same CATH superfamily
3QB2A 3JXIA 4UI9K 3CKBA 4WWNA 3CKCA 2RG8A 1E7UA 2J4DA 2FF4A 3V2OA 3MO2A 4E6HA 3CHPA 2YINA 4BESA 3LYAA 3Q9NC 1IXVA 2F8YA 3UT8A 2P9UG 1S70B 2XEVA 5F59A 4JA9A 3ASFA 1JCRA 4X8QA 1TN7A 2GRMA 3D9JA 5FQ8A 1NI1A 3LS8A 3HXBA 2V8SE 1K8KG 2Y4TA 1N4SA 4PH4B 2V0PA 4AU7A 2OVBA 4DX5D 3PH0C 4N5QA 3KEZA 3CQGB 3VTXA 4GAAA 4K5AB 4A63B 2VGYA 1UG3A 4B94A 1O5MA 4C0EA 3LVQE 5JHNA 4BETA 4JHJA 4B89A 2H6FA 2BEDA 3B7SA 2WPVA 1TNZA 4E47A 5T3RA 4J8FA 1NL4A 2FEZA 4KVOA 3Q4AB 3L9TA 2AJAA 3FUJA 5FQ7A 4Z4PA 5AN8A 5JHAA 2V4LA 4NACA 4G2VA 5C2YA 1TNOA 4BT8A 2VSOE 3UX4A 1JWGA 3JUIA 3G2TA 2WQ7A 3AJIA 2CHXA 3UQ3A 4K5BA 1EF1C 2V5QC 4MRUA 2KZTA 4HNAD 3RRMB 4U63A 5JIYA 4AY6A 1TNYA 2QZAA 3UT4A 4KZ0A 3HIZA 3TXNA 1V54E 3KMAA 3PZ4A 3G2SA 3FEYA 5AJLA 2A4ZA 1TR4A 3TWSA 2V5FA 1SZ9A 1PY1A 4EZJA 4MI0A 2I9CA 2AXZA 4UWLA 2P2CP 3GYZA 5EYLA 4F1PA 3D9MA 2BQZA 3IXEA 5BT1A 2CG3A 5AIJA 4XIFA 3NZUA 1QYMA 5CCMA 1DCEA 1LF8A 5D0QD 2ZGGA 2Q7FA 1SQMA 3ISMC 3UMVA 4QFVA 1HG2A 1Y6IA 3FHEA 2W5ZA 2I1KA 3ML9A 4DUIA 1K1BA 2R3AA 4TUUA 2MHKA 1N6AA 4C9BB 4APFA 1FVFA 4ATGA 5AQAA 4F53A 3V2XA 3SI5A 1BI7B 2GRLA 1OWOA 2ONDA 3ZN3A 1EPUA 5FZSA 5B3SE 4PS8A 3HDXA 3VLEA 3RU0A 2HO1A 3UKRG 4JVSA 3RRNB 3JXJA 4JHKA 2EINE 4EHMA 2OEWA 3CK8A 5FINA 5J08A 4IN3B 1N52A 3U9WA 1UOHA 5HQ8A 1HX8A 4HOSA 3CBPA 3CSTA 4ILIA 4ACLA 4URKA 5AENA 2CG2A 3LCAA 1U3DA 5EILA 3ABLE 1FT2A 2XS8A 3DSXA 1FCHA 1O1TA 4TXRA 3OAWA 3PREA 1N4RA 2AXUA 3CR3A 3SY2A 4AOFA 4O30A 4FA6A 2L9BA 2DYRE 4KYOB 5AAOA 4IJDA 3QWWA 2I2OA 5FZQA 2J4BA 2VSYA 2ZU6B 3CVYA 5BUZA 5CMYA 4WNEA 3E30A 2GRRB 2B6CA 4J8SA 2DZNA 4I9EA 2GGFA 2XCCA 4ANVA 3MYVA 4IJ8A 1ZKKA 4I6GA 3CHRA 2O8JA 5JHBA 3K5KA 4GYOA 2MRIA 1ZU2A 3DEOA 3CK7A 1N6CA 1H6OA 2IQCA 1IHBA 5TEGA 1QZ2A 5D0OD 3EUVA 5C1DA 3KSLA 3RQ4A 1KT0A 4HRNA 1H2TC 3UI2A 1PC2A 2WXPA 4U96D 2XEEA 4HRLA 3CK9A 2V4HC 4AJWA 3Q49B 5BV1A 5CHEE 3B7UX 1A5EA 4EECA 3ULYA 4XKBA 3JUEA 1S64A 4EBAG 2IO2C 1JUQA 2J08A 2VTBA 3FU3A 3CV0A 3CBOA 3W9GA 3DSTA 3U4TA 4ILGA 5E75A 1LD7A 3D9PA 5FQ6A 3CHOA 1B89A 4PS3A 3KEAA 2ETBA 4GA2A 1ML9A 3NOCD 4GMRA 3DEPA 3NBNB 5JJ7A 3F9WA 3UM3A 1IKND 5JJ6A 2PL2A 3KD7A 1MVHA 1SW6A 1EDUA 3UIPC 2R03A 4C48B 2L6BA 2WXOA 2F69A 2OV8A 4HRMB 2C0MA 2XCBA 2R59A 5CRUA 3CGHA 1Z5SC 4FC8A 5CBOA 3ZU7B 3SW9A 3ZKJA 4FADA 1NZNA 1Z6TA 1FPPA 3HVEA 1N95A 3JYSA 3QOUA 1HZ4A 2KBXA 4J8DA 3I3NA 3ZYQA 4J7IA 2IF4A 5G04J 1FT1A 3KS2A 4L9PA 5JMND 2JV0A 4I6JA 1OCZE 2XPZA 4GA0A 3RSEG 3UTMA 2HR2A 3AG2E 2J9QA 1DVPA 4ANUA 2L6JA 1NA3A 2RFAA 1OCRE 2VGEA 3FUEA 2VGXA 4CCAA 3CVLA 4GPKA 3B95A 3FUIA 2GRNB 4DX2A 3DSSA 4EQFA 2M63A 2FI7A 2WXIA 1G3NB 3PZDA 4HLLA 1E8ZA 1E8XA 2L0TB 4GYWA 1TEZA 4I51A 4N2QA 4U8YD 4Y6CA 4YPAA 4JXTA 3L17A 4L2YA 4YDYA 5G04C 4FMUA 3TG4A 2ZISA 5KNHD 5ARFA 2DWZA 4NURA 4HS2A 4U7EB 5HKPA 4I1MA 1ELWA 3D9NA 3FUMA 3U3WA 3PE3A 4G8LA 3VV0A 2PM7A 2H6HA 4YDEA 4BT9A 1SA5A 3LY9A 4RG6A 2R2LA 1OCCE 3ZIMA 2RFMA 4RZ0A 4N3CA 3TWXA 2DIWA 4Z68A 4BSZB 2VSXE 1S0PA 3SFXA 3TWQA 1IYGA 4BFRA 3AU4A 4BEPA 5CEAA 3S7DA 3L13A 5TH7A 5FTPA 5CPRB 3CVVA 5FWQA 3PZ3A 2H6IA 1HH8A 3CHSA 3LDZA 4CEMA 3S7FA 5TTFA 2P9NG 1VDYA 2KXPC 2KCKA 3PZ1A 4GMJA 5IY5E 4HI9A 3L54A 1OT8A 4FU3A 2I6HA 3LPZA 1KT1A 1H6PA 4A3TA 5ENOD 4XE0A 3HG0D 2F0YA 2I1JA 3MO5A 4HOUA 3GW4A 1OUVA 2AVPA 2ILRA 2YHEA 3ZUVB 2XZDG 2WXRA 1Z3YA 1H19A 3FTZA 4LNBA 4N39A 4BTAA 1HF8A 2KZTB 2WMOA 1WDYA 3R7QA 3Q9UC 3QC1A 1HG5A 1OXJA 4C1QA 4PUCA 2XENA 4GTOA 5AYWD 5KBAA 4I2ZA 4A1GA 4G26A 3P1UA 2KC7A 3V31A 2C0LA 3DSUA 2FO1E 2CFZA 2UY1B 2XPYA 5CRVA 2WXGA 4HVBA 3SGHA 3QARA 4XI0A 4EZLA 5B1BE 1GW6A 5HI7A 4B93B 3J5QB 5CCLA 4W9RA 3QKYA 1X81A 3F9ZA 4OYSA 3Q78A 2R02A 3OTNA 3DB5A 3CEQA 2WXFA 3UM2A 3SBSA 1H2UA 4L1BA 2PNNA 4LDGA 2R17C 3R9MA 3QDNA 4F6RD 1MZCA 4WNFA 2P9IG 3MZLB 3EIJA 3M59A 3RJWA 1BD8A 4IULA 5G05J 3DALA 3Q73A 1NA0A 3D9IA 3DXMG 1D8EA 4E85A 1HU3A 3TWVA 2Y1LE 2BKKB 2VYIA 3MCXA 3C98A 4ACKA 5LP0A 4K0RA 3IKOB 3M58A 2P9PG 3G2VA 2WQ6A 5KWDA 3BEEA 2X38A 1MQSA 3B13A 2ETAA 3UKUG 2P58C 4U8HA 3SFZA 3DWLG 4IYPA 5AQ9A 2NXPA 3CSFA 4DRXE 3EDTB 4H12A 1DC2A 3ZEFA 5G05C 3F9YA 3EU9A 3PVLA 5ENTD 2QY7A 4U95D 3X2QE 1W3BA 4FULA 4GZCA 4GU5A 3SNXA 2CFUA 4JPSA 4UQXA 4G11A 4G25A 3JCKC 3RJVA 4KT6B 3D9OA 4B0ZA 2X6JA 1IQRA 2CHWA 5M72A 1TJCA 5CMWA 3MA5A 3OXGA 3AS8A 3TAXA 4JB8P 3P2BA 4Q94A 4JEUA 4AEZC 3M5AA 4ILHB 2P9LG 3D3MA 3CVQA 3UXGA 3PEUB 3RK6A 3QK0A 1WM5A 2A5UA 4I1AA 1H2VC 1D8DA 3TXMA 2KCLA 4ME2A 4LNUD 5JJTA 3SD5A 4N3AA 3SFYA 3FTVA 4O60A 2WMNA 3PUKA 5B1AE 4L7TA 1N11A 2BKGA 3Q79A 4F1SA 3RAYA 3B7BA 3FUHA 4I9CA 3HXDA 4LRZA 3BU8A 3JQ0A 4WWPA 3L22A 4MKTA 4IRUA 4Q96A 1NP7A 3DPDA 4LERA 2DYSE 3IHXA 4GTRA 3ZHEB 4XKCA 1O9SA 2JEKA 4XX5A 2VQ2A 3D9HA 4KBQA 1N4QA 4EPZA 3Q47B 2AWIA 3G2UA 3ZYLA 4G23A 2WQHA 4YDOA 3Q75A 3FUDA 4H7XA 4HOQA 3RO3A 3HHMA 2EIKE 1EYHA 5CECB 1SVXA 1WY6A 2DZOA 4NVQA 4ZFHA 1TYQG 4XZ4A 1YYHA 4UWKA 3TWRA 1XNFA 2KCVA 1H6KA 5EDSA 1N94A 2VSNA 5DBKA 1D9SA 2QC9A 2B0OE 3LJ3A 1KPSB 2BTDA 4FLHA 5EN5D 4HQDA 2Y3AA 4LNGA 4OAUC 4GTPA 2NYJA 4GA1A 3PUJA 3ASHA 3T8KA 2GROB 3F6QA 5BPPA 3KMJA 3I5PA 2C2LA 2WXKA 1UJJA 2WXHA 4GCNA 4CGVA 4AP2A 3AAAC 2J8SD 2NC9A 1TNBA 2F8XK 4GZDA 3TJPA 3E33A 3M53A 4DLOA 5LSZA 4XI9A 4I1OB 4TXQA 1SA4A 4GTSA 3FFLA 2G46A 2L0IA 5AQ7A 4G8KA 3SZ7A 4XEIG 5T5GA 3NAWA 4I17A 2LXLA 4G1TA 3HXEA 4V3IA 2VGXB 2E2EA 3APFA 2WVIA 1A17A 3MKQB 3QWPA 2EQXA 3KAEA 5ANLA 4WNGA 3SF4A 5CERB 3PNLB 5HRYA 4L23A 3WXXA 1OWLA 1BI8B 5FZRA 3ZW3A 4RVBA 3NQPA 3SO8A 3SBTB 4YDWA 3L08A 1XQHA 3SWCA 4HXIA 5G55A 3OS5A 1ZBPA 2WXNA 3OXFA 4C0MA 4L2LA 2QFCA 3EHMA 3BUAA 3ZYKA 5JA4D 1HE8A 5A7DB 3ESKA 2XRZA 3CQCB 4D10C 3CVXA 3O4ZA 4CGWA 1TN8A 1E90A 4CDRA 2X6HA 5ITZF 3V30A 4ZHBA 3VLFA 1HFAA 4BERA 2XZTG 4DPRA 3AU5A 4HORA 4FHKA 2X6KA 4LUNU 1MHQA 1DCQA 4U0ZA 5T0KA 1OY3D 3HXCA 4APOA 3DRAA 4GYYA 3FUKA 2R05A 2Y69E 3UIOC 4YNDA 1X5BA 3EHRA 3AS4A 1O1SA 1MUFA 3BG0B 1JWFA 3K9IA 3DSVA 1S63A 3QAQA 2BF0X 3TWTA 3VLDA 3CVNA 4R7LA 3TWUA 1KLXA 3QJZA 3EJNA 3ESLA 2XHEA 4DLQA 5BXOA 3PNTB 3UT7A 4J8YA 3M54A 1UJKA 1MX2A 4A1SA 3MO0A 3VTYA 2CHZA 4F7AA 2WM9A 5AARA 4GMLA 4YVQC 4GTVA 4WAFA 5D2MC 1AWCB 4KVMA 2XRYA 3EHQA 4JZYA 3MJWA 4ANWA 2JABA 1OWMA 4QENA 3UM1A 2DVWA 1U2VG 3OPEA 1O1RA 5EX0A 4CZ2D 5LX8A 4K5CA 1MVXA 3ASDA 1U3CA 1H3IA 2PQNA 1KZOA 4M3OA 2H6GA 3RO2A 4J8OA 3DSWA 3C72A 4H7YA 3APDA 2UWJG 2WXQA 1L5JA 3PDNA 3PZ2A 1BU9A 3WG7E 3CHMA 4U8VD 4EZKA 1TN6A 1HO8A 2XEHA 2AW6A 4FJZA 4J83A 4JD2G 2IO3C 1N4PA 1QBQA 3UUXA 1HXIA 2LSUA 3ONLA 4NRHB 2HE0A 3UINC 2IJGX 3NB2A 1H0AA 4K03A 2DCPA 2LNIA 3C3RA 2J49A 3C5RA 4CDMA 5T0MA 3DPYA 1N9AA 3ZPJA 5F6KC 3ZYMA 4N5CA 4DX1A 3LKUA 3SHFA 4AM9A 5JJ0A 4CT0A 2F37A 3CHQA 4FP7A 3I4RB 4YNPA 3KMTA 4JEHA 4B8CB 2RD0A 3U64A 3HRAA 3HYMB 1MJ0A 1Z3XA 3R9AB 2MOWA 4UI9J 3M55A 4RSYA 2ZGDA 1SZAA 5A6CA 1NFIE 1OCOE 5CBNA 1E96B 4O1OA 4TUMA 2WXLA 3CVUA 3N71A 5A23A 1JCSA 3UPVA 2PZIA 4CYMD 5ENNA 3ENEA 3FTYA 4GCOA 3FTUA 2VJ8A 2XPIA 2EIJE 3EHNA 5BW8C 3IV0A 3TGOA 1N0RA 5T8IA 5EIDA 3T5VA 4JW1A 4I6EA 4ABNA 4OAVB 2J07A 5CEDB 4WNDA 4Y6WA 3MKRA 1RZ4A 4EBAA 1MYOA 3B7TA 3LXUX 3RKVA 3D9LA 3FTXA 3O48A 5G2NA 3CLJA 4UI9C 3LVRE 1INZA 2E0IA 5KCMA 3T8MA 3FEXA 3VUZA 4UWHA 4P29A 5FQ4A 4I43A 4DX7D 4F3VA 5F5EA 5EKQD 2RFIA 2IFUA 4JL0A 2YNQA 2Y4UA 4U0SA 5AYFA 1MX6A 1TJFA 5D66A 1P5QA 5LSXA 3ZRHA 1FVHA 1ELKA 4KMOA 3FU6A 3CVWA 3M57A 3IBEA 4BSXA 3LY7A 3MX3A 3S2AA 4YPEA 3L16A 3B7RL 2OEVA 5FJYA 2UY1A 4HBDA 3CBMA 1Q2ZA 2LO6A 3ML8A 2IOSA 3EP0A 3FU5A 3ONKA 5LOZA 2ZIRA 4CDNA 4HI8A 5H7PA 2QYUA 3ASGA 4NQ0A 3R7RA 4LCTA 4I2WA 1E7VA 4UWFA 3TL5A 1N0QA 4AVXA 1K3ZD 2X6IA 2HYZA 4N2SA 4MI5A 1IQUA 4WWOA 1LD8A 5ENPD 2WXJA 4BX8A 2LSVA 4J0UA 2FULA 4JDSA 3GZ2A 2RKKA 5F6LA 4HB5A 3OXLA 4BY6A 3AS5A 3KSQA 1JCQA 4ATZD 1IHGA 4BUPA 3E32A 4TV3A 3AG1E 3IEGA 4GZ5A 3TG5A 3FTSA 2P9SG 4OVVA 2XGSA 2FO7A 4U07A 4AY5A 3RIBA 3S7JA 3Q7FA 2X3MA 2IGQA 3MEKA 1PEGA 4AXHA 5ANRA 4OVUA 2LUHA 2OVFA 1TNUA 4WUYA 1OWPA 3DXKG 5KJMA 2DBAA 5KNGA 4J8EA 2P9KG 3FDHA 3EIQC 4BWRA 4DK5A 4KZCA 2XGOA 5T4YA 4DI3A 3AG3E 4HFGA 3C3OA 4O1PA 3RRUA 4FLBA 4A3VA 1LTXA 5AQBA 2KM4A 4JLGA 4A55A 3BO5A 3QNKA 2VTBB 4G24A 3JQ1A 4MLPA 3PE4A 4Q69A 4YPUA 3E4BA 3OOIA 3AG4E 2LXMA 4JC8A 4J6IA 3BQOA 4BTBA 5EX3A 4HLEA 3W9FA 3QWVA 3IHYA 5ENSD 4UUCA 1YA0A 2IOLA 3G2WA 1MT6A 4GPMA 4GTQA 4UQZA 5KJNA 2AXVA 3ZXPA 5LFAA 3SQVA 5JINA 2WXMA 4GB9A 3Q7AA 2KATA 5KJKA 4UQYA 4JA7A 1XGWA 2GRQB 1E8YA 4YNMA 4NIKA 2IU1A 2XS1A 3FU0A 4AV7A 3L6AA 1WG0A 2YQ8A 4FHJA 3ULEG 2JLBA 4LSZE 3HVEB 1N3JA 4U04A 3LY8A 1DNPA 2GW1A 4PDXA 5LCWJ 3NZSA 2GRPB 4PS7A 5HS0A 4CT4A 4NJ5A 4O6FA 3FTWA 5ENRD 3MV2B 5ENQD 2A5EA 5AJDA 5BXUA 3ABME 4DJAA 1K1AA 3ZHEA 1Y8MA 2QYJA 3RAUA 2FBNA 1E8WA 3FH7A 3FH5A 2QPWA 4RG9A 3ZGQA 1BPOA 4GTMA 1RW2A 3E34A 4U0UA 4M7CA 3J5PA 2PM6A 4UWGA 3T5XA 2WB2A 4B8AA 5LCWC 3I4GA 3FUNA 3T9KA 3FPDA 3PRZA 3ZFWA 1OWNA 4AIFA 4MS6A 2EIME 3GZ1A 1KZPA 1HS6A 5BV0A 1UN8A 3HXFA 2MYOA 3FULA 5EYPF 1AP7A 3FP3A 3Q5MA 5ARGA 2XGMA 4TXPA 2OOEA 3TWWA 3MGBA 4DI4A 1PAQA 3F9XA 3CVPA 5J90A 1YMPA 2EILE 3ZNGA 2OCCE 3DBSA 2PQRA 3M56A 4BX9A 3ZXSA 2LAIA 3LEWA 5DIZA 4DX6D 4TRQA 3E37A 4LG6A 3HNAA 3U66A 4QEPA 3L82A 3APCA 1N54A 1UN9A 3LJNA 4N3BA 2XQ0A 1MX4A 2BUGA 3S7BA 1V55E 3Q15A 4JHRA 1JPLA 3CIAA 4CRWA 3IHVA 4QQIA 2NSZA 2W5YA 4YVOA 2IY0C 2X6FA 4FJYA 3D9KA 1BLXB 4RLYA 4GZ3A 1QQEA 3MKQA 3URZA 5E76A 3ASOE 4ANXA 1WAO1 5BNWA 4MBGA 3NOGD 2IONA 4GTTA 3EU5A 4HOTA 1UW4B 4J7FA 4GZ6A 3ASNE 5KJLA 3FUFA 3GZSA 4KXKB 2IEJA 3ULQA 3S8PA 3UM0A 5EIBE 3C3QA 2HM8A 1YCSB 2R5SA 3NF1A 3FH8A 1QNFA 5FIOA 4RQIA 5EG2A 3PEVB 2ETCA 3BG1B 3PS6A 4LEUA 3FWVA 4J7WA 5FT9A 2ZXWE 2YHCA 1ELRA 2Y0BG 3MV3B 3FY4A 2LAHA 3V79K 1ZB1A 2J09A 4QEOA 3ABKE 3ZVVA
chains in the Genus database with same CATH topology
2F69A 2OV8A 4I43A 3QB2A 4F3VA 3IHXA 2C0MA 2XCBA 4UI9K 3ZHEB 4XKCA 5F5EA 3CKBA 5EKQD 2R59A 2JEKA 4WWNA 2VQ2A 4XX5A 1O9SA 3CKCA 4KBQA 2RFIA 2RG8A 2IFUA 4EPZA 3Q47B 3CGHA 2AWIA 2YNQA 3G2UA 4JL0A 2Y4UA 4FC8A 1E7UA 4U0SA 2J4DA 2FF4A 5AYFA 3SW9A 3ZYLA 4FADA 1NZNA 3MO2A 1Z6TA 1TJFA 1P5QA 4E6HA 5LSXA 3CHPA 2YINA 3HVEA 4G23A 2WQHA 3ZRHA 3LYAA 3UT8A 1FVHA 3FUDA 3JYSA 3QOUA 2XEVA 4H7XA 1ELKA 4HOQA 4KMOA 1HZ4A 4JA9A 5F59A 4J8DA 3ASFA 3HHMA 3FU6A 3RO3A 3I3NA 3CVWA 3ZYQA 3IBEA 3M57A 4J7IA 4BSXA 1EYHA 3LY7A 3MX3A 1WY6A 3S2AA 2IF4A 5G04J 4YPEA 2GRMA 3D9JA 3L16A 5FQ8A 4NVQA 3KS2A 3B7RL 3LS8A 5FJYA 4XZ4A 2UY1A 2V8SE 2JV0A 4I6JA 4UWKA 3CBMA 2Y4TA 4PH4B 2V0PA 1XNFA 2LO6A 2XPZA 3ML8A 2IOSA 3EP0A 4AU7A 4GA0A 2OVBA 3FU5A 3ONKA 5LOZA 4CDNA 2KCVA 3PH0C 1H6KA 5EDSA 2HR2A 2VSNA 5DBKA 2J9QA 1DVPA 4ANUA 3ASGA 3LJ3A 2BTDA 2L6JA 1NA3A 4FLHA 4NQ0A 3KEZA 3R7RA 3FUEA 4CCAA 2VGXA 3CVLA 4LCTA 4I2WA 4GPKA 1E7VA 3CQGB 4UWFA 3VTXA 3FUIA 3TL5A 4GAAA 2Y3AA 4AVXA 2X6IA 4EQFA 2M63A 4GA1A 2HYZA 4N2SA 3PUJA 3ASHA 2VGYA 1UG3A 4MI5A 2FI7A 2WXIA 1IQUA 3PZDA 4B94A 4C0EA 5BPPA 3LVQE 4WWOA 3KMJA 3I5PA 2C2LA 2WXKA 1E8ZA 1E8XA 2L0TB 4GYWA 1TEZA 1UJJA 2WXHA 5JHNA 4I51A 4JHJA 4B89A 4GCNA 4Y6CA 4N2QA 4JXTA 4YPAA 4CGVA 3L17A 4L2YA 3B7SA 2WXJA 4AP2A 4BX8A 2NC9A 2WPVA 5G04C 2LSVA 4J0UA 2FULA 4FMUA 4JDSA 3TG4A 3GZ2A 4E47A 5F6LA 5ARFA 4GZDA 3TJPA 3OXLA 5T3RA 4BY6A 4J8FA 4NURA 4HS2A 3AS5A 3M53A 4I1MA 1ELWA 1IHGA 4BUPA 4DLOA 4TV3A 3D9NA 2FEZA 3IEGA 4GZ5A 4KVOA 3FUMA 3U3WA 3TG5A 3FTSA 5LSZA 3PE3A 4XI9A 4I1OB 3VV0A 2PM7A 3Q4AB 4OVVA 2XGSA 3FUJA 4BT9A 3FFLA 2G46A 5FQ7A 2L0IA 3LY9A 2FO7A 4U07A 4Z4PA 4RG6A 5JHAA 2V4LA 3ZIMA 4NACA 4AY5A 3SZ7A 3RIBA 4G2VA 4RZ0A 5C2YA 4N3CA 3S7JA 5T5GA 2DIWA 4I17A 4G1TA 4V3IA 2VGXB 2E2EA 3APFA 2X3MA 2IGQA 3MEKA 1PEGA 2VSXE 4AXHA 1S0PA 4BT8A 2WVIA 5ANRA 1IYGA 1A17A 2VSOE 3MKQB 4OVUA 3UX4A 4BFRA 1JWGA 3QWPA 3AU4A 2OVFA 4WUYA 5KJMA 1OWPA 3JUIA 2EQXA 2DBAA 3KAEA 5ANLA 4WNGA 4J8EA 3SF4A 3S7DA 3G2TA 3FDHA 3L13A 2WQ7A 3EIQC 4BWRA 5FTPA 4DK5A 4KZCA 5TH7A 2XGOA 2CHXA 3PNLB 5T4YA 5CPRB 3UQ3A 4DI3A 3CVVA 4HFGA 4L23A 3WXXA 1EF1C 4MRUA 2KZTA 1OWLA 5FZRA 5FWQA 3RRMB 3RRUA 4U63A 4FLBA 4A3VA 3ZW3A 5JIYA 4AY6A 4RVBA 3NQPA 1HH8A 3SBTB 2KM4A 4JLGA 3CHSA 3LDZA 4CEMA 3L08A 3UT4A 1XQHA 4A55A 3BO5A 3SWCA 4KZ0A 3HIZA 4HXIA 3QNKA 5G55A 3S7FA 3TXNA 5TTFA 3KMAA 3OS5A 1ZBPA 2WXNA 3OXFA 4C0MA 1VDYA 2VTBB 4L2LA 2QFCA 3EHMA 3G2SA 2KCKA 3FEYA 4GMJA 3ZYKA 4G24A 3JQ1A 4MLPA 3PE4A 5AJLA 4Q69A 1HE8A 4YPUA 3E4BA 5A7DB 3OOIA 3L54A 2A4ZA 3ESKA 4JC8A 4FU3A 2I6HA 4J6IA 4BTBA 3LPZA 2XRZA 1KT1A 5EX3A 4A3TA 3CQCB 2V5FA 4HLEA 1SZ9A 3QWVA 3O4ZA 4XE0A 3IHYA 4D10C 4CGWA 1PY1A 1E90A 3CVXA 1YA0A 2IOLA 3G2WA 1MT6A 4EZJA 4MI0A 2I9CA 4CDRA 2AXZA 2X6HA 4UWLA 3GYZA 4UQZA 5KJNA 2AXVA 2I1JA 3VLFA 3D9MA 1HFAA 5LFAA 3MO5A 2BQZA 4HOUA 5BT1A 2CG3A 3GW4A 4DPRA 5JINA 1OUVA 3AU5A 5AIJA 4HORA 4FHKA 2WXMA 4GB9A 2AVPA 2ILRA 2KATA 2X6KA 4UQYA 3NZUA 4XIFA 4LUNU 5KJKA 2YHEA 1MHQA 4JA7A 5CCMA 4U0ZA 1XGWA 2WXRA 1Z3YA 1H19A 3FTZA 1LF8A 4N39A 4BTAA 5T0KA 1HF8A 1E8YA 5D0QD 2KZTB 2WMOA 4APOA 4YNMA 4GYYA 3R7QA 3FUKA 2IU1A 3FU0A 3QC1A 1HG5A 2Q7FA 4YNDA 1SQMA 1X5BA 3AS4A 4AV7A 1MUFA 3L6AA 3BG0B 1JWFA 4C1QA 3K9IA 4PUCA 4QFVA 3UMVA 2YQ8A 1HG2A 1Y6IA 3QAQA 4FHJA 3FHEA 2BF0X 2W5ZA 2JLBA 2I1KA 3VLDA 3CVNA 4R7LA 3HVEB 3ML9A 1N3JA 5AYWD 4U04A 2R3AA 4TUUA 1KLXA 2MHKA 3QJZA 1N6AA 3LY8A 1DNPA 4I2ZA 3EJNA 4A1GA 2GW1A 4G26A 3ESLA 4PDXA 2XHEA 3NZSA 2KC7A 1FVFA 3P1UA 4PS7A 4DLQA 5LCWJ 4ATGA 4CT4A 4NJ5A 3PNTB 4O6FA 3UT7A 2C0LA 3FTWA 4F53A 3M54A 2CFZA 1UJKA 2UY1B 2XPYA 2WXGA 4HVBA 4A1SA 3SGHA 3MV2B 3SI5A 3QARA 4XI0A 2GRLA 1OWOA 4EZLA 2ONDA 5AJDA 2CHZA 3VTYA 3ZN3A 3MO0A 1GW6A 5HI7A 4DJAA 1EPUA 4F7AA 5FZSA 2WM9A 5CCLA 4W9RA 3QKYA 4PS8A 3HDXA 3ZHEA 1Y8MA 3VLEA 3F9ZA 3RU0A 2FBNA 2HO1A 1E8WA 4JVSA 4OYSA 3FH7A 3FH5A 3OTNA 3RRNB 3CEQA 4GMLA 4YVQC 3DB5A 4JHKA 4RG9A 4WAFA 2QPWA 4APFA 2WXFA 3ZGQA 1BPOA 4KVMA 2XRYA 3SBSA 1H2UA 3CK8A 4L1BA 4JZYA 3MJWA 4U0UA 4ANWA 5J08A 1OWMA 4IN3B 4LDGA 2R17C 1N52A 4QENA 3QDNA 3U9WA 4WNFA 5HQ8A 1HX8A 3OPEA 4HOSA 2PM6A 3MZLB 3CSTA 3EIJA 3CBPA 4ILIA 4UWGA 3T5XA 4ACLA 3M59A 3RJWA 2WB2A 4IULA 4B8AA 5G05J 3DALA 4URKA 5EX0A 5AENA 2CG2A 5LX8A 1NA0A 5LCWC 3I4GA 3FUNA 3D9IA 3LCAA 1U3DA 1MVXA 3FPDA 3PRZA 3ASDA 4E85A 1U3CA 3ZFWA 1OWNA 1HU3A 1H3IA 4AIFA 2PQNA 4MS6A 2VYIA 1FCHA 3MCXA 3GZ1A 3C98A 4ACKA 1HS6A 4M3OA 5BV0A 5LP0A 1UN8A 3OAWA 4K0RA 3IKOB 3M58A 3RO2A 4J8OA 3G2VA 3PREA 3FULA 2WQ6A 2AXUA 4H7YA 3CR3A 3BEEA 3FP3A 4AOFA 3APDA 3Q5MA 2X38A 1MQSA 2UWJG 2XGMA 2WXQA 5ARGA 4O30A 4FA6A 2OOEA 3B13A 2L9BA 3MGBA 1L5JA 4KYOB 4DI4A 2P58C 1PAQA 3F9XA 4IJDA 3CVPA 5J90A 3QWWA 2I2OA 3PDNA 3DBSA 2PQRA 3M56A 5FZQA 4U8HA 2J4BA 4BX9A 3ZXSA 3SFZA 2LAIA 3CHMA 3LEWA 4EZKA 5DIZA 4TRQA 1HO8A 4IYPA 2VSYA 2ZU6B 3CVYA 5BUZA 2NXPA 2AW6A 3CSFA 4FJZA 5CMYA 4J83A 4WNEA 3EDTB 4H12A 3UUXA 1HXIA 4J8SA 2LSUA 3HNAA 3ONLA 3ZEFA 5G05C 3U66A 4QEPA 4I9EA 4NRHB 3APCA 3F9YA 1N54A 3PVLA 2GGFA 1UN9A 4N3BA 2XQ0A 2IJGX 2XCCA 4ANVA 2QY7A 1H0AA 3MYVA 4IJ8A 2BUGA 4K03A 1ZKKA 2DCPA 3S7BA 1W3BA 2LNIA 2J49A 4I6GA 4CDMA 5T0MA 3Q15A 4FULA 4GZCA 4GU5A 4JHRA 3SNXA 3ZPJA 1JPLA 3CIAA 2CFUA 3CHRA 4JPSA 5JHBA 2O8JA 5F6KC 3ZYMA 4N5CA 3K5KA 4GYOA 3LKUA 4UQXA 2MRIA 1ZU2A 4G11A 3SHFA 4CRWA 4G25A 3JCKC 3IHVA 4AM9A 5JJ0A 4CT0A 2NSZA 3RJVA 3CK7A 1N6CA 2W5YA 3CHQA 4YVOA 4KT6B 3D9OA 4FP7A 2X6FA 2IQCA 4FJYA 4B0ZA 5TEGA 1QZ2A 3I4RB 5D0OD 3D9KA 4GZ3A 4YNPA 5C1DA 3KMTA 2X6JA 1IQRA 1QQEA 3MKQA 3RQ4A 2CHWA 3URZA 5E76A 5M72A 1KT0A 1TJCA 5CMWA 1H2TC 4ANXA 3MA5A 1PC2A 3AS8A 3OXGA 1WAO1 2WXPA 5BNWA 4JEHA 4B8CB 2IONA 2RD0A 3TAXA 3U64A 3CK9A 4Q94A 3P2BA 4HOTA 1UW4B 3HYMB 4AJWA 4JEUA 4AEZC 4J7FA 1Z3XA 3Q49B 3R9AB 4GZ6A 2MOWA 4UI9J 5BV1A 5KJLA 3M55A 3M5AA 4ILHB 1SZAA 3B7UX 3FUFA 3GZSA 4KXKB 4RSYA 5CHEE 3D3MA 3CVQA 3ZVVA 4EECA 3ULQA 5A6CA 1E96B 3S8PA 2WXLA 4XKBA 3CVUA 3N71A 5A23A 3UPVA 2PZIA 3PEUB 5ENNA 3ENEA 4EBAG 1JUQA 3FTYA 3RK6A 4GCOA 2HM8A 3FTUA 3QK0A 1WM5A 2J08A 2R5SA 2VJ8A 2A5UA 3FH8A 1H2VC 1QNFA 2XPIA 3NF1A 3FU3A 4I1AA 3CV0A 2VTBA 3EHNA 3CBOA 5EG2A 3TXMA 3PEVB 2KCLA 4ME2A 3U4TA 3BG1B 5BW8C 5JJTA 3IV0A 4ILGA 4N3AA 3SD5A 3PS6A 5E75A 3FTVA 5T8IA 4LEUA 3TGOA 3FWVA 3D9PA 2WMNA 5FT9A 3T5VA 4JW1A 3PUKA 4I6EA 4ABNA 5FQ6A 2J07A 4L7TA 4WNDA 2YHCA 4C9BB 4Y6WA 3CHOA 1ELRA 4F1SA 3RAYA 3MKRA 4EBAA 1B89A 3B7TA 3FUHA 3LXUX 4PS3A 3RKVA 3MV3B 4I9CA 3FY4A 4GA2A 2LAHA 1ML9A 3D9LA 3FTXA 3O48A 5G2NA 3CLJA 4LRZA 4UI9C 5JJ7A 3LVRE 3F9WA 3JQ0A 1INZA 4WWPA 5JJ6A 2J09A 2E0IA 2PL2A 3L22A 3KD7A 4MKTA 5KCMA 1MVHA 4QEOA 1EDUA 4IRUA 1NP7A 4Q96A 3DPDA 3T8MA 3FEXA 3VUZA 4LERA 4UWHA 4P29A 2WXOA 5FQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F69 A;  3IHX A;  4F3V A;  2C0M A;  2XCB A;  4UI9 K;  3ZHE B;  5F5E A;  3CKB A;  5EKQ D;  1O9S A;  2VQ2 A;  2RFI A;  3CKC A;  4KBQ A;  2IFU A;  3Q47 B;  4JL0 A;  2Y4U A;  4U0S A;  5AYF A;  2FF4 A;  3SW9 A;  1NZN A;  3MO2 A;  1P5Q A;  5LSX A;  4G23 A;  2WQH A;  3LYA A;  3JYS A;  3QOU A;  2XEV A;  4H7X A;  4HOQ A;  5F59 A;  1HZ4 A;  4JA9 A;  4J8D A;  3ASF A;  3RO3 A;  3M57 A;  4J7I A;  3LY7 A;  2IF4 A;  5G04 J;  4YPE A;  4NVQ A;  3KS2 A;  5FJY A;  2UY1 A;  2JV0 A;  3CBM A;  2Y4T A;  1XNF A;  3EP0 A;  4AU7 A;  4GA0 A;  2KCV A;  2HR2 A;  2VSN A;  5DBK A;  2J9Q A;  3ASG A;  2L6J A;  1NA3 A;  4NQ0 A;  2VGX A;  3CVL A;  4I2W A;  4GPK A;  3VTX A;  4EQF A;  4GA1 A;  2HYZ A;  4N2S A;  3ASH A;  2VGY A;  4MI5 A;  2FI7 A;  4B94 A;  3KMJ A;  2C2L A;  4GYW A;  5JHN A;  4I51 A;  4N2Q A;  4GCN A;  4Y6C A;  4YPA A;  4CGV A;  2NC9 A;  2WPV A;  5G04 C;  2LSV A;  4J0U A;  4FMU A;  4JDS A;  3TG4 A;  3GZ2 A;  4E47 A;  5F6L A;  5ARF A;  3OXL A;  4J8F A;  3M53 A;  3AS5 A;  1ELW A;  1IHG A;  4BUP A;  2FEZ A;  3IEG A;  4GZ5 A;  3U3W A;  3TG5 A;  5LSZ A;  3PE3 A;  4XI9 A;  3VV0 A;  3Q4A B;  2XGS A;  4BT9 A;  3FFL A;  2G46 A;  3LY9 A;  2FO7 A;  4U07 A;  4Z4P A;  4RG6 A;  4AY5 A;  3SZ7 A;  3RIB A;  4G2V A;  4RZ0 A;  4N3C A;  3S7J A;  5T5G A;  4I17 A;  4G1T A;  2VGX B;  2E2E A;  2IGQ A;  3MEK A;  1PEG A;  4BT8 A;  1IYG A;  1A17 A;  3QWP A;  4WUY A;  5KJM A;  2DBA A;  3KAE A;  4WNG A;  4J8E A;  3SF4 A;  3S7D A;  4BWR A;  5TH7 A;  5FTP A;  2XGO A;  5CPR B;  3UQ3 A;  3WXX A;  5FZR A;  5JIY A;  4AY6 A;  1HH8 A;  4JLG A;  1XQH A;  3BO5 A;  3SWC A;  3S7F A;  5TTF A;  3KMA A;  3OS5 A;  1ZBP A;  3OXF A;  2QFC A;  2KCK A;  4G24 A;  3PE4 A;  4YPU A;  3E4B A;  5A7D B;  3OOI A;  3ESK A;  2I6H A;  4BTB A;  3LPZ A;  1KT1 A;  5EX3 A;  2V5F A;  3QWV A;  4CGW A;  1YA0 A;  1MT6 A;  4MI0 A;  4CDR A;  3GYZ A;  4UQZ A;  5KJN A;  3MO5 A;  2BQZ A;  4HOU A;  5BT1 A;  3GW4 A;  5JIN A;  1OUV A;  4HOR A;  2AVP A;  2KAT A;  5KJK A;  4UQY A;  4XIF A;  4JA7 A;  5CCM A;  4U0Z A;  4N39 A;  4BTA A;  5T0K A;  5D0Q D;  4APO A;  4YNM A;  4GYY A;  2Q7F A;  4YND A;  3AS4 A;  1MUF A;  4C1Q A;  3K9I A;  2YQ8 A;  2W5Z A;  2JLB A;  3CVN A;  1N3J A;  5AYW D;  4U04 A;  2R3A A;  1KLX A;  2MHK A;  1N6A A;  3LY8 A;  4I2Z A;  2GW1 A;  4G26 A;  5LCW J;  2KC7 A;  4NJ5 A;  4O6F A;  2C0L A;  3M54 A;  2UY1 B;  4A1S A;  3MV2 B;  4XI0 A;  3MO0 A;  2OND A;  3VTY A;  3ZN3 A;  5HI7 A;  5FZS A;  5CCL A;  4W9R A;  3QKY A;  3ZHE A;  1Y8M A;  3F9Z A;  3RU0 A;  2FBN A;  2HO1 A;  3DB5 A;  3CEQ A;  4YVQ C;  2QPW A;  4RG9 A;  3ZGQ A;  3CK8 A;  4U0U A;  4IN3 B;  4LDG A;  4QEN A;  3QDN A;  4WNF A;  5HQ8 A;  3OPE A;  4HOS A;  3CBP A;  3M59 A;  3RJW A;  5G05 J;  3DAL A;  5EX0 A;  1NA0 A;  5LCW C;  3LCA A;  1MVX A;  3FPD A;  3ASD A;  3ZFW A;  1H3I A;  4AIF A;  2PQN A;  2VYI A;  1FCH A;  3GZ1 A;  3M58 A;  3RO2 A;  4J8O A;  4H7Y A;  3BEE A;  3FP3 A;  3Q5M A;  5ARG A;  2UWJ G;  2XGM A;  4O30 A;  2OOE A;  4KYO B;  2P58 C;  3F9X A;  4IJD A;  3CVP A;  3QWW A;  3PDN A;  3M56 A;  2PQR A;  5FZQ A;  5DIZ A;  2VSY A;  4J83 A;  4WNE A;  3EDT B;  4H12 A;  3UUX A;  1HXI A;  2LSU A;  3HNA A;  5G05 C;  4QEP A;  4I9E A;  4NRH B;  3F9Y A;  4N3B A;  2XCC A;  4IJ8 A;  2BUG A;  1ZKK A;  3S7B A;  1W3B A;  2LNI A;  5T0M A;  3Q15 A;  4JHR A;  3ZPJ A;  5F6K C;  2O8J A;  4N5C A;  3K5K A;  4GYO A;  3LKU A;  4UQX A;  1ZU2 A;  4G25 A;  4AM9 A;  5JJ0 A;  3RJV A;  3CK7 A;  1N6C A;  2W5Y A;  4YVO A;  5TEG A;  1QZ2 A;  5D0O D;  4GZ3 A;  4YNP A;  5C1D A;  3KMT A;  1QQE A;  3RQ4 A;  3URZ A;  5M72 A;  1KT0 A;  1TJC A;  3MA5 A;  1PC2 A;  3AS8 A;  3OXG A;  1WAO 1;  5BNW A;  3TAX A;  3CK9 A;  4HOT A;  3HYM B;  4J7F A;  3Q49 B;  3R9A B;  4GZ6 A;  4UI9 J;  5KJL A;  3M55 A;  3M5A A;  5CHE E;  4KXK B;  5A6C A;  3CVQ A;  3ULQ A;  1E96 B;  3S8P A;  3N71 A;  3UPV A;  2PZI A;  4GCO A;  1WM5 A;  2R5S A;  3NF1 A;  4I1A A;  2XPI A;  3CV0 A;  3CBO A;  5EG2 A;  2KCL A;  4ME2 A;  3U4T A;  5BW8 C;  5JJT A;  4N3A A;  3TGO A;  4LEU A;  3FWV A;  5FT9 A;  4ABN A;  4WND A;  2YHC A;  4Y6W A;  1ELR A;  3RAY A;  3MKR A;  1B89 A;  3RKV A;  3MV3 B;  4I9C A;  4GA2 A;  1ML9 A;  3O48 A;  4UI9 C;  5JJ7 A;  3F9W A;  5JJ6 A;  2PL2 A;  3KD7 A;  1MVH A;  4QEO A;  3VUZ A; 
#chains in the Genus database with same CATH topology
 3QB2 A;  3JXI A;  4UI9 K;  3CKB A;  4WWN A;  3CKC A;  2RG8 A;  1E7U A;  2J4D A;  2FF4 A;  3V2O A;  3MO2 A;  4E6H A;  3CHP A;  2YIN A;  4BES A;  3LYA A;  3Q9N C;  1IXV A;  2F8Y A;  3UT8 A;  2P9U G;  1S70 B;  2XEV A;  5F59 A;  4JA9 A;  3ASF A;  1JCR A;  4X8Q A;  1TN7 A;  2GRM A;  3D9J A;  5FQ8 A;  1NI1 A;  3LS8 A;  3HXB A;  2V8S E;  1K8K G;  2Y4T A;  1N4S A;  4PH4 B;  2V0P A;  4AU7 A;  2OVB A;  4DX5 D;  3PH0 C;  4N5Q A;  3KEZ A;  3CQG B;  3VTX A;  4GAA A;  4K5A B;  4A63 B;  2VGY A;  1UG3 A;  4B94 A;  1O5M A;  4C0E A;  3LVQ E;  5JHN A;  4BET A;  4JHJ A;  4B89 A;  2H6F A;  2BED A;  3B7S A;  2WPV A;  1TNZ A;  4E47 A;  5T3R A;  4J8F A;  1NL4 A;  2FEZ A;  4KVO A;  3Q4A B;  3L9T A;  2AJA A;  3FUJ A;  5FQ7 A;  4Z4P A;  5AN8 A;  5JHA A;  2V4L A;  4NAC A;  4G2V A;  5C2Y A;  1TNO A;  4BT8 A;  2VSO E;  3UX4 A;  1JWG A;  3JUI A;  3G2T A;  2WQ7 A;  3AJI A;  2CHX A;  3UQ3 A;  4K5B A;  1EF1 C;  2V5Q C;  4MRU A;  2KZT A;  4HNA D;  3RRM B;  4U63 A;  5JIY A;  4AY6 A;  1TNY A;  2QZA A;  3UT4 A;  4KZ0 A;  3HIZ A;  3TXN A;  1V54 E;  3KMA A;  3PZ4 A;  3G2S A;  3FEY A;  5AJL A;  2A4Z A;  1TR4 A;  3TWS A;  2V5F A;  1SZ9 A;  1PY1 A;  4EZJ A;  4MI0 A;  2I9C A;  2AXZ A;  4UWL A;  2P2C P;  3GYZ A;  5EYL A;  4F1P A;  3D9M A;  2BQZ A;  3IXE A;  5BT1 A;  2CG3 A;  5AIJ A;  4XIF A;  3NZU A;  1QYM A;  5CCM A;  1DCE A;  1LF8 A;  5D0Q D;  2ZGG A;  2Q7F A;  1SQM A;  3ISM C;  3UMV A;  4QFV A;  1HG2 A;  1Y6I A;  3FHE A;  2W5Z A;  2I1K A;  3ML9 A;  4DUI A;  1K1B A;  2R3A A;  4TUU A;  2MHK A;  1N6A A;  4C9B B;  4APF A;  1FVF A;  4ATG A;  5AQA A;  4F53 A;  3V2X A;  3SI5 A;  1BI7 B;  2GRL A;  1OWO A;  2OND A;  3ZN3 A;  1EPU A;  5FZS A;  5B3S E;  4PS8 A;  3HDX A;  3VLE A;  3RU0 A;  2HO1 A;  3UKR G;  4JVS A;  3RRN B;  3JXJ A;  4JHK A;  2EIN E;  4EHM A;  2OEW A;  3CK8 A;  5FIN A;  5J08 A;  4IN3 B;  1N52 A;  3U9W A;  1UOH A;  5HQ8 A;  1HX8 A;  4HOS A;  3CBP A;  3CST A;  4ILI A;  4ACL A;  4URK A;  5AEN A;  2CG2 A;  3LCA A;  1U3D A;  5EIL A;  3ABL E;  1FT2 A;  2XS8 A;  3DSX A;  1FCH A;  1O1T A;  4TXR A;  3OAW A;  3PRE A;  1N4R A;  2AXU A;  3CR3 A;  3SY2 A;  4AOF A;  4O30 A;  4FA6 A;  2L9B A;  2DYR E;  4KYO B;  5AAO A;  4IJD A;  3QWW A;  2I2O A;  5FZQ A;  2J4B A;  2VSY A;  2ZU6 B;  3CVY A;  5BUZ A;  5CMY A;  4WNE A;  3E30 A;  2GRR B;  2B6C A;  4J8S A;  2DZN A;  4I9E A;  2GGF A;  2XCC A;  4ANV A;  3MYV A;  4IJ8 A;  1ZKK A;  4I6G A;  3CHR A;  2O8J A;  5JHB A;  3K5K A;  4GYO A;  2MRI A;  1ZU2 A;  3DEO A;  3CK7 A;  1N6C A;  1H6O A;  2IQC A;  1IHB A;  5TEG A;  1QZ2 A;  5D0O D;  3EUV A;  5C1D A;  3KSL A;  3RQ4 A;  1KT0 A;  4HRN A;  1H2T C;  3UI2 A;  1PC2 A;  2WXP A;  4U96 D;  2XEE A;  4HRL A;  3CK9 A;  2V4H C;  4AJW A;  3Q49 B;  5BV1 A;  5CHE E;  3B7U X;  1A5E A;  4EEC A;  3ULY A;  4XKB A;  3JUE A;  1S64 A;  4EBA G;  2IO2 C;  1JUQ A;  2J08 A;  2VTB A;  3FU3 A;  3CV0 A;  3CBO A;  3W9G A;  3DST A;  3U4T A;  4ILG A;  5E75 A;  1LD7 A;  3D9P A;  5FQ6 A;  3CHO A;  1B89 A;  4PS3 A;  3KEA A;  2ETB A;  4GA2 A;  1ML9 A;  3NOC D;  4GMR A;  3DEP A;  3NBN B;  5JJ7 A;  3F9W A;  3UM3 A;  1IKN D;  5JJ6 A;  2PL2 A;  3KD7 A;  1MVH A;  1SW6 A;  1EDU A;  3UIP C;  2R03 A;  4C48 B;  2L6B A;  2WXO A;  2F69 A;  2OV8 A;  4HRM B;  2C0M A;  2XCB A;  2R59 A;  5CRU A;  3CGH A;  1Z5S C;  4FC8 A;  5CBO A;  3ZU7 B;  3SW9 A;  3ZKJ A;  4FAD A;  1NZN A;  1Z6T A;  1FPP A;  3HVE A;  1N95 A;  3JYS A;  3QOU A;  1HZ4 A;  2KBX A;  4J8D A;  3I3N A;  3ZYQ A;  4J7I A;  2IF4 A;  5G04 J;  1FT1 A;  3KS2 A;  4L9P A;  5JMN D;  2JV0 A;  4I6J A;  1OCZ E;  2XPZ A;  4GA0 A;  3RSE G;  3UTM A;  2HR2 A;  3AG2 E;  2J9Q A;  1DVP A;  4ANU A;  2L6J A;  1NA3 A;  2RFA A;  1OCR E;  2VGE A;  3FUE A;  2VGX A;  4CCA A;  3CVL A;  4GPK A;  3B95 A;  3FUI A;  2GRN B;  4DX2 A;  3DSS A;  4EQF A;  2M63 A;  2FI7 A;  2WXI A;  1G3N B;  3PZD A;  4HLL A;  1E8Z A;  1E8X A;  2L0T B;  4GYW A;  1TEZ A;  4I51 A;  4N2Q A;  4U8Y D;  4Y6C A;  4YPA A;  4JXT A;  3L17 A;  4L2Y A;  4YDY A;  5G04 C;  4FMU A;  3TG4 A;  2ZIS A;  5KNH D;  5ARF A;  2DWZ A;  4NUR A;  4HS2 A;  4U7E B;  5HKP A;  4I1M A;  1ELW A;  3D9N A;  3FUM A;  3U3W A;  3PE3 A;  4G8L A;  3VV0 A;  2PM7 A;  2H6H A;  4YDE A;  4BT9 A;  1SA5 A;  3LY9 A;  4RG6 A;  2R2L A;  1OCC E;  3ZIM A;  2RFM A;  4RZ0 A;  4N3C A;  3TWX A;  2DIW A;  4Z68 A;  4BSZ B;  2VSX E;  1S0P A;  3SFX A;  3TWQ A;  1IYG A;  4BFR A;  3AU4 A;  4BEP A;  5CEA A;  3S7D A;  3L13 A;  5TH7 A;  5FTP A;  5CPR B;  3CVV A;  5FWQ A;  3PZ3 A;  2H6I A;  1HH8 A;  3CHS A;  3LDZ A;  4CEM A;  3S7F A;  5TTF A;  2P9N G;  1VDY A;  2KXP C;  2KCK A;  3PZ1 A;  4GMJ A;  5IY5 E;  4HI9 A;  3L54 A;  1OT8 A;  4FU3 A;  2I6H A;  3LPZ A;  1KT1 A;  1H6P A;  4A3T A;  5ENO D;  4XE0 A;  3HG0 D;  2F0Y A;  2I1J A;  3MO5 A;  4HOU A;  3GW4 A;  1OUV A;  2AVP A;  2ILR A;  2YHE A;  3ZUV B;  2XZD G;  2WXR A;  1Z3Y A;  1H19 A;  3FTZ A;  4LNB A;  4N39 A;  4BTA A;  1HF8 A;  2KZT B;  2WMO A;  1WDY A;  3R7Q A;  3Q9U C;  3QC1 A;  1HG5 A;  1OXJ A;  4C1Q A;  4PUC A;  2XEN A;  4GTO A;  5AYW D;  5KBA A;  4I2Z A;  4A1G A;  4G26 A;  3P1U A;  2KC7 A;  3V31 A;  2C0L A;  3DSU A;  2FO1 E;  2CFZ A;  2UY1 B;  2XPY A;  5CRV A;  2WXG A;  4HVB A;  3SGH A;  3QAR A;  4XI0 A;  4EZL A;  5B1B E;  1GW6 A;  5HI7 A;  4B93 B;  3J5Q B;  5CCL A;  4W9R A;  3QKY A;  1X81 A;  3F9Z A;  4OYS A;  3Q78 A;  2R02 A;  3OTN A;  3DB5 A;  3CEQ A;  2WXF A;  3UM2 A;  3SBS A;  1H2U A;  4L1B A;  2PNN A;  4LDG A;  2R17 C;  3R9M A;  3QDN A;  4F6R D;  1MZC A;  4WNF A;  2P9I G;  3MZL B;  3EIJ A;  3M59 A;  3RJW A;  1BD8 A;  4IUL A;  5G05 J;  3DAL A;  3Q73 A;  1NA0 A;  3D9I A;  3DXM G;  1D8E A;  4E85 A;  1HU3 A;  3TWV A;  2Y1L E;  2BKK B;  2VYI A;  3MCX A;  3C98 A;  4ACK A;  5LP0 A;  4K0R A;  3IKO B;  3M58 A;  2P9P G;  3G2V A;  2WQ6 A;  5KWD A;  3BEE A;  2X38 A;  1MQS A;  3B13 A;  2ETA A;  3UKU G;  2P58 C;  4U8H A;  3SFZ A;  3DWL G;  4IYP A;  5AQ9 A;  2NXP A;  3CSF A;  4DRX E;  3EDT B;  4H12 A;  1DC2 A;  3ZEF A;  5G05 C;  3F9Y A;  3EU9 A;  3PVL A;  5ENT D;  2QY7 A;  4U95 D;  3X2Q E;  1W3B A;  4FUL A;  4GZC A;  4GU5 A;  3SNX A;  2CFU A;  4JPS A;  4UQX A;  4G11 A;  4G25 A;  3JCK C;  3RJV A;  4KT6 B;  3D9O A;  4B0Z A;  2X6J A;  1IQR A;  2CHW A;  5M72 A;  1TJC A;  5CMW A;  3MA5 A;  3OXG A;  3AS8 A;  3TAX A;  4JB8 P;  3P2B A;  4Q94 A;  4JEU A;  4AEZ C;  3M5A A;  4ILH B;  2P9L G;  3D3M A;  3CVQ A;  3UXG A;  3PEU B;  3RK6 A;  3QK0 A;  1WM5 A;  2A5U A;  4I1A A;  1H2V C;  1D8D A;  3TXM A;  2KCL A;  4ME2 A;  4LNU D;  5JJT A;  3SD5 A;  4N3A A;  3SFY A;  3FTV A;  4O60 A;  2WMN A;  3PUK A;  5B1A E;  4L7T A;  1N11 A;  2BKG A;  3Q79 A;  4F1S A;  3RAY A;  3B7B A;  3FUH A;  4I9C A;  3HXD A;  4LRZ A;  3BU8 A;  3JQ0 A;  4WWP A;  3L22 A;  4MKT A;  4IRU A;  4Q96 A;  1NP7 A;  3DPD A;  4LER A;  2DYS E;  3IHX A;  4GTR A;  3ZHE B;  4XKC A;  1O9S A;  2JEK A;  4XX5 A;  2VQ2 A;  3D9H A;  4KBQ A;  1N4Q A;  4EPZ A;  3Q47 B;  2AWI A;  3G2U A;  3ZYL A;  4G23 A;  2WQH A;  4YDO A;  3Q75 A;  3FUD A;  4H7X A;  4HOQ A;  3RO3 A;  3HHM A;  2EIK E;  1EYH A;  5CEC B;  1SVX A;  1WY6 A;  2DZO A;  4NVQ A;  4ZFH A;  1TYQ G;  4XZ4 A;  1YYH A;  4UWK A;  3TWR A;  1XNF A;  2KCV A;  1H6K A;  5EDS A;  1N94 A;  2VSN A;  5DBK A;  1D9S A;  2QC9 A;  2B0O E;  3LJ3 A;  1KPS B;  2BTD A;  4FLH A;  5EN5 D;  4HQD A;  2Y3A A;  4LNG A;  4OAU C;  4GTP A;  2NYJ A;  4GA1 A;  3PUJ A;  3ASH A;  3T8K A;  2GRO B;  3F6Q A;  5BPP A;  3KMJ A;  3I5P A;  2C2L A;  2WXK A;  1UJJ A;  2WXH A;  4GCN A;  4CGV A;  4AP2 A;  3AAA C;  2J8S D;  2NC9 A;  1TNB A;  2F8X K;  4GZD A;  3TJP A;  3E33 A;  3M53 A;  4DLO A;  5LSZ A;  4XI9 A;  4I1O B;  4TXQ A;  1SA4 A;  4GTS A;  3FFL A;  2G46 A;  2L0I A;  5AQ7 A;  4G8K A;  3SZ7 A;  4XEI G;  5T5G A;  3NAW A;  4I17 A;  2LXL A;  4G1T A;  3HXE A;  4V3I A;  2VGX B;  2E2E A;  3APF A;  2WVI A;  1A17 A;  3MKQ B;  3QWP A;  2EQX A;  3KAE A;  5ANL A;  4WNG A;  3SF4 A;  5CER B;  3PNL B;  5HRY A;  4L23 A;  3WXX A;  1OWL A;  1BI8 B;  5FZR A;  3ZW3 A;  4RVB A;  3NQP A;  3SO8 A;  3SBT B;  4YDW A;  3L08 A;  1XQH A;  3SWC A;  4HXI A;  5G55 A;  3OS5 A;  1ZBP A;  2WXN A;  3OXF A;  4C0M A;  4L2L A;  2QFC A;  3EHM A;  3BUA A;  3ZYK A;  5JA4 D;  1HE8 A;  5A7D B;  3ESK A;  2XRZ A;  3CQC B;  4D10 C;  3CVX A;  3O4Z A;  4CGW A;  1TN8 A;  1E90 A;  4CDR A;  2X6H A;  5ITZ F;  3V30 A;  4ZHB A;  3VLF A;  1HFA A;  4BER A;  2XZT G;  4DPR A;  3AU5 A;  4HOR A;  4FHK A;  2X6K A;  4LUN U;  1MHQ A;  1DCQ A;  4U0Z A;  5T0K A;  1OY3 D;  3HXC A;  4APO A;  3DRA A;  4GYY A;  3FUK A;  2R05 A;  2Y69 E;  3UIO C;  4YND A;  1X5B A;  3EHR A;  3AS4 A;  1O1S A;  1MUF A;  3BG0 B;  1JWF A;  3K9I A;  3DSV A;  1S63 A;  3QAQ A;  2BF0 X;  3TWT A;  3VLD A;  3CVN A;  4R7L A;  3TWU A;  1KLX A;  3QJZ A;  3EJN A;  3ESL A;  2XHE A;  4DLQ A;  5BXO A;  3PNT B;  3UT7 A;  4J8Y A;  3M54 A;  1UJK A;  1MX2 A;  4A1S A;  3MO0 A;  3VTY A;  2CHZ A;  4F7A A;  2WM9 A;  5AAR A;  4GML A;  4YVQ C;  4GTV A;  4WAF A;  5D2M C;  1AWC B;  4KVM A;  2XRY A;  3EHQ A;  4JZY A;  3MJW A;  4ANW A;  2JAB A;  1OWM A;  4QEN A;  3UM1 A;  2DVW A;  1U2V G;  3OPE A;  1O1R A;  5EX0 A;  4CZ2 D;  5LX8 A;  4K5C A;  1MVX A;  3ASD A;  1U3C A;  1H3I A;  2PQN A;  1KZO A;  4M3O A;  2H6G A;  3RO2 A;  4J8O A;  3DSW A;  3C72 A;  4H7Y A;  3APD A;  2UWJ G;  2WXQ A;  1L5J A;  3PDN A;  3PZ2 A;  1BU9 A;  3WG7 E;  3CHM A;  4U8V D;  4EZK A;  1TN6 A;  1HO8 A;  2XEH A;  2AW6 A;  4FJZ A;  4J83 A;  4JD2 G;  2IO3 C;  1N4P A;  1QBQ A;  3UUX A;  1HXI A;  2LSU A;  3ONL A;  4NRH B;  2HE0 A;  3UIN C;  2IJG X;  3NB2 A;  1H0A A;  4K03 A;  2DCP A;  2LNI A;  3C3R A;  2J49 A;  3C5R A;  4CDM A;  5T0M A;  3DPY A;  1N9A A;  3ZPJ A;  5F6K C;  3ZYM A;  4N5C A;  4DX1 A;  3LKU A;  3SHF A;  4AM9 A;  5JJ0 A;  4CT0 A;  2F37 A;  3CHQ A;  4FP7 A;  3I4R B;  4YNP A;  3KMT A;  4JEH A;  4B8C B;  2RD0 A;  3U64 A;  3HRA A;  3HYM B;  1MJ0 A;  1Z3X A;  3R9A B;  2MOW A;  4UI9 J;  3M55 A;  4RSY A;  2ZGD A;  1SZA A;  5A6C A;  1NFI E;  1OCO E;  5CBN A;  1E96 B;  4O1O A;  4TUM A;  2WXL A;  3CVU A;  3N71 A;  5A23 A;  1JCS A;  3UPV A;  2PZI A;  4CYM D;  5ENN A;  3ENE A;  3FTY A;  4GCO A;  3FTU A;  2VJ8 A;  2XPI A;  2EIJ E;  3EHN A;  5BW8 C;  3IV0 A;  3TGO A;  1N0R A;  5T8I A;  5EID A;  3T5V A;  4JW1 A;  4I6E A;  4ABN A;  4OAV B;  2J07 A;  5CED B;  4WND A;  4Y6W A;  3MKR A;  1RZ4 A;  4EBA A;  1MYO A;  3B7T A;  3LXU X;  3RKV A;  3D9L A;  3FTX A;  3O48 A;  5G2N A;  3CLJ A;  4UI9 C;  3LVR E;  1INZ A;  2E0I A;  5KCM A;  3T8M A;  3FEX A;  3VUZ A;  4UWH A;  4P29 A;  5FQ4 A;  4I43 A;  4DX7 D;  4F3V A;  5F5E A;  5EKQ D;  2RFI A;  2IFU A;  4JL0 A;  2YNQ A;  2Y4U A;  4U0S A;  5AYF A;  1MX6 A;  1TJF A;  5D66 A;  1P5Q A;  5LSX A;  3ZRH A;  1FVH A;  1ELK A;  4KMO A;  3FU6 A;  3CVW A;  3M57 A;  3IBE A;  4BSX A;  3LY7 A;  3MX3 A;  3S2A A;  4YPE A;  3L16 A;  3B7R L;  2OEV A;  5FJY A;  2UY1 A;  4HBD A;  3CBM A;  1Q2Z A;  2LO6 A;  3ML8 A;  2IOS A;  3EP0 A;  3FU5 A;  3ONK A;  5LOZ A;  2ZIR A;  4CDN A;  4HI8 A;  5H7P A;  2QYU A;  3ASG A;  4NQ0 A;  3R7R A;  4LCT A;  4I2W A;  1E7V A;  4UWF A;  3TL5 A;  1N0Q A;  4AVX A;  1K3Z D;  2X6I A;  2HYZ A;  4N2S A;  4MI5 A;  1IQU A;  4WWO A;  1LD8 A;  5ENP D;  2WXJ A;  4BX8 A;  2LSV A;  4J0U A;  2FUL A;  4JDS A;  3GZ2 A;  2RKK A;  5F6L A;  4HB5 A;  3OXL A;  4BY6 A;  3AS5 A;  3KSQ A;  1JCQ A;  4ATZ D;  1IHG A;  4BUP A;  3E32 A;  4TV3 A;  3AG1 E;  3IEG A;  4GZ5 A;  3TG5 A;  3FTS A;  2P9S G;  4OVV A;  2XGS A;  2FO7 A;  4U07 A;  4AY5 A;  3RIB A;  3S7J A;  3Q7F A;  2X3M A;  2IGQ A;  3MEK A;  1PEG A;  4AXH A;  5ANR A;  4OVU A;  2LUH A;  2OVF A;  1TNU A;  4WUY A;  1OWP A;  3DXK G;  5KJM A;  2DBA A;  5KNG A;  4J8E A;  2P9K G;  3FDH A;  3EIQ C;  4BWR A;  4DK5 A;  4KZC A;  2XGO A;  5T4Y A;  4DI3 A;  3AG3 E;  4HFG A;  3C3O A;  4O1P A;  3RRU A;  4FLB A;  4A3V A;  1LTX A;  5AQB A;  2KM4 A;  4JLG A;  4A55 A;  3BO5 A;  3QNK A;  2VTB B;  4G24 A;  3JQ1 A;  4MLP A;  3PE4 A;  4Q69 A;  4YPU A;  3E4B A;  3OOI A;  3AG4 E;  2LXM A;  4JC8 A;  4J6I A;  3BQO A;  4BTB A;  5EX3 A;  4HLE A;  3W9F A;  3QWV A;  3IHY A;  5ENS D;  4UUC A;  1YA0 A;  2IOL A;  3G2W A;  1MT6 A;  4GPM A;  4GTQ A;  4UQZ A;  5KJN A;  2AXV A;  3ZXP A;  5LFA A;  3SQV A;  5JIN A;  2WXM A;  4GB9 A;  3Q7A A;  2KAT A;  5KJK A;  4UQY A;  4JA7 A;  1XGW A;  2GRQ B;  1E8Y A;  4YNM A;  4NIK A;  2IU1 A;  2XS1 A;  3FU0 A;  4AV7 A;  3L6A A;  1WG0 A;  2YQ8 A;  4FHJ A;  3ULE G;  2JLB A;  4LSZ E;  3HVE B;  1N3J A;  4U04 A;  3LY8 A;  1DNP A;  2GW1 A;  4PDX A;  5LCW J;  3NZS A;  2GRP B;  4PS7 A;  5HS0 A;  4CT4 A;  4NJ5 A;  4O6F A;  3FTW A;  5ENR D;  3MV2 B;  5ENQ D;  2A5E A;  5AJD A;  5BXU A;  3ABM E;  4DJA A;  1K1A A;  3ZHE A;  1Y8M A;  2QYJ A;  3RAU A;  2FBN A;  1E8W A;  3FH7 A;  3FH5 A;  2QPW A;  4RG9 A;  3ZGQ A;  1BPO A;  4GTM A;  1RW2 A;  3E34 A;  4U0U A;  4M7C A;  3J5P A;  2PM6 A;  4UWG A;  3T5X A;  2WB2 A;  4B8A A;  5LCW C;  3I4G A;  3FUN A;  3T9K A;  3FPD A;  3PRZ A;  3ZFW A;  1OWN A;  4AIF A;  4MS6 A;  2EIM E;  3GZ1 A;  1KZP A;  1HS6 A;  5BV0 A;  1UN8 A;  3HXF A;  2MYO A;  3FUL A;  5EYP F;  1AP7 A;  3FP3 A;  3Q5M A;  5ARG A;  2XGM A;  4TXP A;  2OOE A;  3TWW A;  3MGB A;  4DI4 A;  1PAQ A;  3F9X A;  3CVP A;  5J90 A;  1YMP A;  2EIL E;  3ZNG A;  2OCC E;  3DBS A;  2PQR A;  3M56 A;  4BX9 A;  3ZXS A;  2LAI A;  3LEW A;  5DIZ A;  4DX6 D;  4TRQ A;  3E37 A;  4LG6 A;  3HNA A;  3U66 A;  4QEP A;  3L82 A;  3APC A;  1N54 A;  1UN9 A;  3LJN A;  4N3B A;  2XQ0 A;  1MX4 A;  2BUG A;  3S7B A;  1V55 E;  3Q15 A;  4JHR A;  1JPL A;  3CIA A;  4CRW A;  3IHV A;  4QQI A;  2NSZ A;  2W5Y A;  4YVO A;  2IY0 C;  2X6F A;  4FJY A;  3D9K A;  1BLX B;  4RLY A;  4GZ3 A;  1QQE A;  3MKQ A;  3URZ A;  5E76 A;  3ASO E;  4ANX A;  1WAO 1;  5BNW A;  4MBG A;  3NOG D;  2ION A;  4GTT A;  3EU5 A;  4HOT A;  1UW4 B;  4J7F A;  4GZ6 A;  3ASN E;  5KJL A;  3FUF A;  3GZS A;  4KXK B;  2IEJ A;  3ULQ A;  3S8P A;  3UM0 A;  5EIB E;  3C3Q A;  2HM8 A;  1YCS B;  2R5S A;  3NF1 A;  3FH8 A;  1QNF A;  5FIO A;  4RQI A;  5EG2 A;  3PEV B;  2ETC A;  3BG1 B;  3PS6 A;  4LEU A;  3FWV A;  4J7W A;  5FT9 A;  2ZXW E;  2YHC A;  1ELR A;  2Y0B G;  3MV3 B;  3FY4 A;  2LAH A;  3V79 K;  1ZB1 A;  2J09 A;  4QEO A;  3ABK E;  3ZVV A; 
#chains in the Genus database with same CATH homology
 2F69 A;  2OV8 A;  4I43 A;  3QB2 A;  4F3V A;  3IHX A;  2C0M A;  2XCB A;  4UI9 K;  3ZHE B;  4XKC A;  5F5E A;  3CKB A;  5EKQ D;  2R59 A;  2JEK A;  4WWN A;  2VQ2 A;  4XX5 A;  1O9S A;  3CKC A;  4KBQ A;  2RFI A;  2RG8 A;  2IFU A;  4EPZ A;  3Q47 B;  3CGH A;  2AWI A;  2YNQ A;  3G2U A;  4JL0 A;  2Y4U A;  4FC8 A;  1E7U A;  4U0S A;  2J4D A;  2FF4 A;  5AYF A;  3SW9 A;  3ZYL A;  4FAD A;  1NZN A;  3MO2 A;  1Z6T A;  1TJF A;  1P5Q A;  4E6H A;  5LSX A;  3CHP A;  2YIN A;  3HVE A;  4G23 A;  2WQH A;  3ZRH A;  3LYA A;  3UT8 A;  1FVH A;  3FUD A;  3JYS A;  3QOU A;  2XEV A;  4H7X A;  1ELK A;  4HOQ A;  4KMO A;  1HZ4 A;  4JA9 A;  5F59 A;  4J8D A;  3ASF A;  3HHM A;  3FU6 A;  3RO3 A;  3I3N A;  3CVW A;  3ZYQ A;  3IBE A;  3M57 A;  4J7I A;  4BSX A;  1EYH A;  3LY7 A;  3MX3 A;  1WY6 A;  3S2A A;  2IF4 A;  5G04 J;  4YPE A;  2GRM A;  3D9J A;  3L16 A;  5FQ8 A;  4NVQ A;  3KS2 A;  3B7R L;  3LS8 A;  5FJY A;  4XZ4 A;  2UY1 A;  2V8S E;  2JV0 A;  4I6J A;  4UWK A;  3CBM A;  2Y4T A;  4PH4 B;  2V0P A;  1XNF A;  2LO6 A;  2XPZ A;  3ML8 A;  2IOS A;  3EP0 A;  4AU7 A;  4GA0 A;  2OVB A;  3FU5 A;  3ONK A;  5LOZ A;  4CDN A;  2KCV A;  3PH0 C;  1H6K A;  5EDS A;  2HR2 A;  2VSN A;  5DBK A;  2J9Q A;  1DVP A;  4ANU A;  3ASG A;  3LJ3 A;  2BTD A;  2L6J A;  1NA3 A;  4FLH A;  4NQ0 A;  3KEZ A;  3R7R A;  3FUE A;  4CCA A;  2VGX A;  3CVL A;  4LCT A;  4I2W A;  4GPK A;  1E7V A;  3CQG B;  4UWF A;  3VTX A;  3FUI A;  3TL5 A;  4GAA A;  2Y3A A;  4AVX A;  2X6I A;  4EQF A;  2M63 A;  4GA1 A;  2HYZ A;  4N2S A;  3PUJ A;  3ASH A;  2VGY A;  1UG3 A;  4MI5 A;  2FI7 A;  2WXI A;  1IQU A;  3PZD A;  4B94 A;  4C0E A;  5BPP A;  3LVQ E;  4WWO A;  3KMJ A;  3I5P A;  2C2L A;  2WXK A;  1E8Z A;  1E8X A;  2L0T B;  4GYW A;  1TEZ A;  1UJJ A;  2WXH A;  5JHN A;  4I51 A;  4JHJ A;  4B89 A;  4GCN A;  4Y6C A;  4N2Q A;  4JXT A;  4YPA A;  4CGV A;  3L17 A;  4L2Y A;  3B7S A;  2WXJ A;  4AP2 A;  4BX8 A;  2NC9 A;  2WPV A;  5G04 C;  2LSV A;  4J0U A;  2FUL A;  4FMU A;  4JDS A;  3TG4 A;  3GZ2 A;  4E47 A;  5F6L A;  5ARF A;  4GZD A;  3TJP A;  3OXL A;  5T3R A;  4BY6 A;  4J8F A;  4NUR A;  4HS2 A;  3AS5 A;  3M53 A;  4I1M A;  1ELW A;  1IHG A;  4BUP A;  4DLO A;  4TV3 A;  3D9N A;  2FEZ A;  3IEG A;  4GZ5 A;  4KVO A;  3FUM A;  3U3W A;  3TG5 A;  3FTS A;  5LSZ A;  3PE3 A;  4XI9 A;  4I1O B;  3VV0 A;  2PM7 A;  3Q4A B;  4OVV A;  2XGS A;  3FUJ A;  4BT9 A;  3FFL A;  2G46 A;  5FQ7 A;  2L0I A;  3LY9 A;  2FO7 A;  4U07 A;  4Z4P A;  4RG6 A;  5JHA A;  2V4L A;  3ZIM A;  4NAC A;  4AY5 A;  3SZ7 A;  3RIB A;  4G2V A;  4RZ0 A;  5C2Y A;  4N3C A;  3S7J A;  5T5G A;  2DIW A;  4I17 A;  4G1T A;  4V3I A;  2VGX B;  2E2E A;  3APF A;  2X3M A;  2IGQ A;  3MEK A;  1PEG A;  2VSX E;  4AXH A;  1S0P A;  4BT8 A;  2WVI A;  5ANR A;  1IYG A;  1A17 A;  2VSO E;  3MKQ B;  4OVU A;  3UX4 A;  4BFR A;  1JWG A;  3QWP A;  3AU4 A;  2OVF A;  4WUY A;  5KJM A;  1OWP A;  3JUI A;  2EQX A;  2DBA A;  3KAE A;  5ANL A;  4WNG A;  4J8E A;  3SF4 A;  3S7D A;  3G2T A;  3FDH A;  3L13 A;  2WQ7 A;  3EIQ C;  4BWR A;  5FTP A;  4DK5 A;  4KZC A;  5TH7 A;  2XGO A;  2CHX A;  3PNL B;  5T4Y A;  5CPR B;  3UQ3 A;  4DI3 A;  3CVV A;  4HFG A;  4L23 A;  3WXX A;  1EF1 C;  4MRU A;  2KZT A;  1OWL A;  5FZR A;  5FWQ A;  3RRM B;  3RRU A;  4U63 A;  4FLB A;  4A3V A;  3ZW3 A;  5JIY A;  4AY6 A;  4RVB A;  3NQP A;  1HH8 A;  3SBT B;  2KM4 A;  4JLG A;  3CHS A;  3LDZ A;  4CEM A;  3L08 A;  3UT4 A;  1XQH A;  4A55 A;  3BO5 A;  3SWC A;  4KZ0 A;  3HIZ A;  4HXI A;  3QNK A;  5G55 A;  3S7F A;  3TXN A;  5TTF A;  3KMA A;  3OS5 A;  1ZBP A;  2WXN A;  3OXF A;  4C0M A;  1VDY A;  2VTB B;  4L2L A;  2QFC A;  3EHM A;  3G2S A;  2KCK A;  3FEY A;  4GMJ A;  3ZYK A;  4G24 A;  3JQ1 A;  4MLP A;  3PE4 A;  5AJL A;  4Q69 A;  1HE8 A;  4YPU A;  3E4B A;  5A7D B;  3OOI A;  3L54 A;  2A4Z A;  3ESK A;  4JC8 A;  4FU3 A;  2I6H A;  4J6I A;  4BTB A;  3LPZ A;  2XRZ A;  1KT1 A;  5EX3 A;  4A3T A;  3CQC B;  2V5F A;  4HLE A;  1SZ9 A;  3QWV A;  3O4Z A;  4XE0 A;  3IHY A;  4D10 C;  4CGW A;  1PY1 A;  1E90 A;  3CVX A;  1YA0 A;  2IOL A;  3G2W A;  1MT6 A;  4EZJ A;  4MI0 A;  2I9C A;  4CDR A;  2AXZ A;  2X6H A;  4UWL A;  3GYZ A;  4UQZ A;  5KJN A;  2AXV A;  2I1J A;  3VLF A;  3D9M A;  1HFA A;  5LFA A;  3MO5 A;  2BQZ A;  4HOU A;  5BT1 A;  2CG3 A;  3GW4 A;  4DPR A;  5JIN A;  1OUV A;  3AU5 A;  5AIJ A;  4HOR A;  4FHK A;  2WXM A;  4GB9 A;  2AVP A;  2ILR A;  2KAT A;  2X6K A;  4UQY A;  3NZU A;  4XIF A;  4LUN U;  5KJK A;  2YHE A;  1MHQ A;  4JA7 A;  5CCM A;  4U0Z A;  1XGW A;  2WXR A;  1Z3Y A;  1H19 A;  3FTZ A;  1LF8 A;  4N39 A;  4BTA A;  5T0K A;  1HF8 A;  1E8Y A;  5D0Q D;  2KZT B;  2WMO A;  4APO A;  4YNM A;  4GYY A;  3R7Q A;  3FUK A;  2IU1 A;  3FU0 A;  3QC1 A;  1HG5 A;  2Q7F A;  4YND A;  1SQM A;  1X5B A;  3AS4 A;  4AV7 A;  1MUF A;  3L6A A;  3BG0 B;  1JWF A;  4C1Q A;  3K9I A;  4PUC A;  4QFV A;  3UMV A;  2YQ8 A;  1HG2 A;  1Y6I A;  3QAQ A;  4FHJ A;  3FHE A;  2BF0 X;  2W5Z A;  2JLB A;  2I1K A;  3VLD A;  3CVN A;  4R7L A;  3HVE B;  3ML9 A;  1N3J A;  5AYW D;  4U04 A;  2R3A A;  4TUU A;  1KLX A;  2MHK A;  3QJZ A;  1N6A A;  3LY8 A;  1DNP A;  4I2Z A;  3EJN A;  4A1G A;  2GW1 A;  4G26 A;  3ESL A;  4PDX A;  2XHE A;  3NZS A;  2KC7 A;  1FVF A;  3P1U A;  4PS7 A;  4DLQ A;  5LCW J;  4ATG A;  4CT4 A;  4NJ5 A;  3PNT B;  4O6F A;  3UT7 A;  2C0L A;  3FTW A;  4F53 A;  3M54 A;  2CFZ A;  1UJK A;  2UY1 B;  2XPY A;  2WXG A;  4HVB A;  4A1S A;  3SGH A;  3MV2 B;  3SI5 A;  3QAR A;  4XI0 A;  2GRL A;  1OWO A;  4EZL A;  2OND A;  5AJD A;  2CHZ A;  3VTY A;  3ZN3 A;  3MO0 A;  1GW6 A;  5HI7 A;  4DJA A;  1EPU A;  4F7A A;  5FZS A;  2WM9 A;  5CCL A;  4W9R A;  3QKY A;  4PS8 A;  3HDX A;  3ZHE A;  1Y8M A;  3VLE A;  3F9Z A;  3RU0 A;  2FBN A;  2HO1 A;  1E8W A;  4JVS A;  4OYS A;  3FH7 A;  3FH5 A;  3OTN A;  3RRN B;  3CEQ A;  4GML A;  4YVQ C;  3DB5 A;  4JHK A;  4RG9 A;  4WAF A;  2QPW A;  4APF A;  2WXF A;  3ZGQ A;  1BPO A;  4KVM A;  2XRY A;  3SBS A;  1H2U A;  3CK8 A;  4L1B A;  4JZY A;  3MJW A;  4U0U A;  4ANW A;  5J08 A;  1OWM A;  4IN3 B;  4LDG A;  2R17 C;  1N52 A;  4QEN A;  3QDN A;  3U9W A;  4WNF A;  5HQ8 A;  1HX8 A;  3OPE A;  4HOS A;  2PM6 A;  3MZL B;  3CST A;  3EIJ A;  3CBP A;  4ILI A;  4UWG A;  3T5X A;  4ACL A;  3M59 A;  3RJW A;  2WB2 A;  4IUL A;  4B8A A;  5G05 J;  3DAL A;  4URK A;  5EX0 A;  5AEN A;  2CG2 A;  5LX8 A;  1NA0 A;  5LCW C;  3I4G A;  3FUN A;  3D9I A;  3LCA A;  1U3D A;  1MVX A;  3FPD A;  3PRZ A;  3ASD A;  4E85 A;  1U3C A;  3ZFW A;  1OWN A;  1HU3 A;  1H3I A;  4AIF A;  2PQN A;  4MS6 A;  2VYI A;  1FCH A;  3MCX A;  3GZ1 A;  3C98 A;  4ACK A;  1HS6 A;  4M3O A;  5BV0 A;  5LP0 A;  1UN8 A;  3OAW A;  4K0R A;  3IKO B;  3M58 A;  3RO2 A;  4J8O A;  3G2V A;  3PRE A;  3FUL A;  2WQ6 A;  2AXU A;  4H7Y A;  3CR3 A;  3BEE A;  3FP3 A;  4AOF A;  3APD A;  3Q5M A;  2X38 A;  1MQS A;  2UWJ G;  2XGM A;  2WXQ A;  5ARG A;  4O30 A;  4FA6 A;  2OOE A;  3B13 A;  2L9B A;  3MGB A;  1L5J A;  4KYO B;  4DI4 A;  2P58 C;  1PAQ A;  3F9X A;  4IJD A;  3CVP A;  5J90 A;  3QWW A;  2I2O A;  3PDN A;  3DBS A;  2PQR A;  3M56 A;  5FZQ A;  4U8H A;  2J4B A;  4BX9 A;  3ZXS A;  3SFZ A;  2LAI A;  3CHM A;  3LEW A;  4EZK A;  5DIZ A;  4TRQ A;  1HO8 A;  4IYP A;  2VSY A;  2ZU6 B;  3CVY A;  5BUZ A;  2NXP A;  2AW6 A;  3CSF A;  4FJZ A;  5CMY A;  4J83 A;  4WNE A;  3EDT B;  4H12 A;  3UUX A;  1HXI A;  4J8S A;  2LSU A;  3HNA A;  3ONL A;  3ZEF A;  5G05 C;  3U66 A;  4QEP A;  4I9E A;  4NRH B;  3APC A;  3F9Y A;  1N54 A;  3PVL A;  2GGF A;  1UN9 A;  4N3B A;  2XQ0 A;  2IJG X;  2XCC A;  4ANV A;  2QY7 A;  1H0A A;  3MYV A;  4IJ8 A;  2BUG A;  4K03 A;  1ZKK A;  2DCP A;  3S7B A;  1W3B A;  2LNI A;  2J49 A;  4I6G A;  4CDM A;  5T0M A;  3Q15 A;  4FUL A;  4GZC A;  4GU5 A;  4JHR A;  3SNX A;  3ZPJ A;  1JPL A;  3CIA A;  2CFU A;  3CHR A;  4JPS A;  5JHB A;  2O8J A;  5F6K C;  3ZYM A;  4N5C A;  3K5K A;  4GYO A;  3LKU A;  4UQX A;  2MRI A;  1ZU2 A;  4G11 A;  3SHF A;  4CRW A;  4G25 A;  3JCK C;  3IHV A;  4AM9 A;  5JJ0 A;  4CT0 A;  2NSZ A;  3RJV A;  3CK7 A;  1N6C A;  2W5Y A;  3CHQ A;  4YVO A;  4KT6 B;  3D9O A;  4FP7 A;  2X6F A;  2IQC A;  4FJY A;  4B0Z A;  5TEG A;  1QZ2 A;  3I4R B;  5D0O D;  3D9K A;  4GZ3 A;  4YNP A;  5C1D A;  3KMT A;  2X6J A;  1IQR A;  1QQE A;  3MKQ A;  3RQ4 A;  2CHW A;  3URZ A;  5E76 A;  5M72 A;  1KT0 A;  1TJC A;  5CMW A;  1H2T C;  4ANX A;  3MA5 A;  1PC2 A;  3AS8 A;  3OXG A;  1WAO 1;  2WXP A;  5BNW A;  4JEH A;  4B8C B;  2ION A;  2RD0 A;  3TAX A;  3U64 A;  3CK9 A;  4Q94 A;  3P2B A;  4HOT A;  1UW4 B;  3HYM B;  4AJW A;  4JEU A;  4AEZ C;  4J7F A;  1Z3X A;  3Q49 B;  3R9A B;  4GZ6 A;  2MOW A;  4UI9 J;  5BV1 A;  5KJL A;  3M55 A;  3M5A A;  4ILH B;  1SZA A;  3B7U X;  3FUF A;  3GZS A;  4KXK B;  4RSY A;  5CHE E;  3D3M A;  3CVQ A;  3ZVV A;  4EEC A;  3ULQ A;  5A6C A;  1E96 B;  3S8P A;  2WXL A;  4XKB A;  3CVU A;  3N71 A;  5A23 A;  3UPV A;  2PZI A;  3PEU B;  5ENN A;  3ENE A;  4EBA G;  1JUQ A;  3FTY A;  3RK6 A;  4GCO A;  2HM8 A;  3FTU A;  3QK0 A;  1WM5 A;  2J08 A;  2R5S A;  2VJ8 A;  2A5U A;  3FH8 A;  1H2V C;  1QNF A;  2XPI A;  3NF1 A;  3FU3 A;  4I1A A;  3CV0 A;  2VTB A;  3EHN A;  3CBO A;  5EG2 A;  3TXM A;  3PEV B;  2KCL A;  4ME2 A;  3U4T A;  3BG1 B;  5BW8 C;  5JJT A;  3IV0 A;  4ILG A;  4N3A A;  3SD5 A;  3PS6 A;  5E75 A;  3FTV A;  5T8I A;  4LEU A;  3TGO A;  3FWV A;  3D9P A;  2WMN A;  5FT9 A;  3T5V A;  4JW1 A;  3PUK A;  4I6E A;  4ABN A;  5FQ6 A;  2J07 A;  4L7T A;  4WND A;  2YHC A;  4C9B B;  4Y6W A;  3CHO A;  1ELR A;  4F1S A;  3RAY A;  3MKR A;  4EBA A;  1B89 A;  3B7T A;  3FUH A;  3LXU X;  4PS3 A;  3RKV A;  3MV3 B;  4I9C A;  3FY4 A;  4GA2 A;  2LAH A;  1ML9 A;  3D9L A;  3FTX A;  3O48 A;  5G2N A;  3CLJ A;  4LRZ A;  4UI9 C;  5JJ7 A;  3LVR E;  3F9W A;  3JQ0 A;  1INZ A;  4WWP A;  5JJ6 A;  2J09 A;  2E0I A;  2PL2 A;  3L22 A;  3KD7 A;  4MKT A;  5KCM A;  1MVH A;  4QEO A;  1EDU A;  4IRU A;  1NP7 A;  4Q96 A;  3DPD A;  3T8M A;  3FEX A;  3VUZ A;  4LER A;  4UWH A;  4P29 A;  2WXO A;  5FQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...