5KJNA

Smyd2 in complex with az506
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
total genus 147
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjnA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjnA01
3F9YA 1B89A 4HOSA 2GW1A 5BT1A 4G23A 3CEQA 1OUVA 1A17A 3RU0A 3N71A 3BEEA 3KD7A 3MV3B 3S8PA 5CHEE 3KMJA 2JV0A 1MUFA 5FZRA 5KJMA 5F5EA 2LNIA 4GCOA 5LCWJ 4N2SA 5JJ6A 4GA2A 3S7DA 3PE3A 4IJDA 4KBQA 4YPEA 3GZ1A 4GA1A 3LYAA 4N5CA 2YQ8A 4CGWA 1FCHA 2WQHA 4WNFA 3IHXA 5JIYA 4YNPA 5G04J 3OS5A 1ZU2A 4GZ6A 3UUXA 5CCLA 2XGOA 3CKBA 3GYZA 3MO5A 4I51A 4MI0A 5TH7A 3SZ7A 3S7FA 3TG4A 3BO5A 3CK7A 2PZIA 3QWVA 5HQ8A 3F9WA 4H12A 5ARFA 3MO2A 5F6LA 3CVQA 1IHGA 2OOEA 1ZKKA 1PC2A 4J8DA 5EX3A 3PDNA 5FTPA 4BTBA 1N6CA 3RAYA 3IEGA 1O9SA 3PE4A 2AVPA 5A6CA 1ML9A 4AY5A 4J7FA 5BW8C 2KCLA 4G1TA 3ASHA 4J8EA 4UI9C 2IFUA 3SF4A 4HOQA 4QEOA 1ZBPA 1NA0A 3OXLA 3OXFA 4XI0A 4GZ5A 3KS2A 5LSZA 5ARGA 3CVLA 3LPZA 3ASDA 2IGQA 4GPKA 2XGMA 4JDSA 4YVOA 3DB5A 2QPWA 4I2ZA 3M57A 4G26A 3M5AA 1PEGA 2R3AA 4YPUA 1QZ2A 4C1QA 2LSVA 3ZPJA 3UPVA 2JLBA 2RFIA 2E2EA 3M58A 4JHRA 3ZHEA 4XIFA 3AS4A 4JA9A 3ZHEB 2FO7A 1Y8MA 5FJYA 3DALA 4N3AA 4XI9A 4AU7A 3Q5MA 3VTYA 4CGVA 5AYWD 2Q7FA 3ASGA 1WM5A 1KT1A 2UWJG 4GZ3A 3HNAA 3F9XA 2L6JA 4NQ0A 3QWPA 5G04C 4NJ5A 1XNFA 4IN3B 4IJ8A 4UQXA 5AYFA 5FT9A 2FEZA 3EP0A 4RG6A 4LEUA 3MEKA 5FZQA 3K5KA 3ASFA 4I9CA 3M54A 4J0UA 3HYMB 3QOUA 1IYGA 2FF4A 4Y6CA 3URZA 3RO3A 3MO0A 2VYIA 5D0OD 3RJWA 3S7JA 5EKQD 5TTFA 2C0LA 4KXKB 4WNDA 3R9AB 3JYSA 2HO1A 2P58C 1W3BA 3OOIA 3S7BA 4YPAA 2KATA 3CKCA 2PQNA 2R5SA 4N3CA 3Q47B 5KJLA 3MA5A 5F6KC 5G05J 4F3VA 1MVHA 3M56A 4BT8A 3M53A 3LY8A 3CBPA 3CK8A 4UQZA 4ME2A 3OPEA 4RG9A 4J7IA 3QWWA 1YA0A 2C0MA 2XEVA 4U07A 4RZ0A 3QDNA 2ONDA 5EG2A 4QENA 1XQHA 3M55A 4N2QA 4O30A 2BUGA 4H7XA 4MI5A 4ABNA 4GA0A 4YNDA 2XPIA 3CBMA 2FBNA 3M59A 2W5YA 2IF4A 5T0KA 3AS5A 2YHCA 5D0QD 5BNWA 4CDRA 2VQ2A 3O48A 5TEGA 2BQZA 5DIZA 3AS8A 4J83A 1HH8A 1QQEA 1P5QA 1MT6A 3RO2A 2QFCA 5HI7A 1E96B 4U0UA 2PL2A 4AY6A 2PQRA 4G2VA 1HZ4A 3Q15A 4WUYA 3SW9A 3UQ3A 4AM9A 4I2WA 3LY9A 4U0SA 4YVQC 3RQ4A 4LDGA 5T5GA 5A7DB 4B94A 5JJTA 2F69A 4J8OA 1ELWA 3U4TA 5CCMA 4JA7A 4BWRA 2XCBA 3VUZA 4U0ZA 4N3BA 3CK9A 5G05C 1MVXA 3VV0A 2VGXA 4NRHB 1H3IA 3ZGQA 3FP3A 2I6HA 2VGXB 5JHNA 3EDTB 3WXXA 4GYYA 3NF1A 3MV2B 5CPRB 2W5ZA 4BTAA 4NVQA 3LCAA 4E47A 5JINA 1HXIA 2G46A 4GYOA 3GZ2A 4GCNA 3ULQA 4BT9A 2J9QA 5DBKA 3TG5A 3QKYA 4J8FA 2KCVA 4I1AA 3OXGA 3RJVA 3FPDA 5JJ0A 5M72A 3VTXA 4Z4PA 5KJNA 2KCKA 3LY7A 4I17A 3ZFWA 2XGSA 4O6FA 5JJ7A 3CVNA 3SWCA 3CV0A 1WAO1 3F9ZA 2KC7A 1KT0A 3TGOA 4UI9K 3CBOA 3FFLA 2O8JA 1NZNA 4HOUA 2V5FA 4HOTA 2FI7A 3RKVA 5LSXA 4BUPA 1NA3A 2XCCA 4JLGA 3RIBA 1KLXA 2VGYA 3Q49B 2HR2A 4G25A 1N6AA 5F59A 3LKUA 4UQYA 4Y6WA 3MKRA 2VSYA 5KJKA 2NC9A 1N3JA 4WNGA 2Y4UA 2Y4TA 4H7YA 4QEPA 3CVPA 2UY1A 5FZSA 4U04A 4AIFA 4HORA 2UY1B 2WPVA 2C2LA 3TAXA 2DBAA 4KYOB 2HYZA 4GYWA 1TJCA 4W9RA 3E4BA 3ESKA 4N39A 4A1SA 5EX0A 3Q4AB 4WNEA 3GW4A 4APOA 3KAEA 4YNMA 3KMAA 3ZN3A 3KMTA 2LSUA 3U3WA 3FWVA 4G24A 3K9IA 4I9EA 4EQFA 5C1DA 5T0MA 4UI9J 2VSNA 1ELRA 4FMUA 2MHKA 5LCWC 4JL0A
chains in the Genus database with same CATH superfamily
3FEXA 4N5QA 3F9YA 1SZ9A 4DLQA 4HOSA 4G23A 3B7UX 1A17A 3KD7A 2R02A 1MX6A 3PUJA 2P9LG 3EHRA 3UIPC 3CVYA 1Z5SC 3IXEA 4F7AA 3PH0C 4B8CB 2LNIA 4GTVA 5LCWJ 4GA2A 3Q75A 4YPEA 3ZVVA 1FCHA 3W9FA 3ASOE 5BV1A 4BY6A 3NZSA 4APFA 2LXMA 5CEAA 2XS8A 5G04J 4AXHA 2P9IG 3CHRA 3UUXA 1AWCB 3MO5A 3C5RA 4I51A 4C9BB 4I6EA 3MJWA 1DC2A 2JEKA 3UXGA 2EIJE 3QWVA 3QAQA 2I1KA 4H12A 4JEUA 5F6LA 3CVQA 1OCRE 2WXOA 2XEEA 2OOEA 1ZKKA 3BQOA 4Q96A 4J8DA 5JHBA 1LD7A 2B6CA 3PDNA 5A23A 2H6IA 3B7TA 1N6CA 2J09A 3IEGA 2WMOA 3LDZA 3KSQA 1TJFA 4A55A 3DSWA 1NA0A 3OXLA 2XZTG 3U9WA 3ML9A 2P9UG 3BG1B 4F1SA 4GPKA 1MYOA 4CCAA 2XGMA 3LVRE 3QARA 2RFMA 3RK6A 4FU3A 3ZPJA 2AXVA 1N9AA 3D3MA 4KZ0A 3M58A 1S70B 4XIFA 3AS4A 2ZIRA 3ZHEB 2EIKE 2ETAA 1S63A 3HG0D 4ACKA 2JABA 2WXLA 2P9KG 3DALA 4XI9A 4NACA 4AU7A 3B13A 3TWWA 3ZXPA 1WM5A 1JUQA 1XNFA 3CHSA 3ISMC 4IJ8A 2A4ZA 1MX2A 3EP0A 2KZTB 3DSTA 3FUNA 3MEKA 2GROB 3K5KA 2GGFA 4U95D 3HXDA 3PREA 1HU3A 3UM1A 3RO3A 3Q9UC 3MO0A 2VYIA 3RAUA 2BKGA 3C3RA 4HLLA 3L17A 3JYSA 5AQAA 2KATA 4RSYA 3MYVA 3CIAA 3FEYA 4GAAA 2GRNB 1MVHA 3M56A 4GTOA 4JC8A 3CK8A 5HKPA 1UOHA 1H6KA 4RG9A 4U07A 4RZ0A 4ZFHA 2ONDA 5EG2A 4HB5A 5ENOD 1E90A 3B7RL 3CHMA 4K0RA 3SFYA 2ZU6B 3D9PA 3SD5A 2KM4A 2H6FA 4EZLA 5ENPD 2BKKB 3FUMA 3S2AA 3AJIA 2FBNA 3ZU7B 1OWNA 2W5YA 5T0KA 3LXUX 3AS5A 2YHCA 3FTWA 3CQCB 2R59A 4L9PA 3TWQA 4CDRA 3FU5A 5TEGA 3EU5A 1NL4A 3DEOA 3HXFA 3IBEA 3RO2A 3DWLG 4ATGA 4XKCA 1FVHA 4RQIA 3HVEB 4G2VA 3AAAC 4DX5D 3G2UA 2WM9A 4U0SA 4LDGA 4QQIA 3UTMA 2XHEA 5JHAA 3VLDA 1H2TC 2F69A 3PZ4A 2WMNA 4XKBA 4JA7A 3VUZA 4N3BA 4NURA 3CK9A 3VV0A 2VGXA 3QB2A 1H3IA 2X6KA 3T8MA 3WXXA 4GYYA 5CPRB 1JCSA 4BTAA 4E47A 5CBOA 3P2BA 1IKND 3QKYA 2KCVA 4FHKA 4I1AA 3DXKG 3FUEA 4HQDA 3LY7A 4MLPA 3ABME 3HXCA 3L08A 3D9MA 1KT0A 4B93B 1QBQA 4K03A 2IOSA 2O8JA 1UW4B 4HOTA 1U3DA 5LSXA 4ANXA 1S0PA 3EUVA 4JLGA 4ILIA 3T8KA 4TRQA 2QZAA 3Q49B 4G25A 3MKRA 2VSYA 3CVXA 2ZXWE 1YYHA 3PEUB 4I6GA 5FZSA 5T8IA 5AAOA 4HORA 3CR3A 4KYOB 1N95A 1N4SA 3ESKA 1BPOA 5EX0A 3Q4AB 4HI9A 2DVWA 3DBSA 5T3RA 3KMAA 3ZN3A 3U3WA 3E30A 2IO3C 4G24A 4C48B 1H6PA 3K9IA 3J5QB 2PM6A 3P1UA 1FVFA 2VSNA 5AARA 5BXUA 2MHKA 4CYMD 4KZCA 1E7VA 2WXMA 4L2LA 1TNBA 5EIBE 3CEQA 1OUVA 3RU0A 3BEEA 4PDXA 1JWFA 3MV3B 3RRNB 4DUIA 1SA5A 3ZYLA 4WAFA 5CHEE 5KJMA 5F5EA 2XQ0A 1EF1C 1E8YA 4CEMA 4DRXE 4KBQA 5JA4D 3CVVA 4OAUC 1JCRA 3LYAA 4HNAD 4LNUD 2YQ8A 4O60A 1K8KG 2H6HA 4B0ZA 1GW6A 5JIYA 3UKRG 4TV3A 4L7TA 2XPYA 2P9PG 1K1BA 3TG4A 3BO5A 3CK7A 3D9KA 4D10C 3R9MA 4CRWA 1O5MA 3IKOB 3C72A 5HQ8A 3T5XA 2GRLA 3ONKA 3FU0A 1IHGA 3L6AA 5KCMA 4BTBA 3GZSA 4GTMA 2LAIA 2DIWA 4AP2A 2EIME 3PE4A 1ML9A 3ASNE 2IOLA 2LAHA 1Z3YA 4UI9C 2IFUA 3SF4A 4FLHA 3T9KA 3ZW3A 2ETBA 2OV8A 3D9JA 3FUHA 1SQMA 2XRYA 4XI0A 5E75A 5ENRD 3KS2A 3LJ3A 3CVLA 3LPZA 3AG4E 3G2SA 4JDSA 3DB5A 2QPWA 3M57A 2WXHA 1RW2A 2FULA 5H7PA 3M5AA 4YPUA 2CG3A 1QZ2A 4C1QA 3JUIA 4F1PA 3APCA 1BD8A 5CRVA 3UPVA 2JLBA 2EILE 3ZHEA 4UWLA 1N4QA 2OCCE 3AG1E 3ML8A 3FUKA 4EHMA 3O4ZA 1G3NB 3DSSA 3TXMA 4K5AB 3I5PA 3ASGA 3LVQE 3F9XA 3HNAA 2L6JA 3QWPA 1HO8A 4HBDA 3DSXA 2KZTA 2J49A 5FT9A 4NIKA 4ILGA 2I2OA 4LEUA 2GRMA 3G2WA 2EINE 4I9CA 3M54A 1N11A 3VLFA 4FJYA 3ZYQA 3HYMB 4AVXA 4OYSA 5EDSA 1EPUA 2GRRB 4XX5A 5D0OD 2M63A 4OVUA 5EKQD 4HVBA 4KXKB 2P58C 4KVOA 4YPAA 3CQGB 2EQXA 3Q47B 5KJLA 5AJLA 2QY7A 1UJJA 3SI5A 1BI8B 3V30A 4F3VA 3ULEG 4BT8A 3M53A 4LERA 3Q7AA 1HE8A 4GPMA 4UQZA 4M3OA 1BLXB 4K5CA 4J7IA 3QWWA 4EECA 5JMND 1YA0A 5CMWA 4MRUA 2XEVA 1SA4A 3DRAA 3FTUA 4U96D 5LP0A 4OAVB 3QDNA 2F8YA 4J8SA 3M55A 3MGBA 4JZYA 4XE0A 2BUGA 1TNZA 4H7XA 2V5QC 3DPDA 2XPIA 4HI8A 1IXVA 3HRAA 3QJZA 5KBAA 3UM0A 1HF8A 5D0QD 3APFA 2VQ2A 3O48A 3MKQB 2BQZA 4A63B 4I1OB 2KBXA 1HH8A 1QQEA 3FTSA 3CHOA 4GTQA 1IQUA 3D9IA 5HI7A 3HVEA 4E6HA 3D9NA 3VLEA 4GZCA 5KNHD 4YDYA 3PS6A 1FPPA 3UI2A 4AM9A 2LUHA 3LY9A 1FT2A 3UINC 1OWMA 5AQBA 4GU5A 4O1PA 5A7DB 4B94A 1KPSB 4BEPA 5CCMA 3ESLA 3UM3A 4UUCA 2I1JA 2XCBA 1V55E 2WXFA 1MJ0A 1MQSA 1MVXA 2VSXE 3Q79A 5EYLA 1D8EA 3FP3A 2V4LA 5JHNA 3EDTB 4PUCA 3NF1A 4G8LA 1AP7A 5JINA 1OCCE 3GZ2A 3BG0B 4I1MA 2J9QA 5DBKA 4O1OA 4URKA 4J8FA 3RJVA 5AN8A 5JJ0A 5M72A 1QNFA 4I17A 5B3SE 3AU4A 3SWCA 2ZGDA 1HS6A 2WQ6A 4M7CA 4BESA 2YNQA 4B89A 1D9SA 1TNOA 2KC7A 4BX8A 1JCQA 4PS7A 2OVFA 2XZDG 2CHZA 3JXIA 4HOUA 1OY3D 2L9BA 3NOGD 4ATZD 3CHQA 1K1AA 5LOZA 4G8KA 4ILHB 3RKVA 3FH7A 3AG3E 1NA3A 3RRMB 2WXIA 3RIBA 4J8YA 2A5UA 2X3MA 2X6JA 4UQYA 5KJKA 2NC9A 2Y4TA 3AG2E 4QEPA 3CVPA 3UX4A 4U04A 4AIFA 1UG3A 2J08A 4HS2A 2WVIA 2RKKA 2J4DA 2WXKA 2HYZA 1TJCA 2WXGA 4YDOA 4WNEA 3TWRA 2RG8A 3KAEA 3KMTA 3ABLE 3FWVA 4MKTA 3EHMA 5EYPF 5T0MA 3EU9A 4UI9J 1ELRA 3CSFA 3Q7FA 5LCWC 3WG7E 4JL0A 1OCOE 4K5BA 2GW1A 4GTTA 3Q78A 5KWDA 1A5EA 3F6QA 2VTBB 1NFIE 3NOCD 4CT4A 1H2VC 4BSZB 3KMJA 3QNKA 1YMPA 5CBNA 4GMRA 3OAWA 4KMOA 1MZCA 5JJ6A 4F6RD 1OWLA 4IJDA 1RZ4A 2CHWA 3GZ1A 4GA1A 4LSZE 4CZ2D 4JEHA 5EN5D 4CGWA 1V54E 1JWGA 3D9LA 4UWGA 3G2VA 3JXJA 4WNFA 3IHXA 4KT6B 3I3NA 5CEDB 1ZU2A 4WWNA 4GZ6A 4MI0A 5TH7A 4B8AA 2PZIA 2ETCA 4WWOA 3R7QA 3F9WA 2MYOA 3G2TA 3MO2A 4V3IA 2WXRA 4HRMB 1UN9A 2A5EA 4GMJA 1PC2A 5FWQA 4E85A 2RFAA 5EX3A 5FTPA 3RAYA 5KNGA 4ANVA 3ZEFA 5LFAA 2VJ8A 2LXLA 2AVPA 3PUKA 2XRZA 2X6FA 5BW8C 2KCLA 3I4RB 3IV0A 4BFRA 4HOQA 3KEZA 3OXFA 4GZ5A 2F8XK 1ELKA 1WDYA 3E37A 1MX4A 4FADA 4BSXA 3L9TA 4G26A 1PEGA 2CFZA 2R3AA 4HLEA 2LSVA 1Z6TA 5ITZF 3SBTB 2RFIA 4FULA 4QFVA 4RLYA 4JA9A 1Y8MA 4EBAA 3MZLB 3RSEG 4FJZA 2WQ7A 3TL5A 4KVMA 3UT8A 3Q5MA 4CGVA 2Q7FA 4GZ3A 4J6IA 4NJ5A 3TWXA 2HM8A 1O1TA 2IY0C 4UQXA 4DI3A 4Z68A 3HDXA 5AYFA 3V31A 4LUNU 3ULYA 3EIQC 4G11A 3ASFA 4ACLA 5T4YA 1N4PA 5FIOA 3L22A 2L0TB 3ZXSA 3QOUA 5CMYA 2KXPC 1N0RA 1LTXA 4EZJA 3SNXA 4Y6CA 3LJNA 3URZA 1KZOA 1E8XA 2V8SE 3S7JA 4DI4A 4AOFA 4GTPA 2AW6A 5TTFA 2C0LA 3ZYMA 2XS1A 4WNDA 1HFAA 3HIZA 3R9AB 1OT8A 3U64A 1W3BA 4ANWA 3BUAA 2NYJA 4LNGA 2PM7A 3CKCA 5CECB 2R5SA 2H6GA 4N3CA 4L1BA 2X6HA 2R03A 5F6KC 2ILRA 5HRYA 4RVBA 2WB2A 2CG2A 1U3CA 3CBPA 5AENA 3DPYA 2YHEA 3E33A 2DZOA 5EILA 4AV7A 3OPEA 3JUEA 5FQ7A 3ONLA 1HG5A 1TYQG 3FH8A 4DLOA 3CLJA 4GZDA 3FDHA 5ENQD 4O30A 1INZA 2IQCA 3DSVA 1DCQA 4WWPA 4MI5A 4C0MA 2RD0A 2FO1E 2P9SG 4GA0A 2WXNA 4P29A 3EIJA 3FU3A 3EJNA 1OWPA 5G2NA 3ABKE 4JHKA 1IQRA 5BNWA 3C98A 3MKQA 2R05A 3Q9NC 5DIZA 2R2LA 2J8SD 3AU5A 1MT6A 1KZPA 1VDYA 4F53A 3IHVA 2QFCA 2L6BA 1E96B 4GMLA 3PEVB 5AQ7A 4AY6A 1ZB1A 1HZ4A 3Q15A 4WUYA 4HRLA 3SW9A 1EDUA 4GB9A 4FP7A 3B7BA 3FUDA 4I2WA 3JQ0A 1O1SA 4YVQC 3RQ4A 5ANLA 4FA6A 2DZNA 4U63A 2CFUA 2Y69E 3DSUA 5JJTA 3ZIMA 3UT4A 1ELWA 3DXMG 3X2QE 4BWRA 5G05C 1TNUA 4AJWA 4NRHB 3TWSA 3QC1A 4CDNA 4NVQA 3EHNA 4IULA 5D66A 4GCNA 5B1AE 3V2XA 4X8QA 3TG5A 3D9HA 1TNYA 1H6OA 3KSLA 4LRZA 2XGSA 5JJ7A 1OXJA 3FU6A 4JHJA 3ZKJA 1LD8A 4ANUA 5BPPA 1WAO1 3SFZA 1DVPA 2AJAA 2XENA 3C3OA 3F9ZA 1HG2A 5E76A 4DX6D 1LF8A 3TGOA 3SY2A 4PS8A 4UI9K 2NSZA 3FFLA 3C3QA 1NZNA 2MRIA 2V5FA 1SVXA 3FHEA 5BUZA 3FTXA 3NB2A 4CT0A 4JPSA 5AIJA 2ZGGA 3NAWA 4GTRA 2R17C 2ZISA 3UM2A 5G55A 4MS6A 3ZRHA 1KLXA 1H0AA 1N6AA 5F59A 4TUUA 1OWOA 2Y4UA 5D2MC 3PZ2A 3FTVA 1XGWA 2MOWA 2UY1B 2IEJA 5C2YA 4U7EB 4GYWA 4JD2G 1JPLA 4BERA 3FTYA 3T5VA 5C1DA 4FMUA 2NXPA 1UJKA 4A3VA 1B89A 5FQ6A 5BT1A 4EZKA 3SBSA 4DX2A 3N71A 2VTBA 2B0OE 1FT1A 5IY5E 2OEWA 4FC8A 1WG0A 1N4RA 4TXPA 3S8PA 2OEVA 4C0EA 3SQVA 2DYSE 3B7SA 2JV0A 1MUFA 2XEHA 5FZRA 4A3TA 4GCOA 4N2SA 2BEDA 1N94A 3S7DA 3UT7A 1D8DA 3PE3A 5ENSD 3PZDA 4N5CA 2J07A 1SW6A 3E34A 2WQHA 5FINA 3IHYA 3QK0A 3E32A 4MBGA 4YNPA 3OS5A 4LCTA 5ANRA 2IU1A 4U8HA 4DX7D 5CCLA 2XGOA 3CKBA 3CVWA 3GYZA 2E0IA 3SZ7A 3S7FA 4JVSA 2F0YA 2OVBA 1OCZE 3TWVA 2AXZA 4JW1A 5ARFA 4I43A 1UN8A 2BTDA 4AEZC 4TXRA 4JXTA 5LX8A 4GTSA 3U66A 3J5PA 4HFGA 4L2YA 3UKUG 4YDWA 1TEZA 2P2CP 1Z3XA 2DYRE 1O9SA 3MCXA 3PNTB 5A6CA 4AY5A 4J7FA 4G1TA 3ASHA 2X38A 4J8EA 5CRUA 4QEOA 1ZBPA 3V2OA 1E8WA 1QYMA 2X6IA 5HS0A 3LEWA 1L5JA 5LSZA 5ARGA 3ASDA 2IGQA 4YVOA 4I2ZA 3HXEA 2BF0X 3SFXA 3NQPA 1DCEA 4Q69A 2PNNA 3CGHA 2E2EA 4JHRA 3RRUA 4R7LA 2AXUA 2FO7A 5FJYA 3FTZA 4N3AA 3VTYA 5AYWD 1K3ZD 2WXPA 1KT1A 2UWJG 4LG6A 1EYHA 1TN7A 2L0IA 4NQ0A 5G04C 4IYPA 2QYJA 2VGEA 3L16A 4IN3B 1NI1A 1E7UA 1IHBA 3CVUA 2FEZA 4BETA 4RG6A 3D9OA 5FZQA 4EPZA 2IONA 2I9CA 2WXJA 3MX3A 3FH5A 4DX1A 4J0UA 3B95A 4YDEA 1S64A 1IYGA 3TWUA 4HXIA 1TN6A 1SZAA 2FF4A 3V79K 1WY6A 3ZYKA 3RJWA 4EBAG 5FQ4A 3KEAA 1H19A 3FUJA 3SO8A 2GRPB 4UWHA 2HO1A 4FHJA 3OOIA 3FUFA 3S7BA 5AJDA 3W9GA 2PQNA 3TJPA 3MA5A 5G05J 4CDMA 1N52A 1TN8A 3LY8A 5B1BE 4ME2A 2Y3AA 2IO2C 3PRZA 3Q73A 1HX8A 2DCPA 2C0MA 4DK5A 3ZUVB 3R7RA 2YINA 1BU9A 4QENA 1XQHA 1O1RA 4N2QA 5J08A 3PZ3A 3PNLB 3ENEA 2Y1LE 3NBNB 4ABNA 1X5BA 2DWZA 4YNDA 1X81A 2WXQA 3L13A 3TXNA 4IRUA 3CBMA 3M59A 2IF4A 2XPZA 4JB8P 3PZ1A 3UIOC 3AS8A 4J83A 3BU8A 1P5QA 4PH4B 4XZ4A 3DEPA 5ENNA 2IJGX 2HE0A 2QYUA 4U0UA 2PL2A 4U8YD 2PQRA 1MHQA 4DPRA 3CHPA 3UQ3A 3JQ1A 3SHFA 5T5GA 4L23A 5J90A 3HXBA 4J8OA 3ZNGA 4UWFA 3U4TA 3CSTA 4U0ZA 1PAQA 1PY1A 3ZGQA 2I6HA 2VGXB 5FQ8A 3I4GA 3MV2B 2W5ZA 2GRQB 4TXQA 3LCAA 2V4HC 4I6JA 1HXIA 2G46A 4GYOA 3FULA 3ULQA 4BT9A 1BI7B 3TWTA 5BV0A 4Q94A 3NZUA 3UMVA 3OXGA 2V0PA 3FPDA 3FY4A 4U8VD 3VTXA 5AQ9A 4Z4PA 4J7WA 5KJNA 2KCKA 2CHXA 2F37A 3ZFWA 1DNPA 4O6FA 3OTNA 3CVNA 1H2UA 2AWIA 3HHMA 3CV0A 3JCKC 4UWKA 1Y6IA 4OVVA 4HRNA 3SGHA 3CBOA 4PS3A 2QC9A 2FI7A 1YCSB 4XEIG 3FUIA 4BUPA 1E8ZA 2XCCA 4A1GA 1N54A 1Q2ZA 3L82A 3L54A 1NP7A 2VSOE 2VGYA 2HR2A 3LKUA 4Y6WA 1U2VG 1N3JA 3PVLA 4DJAA 3EHQA 4WNGA 4H7YA 2LO6A 2UY1A 3APDA 1N0QA 4BX9A 3LS8A 2WPVA 2C2LA 5ENTD 3TAXA 2DBAA 4W9RA 3E4BA 4N39A 4A1SA 3GW4A 4TUMA 4LNBA 4APOA 4YNMA 2LSUA 5BXOA 2Y0BG 4FLBA 5EIDA 5CERB 4I9EA 4ZHBA 2J4BA 4EQFA 2P9NG 1TR4A
chains in the Genus database with same CATH topology
3FEXA 3F9YA 4A3VA 1SZ9A 1B89A 4DLQA 4HOSA 2GW1A 5FQ6A 1E7VA 5BT1A 2WXMA 4G23A 3B7UX 4L2LA 4EZKA 3CEQA 3SBSA 1OUVA 1A17A 3RU0A 3N71A 3BEEA 3KD7A 2VTBA 4PDXA 1JWFA 3MV3B 3RRNB 2VTBB 3PUJA 3ZYLA 4FC8A 3CVYA 4CT4A 3S8PA 1H2VC 4C0EA 4WAFA 3B7SA 5CHEE 4F7AA 3QNKA 1MUFA 2JV0A 3KMJA 3OAWA 3PH0C 5FZRA 4B8CB 5KJMA 5F5EA 2LNIA 4A3TA 2XQ0A 4GCOA 4KMOA 5LCWJ 4N2SA 1EF1C 1E8YA 5JJ6A 4GA2A 3S7DA 3UT7A 4CEMA 3PE3A 1OWLA 4IJDA 4KBQA 3CVVA 4YPEA 2CHWA 3GZ1A 3PZDA 3ZVVA 4GA1A 3LYAA 4JEHA 4N5CA 2YQ8A 2J07A 4CGWA 1FCHA 1JWGA 2WQHA 3D9LA 4UWGA 3G2VA 5BV1A 3IHYA 4WNFA 4BY6A 3QK0A 3IHXA 3NZSA 4APFA 4KT6B 3I3NA 4B0ZA 1GW6A 4YNPA 5JIYA 4TV3A 5G04J 4AXHA 3OS5A 4LCTA 5ANRA 4L7TA 2IU1A 1ZU2A 3CHRA 4WWNA 4GZ6A 2XPYA 4U8HA 3UUXA 5CCLA 2XGOA 3CKBA 3CVWA 3GYZA 3MO5A 2E0IA 4I51A 4MI0A 4C9BB 5TH7A 3SZ7A 3S7FA 3TG4A 3BO5A 4I6EA 3MJWA 3CK7A 4B8AA 2PZIA 2JEKA 3D9KA 4JVSA 4D10C 4CRWA 3QWVA 2OVBA 3IKOB 3QAQA 2I1KA 4WWOA 3R7QA 2AXZA 4JW1A 5HQ8A 3F9WA 3G2TA 4H12A 5ARFA 3MO2A 4JEUA 4V3IA 2WXRA 4I43A 5F6LA 1UN8A 3T5XA 3CVQA 2GRLA 2BTDA 3ONKA 3FU0A 4AEZC 2WXOA 1UN9A 1IHGA 2OOEA 4GMJA 1ZKKA 1PC2A 4Q96A 5FWQA 4E85A 3L6AA 5KCMA 4J8DA 5JHBA 4JXTA 5EX3A 5LX8A 3U66A 3PDNA 5A23A 5FTPA 4BTBA 3GZSA 3B7TA 1N6CA 3RAYA 4HFGA 4L2YA 2J09A 2LAIA 1TEZA 2DIWA 3IEGA 4AP2A 1Z3XA 4ANVA 1O9SA 3ZEFA 5LFAA 3MCXA 2VJ8A 3PNTB 3PE4A 3PUKA 2AVPA 5A6CA 2WMOA 1ML9A 3LDZA 2XRZA 4AY5A 2X6FA 5BW8C 4J7FA 2IOLA 2KCLA 3I4RB 2LAHA 4G1TA 3ASHA 1TJFA 3IV0A 2X38A 1Z3YA 4BFRA 4J8EA 4UI9C 4A55A 2IFUA 3SF4A 4FLHA 4HOQA 4QEOA 3KEZA 3ZW3A 1ZBPA 3D9JA 2OV8A 1E8WA 1NA0A 3OXLA 3FUHA 1SQMA 2X6IA 3OXFA 2XRYA 4XI0A 5E75A 3U9WA 3KS2A 4GZ5A 3LEWA 3ML9A 1L5JA 3BG1B 5LSZA 5ARGA 3LJ3A 3CVLA 1ELKA 3ASDA 3LPZA 2IGQA 4F1SA 4GPKA 4CCAA 3G2SA 4FADA 2XGMA 4BSXA 4JDSA 3LVRE 4YVOA 3DB5A 2QPWA 4I2ZA 3QARA 3M57A 2WXHA 2FULA 4G26A 3M5AA 1PEGA 2CFZA 2R3AA 2CG3A 1QZ2A 4YPUA 2BF0X 4C1QA 4HLEA 3JUIA 3NQPA 3APCA 2LSVA 3RK6A 1Z6TA 4FU3A 3ZPJA 3UPVA 3SBTB 2JLBA 2RFIA 2AXVA 4Q69A 3D3MA 4KZ0A 3CGHA 2E2EA 4FULA 4QFVA 4JHRA 3ZHEA 4XIFA 3RRUA 3M58A 4R7LA 3AS4A 4JA9A 2AXUA 3ZHEB 4UWLA 2FO7A 1Y8MA 4EBAA 3MZLB 5FJYA 4FJZA 4ACKA 2WXLA 2WQ7A 3DALA 3ML8A 3FUKA 3TL5A 4KVMA 3O4ZA 3FTZA 4N3AA 3UT8A 4XI9A 4NACA 4AU7A 3B13A 3TXMA 3Q5MA 3VTYA 3I5PA 5AYWD 4CGVA 2Q7FA 2WXPA 3ASGA 3LVQE 1WM5A 1KT1A 2UWJG 4GZ3A 3HNAA 3F9XA 1JUQA 4J6IA 1EYHA 2L0IA 2L6JA 4NQ0A 3QWPA 5G04C 4NJ5A 4IYPA 1HO8A 1XNFA 3CHSA 3L16A 4IN3B 2HM8A 1E7UA 4IJ8A 4BX9A 4UQXA 2KZTA 4DI3A 2J49A 2A4ZA 3HDXA 5FT9A 3CVUA 2FEZA 5AYFA 4ILGA 4LUNU 2I2OA 3EP0A 2KZTB 4RG6A 3D9OA 4LEUA 3FUNA 3MEKA 3EIQC 2GRMA 3G2WA 5FZQA 3K5KA 2GGFA 4G11A 2IONA 4EPZA 2I9CA 3ASFA 2WXJA 3MX3A 4I9CA 4ACLA 3M54A 3VLFA 5T4YA 4FJYA 3FH5A 3ZYQA 4J0UA 3L22A 2L0TB 3PREA 3ZXSA 3HYMB 1HU3A 3QOUA 1IYGA 4AVXA 4HXIA 4OYSA 5CMYA 5EDSA 1SZAA 2FF4A 4EZJA 1EPUA 3SNXA 4Y6CA 3URZA 4XX5A 3RO3A 3MO0A 2VYIA 5D0OD 1WY6A 3ZYKA 2M63A 3RJWA 1E8XA 2V8SE 3S7JA 5FQ4A 4AOFA 4OVUA 4DI4A 2AW6A 5EKQD 1H19A 4EBAG 2C0LA 4HVBA 4KXKB 5TTFA 3ZYMA 3FUJA 4UWHA 3L17A 4WNDA 1HFAA 3HIZA 3R9AB 3JYSA 2HO1A 2P58C 3U64A 1W3BA 4ANWA 4FHJA 4KVOA 3FUFA 3S7BA 3OOIA 4YPAA 2KATA 3CQGB 5AJDA 2PM7A 3CKCA 2PQNA 2R5SA 4RSYA 4N3CA 4L1BA 3MYVA 2EQXA 2X6HA 3CIAA 3Q47B 3TJPA 5KJLA 3MA5A 5AJLA 5F6KC 5G05J 3FEYA 2ILRA 2QY7A 1UJJA 4GAAA 3SI5A 4CDMA 4RVBA 2WB2A 4F3VA 2CG2A 1N52A 4BT8A 1MVHA 3M53A 3M56A 4LERA 3LY8A 4JC8A 1U3CA 3CBPA 3CK8A 1HE8A 5AENA 4UQZA 4ME2A 2Y3AA 2YHEA 4M3OA 4AV7A 1H6KA 3OPEA 4RG9A 4J7IA 3PRZA 3QWWA 4EECA 1HX8A 1YA0A 5CMWA 2DCPA 2C0MA 4MRUA 2XEVA 4U07A 4DK5A 5FQ7A 3ONLA 4RZ0A 3R7RA 1HG5A 3FTUA 5LP0A 3FH8A 3QDNA 2ONDA 4DLOA 2YINA 5EG2A 3CLJA 4GZDA 1E90A 3FDHA 3B7RL 4J8SA 4QENA 1XQHA 3CHMA 3M55A 4K0RA 4N2QA 3MGBA 4JZYA 5J08A 4XE0A 4O30A 1INZA 2BUGA 2IQCA 4H7XA 3PNLB 4WWPA 2ZU6B 3D9PA 3ENEA 4C0MA 3SD5A 4MI5A 2KM4A 2RD0A 4ABNA 3DPDA 1X5BA 4GA0A 2WXNA 4EZLA 4YNDA 2XPIA 4P29A 2WXQA 3L13A 4IRUA 3TXNA 3EIJA 3FU3A 3FUMA 3EJNA 3S2AA 1OWPA 3QJZA 3ZRHA 3CBMA 2FBNA 3M59A 5G2NA 1HF8A 1OWNA 4JHKA 2W5YA 2IF4A 5T0KA 3LXUX 3AS5A 2YHCA 3FTWA 1IQRA 5D0QD 3APFA 5BNWA 3CQCB 2R59A 3C98A 3MKQA 2XPZA 4CDRA 2VQ2A 3O48A 3FU5A 3MKQB 2BQZA 5TEGA 4I1OB 5DIZA 3AS8A 4J83A 1HH8A 1QQEA 1P5QA 4PH4B 3AU5A 3FTSA 4XZ4A 1MT6A 3IBEA 5ENNA 1VDYA 2IJGX 4F53A 3RO2A 3CHOA 3IHVA 1IQUA 3D9IA 2QFCA 5HI7A 1E96B 4ATGA 4GMLA 4XKCA 3HVEA 4U0UA 2PL2A 3PEVB 4AY6A 2PQRA 1FVHA 4E6HA 3HVEB 4G2VA 1HZ4A 3D9NA 3Q15A 1MHQA 3VLEA 4GZCA 4DPRA 4WUYA 3PS6A 3CHPA 3SW9A 1EDUA 3UQ3A 4GB9A 4FP7A 3JQ1A 4AM9A 3FUDA 4I2WA 3JQ0A 3SHFA 3G2UA 2WM9A 3LY9A 4U0SA 4YVQC 5ANLA 4LDGA 5T5GA 3RQ4A 4FA6A 1OWMA 4GU5A 2XHEA 5JHAA 4U63A 4L23A 3VLDA 2CFUA 5A7DB 4B94A 5JJTA 5J90A 1H2TC 2F69A 3ZIMA 4J8OA 3UT4A 1ELWA 4UWFA 3U4TA 3CSTA 5CCMA 2WMNA 4XKBA 3ESLA 4JA7A 4BWRA 2I1JA 2XCBA 3VUZA 4U0ZA 4N3BA 4NURA 2WXFA 3CK9A 1PAQA 5G05C 1MQSA 1MVXA 3VV0A 2VGXA 3QB2A 4AJWA 4NRHB 1H3IA 2X6KA 2VSXE 1PY1A 3ZGQA 3FP3A 2I6HA 2VGXB 3QC1A 2V4LA 5JHNA 3T8MA 3EDTB 5FQ8A 4PUCA 4GYYA 3WXXA 3I4GA 3NF1A 3MV2B 4CDNA 5CPRB 2W5ZA 4BTAA 4NVQA 3EHNA 4TRQA 3LCAA 4I6JA 4E47A 5JINA 1HXIA 4IULA 2G46A 4GYOA 3GZ2A 3BG0B 3FULA 4GCNA 3ULQA 4BT9A 4I1MA 2J9QA 5DBKA 3P2BA 5BV0A 4Q94A 3NZUA 3TG5A 3UMVA 3QKYA 4J8FA 2KCVA 4FHKA 4I1AA 3OXGA 2V0PA 4URKA 3FUEA 3RJVA 3FPDA 5JJ0A 3FY4A 1QNFA 5M72A 3VTXA 4LRZA 4Z4PA 5KJNA 2KCKA 2CHXA 3LY7A 4I17A 3ZFWA 1DNPA 2XGSA 4O6FA 3OTNA 5JJ7A 3CVNA 3AU4A 1H2UA 3FU6A 4JHJA 3SWCA 2AWIA 3HHMA 3CV0A 3JCKC 4MLPA 4ANUA 1HS6A 2WQ6A 5BPPA 4UWKA 1WAO1 1Y6IA 4OVVA 1DVPA 3SFZA 2YNQA 3L08A 4B89A 3F9ZA 1HG2A 3D9MA 5E76A 2KC7A 4BX8A 1KT0A 1LF8A 3TGOA 4PS8A 4PS7A 4UI9K 3SGHA 2OVFA 3CBOA 2NSZA 2CHZA 3FFLA 4K03A 2IOSA 1NZNA 4HOUA 4PS3A 2O8JA 2MRIA 2L9BA 2V5FA 3FHEA 5BUZA 1UW4B 4HOTA 2FI7A 3CHQA 5LOZA 1U3DA 4ILHB 3FTXA 3RKVA 3FH7A 3FUIA 5LSXA 4CT0A 4ANXA 4JPSA 5AIJA 4BUPA 1S0PA 1E8ZA 1NA3A 2XCCA 4A1GA 1N54A 2R17C 4JLGA 3RRMB 2WXIA 4ILIA 5G55A 3RIBA 3L54A 2A5UA 4MS6A 1NP7A 2VSOE 1KLXA 2VGYA 2X6JA 1H0AA 2HR2A 2X3MA 3Q49B 3LKUA 4G25A 4UQYA 4Y6WA 1N6AA 5F59A 3MKRA 2VSYA 3CVXA 5KJKA 4TUUA 2NC9A 1N3JA 3PVLA 4DJAA 1OWOA 2Y4UA 2Y4TA 4WNGA 4H7YA 3PEUB 4QEPA 2LO6A 3CVPA 2UY1A 4I6GA 5FZSA 3UX4A 3FTVA 1XGWA 4U04A 4AIFA 3APDA 1UG3A 2MOWA 3LS8A 5T8IA 2J08A 4HS2A 2UY1B 2WPVA 2C2LA 2WVIA 3CR3A 4HORA 3TAXA 2DBAA 2J4DA 4KYOB 5C2YA 2WXKA 2HYZA 4GYWA 1TJCA 4W9RA 3E4BA 3ESKA 4N39A 2WXGA 4A1SA 1JPLA 1BPOA 5EX0A 3Q4AB 4WNEA 3GW4A 2RG8A 4APOA 3DBSA 3KAEA 5T3RA 4YNMA 3KMAA 3ZN3A 3KMTA 2LSUA 3U3WA 3FWVA 4FLBA 4G24A 3FTYA 4MKTA 3EHMA 3K9IA 4I9EA 2J4BA 4EQFA 2PM6A 3P1UA 5C1DA 3T5VA 4UI9J 5T0MA 1FVFA 2VSNA 1ELRA 4FMUA 2MHKA 2NXPA 3CSFA 1UJKA 5LCWC 4JL0A 4KZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9Y A;  1B89 A;  4HOS A;  2GW1 A;  5BT1 A;  4G23 A;  3CEQ A;  1OUV A;  1A17 A;  3RU0 A;  3N71 A;  3BEE A;  3KD7 A;  3MV3 B;  3S8P A;  5CHE E;  3KMJ A;  2JV0 A;  1MUF A;  5FZR A;  5KJM A;  5F5E A;  2LNI A;  4GCO A;  5LCW J;  4N2S A;  5JJ6 A;  4GA2 A;  3S7D A;  3PE3 A;  4IJD A;  4KBQ A;  4YPE A;  3GZ1 A;  4GA1 A;  3LYA A;  4N5C A;  2YQ8 A;  4CGW A;  1FCH A;  2WQH A;  4WNF A;  3IHX A;  5JIY A;  4YNP A;  5G04 J;  3OS5 A;  1ZU2 A;  4GZ6 A;  3UUX A;  5CCL A;  2XGO A;  3CKB A;  3GYZ A;  3MO5 A;  4I51 A;  4MI0 A;  5TH7 A;  3SZ7 A;  3S7F A;  3TG4 A;  3BO5 A;  3CK7 A;  2PZI A;  3QWV A;  5HQ8 A;  3F9W A;  4H12 A;  5ARF A;  3MO2 A;  5F6L A;  3CVQ A;  1IHG A;  2OOE A;  1ZKK A;  1PC2 A;  4J8D A;  5EX3 A;  3PDN A;  5FTP A;  4BTB A;  1N6C A;  3RAY A;  3IEG A;  1O9S A;  3PE4 A;  2AVP A;  5A6C A;  1ML9 A;  4AY5 A;  4J7F A;  5BW8 C;  2KCL A;  4G1T A;  3ASH A;  4J8E A;  4UI9 C;  2IFU A;  3SF4 A;  4HOQ A;  4QEO A;  1ZBP A;  1NA0 A;  3OXL A;  3OXF A;  4XI0 A;  4GZ5 A;  3KS2 A;  5LSZ A;  5ARG A;  3CVL A;  3LPZ A;  3ASD A;  2IGQ A;  4GPK A;  2XGM A;  4JDS A;  4YVO A;  3DB5 A;  2QPW A;  4I2Z A;  3M57 A;  4G26 A;  3M5A A;  1PEG A;  2R3A A;  4YPU A;  1QZ2 A;  4C1Q A;  2LSV A;  3ZPJ A;  3UPV A;  2JLB A;  2RFI A;  2E2E A;  3M58 A;  4JHR A;  3ZHE A;  4XIF A;  3AS4 A;  4JA9 A;  3ZHE B;  2FO7 A;  1Y8M A;  5FJY A;  3DAL A;  4N3A A;  4XI9 A;  4AU7 A;  3Q5M A;  3VTY A;  4CGV A;  5AYW D;  2Q7F A;  3ASG A;  1WM5 A;  1KT1 A;  2UWJ G;  4GZ3 A;  3HNA A;  3F9X A;  2L6J A;  4NQ0 A;  3QWP A;  5G04 C;  4NJ5 A;  1XNF A;  4IN3 B;  4IJ8 A;  4UQX A;  5AYF A;  5FT9 A;  2FEZ A;  3EP0 A;  4RG6 A;  4LEU A;  3MEK A;  5FZQ A;  3K5K A;  3ASF A;  4I9C A;  3M54 A;  4J0U A;  3HYM B;  3QOU A;  1IYG A;  2FF4 A;  4Y6C A;  3URZ A;  3RO3 A;  3MO0 A;  2VYI A;  5D0O D;  3RJW A;  3S7J A;  5EKQ D;  5TTF A;  2C0L A;  4KXK B;  4WND A;  3R9A B;  3JYS A;  2HO1 A;  2P58 C;  1W3B A;  3OOI A;  3S7B A;  4YPA A;  2KAT A;  3CKC A;  2PQN A;  2R5S A;  4N3C A;  3Q47 B;  5KJL A;  3MA5 A;  5F6K C;  5G05 J;  4F3V A;  1MVH A;  3M56 A;  4BT8 A;  3M53 A;  3LY8 A;  3CBP A;  3CK8 A;  4UQZ A;  4ME2 A;  3OPE A;  4RG9 A;  4J7I A;  3QWW A;  1YA0 A;  2C0M A;  2XEV A;  4U07 A;  4RZ0 A;  3QDN A;  2OND A;  5EG2 A;  4QEN A;  1XQH A;  3M55 A;  4N2Q A;  4O30 A;  2BUG A;  4H7X A;  4MI5 A;  4ABN A;  4GA0 A;  4YND A;  2XPI A;  3CBM A;  2FBN A;  3M59 A;  2W5Y A;  2IF4 A;  5T0K A;  3AS5 A;  2YHC A;  5D0Q D;  5BNW A;  4CDR A;  2VQ2 A;  3O48 A;  5TEG A;  2BQZ A;  5DIZ A;  3AS8 A;  4J83 A;  1HH8 A;  1QQE A;  1P5Q A;  1MT6 A;  3RO2 A;  2QFC A;  5HI7 A;  1E96 B;  4U0U A;  2PL2 A;  4AY6 A;  2PQR A;  4G2V A;  1HZ4 A;  3Q15 A;  4WUY A;  3SW9 A;  3UQ3 A;  4AM9 A;  4I2W A;  3LY9 A;  4U0S A;  4YVQ C;  3RQ4 A;  4LDG A;  5T5G A;  5A7D B;  4B94 A;  5JJT A;  2F69 A;  4J8O A;  1ELW A;  3U4T A;  5CCM A;  4JA7 A;  4BWR A;  2XCB A;  3VUZ A;  4U0Z A;  4N3B A;  3CK9 A;  5G05 C;  1MVX A;  3VV0 A;  2VGX A;  4NRH B;  1H3I A;  3ZGQ A;  3FP3 A;  2I6H A;  2VGX B;  5JHN A;  3EDT B;  3WXX A;  4GYY A;  3NF1 A;  3MV2 B;  5CPR B;  2W5Z A;  4BTA A;  4NVQ A;  3LCA A;  4E47 A;  5JIN A;  1HXI A;  2G46 A;  4GYO A;  3GZ2 A;  4GCN A;  3ULQ A;  4BT9 A;  2J9Q A;  5DBK A;  3TG5 A;  3QKY A;  4J8F A;  2KCV A;  4I1A A;  3OXG A;  3RJV A;  3FPD A;  5JJ0 A;  5M72 A;  3VTX A;  4Z4P A;  5KJN A;  2KCK A;  3LY7 A;  4I17 A;  3ZFW A;  2XGS A;  4O6F A;  5JJ7 A;  3CVN A;  3SWC A;  3CV0 A;  1WAO 1;  3F9Z A;  2KC7 A;  1KT0 A;  3TGO A;  4UI9 K;  3CBO A;  3FFL A;  2O8J A;  1NZN A;  4HOU A;  2V5F A;  4HOT A;  2FI7 A;  3RKV A;  5LSX A;  4BUP A;  1NA3 A;  2XCC A;  4JLG A;  3RIB A;  1KLX A;  2VGY A;  3Q49 B;  2HR2 A;  4G25 A;  1N6A A;  5F59 A;  3LKU A;  4UQY A;  4Y6W A;  3MKR A;  2VSY A;  5KJK A;  2NC9 A;  1N3J A;  4WNG A;  2Y4U A;  2Y4T A;  4H7Y A;  4QEP A;  3CVP A;  2UY1 A;  5FZS A;  4U04 A;  4AIF A;  4HOR A;  2UY1 B;  2WPV A;  2C2L A;  3TAX A;  2DBA A;  4KYO B;  2HYZ A;  4GYW A;  1TJC A;  4W9R A;  3E4B A;  3ESK A;  4N39 A;  4A1S A;  5EX0 A;  3Q4A B;  4WNE A;  3GW4 A;  4APO A;  3KAE A;  4YNM A;  3KMA A;  3ZN3 A;  3KMT A;  2LSU A;  3U3W A;  3FWV A;  4G24 A;  3K9I A;  4I9E A;  4EQF A;  5C1D A;  5T0M A;  4UI9 J;  2VSN A;  1ELR A;  4FMU A;  2MHK A;  5LCW C;  4JL0 A; 
#chains in the Genus database with same CATH topology
 3FEX A;  4N5Q A;  3F9Y A;  1SZ9 A;  4DLQ A;  4HOS A;  4G23 A;  3B7U X;  1A17 A;  3KD7 A;  2R02 A;  1MX6 A;  3PUJ A;  2P9L G;  3EHR A;  3UIP C;  3CVY A;  1Z5S C;  3IXE A;  4F7A A;  3PH0 C;  4B8C B;  2LNI A;  4GTV A;  5LCW J;  4GA2 A;  3Q75 A;  4YPE A;  3ZVV A;  1FCH A;  3W9F A;  3ASO E;  5BV1 A;  4BY6 A;  3NZS A;  4APF A;  2LXM A;  5CEA A;  2XS8 A;  5G04 J;  4AXH A;  2P9I G;  3CHR A;  3UUX A;  1AWC B;  3MO5 A;  3C5R A;  4I51 A;  4C9B B;  4I6E A;  3MJW A;  1DC2 A;  2JEK A;  3UXG A;  2EIJ E;  3QWV A;  3QAQ A;  2I1K A;  4H12 A;  4JEU A;  5F6L A;  3CVQ A;  1OCR E;  2WXO A;  2XEE A;  2OOE A;  1ZKK A;  3BQO A;  4Q96 A;  4J8D A;  5JHB A;  1LD7 A;  2B6C A;  3PDN A;  5A23 A;  2H6I A;  3B7T A;  1N6C A;  2J09 A;  3IEG A;  2WMO A;  3LDZ A;  3KSQ A;  1TJF A;  4A55 A;  3DSW A;  1NA0 A;  3OXL A;  2XZT G;  3U9W A;  3ML9 A;  2P9U G;  3BG1 B;  4F1S A;  4GPK A;  1MYO A;  4CCA A;  2XGM A;  3LVR E;  3QAR A;  2RFM A;  3RK6 A;  4FU3 A;  3ZPJ A;  2AXV A;  1N9A A;  3D3M A;  4KZ0 A;  3M58 A;  1S70 B;  4XIF A;  3AS4 A;  2ZIR A;  3ZHE B;  2EIK E;  2ETA A;  1S63 A;  3HG0 D;  4ACK A;  2JAB A;  2WXL A;  2P9K G;  3DAL A;  4XI9 A;  4NAC A;  4AU7 A;  3B13 A;  3TWW A;  3ZXP A;  1WM5 A;  1JUQ A;  1XNF A;  3CHS A;  3ISM C;  4IJ8 A;  2A4Z A;  1MX2 A;  3EP0 A;  2KZT B;  3DST A;  3FUN A;  3MEK A;  2GRO B;  3K5K A;  2GGF A;  4U95 D;  3HXD A;  3PRE A;  1HU3 A;  3UM1 A;  3RO3 A;  3Q9U C;  3MO0 A;  2VYI A;  3RAU A;  2BKG A;  3C3R A;  4HLL A;  3L17 A;  3JYS A;  5AQA A;  2KAT A;  4RSY A;  3MYV A;  3CIA A;  3FEY A;  4GAA A;  2GRN B;  1MVH A;  3M56 A;  4GTO A;  4JC8 A;  3CK8 A;  5HKP A;  1UOH A;  1H6K A;  4RG9 A;  4U07 A;  4RZ0 A;  4ZFH A;  2OND A;  5EG2 A;  4HB5 A;  5ENO D;  1E90 A;  3B7R L;  3CHM A;  4K0R A;  3SFY A;  2ZU6 B;  3D9P A;  3SD5 A;  2KM4 A;  2H6F A;  4EZL A;  5ENP D;  2BKK B;  3FUM A;  3S2A A;  3AJI A;  2FBN A;  3ZU7 B;  1OWN A;  2W5Y A;  5T0K A;  3LXU X;  3AS5 A;  2YHC A;  3FTW A;  3CQC B;  2R59 A;  4L9P A;  3TWQ A;  4CDR A;  3FU5 A;  5TEG A;  3EU5 A;  1NL4 A;  3DEO A;  3HXF A;  3IBE A;  3RO2 A;  3DWL G;  4ATG A;  4XKC A;  1FVH A;  4RQI A;  3HVE B;  4G2V A;  3AAA C;  4DX5 D;  3G2U A;  2WM9 A;  4U0S A;  4LDG A;  4QQI A;  3UTM A;  2XHE A;  5JHA A;  3VLD A;  1H2T C;  2F69 A;  3PZ4 A;  2WMN A;  4XKB A;  4JA7 A;  3VUZ A;  4N3B A;  4NUR A;  3CK9 A;  3VV0 A;  2VGX A;  3QB2 A;  1H3I A;  2X6K A;  3T8M A;  3WXX A;  4GYY A;  5CPR B;  1JCS A;  4BTA A;  4E47 A;  5CBO A;  3P2B A;  1IKN D;  3QKY A;  2KCV A;  4FHK A;  4I1A A;  3DXK G;  3FUE A;  4HQD A;  3LY7 A;  4MLP A;  3ABM E;  3HXC A;  3L08 A;  3D9M A;  1KT0 A;  4B93 B;  1QBQ A;  4K03 A;  2IOS A;  2O8J A;  1UW4 B;  4HOT A;  1U3D A;  5LSX A;  4ANX A;  1S0P A;  3EUV A;  4JLG A;  4ILI A;  3T8K A;  4TRQ A;  2QZA A;  3Q49 B;  4G25 A;  3MKR A;  2VSY A;  3CVX A;  2ZXW E;  1YYH A;  3PEU B;  4I6G A;  5FZS A;  5T8I A;  5AAO A;  4HOR A;  3CR3 A;  4KYO B;  1N95 A;  1N4S A;  3ESK A;  1BPO A;  5EX0 A;  3Q4A B;  4HI9 A;  2DVW A;  3DBS A;  5T3R A;  3KMA A;  3ZN3 A;  3U3W A;  3E30 A;  2IO3 C;  4G24 A;  4C48 B;  1H6P A;  3K9I A;  3J5Q B;  2PM6 A;  3P1U A;  1FVF A;  2VSN A;  5AAR A;  5BXU A;  2MHK A;  4CYM D;  4KZC A;  1E7V A;  2WXM A;  4L2L A;  1TNB A;  5EIB E;  3CEQ A;  1OUV A;  3RU0 A;  3BEE A;  4PDX A;  1JWF A;  3MV3 B;  3RRN B;  4DUI A;  1SA5 A;  3ZYL A;  4WAF A;  5CHE E;  5KJM A;  5F5E A;  2XQ0 A;  1EF1 C;  1E8Y A;  4CEM A;  4DRX E;  4KBQ A;  5JA4 D;  3CVV A;  4OAU C;  1JCR A;  3LYA A;  4HNA D;  4LNU D;  2YQ8 A;  4O60 A;  1K8K G;  2H6H A;  4B0Z A;  1GW6 A;  5JIY A;  3UKR G;  4TV3 A;  4L7T A;  2XPY A;  2P9P G;  1K1B A;  3TG4 A;  3BO5 A;  3CK7 A;  3D9K A;  4D10 C;  3R9M A;  4CRW A;  1O5M A;  3IKO B;  3C72 A;  5HQ8 A;  3T5X A;  2GRL A;  3ONK A;  3FU0 A;  1IHG A;  3L6A A;  5KCM A;  4BTB A;  3GZS A;  4GTM A;  2LAI A;  2DIW A;  4AP2 A;  2EIM E;  3PE4 A;  1ML9 A;  3ASN E;  2IOL A;  2LAH A;  1Z3Y A;  4UI9 C;  2IFU A;  3SF4 A;  4FLH A;  3T9K A;  3ZW3 A;  2ETB A;  2OV8 A;  3D9J A;  3FUH A;  1SQM A;  2XRY A;  4XI0 A;  5E75 A;  5ENR D;  3KS2 A;  3LJ3 A;  3CVL A;  3LPZ A;  3AG4 E;  3G2S A;  4JDS A;  3DB5 A;  2QPW A;  3M57 A;  2WXH A;  1RW2 A;  2FUL A;  5H7P A;  3M5A A;  4YPU A;  2CG3 A;  1QZ2 A;  4C1Q A;  3JUI A;  4F1P A;  3APC A;  1BD8 A;  5CRV A;  3UPV A;  2JLB A;  2EIL E;  3ZHE A;  4UWL A;  1N4Q A;  2OCC E;  3AG1 E;  3ML8 A;  3FUK A;  4EHM A;  3O4Z A;  1G3N B;  3DSS A;  3TXM A;  4K5A B;  3I5P A;  3ASG A;  3LVQ E;  3F9X A;  3HNA A;  2L6J A;  3QWP A;  1HO8 A;  4HBD A;  3DSX A;  2KZT A;  2J49 A;  5FT9 A;  4NIK A;  4ILG A;  2I2O A;  4LEU A;  2GRM A;  3G2W A;  2EIN E;  4I9C A;  3M54 A;  1N11 A;  3VLF A;  4FJY A;  3ZYQ A;  3HYM B;  4AVX A;  4OYS A;  5EDS A;  1EPU A;  2GRR B;  4XX5 A;  5D0O D;  2M63 A;  4OVU A;  5EKQ D;  4HVB A;  4KXK B;  2P58 C;  4KVO A;  4YPA A;  3CQG B;  2EQX A;  3Q47 B;  5KJL A;  5AJL A;  2QY7 A;  1UJJ A;  3SI5 A;  1BI8 B;  3V30 A;  4F3V A;  3ULE G;  4BT8 A;  3M53 A;  4LER A;  3Q7A A;  1HE8 A;  4GPM A;  4UQZ A;  4M3O A;  1BLX B;  4K5C A;  4J7I A;  3QWW A;  4EEC A;  5JMN D;  1YA0 A;  5CMW A;  4MRU A;  2XEV A;  1SA4 A;  3DRA A;  3FTU A;  4U96 D;  5LP0 A;  4OAV B;  3QDN A;  2F8Y A;  4J8S A;  3M55 A;  3MGB A;  4JZY A;  4XE0 A;  2BUG A;  1TNZ A;  4H7X A;  2V5Q C;  3DPD A;  2XPI A;  4HI8 A;  1IXV A;  3HRA A;  3QJZ A;  5KBA A;  3UM0 A;  1HF8 A;  5D0Q D;  3APF A;  2VQ2 A;  3O48 A;  3MKQ B;  2BQZ A;  4A63 B;  4I1O B;  2KBX A;  1HH8 A;  1QQE A;  3FTS A;  3CHO A;  4GTQ A;  1IQU A;  3D9I A;  5HI7 A;  3HVE A;  4E6H A;  3D9N A;  3VLE A;  4GZC A;  5KNH D;  4YDY A;  3PS6 A;  1FPP A;  3UI2 A;  4AM9 A;  2LUH A;  3LY9 A;  1FT2 A;  3UIN C;  1OWM A;  5AQB A;  4GU5 A;  4O1P A;  5A7D B;  4B94 A;  1KPS B;  4BEP A;  5CCM A;  3ESL A;  3UM3 A;  4UUC A;  2I1J A;  2XCB A;  1V55 E;  2WXF A;  1MJ0 A;  1MQS A;  1MVX A;  2VSX E;  3Q79 A;  5EYL A;  1D8E A;  3FP3 A;  2V4L A;  5JHN A;  3EDT B;  4PUC A;  3NF1 A;  4G8L A;  1AP7 A;  5JIN A;  1OCC E;  3GZ2 A;  3BG0 B;  4I1M A;  2J9Q A;  5DBK A;  4O1O A;  4URK A;  4J8F A;  3RJV A;  5AN8 A;  5JJ0 A;  5M72 A;  1QNF A;  4I17 A;  5B3S E;  3AU4 A;  3SWC A;  2ZGD A;  1HS6 A;  2WQ6 A;  4M7C A;  4BES A;  2YNQ A;  4B89 A;  1D9S A;  1TNO A;  2KC7 A;  4BX8 A;  1JCQ A;  4PS7 A;  2OVF A;  2XZD G;  2CHZ A;  3JXI A;  4HOU A;  1OY3 D;  2L9B A;  3NOG D;  4ATZ D;  3CHQ A;  1K1A A;  5LOZ A;  4G8K A;  4ILH B;  3RKV A;  3FH7 A;  3AG3 E;  1NA3 A;  3RRM B;  2WXI A;  3RIB A;  4J8Y A;  2A5U A;  2X3M A;  2X6J A;  4UQY A;  5KJK A;  2NC9 A;  2Y4T A;  3AG2 E;  4QEP A;  3CVP A;  3UX4 A;  4U04 A;  4AIF A;  1UG3 A;  2J08 A;  4HS2 A;  2WVI A;  2RKK A;  2J4D A;  2WXK A;  2HYZ A;  1TJC A;  2WXG A;  4YDO A;  4WNE A;  3TWR A;  2RG8 A;  3KAE A;  3KMT A;  3ABL E;  3FWV A;  4MKT A;  3EHM A;  5EYP F;  5T0M A;  3EU9 A;  4UI9 J;  1ELR A;  3CSF A;  3Q7F A;  5LCW C;  3WG7 E;  4JL0 A;  1OCO E;  4K5B A;  2GW1 A;  4GTT A;  3Q78 A;  5KWD A;  1A5E A;  3F6Q A;  2VTB B;  1NFI E;  3NOC D;  4CT4 A;  1H2V C;  4BSZ B;  3KMJ A;  3QNK A;  1YMP A;  5CBN A;  4GMR A;  3OAW A;  4KMO A;  1MZC A;  5JJ6 A;  4F6R D;  1OWL A;  4IJD A;  1RZ4 A;  2CHW A;  3GZ1 A;  4GA1 A;  4LSZ E;  4CZ2 D;  4JEH A;  5EN5 D;  4CGW A;  1V54 E;  1JWG A;  3D9L A;  4UWG A;  3G2V A;  3JXJ A;  4WNF A;  3IHX A;  4KT6 B;  3I3N A;  5CED B;  1ZU2 A;  4WWN A;  4GZ6 A;  4MI0 A;  5TH7 A;  4B8A A;  2PZI A;  2ETC A;  4WWO A;  3R7Q A;  3F9W A;  2MYO A;  3G2T A;  3MO2 A;  4V3I A;  2WXR A;  4HRM B;  1UN9 A;  2A5E A;  4GMJ A;  1PC2 A;  5FWQ A;  4E85 A;  2RFA A;  5EX3 A;  5FTP A;  3RAY A;  5KNG A;  4ANV A;  3ZEF A;  5LFA A;  2VJ8 A;  2LXL A;  2AVP A;  3PUK A;  2XRZ A;  2X6F A;  5BW8 C;  2KCL A;  3I4R B;  3IV0 A;  4BFR A;  4HOQ A;  3KEZ A;  3OXF A;  4GZ5 A;  2F8X K;  1ELK A;  1WDY A;  3E37 A;  1MX4 A;  4FAD A;  4BSX A;  3L9T A;  4G26 A;  1PEG A;  2CFZ A;  2R3A A;  4HLE A;  2LSV A;  1Z6T A;  5ITZ F;  3SBT B;  2RFI A;  4FUL A;  4QFV A;  4RLY A;  4JA9 A;  1Y8M A;  4EBA A;  3MZL B;  3RSE G;  4FJZ A;  2WQ7 A;  3TL5 A;  4KVM A;  3UT8 A;  3Q5M A;  4CGV A;  2Q7F A;  4GZ3 A;  4J6I A;  4NJ5 A;  3TWX A;  2HM8 A;  1O1T A;  2IY0 C;  4UQX A;  4DI3 A;  4Z68 A;  3HDX A;  5AYF A;  3V31 A;  4LUN U;  3ULY A;  3EIQ C;  4G11 A;  3ASF A;  4ACL A;  5T4Y A;  1N4P A;  5FIO A;  3L22 A;  2L0T B;  3ZXS A;  3QOU A;  5CMY A;  2KXP C;  1N0R A;  1LTX A;  4EZJ A;  3SNX A;  4Y6C A;  3LJN A;  3URZ A;  1KZO A;  1E8X A;  2V8S E;  3S7J A;  4DI4 A;  4AOF A;  4GTP A;  2AW6 A;  5TTF A;  2C0L A;  3ZYM A;  2XS1 A;  4WND A;  1HFA A;  3HIZ A;  3R9A B;  1OT8 A;  3U64 A;  1W3B A;  4ANW A;  3BUA A;  2NYJ A;  4LNG A;  2PM7 A;  3CKC A;  5CEC B;  2R5S A;  2H6G A;  4N3C A;  4L1B A;  2X6H A;  2R03 A;  5F6K C;  2ILR A;  5HRY A;  4RVB A;  2WB2 A;  2CG2 A;  1U3C A;  3CBP A;  5AEN A;  3DPY A;  2YHE A;  3E33 A;  2DZO A;  5EIL A;  4AV7 A;  3OPE A;  3JUE A;  5FQ7 A;  3ONL A;  1HG5 A;  1TYQ G;  3FH8 A;  4DLO A;  3CLJ A;  4GZD A;  3FDH A;  5ENQ D;  4O30 A;  1INZ A;  2IQC A;  3DSV A;  1DCQ A;  4WWP A;  4MI5 A;  4C0M A;  2RD0 A;  2FO1 E;  2P9S G;  4GA0 A;  2WXN A;  4P29 A;  3EIJ A;  3FU3 A;  3EJN A;  1OWP A;  5G2N A;  3ABK E;  4JHK A;  1IQR A;  5BNW A;  3C98 A;  3MKQ A;  2R05 A;  3Q9N C;  5DIZ A;  2R2L A;  2J8S D;  3AU5 A;  1MT6 A;  1KZP A;  1VDY A;  4F53 A;  3IHV A;  2QFC A;  2L6B A;  1E96 B;  4GML A;  3PEV B;  5AQ7 A;  4AY6 A;  1ZB1 A;  1HZ4 A;  3Q15 A;  4WUY A;  4HRL A;  3SW9 A;  1EDU A;  4GB9 A;  4FP7 A;  3B7B A;  3FUD A;  4I2W A;  3JQ0 A;  1O1S A;  4YVQ C;  3RQ4 A;  5ANL A;  4FA6 A;  2DZN A;  4U63 A;  2CFU A;  2Y69 E;  3DSU A;  5JJT A;  3ZIM A;  3UT4 A;  1ELW A;  3DXM G;  3X2Q E;  4BWR A;  5G05 C;  1TNU A;  4AJW A;  4NRH B;  3TWS A;  3QC1 A;  4CDN A;  4NVQ A;  3EHN A;  4IUL A;  5D66 A;  4GCN A;  5B1A E;  3V2X A;  4X8Q A;  3TG5 A;  3D9H A;  1TNY A;  1H6O A;  3KSL A;  4LRZ A;  2XGS A;  5JJ7 A;  1OXJ A;  3FU6 A;  4JHJ A;  3ZKJ A;  1LD8 A;  4ANU A;  5BPP A;  1WAO 1;  3SFZ A;  1DVP A;  2AJA A;  2XEN A;  3C3O A;  3F9Z A;  1HG2 A;  5E76 A;  4DX6 D;  1LF8 A;  3TGO A;  3SY2 A;  4PS8 A;  4UI9 K;  2NSZ A;  3FFL A;  3C3Q A;  1NZN A;  2MRI A;  2V5F A;  1SVX A;  3FHE A;  5BUZ A;  3FTX A;  3NB2 A;  4CT0 A;  4JPS A;  5AIJ A;  2ZGG A;  3NAW A;  4GTR A;  2R17 C;  2ZIS A;  3UM2 A;  5G55 A;  4MS6 A;  3ZRH A;  1KLX A;  1H0A A;  1N6A A;  5F59 A;  4TUU A;  1OWO A;  2Y4U A;  5D2M C;  3PZ2 A;  3FTV A;  1XGW A;  2MOW A;  2UY1 B;  2IEJ A;  5C2Y A;  4U7E B;  4GYW A;  4JD2 G;  1JPL A;  4BER A;  3FTY A;  3T5V A;  5C1D A;  4FMU A;  2NXP A;  1UJK A;  4A3V A;  1B89 A;  5FQ6 A;  5BT1 A;  4EZK A;  3SBS A;  4DX2 A;  3N71 A;  2VTB A;  2B0O E;  1FT1 A;  5IY5 E;  2OEW A;  4FC8 A;  1WG0 A;  1N4R A;  4TXP A;  3S8P A;  2OEV A;  4C0E A;  3SQV A;  2DYS E;  3B7S A;  2JV0 A;  1MUF A;  2XEH A;  5FZR A;  4A3T A;  4GCO A;  4N2S A;  2BED A;  1N94 A;  3S7D A;  3UT7 A;  1D8D A;  3PE3 A;  5ENS D;  3PZD A;  4N5C A;  2J07 A;  1SW6 A;  3E34 A;  2WQH A;  5FIN A;  3IHY A;  3QK0 A;  3E32 A;  4MBG A;  4YNP A;  3OS5 A;  4LCT A;  5ANR A;  2IU1 A;  4U8H A;  4DX7 D;  5CCL A;  2XGO A;  3CKB A;  3CVW A;  3GYZ A;  2E0I A;  3SZ7 A;  3S7F A;  4JVS A;  2F0Y A;  2OVB A;  1OCZ E;  3TWV A;  2AXZ A;  4JW1 A;  5ARF A;  4I43 A;  1UN8 A;  2BTD A;  4AEZ C;  4TXR A;  4JXT A;  5LX8 A;  4GTS A;  3U66 A;  3J5P A;  4HFG A;  4L2Y A;  3UKU G;  4YDW A;  1TEZ A;  2P2C P;  1Z3X A;  2DYR E;  1O9S A;  3MCX A;  3PNT B;  5A6C A;  4AY5 A;  4J7F A;  4G1T A;  3ASH A;  2X38 A;  4J8E A;  5CRU A;  4QEO A;  1ZBP A;  3V2O A;  1E8W A;  1QYM A;  2X6I A;  5HS0 A;  3LEW A;  1L5J A;  5LSZ A;  5ARG A;  3ASD A;  2IGQ A;  4YVO A;  4I2Z A;  3HXE A;  2BF0 X;  3SFX A;  3NQP A;  1DCE A;  4Q69 A;  2PNN A;  3CGH A;  2E2E A;  4JHR A;  3RRU A;  4R7L A;  2AXU A;  2FO7 A;  5FJY A;  3FTZ A;  4N3A A;  3VTY A;  5AYW D;  1K3Z D;  2WXP A;  1KT1 A;  2UWJ G;  4LG6 A;  1EYH A;  1TN7 A;  2L0I A;  4NQ0 A;  5G04 C;  4IYP A;  2QYJ A;  2VGE A;  3L16 A;  4IN3 B;  1NI1 A;  1E7U A;  1IHB A;  3CVU A;  2FEZ A;  4BET A;  4RG6 A;  3D9O A;  5FZQ A;  4EPZ A;  2ION A;  2I9C A;  2WXJ A;  3MX3 A;  3FH5 A;  4DX1 A;  4J0U A;  3B95 A;  4YDE A;  1S64 A;  1IYG A;  3TWU A;  4HXI A;  1TN6 A;  1SZA A;  2FF4 A;  3V79 K;  1WY6 A;  3ZYK A;  3RJW A;  4EBA G;  5FQ4 A;  3KEA A;  1H19 A;  3FUJ A;  3SO8 A;  2GRP B;  4UWH A;  2HO1 A;  4FHJ A;  3OOI A;  3FUF A;  3S7B A;  5AJD A;  3W9G A;  2PQN A;  3TJP A;  3MA5 A;  5G05 J;  4CDM A;  1N52 A;  1TN8 A;  3LY8 A;  5B1B E;  4ME2 A;  2Y3A A;  2IO2 C;  3PRZ A;  3Q73 A;  1HX8 A;  2DCP A;  2C0M A;  4DK5 A;  3ZUV B;  3R7R A;  2YIN A;  1BU9 A;  4QEN A;  1XQH A;  1O1R A;  4N2Q A;  5J08 A;  3PZ3 A;  3PNL B;  3ENE A;  2Y1L E;  3NBN B;  4ABN A;  1X5B A;  2DWZ A;  4YND A;  1X81 A;  2WXQ A;  3L13 A;  3TXN A;  4IRU A;  3CBM A;  3M59 A;  2IF4 A;  2XPZ A;  4JB8 P;  3PZ1 A;  3UIO C;  3AS8 A;  4J83 A;  3BU8 A;  1P5Q A;  4PH4 B;  4XZ4 A;  3DEP A;  5ENN A;  2IJG X;  2HE0 A;  2QYU A;  4U0U A;  2PL2 A;  4U8Y D;  2PQR A;  1MHQ A;  4DPR A;  3CHP A;  3UQ3 A;  3JQ1 A;  3SHF A;  5T5G A;  4L23 A;  5J90 A;  3HXB A;  4J8O A;  3ZNG A;  4UWF A;  3U4T A;  3CST A;  4U0Z A;  1PAQ A;  1PY1 A;  3ZGQ A;  2I6H A;  2VGX B;  5FQ8 A;  3I4G A;  3MV2 B;  2W5Z A;  2GRQ B;  4TXQ A;  3LCA A;  2V4H C;  4I6J A;  1HXI A;  2G46 A;  4GYO A;  3FUL A;  3ULQ A;  4BT9 A;  1BI7 B;  3TWT A;  5BV0 A;  4Q94 A;  3NZU A;  3UMV A;  3OXG A;  2V0P A;  3FPD A;  3FY4 A;  4U8V D;  3VTX A;  5AQ9 A;  4Z4P A;  4J7W A;  5KJN A;  2KCK A;  2CHX A;  2F37 A;  3ZFW A;  1DNP A;  4O6F A;  3OTN A;  3CVN A;  1H2U A;  2AWI A;  3HHM A;  3CV0 A;  3JCK C;  4UWK A;  1Y6I A;  4OVV A;  4HRN A;  3SGH A;  3CBO A;  4PS3 A;  2QC9 A;  2FI7 A;  1YCS B;  4XEI G;  3FUI A;  4BUP A;  1E8Z A;  2XCC A;  4A1G A;  1N54 A;  1Q2Z A;  3L82 A;  3L54 A;  1NP7 A;  2VSO E;  2VGY A;  2HR2 A;  3LKU A;  4Y6W A;  1U2V G;  1N3J A;  3PVL A;  4DJA A;  3EHQ A;  4WNG A;  4H7Y A;  2LO6 A;  2UY1 A;  3APD A;  1N0Q A;  4BX9 A;  3LS8 A;  2WPV A;  2C2L A;  5ENT D;  3TAX A;  2DBA A;  4W9R A;  3E4B A;  4N39 A;  4A1S A;  3GW4 A;  4TUM A;  4LNB A;  4APO A;  4YNM A;  2LSU A;  5BXO A;  2Y0B G;  4FLB A;  5EID A;  5CER B;  4I9E A;  4ZHB A;  2J4B A;  4EQF A;  2P9N G;  1TR4 A; 
#chains in the Genus database with same CATH homology
 3FEX A;  3F9Y A;  4A3V A;  1SZ9 A;  1B89 A;  4DLQ A;  4HOS A;  2GW1 A;  5FQ6 A;  1E7V A;  5BT1 A;  2WXM A;  4G23 A;  3B7U X;  4L2L A;  4EZK A;  3CEQ A;  3SBS A;  1OUV A;  1A17 A;  3RU0 A;  3N71 A;  3BEE A;  3KD7 A;  2VTB A;  4PDX A;  1JWF A;  3MV3 B;  3RRN B;  2VTB B;  3PUJ A;  3ZYL A;  4FC8 A;  3CVY A;  4CT4 A;  3S8P A;  1H2V C;  4C0E A;  4WAF A;  3B7S A;  5CHE E;  4F7A A;  3QNK A;  1MUF A;  2JV0 A;  3KMJ A;  3OAW A;  3PH0 C;  5FZR A;  4B8C B;  5KJM A;  5F5E A;  2LNI A;  4A3T A;  2XQ0 A;  4GCO A;  4KMO A;  5LCW J;  4N2S A;  1EF1 C;  1E8Y A;  5JJ6 A;  4GA2 A;  3S7D A;  3UT7 A;  4CEM A;  3PE3 A;  1OWL A;  4IJD A;  4KBQ A;  3CVV A;  4YPE A;  2CHW A;  3GZ1 A;  3PZD A;  3ZVV A;  4GA1 A;  3LYA A;  4JEH A;  4N5C A;  2YQ8 A;  2J07 A;  4CGW A;  1FCH A;  1JWG A;  2WQH A;  3D9L A;  4UWG A;  3G2V A;  5BV1 A;  3IHY A;  4WNF A;  4BY6 A;  3QK0 A;  3IHX A;  3NZS A;  4APF A;  4KT6 B;  3I3N A;  4B0Z A;  1GW6 A;  4YNP A;  5JIY A;  4TV3 A;  5G04 J;  4AXH A;  3OS5 A;  4LCT A;  5ANR A;  4L7T A;  2IU1 A;  1ZU2 A;  3CHR A;  4WWN A;  4GZ6 A;  2XPY A;  4U8H A;  3UUX A;  5CCL A;  2XGO A;  3CKB A;  3CVW A;  3GYZ A;  3MO5 A;  2E0I A;  4I51 A;  4MI0 A;  4C9B B;  5TH7 A;  3SZ7 A;  3S7F A;  3TG4 A;  3BO5 A;  4I6E A;  3MJW A;  3CK7 A;  4B8A A;  2PZI A;  2JEK A;  3D9K A;  4JVS A;  4D10 C;  4CRW A;  3QWV A;  2OVB A;  3IKO B;  3QAQ A;  2I1K A;  4WWO A;  3R7Q A;  2AXZ A;  4JW1 A;  5HQ8 A;  3F9W A;  3G2T A;  4H12 A;  5ARF A;  3MO2 A;  4JEU A;  4V3I A;  2WXR A;  4I43 A;  5F6L A;  1UN8 A;  3T5X A;  3CVQ A;  2GRL A;  2BTD A;  3ONK A;  3FU0 A;  4AEZ C;  2WXO A;  1UN9 A;  1IHG A;  2OOE A;  4GMJ A;  1ZKK A;  1PC2 A;  4Q96 A;  5FWQ A;  4E85 A;  3L6A A;  5KCM A;  4J8D A;  5JHB A;  4JXT A;  5EX3 A;  5LX8 A;  3U66 A;  3PDN A;  5A23 A;  5FTP A;  4BTB A;  3GZS A;  3B7T A;  1N6C A;  3RAY A;  4HFG A;  4L2Y A;  2J09 A;  2LAI A;  1TEZ A;  2DIW A;  3IEG A;  4AP2 A;  1Z3X A;  4ANV A;  1O9S A;  3ZEF A;  5LFA A;  3MCX A;  2VJ8 A;  3PNT B;  3PE4 A;  3PUK A;  2AVP A;  5A6C A;  2WMO A;  1ML9 A;  3LDZ A;  2XRZ A;  4AY5 A;  2X6F A;  5BW8 C;  4J7F A;  2IOL A;  2KCL A;  3I4R B;  2LAH A;  4G1T A;  3ASH A;  1TJF A;  3IV0 A;  2X38 A;  1Z3Y A;  4BFR A;  4J8E A;  4UI9 C;  4A55 A;  2IFU A;  3SF4 A;  4FLH A;  4HOQ A;  4QEO A;  3KEZ A;  3ZW3 A;  1ZBP A;  3D9J A;  2OV8 A;  1E8W A;  1NA0 A;  3OXL A;  3FUH A;  1SQM A;  2X6I A;  3OXF A;  2XRY A;  4XI0 A;  5E75 A;  3U9W A;  3KS2 A;  4GZ5 A;  3LEW A;  3ML9 A;  1L5J A;  3BG1 B;  5LSZ A;  5ARG A;  3LJ3 A;  3CVL A;  1ELK A;  3ASD A;  3LPZ A;  2IGQ A;  4F1S A;  4GPK A;  4CCA A;  3G2S A;  4FAD A;  2XGM A;  4BSX A;  4JDS A;  3LVR E;  4YVO A;  3DB5 A;  2QPW A;  4I2Z A;  3QAR A;  3M57 A;  2WXH A;  2FUL A;  4G26 A;  3M5A A;  1PEG A;  2CFZ A;  2R3A A;  2CG3 A;  1QZ2 A;  4YPU A;  2BF0 X;  4C1Q A;  4HLE A;  3JUI A;  3NQP A;  3APC A;  2LSV A;  3RK6 A;  1Z6T A;  4FU3 A;  3ZPJ A;  3UPV A;  3SBT B;  2JLB A;  2RFI A;  2AXV A;  4Q69 A;  3D3M A;  4KZ0 A;  3CGH A;  2E2E A;  4FUL A;  4QFV A;  4JHR A;  3ZHE A;  4XIF A;  3RRU A;  3M58 A;  4R7L A;  3AS4 A;  4JA9 A;  2AXU A;  3ZHE B;  4UWL A;  2FO7 A;  1Y8M A;  4EBA A;  3MZL B;  5FJY A;  4FJZ A;  4ACK A;  2WXL A;  2WQ7 A;  3DAL A;  3ML8 A;  3FUK A;  3TL5 A;  4KVM A;  3O4Z A;  3FTZ A;  4N3A A;  3UT8 A;  4XI9 A;  4NAC A;  4AU7 A;  3B13 A;  3TXM A;  3Q5M A;  3VTY A;  3I5P A;  5AYW D;  4CGV A;  2Q7F A;  2WXP A;  3ASG A;  3LVQ E;  1WM5 A;  1KT1 A;  2UWJ G;  4GZ3 A;  3HNA A;  3F9X A;  1JUQ A;  4J6I A;  1EYH A;  2L0I A;  2L6J A;  4NQ0 A;  3QWP A;  5G04 C;  4NJ5 A;  4IYP A;  1HO8 A;  1XNF A;  3CHS A;  3L16 A;  4IN3 B;  2HM8 A;  1E7U A;  4IJ8 A;  4BX9 A;  4UQX A;  2KZT A;  4DI3 A;  2J49 A;  2A4Z A;  3HDX A;  5FT9 A;  3CVU A;  2FEZ A;  5AYF A;  4ILG A;  4LUN U;  2I2O A;  3EP0 A;  2KZT B;  4RG6 A;  3D9O A;  4LEU A;  3FUN A;  3MEK A;  3EIQ C;  2GRM A;  3G2W A;  5FZQ A;  3K5K A;  2GGF A;  4G11 A;  2ION A;  4EPZ A;  2I9C A;  3ASF A;  2WXJ A;  3MX3 A;  4I9C A;  4ACL A;  3M54 A;  3VLF A;  5T4Y A;  4FJY A;  3FH5 A;  3ZYQ A;  4J0U A;  3L22 A;  2L0T B;  3PRE A;  3ZXS A;  3HYM B;  1HU3 A;  3QOU A;  1IYG A;  4AVX A;  4HXI A;  4OYS A;  5CMY A;  5EDS A;  1SZA A;  2FF4 A;  4EZJ A;  1EPU A;  3SNX A;  4Y6C A;  3URZ A;  4XX5 A;  3RO3 A;  3MO0 A;  2VYI A;  5D0O D;  1WY6 A;  3ZYK A;  2M63 A;  3RJW A;  1E8X A;  2V8S E;  3S7J A;  5FQ4 A;  4AOF A;  4OVU A;  4DI4 A;  2AW6 A;  5EKQ D;  1H19 A;  4EBA G;  2C0L A;  4HVB A;  4KXK B;  5TTF A;  3ZYM A;  3FUJ A;  4UWH A;  3L17 A;  4WND A;  1HFA A;  3HIZ A;  3R9A B;  3JYS A;  2HO1 A;  2P58 C;  3U64 A;  1W3B A;  4ANW A;  4FHJ A;  4KVO A;  3FUF A;  3S7B A;  3OOI A;  4YPA A;  2KAT A;  3CQG B;  5AJD A;  2PM7 A;  3CKC A;  2PQN A;  2R5S A;  4RSY A;  4N3C A;  4L1B A;  3MYV A;  2EQX A;  2X6H A;  3CIA A;  3Q47 B;  3TJP A;  5KJL A;  3MA5 A;  5AJL A;  5F6K C;  5G05 J;  3FEY A;  2ILR A;  2QY7 A;  1UJJ A;  4GAA A;  3SI5 A;  4CDM A;  4RVB A;  2WB2 A;  4F3V A;  2CG2 A;  1N52 A;  4BT8 A;  1MVH A;  3M53 A;  3M56 A;  4LER A;  3LY8 A;  4JC8 A;  1U3C A;  3CBP A;  3CK8 A;  1HE8 A;  5AEN A;  4UQZ A;  4ME2 A;  2Y3A A;  2YHE A;  4M3O A;  4AV7 A;  1H6K A;  3OPE A;  4RG9 A;  4J7I A;  3PRZ A;  3QWW A;  4EEC A;  1HX8 A;  1YA0 A;  5CMW A;  2DCP A;  2C0M A;  4MRU A;  2XEV A;  4U07 A;  4DK5 A;  5FQ7 A;  3ONL A;  4RZ0 A;  3R7R A;  1HG5 A;  3FTU A;  5LP0 A;  3FH8 A;  3QDN A;  2OND A;  4DLO A;  2YIN A;  5EG2 A;  3CLJ A;  4GZD A;  1E90 A;  3FDH A;  3B7R L;  4J8S A;  4QEN A;  1XQH A;  3CHM A;  3M55 A;  4K0R A;  4N2Q A;  3MGB A;  4JZY A;  5J08 A;  4XE0 A;  4O30 A;  1INZ A;  2BUG A;  2IQC A;  4H7X A;  3PNL B;  4WWP A;  2ZU6 B;  3D9P A;  3ENE A;  4C0M A;  3SD5 A;  4MI5 A;  2KM4 A;  2RD0 A;  4ABN A;  3DPD A;  1X5B A;  4GA0 A;  2WXN A;  4EZL A;  4YND A;  2XPI A;  4P29 A;  2WXQ A;  3L13 A;  4IRU A;  3TXN A;  3EIJ A;  3FU3 A;  3FUM A;  3EJN A;  3S2A A;  1OWP A;  3QJZ A;  3ZRH A;  3CBM A;  2FBN A;  3M59 A;  5G2N A;  1HF8 A;  1OWN A;  4JHK A;  2W5Y A;  2IF4 A;  5T0K A;  3LXU X;  3AS5 A;  2YHC A;  3FTW A;  1IQR A;  5D0Q D;  3APF A;  5BNW A;  3CQC B;  2R59 A;  3C98 A;  3MKQ A;  2XPZ A;  4CDR A;  2VQ2 A;  3O48 A;  3FU5 A;  3MKQ B;  2BQZ A;  5TEG A;  4I1O B;  5DIZ A;  3AS8 A;  4J83 A;  1HH8 A;  1QQE A;  1P5Q A;  4PH4 B;  3AU5 A;  3FTS A;  4XZ4 A;  1MT6 A;  3IBE A;  5ENN A;  1VDY A;  2IJG X;  4F53 A;  3RO2 A;  3CHO A;  3IHV A;  1IQU A;  3D9I A;  2QFC A;  5HI7 A;  1E96 B;  4ATG A;  4GML A;  4XKC A;  3HVE A;  4U0U A;  2PL2 A;  3PEV B;  4AY6 A;  2PQR A;  1FVH A;  4E6H A;  3HVE B;  4G2V A;  1HZ4 A;  3D9N A;  3Q15 A;  1MHQ A;  3VLE A;  4GZC A;  4DPR A;  4WUY A;  3PS6 A;  3CHP A;  3SW9 A;  1EDU A;  3UQ3 A;  4GB9 A;  4FP7 A;  3JQ1 A;  4AM9 A;  3FUD A;  4I2W A;  3JQ0 A;  3SHF A;  3G2U A;  2WM9 A;  3LY9 A;  4U0S A;  4YVQ C;  5ANL A;  4LDG A;  5T5G A;  3RQ4 A;  4FA6 A;  1OWM A;  4GU5 A;  2XHE A;  5JHA A;  4U63 A;  4L23 A;  3VLD A;  2CFU A;  5A7D B;  4B94 A;  5JJT A;  5J90 A;  1H2T C;  2F69 A;  3ZIM A;  4J8O A;  3UT4 A;  1ELW A;  4UWF A;  3U4T A;  3CST A;  5CCM A;  2WMN A;  4XKB A;  3ESL A;  4JA7 A;  4BWR A;  2I1J A;  2XCB A;  3VUZ A;  4U0Z A;  4N3B A;  4NUR A;  2WXF A;  3CK9 A;  1PAQ A;  5G05 C;  1MQS A;  1MVX A;  3VV0 A;  2VGX A;  3QB2 A;  4AJW A;  4NRH B;  1H3I A;  2X6K A;  2VSX E;  1PY1 A;  3ZGQ A;  3FP3 A;  2I6H A;  2VGX B;  3QC1 A;  2V4L A;  5JHN A;  3T8M A;  3EDT B;  5FQ8 A;  4PUC A;  4GYY A;  3WXX A;  3I4G A;  3NF1 A;  3MV2 B;  4CDN A;  5CPR B;  2W5Z A;  4BTA A;  4NVQ A;  3EHN A;  4TRQ A;  3LCA A;  4I6J A;  4E47 A;  5JIN A;  1HXI A;  4IUL A;  2G46 A;  4GYO A;  3GZ2 A;  3BG0 B;  3FUL A;  4GCN A;  3ULQ A;  4BT9 A;  4I1M A;  2J9Q A;  5DBK A;  3P2B A;  5BV0 A;  4Q94 A;  3NZU A;  3TG5 A;  3UMV A;  3QKY A;  4J8F A;  2KCV A;  4FHK A;  4I1A A;  3OXG A;  2V0P A;  4URK A;  3FUE A;  3RJV A;  3FPD A;  5JJ0 A;  3FY4 A;  1QNF A;  5M72 A;  3VTX A;  4LRZ A;  4Z4P A;  5KJN A;  2KCK A;  2CHX A;  3LY7 A;  4I17 A;  3ZFW A;  1DNP A;  2XGS A;  4O6F A;  3OTN A;  5JJ7 A;  3CVN A;  3AU4 A;  1H2U A;  3FU6 A;  4JHJ A;  3SWC A;  2AWI A;  3HHM A;  3CV0 A;  3JCK C;  4MLP A;  4ANU A;  1HS6 A;  2WQ6 A;  5BPP A;  4UWK A;  1WAO 1;  1Y6I A;  4OVV A;  1DVP A;  3SFZ A;  2YNQ A;  3L08 A;  4B89 A;  3F9Z A;  1HG2 A;  3D9M A;  5E76 A;  2KC7 A;  4BX8 A;  1KT0 A;  1LF8 A;  3TGO A;  4PS8 A;  4PS7 A;  4UI9 K;  3SGH A;  2OVF A;  3CBO A;  2NSZ A;  2CHZ A;  3FFL A;  4K03 A;  2IOS A;  1NZN A;  4HOU A;  4PS3 A;  2O8J A;  2MRI A;  2L9B A;  2V5F A;  3FHE A;  5BUZ A;  1UW4 B;  4HOT A;  2FI7 A;  3CHQ A;  5LOZ A;  1U3D A;  4ILH B;  3FTX A;  3RKV A;  3FH7 A;  3FUI A;  5LSX A;  4CT0 A;  4ANX A;  4JPS A;  5AIJ A;  4BUP A;  1S0P A;  1E8Z A;  1NA3 A;  2XCC A;  4A1G A;  1N54 A;  2R17 C;  4JLG A;  3RRM B;  2WXI A;  4ILI A;  5G55 A;  3RIB A;  3L54 A;  2A5U A;  4MS6 A;  1NP7 A;  2VSO E;  1KLX A;  2VGY A;  2X6J A;  1H0A A;  2HR2 A;  2X3M A;  3Q49 B;  3LKU A;  4G25 A;  4UQY A;  4Y6W A;  1N6A A;  5F59 A;  3MKR A;  2VSY A;  3CVX A;  5KJK A;  4TUU A;  2NC9 A;  1N3J A;  3PVL A;  4DJA A;  1OWO A;  2Y4U A;  2Y4T A;  4WNG A;  4H7Y A;  3PEU B;  4QEP A;  2LO6 A;  3CVP A;  2UY1 A;  4I6G A;  5FZS A;  3UX4 A;  3FTV A;  1XGW A;  4U04 A;  4AIF A;  3APD A;  1UG3 A;  2MOW A;  3LS8 A;  5T8I A;  2J08 A;  4HS2 A;  2UY1 B;  2WPV A;  2C2L A;  2WVI A;  3CR3 A;  4HOR A;  3TAX A;  2DBA A;  2J4D A;  4KYO B;  5C2Y A;  2WXK A;  2HYZ A;  4GYW A;  1TJC A;  4W9R A;  3E4B A;  3ESK A;  4N39 A;  2WXG A;  4A1S A;  1JPL A;  1BPO A;  5EX0 A;  3Q4A B;  4WNE A;  3GW4 A;  2RG8 A;  4APO A;  3DBS A;  3KAE A;  5T3R A;  4YNM A;  3KMA A;  3ZN3 A;  3KMT A;  2LSU A;  3U3W A;  3FWV A;  4FLB A;  4G24 A;  3FTY A;  4MKT A;  3EHM A;  3K9I A;  4I9E A;  2J4B A;  4EQF A;  2PM6 A;  3P1U A;  5C1D A;  3T5V A;  4UI9 J;  5T0M A;  1FVF A;  2VSN A;  1ELR A;  4FMU A;  2MHK A;  2NXP A;  3CSF A;  1UJK A;  5LCW C;  4JL0 A;  4KZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...