5KJNA

Smyd2 in complex with az506
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
total genus 147
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjnA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjnA01
1PEGA 4RG9A 5A6CA 2PL2A 4GPKA 3FWVA 3KS2A 3CK8A 4GZ3A 2FF4A 3WXXA 4E47A 2C0LA 2FEZA 1WM5A 3OPEA 3QWWA 2LNIA 4XI9A 3KMAA 3PE4A 4HOQA 3AS8A 2KATA 2G46A 4A1SA 4AIFA 1KLXA 5ARGA 3LY8A 4WNFA 2XGSA 2VQ2A 2YHCA 1XQHA 3CVQA 4Y6WA 3KMTA 3Q4AB 4YPAA 4GYOA 4GCNA 5HI7A 3MV2B 2KCLA 5JJ7A 3CK9A 5FZSA 4YNPA 4BUPA 2KCKA 1Y8MA 3RAYA 4ABNA 5KJLA 3CKBA 4YNMA 2E2EA 4N3BA 5F5EA 2LSUA 2QPWA 2NC9A 5G04J 3HNAA 3ZHEA 4XI0A 2XGMA 3PE3A 4UQXA 2V5FA 3SF4A 1ML9A 4J8OA 4WNGA 3GYZA 2IGQA 5JJ0A 3VUZA 3ESKA 3QKYA 4GA0A 4JL0A 3RO3A 5CCLA 1IYGA 5FTPA 3S7JA 3E4BA 4BT9A 2FI7A 2GW1A 3ASGA 5F59A 4RZ0A 2MHKA 5JJ6A 2YQ8A 3TG5A 4U07A 5G05C 2UWJG 4JDSA 4HOSA 3OXGA 4KXKB 4G25A 5FZQA 3K5KA 4GZ6A 3NF1A 3DB5A 2L6JA 4N39A 3Q15A 2BQZA 5T0MA 2I6HA 1HZ4A 4J83A 1ELRA 1E96B 1B89A 3ASHA 1PC2A 1N6AA 3RO2A 5KJMA 3EP0A 4QEPA 4XIFA 4H7YA 4YVQC 2PQRA 3CBMA 5TTFA 4G1TA 4GZ5A 3TG4A 4O6FA 2JLBA 2Q7FA 2VYIA 2RFIA 3M57A 5EG2A 3CVNA 4I2ZA 2O8JA 4CDRA 4IJ8A 5A7DB 3VV0A 5BNWA 3FP3A 4RG6A 5M72A 5JJTA 4YPUA 4H12A 4N3AA 2WPVA 3GZ1A 2FO7A 3R9AB 1HH8A 5CPRB 3RQ4A 3Q49B 2PQNA 2HO1A 2OOEA 4WNEA 4IN3B 4HORA 4I17A 5FJYA 4F3VA 3QOUA 1H3IA 4U0SA 5EX0A 5KJNA 3MEKA 3LY9A 3F9XA 4IJDA 1KT1A 1MUFA 1TJCA 4BTAA 3F9ZA 2XCBA 3ZPJA 3S7FA 1NA0A 3CVPA 3PDNA 3M58A 4N5CA 1P5QA 4CGWA 2F69A 4H7XA 1QQEA 3M54A 4GCOA 3ZFWA 3MKRA 2PZIA 3UQ3A 2R5SA 2HR2A 4AU7A 4J8DA 2ONDA 4U0ZA 5G04C 3MO0A 3RIBA 3U4TA 3RKVA 5LCWC 1N6CA 4LEUA 2J9QA 4U0UA 3ZHEB 4B94A 3LY7A 3DALA 4NJ5A 3SWCA 4J8FA 3ASDA 1OUVA 3K9IA 4BTBA 2VSYA 5G05J 3RU0A 3CBOA 3GW4A 2VSNA 1O9SA 3IEGA 4UQYA 2W5YA 4KYOB 3M59A 4JHRA 5BW8C 4HOUA 1MVHA 3MV3B 1QZ2A 3S8PA 4I9CA 2IFUA 4AY6A 5FT9A 1ZKKA 1HXIA 5BT1A 5TEGA 3Q5MA 3UUXA 1ELWA 2VGXB 4UQZA 3MO5A 3URZA 3EDTB 3OXLA 4G2VA 3QDNA 3RJWA 2IF4A 5AYWD 4G23A 5DIZA 3N71A 3M53A 5T5GA 3VTYA 5FZRA 1MVXA 4FMUA 4U04A 4YVOA 5T0KA 3UPVA 2LSVA 5DBKA 1NA3A 5EX3A 5JIYA 3JYSA 2R3AA 3IHXA 3LKUA 2Y4TA 1W3BA 4BWRA 2QFCA 1N3JA 1MT6A 4QEOA 3KAEA 2P58C 3QWVA 4J0UA 2W5ZA 5F6KC 4I1AA 4YNDA 4BT8A 3CKCA 4JLGA 3BO5A 5LSXA 4J7IA 5LCWJ 5EKQD 3HYMB 3CEQA 5JHNA 3S7BA 5ARFA 4I2WA 1ZBPA 4W9RA 4NVQA 3FFLA 3OS5A 3CVLA 4GA2A 3OOIA 2DBAA 2HYZA 3BEEA 1WAO1 2C0MA 3FPDA 3QWPA 4Y6CA 2XGOA 2VGYA 4GYWA 1XNFA 2KC7A 1ZU2A 4I9EA 4WNDA 2JV0A 2XEVA 5CHEE 4CGVA 1FCHA 3ZN3A 4MI5A 2XCCA 1YA0A 4GYYA 3Q47B 3OXFA 3SZ7A 4I51A 5AYFA 3F9WA 4HOTA 3LCAA 2FBNA 4O30A 2C2LA 3TAXA 5D0QD 4UI9K 5HQ8A 4Z4PA 3VTXA 5JINA 3TGOA 3ASFA 3O48A 4MI0A 3AS4A 3CK7A 4ME2A 3CV0A 3GZ2A 2AVPA 5D0OD 5TH7A 4GA1A 3F9YA 3S7DA 4G26A 2KCVA 4KBQA 1A17A 3MO2A 3LPZA 4LDGA 4WUYA 4C1QA 2BUGA 4JA7A 2UY1B 4J8EA 3M56A 4AM9A 3MA5A 2WQHA 4NQ0A 5LSZA 3M5AA 5F6LA 2XPIA 3RJVA 4AY5A 2VGXA 4G24A 2Y4UA 4UI9J 4QENA 4JA9A 3CBPA 4N2QA 3KMJA 3KD7A 3ULQA 3LYAA 3U3WA 5KJKA 2UY1A 1IHGA 4NRHB 1KT0A 3M55A 4YPEA 4N2SA 4EQFA 4APOA 3SW9A 4UI9C 3ZGQA 1NZNA 4J7FA 3AS5A 5CCMA 5C1DA 4N3CA
chains in the Genus database with same CATH superfamily
4K0RA 3CK8A 4E47A 3B95A 1INZA 4GTOA 2YINA 4AP2A 2I2OA 4B93B 2LNIA 3NZSA 2J4DA 3KMAA 1YMPA 4HOQA 2KATA 4A1SA 2IU1A 2IO2C 4AIFA 3LEWA 4HQDA 1OWMA 2XGSA 2VQ2A 3ASNE 3FEYA 3KSQA 3TXMA 3CVQA 3FEXA 3KMTA 1WDYA 3DWLG 5HI7A 4DI3A 3DSWA 1Y8MA 4DLOA 5J90A 3CKBA 4GMJA 2GGFA 2XZDG 4YNMA 2DYRE 5F5EA 2LSUA 1OWNA 5G04J 4WWNA 4XI0A 4TUMA 1OCOE 1NFIE 4UQXA 3GYZA 2IGQA 5JJ0A 3VUZA 5KCMA 3ESKA 3FTXA 4WWPA 1TNBA 4FLBA 5CEAA 3IXEA 3ASGA 3UKUG 5JJ6A 4HB5A 4U07A 5G05C 3OXGA 3SHFA 3SQVA 4J8SA 5FZQA 2WXKA 5JA4D 2GRMA 4N39A 3Q15A 4EZJA 1ELRA 3RSEG 3ASHA 3CSFA 2VJ8A 3EP0A 5ENTD 4GPMA 4XIFA 2V4HC 3KSLA 2PQRA 2R03A 3FU6A 5TTFA 4J6IA 1K8KG 2WXQA 4GZ5A 2JLBA 3AG2E 5ENQD 5EG2A 2O8JA 3ZW3A 2LO6A 4WWOA 5BNWA 1HO8A 4YPUA 4H12A 5FQ7A 3FUFA 3QAQA 3B13A 2CFZA 5JMND 1N0RA 3C3OA 3RQ4A 1OT8A 2HO1A 1N0QA 2JEKA 1RZ4A 4KZCA 1AP7A 4U0SA 5EX0A 3DXKG 3APCA 4TV3A 4BTAA 2F8XK 2ETCA 3B7UX 2DZOA 4CGWA 4JVSA 1QNFA 1N52A 2QC9A 2IOSA 3FUKA 4B8CB 4GCOA 3HVEA 3I4RB 2PZIA 4J8YA 2R5SA 4AU7A 2BTDA 5ANLA 2HE0A 2LUHA 4J8DA 3D9OA 4BERA 3CHRA 3VLEA 4BFRA 4LERA 3ZUVB 5AIJA 1PAQA 4GU5A 4PS7A 3G2VA 3DALA 3SWCA 3BG0B 4J8FA 1ZB1A 3ASDA 4U8YD 1OUVA 3TWQA 4ATZD 2VSYA 3W9FA 1XGWA 2CHZA 3JXIA 3RU0A 5G05J 5T8IA 1Y6IA 2WXNA 3GW4A 4ANVA 4C48B 4RSYA 5ENRD 1O9SA 5T3RA 2WMOA 1OXJA 5LP0A 1UG3A 4FJYA 4JHRA 4HOUA 4HI8A 4NIKA 4O1OA 4JEUA 3NQPA 1ZKKA 2OV8A 1FVHA 4IULA 5TEGA 3UT8A 3UX4A 1ELWA 4GZDA 4CDMA 3EIJA 1TN6A 2L6BA 4IRUA 3ZNGA 3HXCA 3RJWA 5CRUA 3FTZA 4FJZA 1TR4A 4PH4B 2J8SD 2LXLA 3QARA 4LRZA 3FUMA 4LG6A 5FZRA 1MVXA 4FHJA 1Z6TA 3LXUX 1TYQG 2P9NG 3IBEA 4MLPA 4ZHBA 3I4GA 5T0KA 3MKQB 1MT6A 5KWDA 3QWVA 1E8YA 4HVBA 4BSZB 5AQ7A 3CVWA 1MX4A 3J5PA 2XENA 4JLGA 3BO5A 1JPLA 4XX5A 5EKQD 2I1JA 3QC1A 2ZIRA 4GTMA 5JHNA 3SNXA 2P9UG 1ZBPA 4W9RA 4HS2A 2XPYA 3OS5A 3D9PA 1IQRA 2H6GA 1MYOA 2BKKB 1WAO1 3Q7FA 3B7SA 3QK0A 4FULA 4EZLA 4J7WA 3FPDA 3JQ1A 2I1KA 4CRWA 1FT2A 2KC7A 5HS0A 1ZU2A 4I9EA 3X2QE 3ZKJA 1FCHA 3D9HA 1KZOA 2XCCA 4JB8P 4GYYA 3SZ7A 4E6HA 3F9WA 2WB2A 3UT7A 4DK5A 4HOTA 2XS8A 3FH8A 3PEUB 5D0QD 4UI9K 4HI9A 5HQ8A 4Z4PA 5JINA 5EYLA 2P9SG 3AS4A 4RLYA 1DVPA 1JUQA 2AVPA 4L23A 5TH7A 3F9YA 3APDA 3MO2A 3LPZA 4LDGA 2RD0A 5ENNA 2BUGA 1LF8A 2WQHA 4NQ0A 3M5AA 3HXBA 3RJVA 4AY5A 1UN8A 2ZU6B 4BSXA 1Q2ZA 3ZYKA 1H2TC 3L9TA 2DVWA 3LYAA 4O60A 4A3TA 2V4LA 4NRHB 1L5JA 3M55A 1MZCA 2WXJA 3SW9A 2IQCA 2AXUA 4UI9C 1H0AA 3ZGQA 3FU3A 4J7FA 1Z5SC 3AS5A 5CERB 4HLEA 5A6CA 2IEJA 2R02A 2WXOA 3UIPC 4GPKA 1JCRA 3KS2A 4GZ3A 3WXXA 3QJZA 3ZXPA 4M3OA 1WM5A 3OPEA 2XEHA 2G46A 2ILRA 3ZEFA 1N54A 3ML9A 5AJDA 2EIJE 1XQHA 2DIWA 1SVXA 3E33A 4WAFA 4A3VA 4GMLA 4GYOA 3MV2B 4FHKA 2KCLA 2L9BA 3HIZA 5KNHD 1BI7B 2RKKA 2KM4A 4BX8A 1LD8A 3L13A 2QPWA 2NC9A 3HNAA 1QYMA 3AG4E 1BU9A 2V5FA 3SF4A 4J8OA 1UW4B 4GA0A 3U64A 3LJ3A 5E76A 3RO3A 5CCLA 4HRNA 2X3MA 2GW1A 5F59A 3HG0D 1N11A 2GRNB 3L22A 3ONKA 2UWJG 4HOSA 4KXKB 3FUHA 1YCSB 3J5QB 4EBAG 1N4SA 2I6HA 4DX2A 4J83A 1E96B 4XZ4A 1NP7A 5FWQA 1N6AA 4QEPA 4M7CA 2P9IG 1V55E 4EPZA 2R17C 4L7TA 4G1TA 2Y69E 3TWXA 2VYIA 2RFIA 4U96D 4I2ZA 3SGHA 3TL5A 4EBAA 5A7DB 4IJ8A 3VV0A 1IXVA 1JCSA 5ANRA 3FP3A 3U9WA 2GRRB 4N3AA 2WPVA 3EUVA 5B1BE 3HXDA 4RQIA 3OAWA 5BXUA 3R9AB 1HH8A 4AVXA 2PQNA 3EHNA 4GTVA 4IN3B 4ACKA 3E34A 4F3VA 5KJNA 4L2LA 3MEKA 3LY9A 3F9XA 4IJDA 3Q9NC 4GTQA 1MUFA 1TJCA 3LDZA 4AEZC 3AJIA 1NA0A 1WY6A 3CVPA 4C0EA 4U8HA 4N5CA 1P5QA 3PH0C 1D8DA 3M54A 4K5BA 2XRZA 4U8VD 2EQXA 4OYSA 4OVUA 2P9KG 3UQ3A 2Y3AA 2HR2A 3VLDA 2CHXA 5LFAA 1N94A 5G04C 1S70B 4BESA 4LEUA 5ENPD 3FUDA 2BKGA 3I3NA 4ZFHA 3RRUA 4O1PA 4NJ5A 3SBTB 4JHKA 5KNGA 3IHVA 4BTBA 2OEVA 1MQSA 2KZTB 4BX9A 5AENA 4AV7A 3IEGA 4MKTA 3M59A 4KYOB 3Q79A 5BW8C 1MVHA 4GTTA 3G2TA 5FQ8A 2IJGX 1X5BA 4JPSA 5G55A 4AY6A 1HXIA 3G2WA 4KZ0A 4LNGA 5CRVA 1OWOA 5CMYA 4ATGA 3FTYA 3RK6A 2M63A 5AQ9A 2VGXB 3FDHA 4UQZA 1DNPA 4Q69A 4Q94A 3TWVA 4KT6B 4JXTA 1H6PA 3OXLA 2IONA 3CHSA 1LTXA 1S64A 5KBAA 3CVVA 4G23A 2X6HA 3M53A 3SFZA 4UWFA 1TNOA 5T5GA 3CHQA 3VTYA 1N95A 4FMUA 1NL4A 1UJJA 1VDYA 1H2VC 2LSVA 5DBKA 1NA3A 5EX3A 3TWUA 2R3AA 3ULYA 3IHXA 2VGEA 5JIYA 2QYJA 3C3QA 3MJWA 5LX8A 2P58C 4J0UA 5F6KC 4E85A 4JHJA 3FTUA 4KMOA 1A5EA 3R7RA 1MX6A 3CKCA 4L1BA 3DSXA 5LCWJ 3HYMB 3FHEA 4DRXE 3FY4A 3Q7AA 4KVMA 5ARFA 4EHMA 4NVQA 3FFLA 3OOIA 2DBAA 4R7LA 5AJLA 1HF8A 2C0MA 4ILIA 2YNQA 3DRAA 2XGOA 2GRPB 3NBNB 1EF1C 1O1SA 3KEAA 2JV0A 5CHEE 2AJAA 4ILHB 4JEHA 2H6HA 3Q47B 1S0PA 2R2LA 2FO1E 3OXFA 2RFAA 4F6RD 1RW2A 4ACLA 4I51A 4K5CA 4CDNA 4PS8A 1H2UA 2VSOE 5B3SE 2FBNA 4O30A 3D3MA 3UKRG 2WVIA 3ABKE 2F37A 3EJNA 4XKCA 2CFUA 5J08A 4LNBA 4TXPA 5BV0A 4CYMD 4FP7A 3G2UA 1MX2A 2KCVA 2IOLA 3E32A 3NOGD 3ABLE 4JA7A 4HLLA 2P9LG 4J8EA 3CLJA 2LAIA 3G2SA 1H6KA 3M56A 5AARA 3MA5A 3U66A 2VGXA 3QB2A 3EHQA 1TEZA 2Y4UA 4UI9J 3SY2A 4QENA 3CBPA 4N2QA 1E90A 3ULQA 3ONLA 3U3WA 5KJKA 1IHGA 2J07A 5AN8A 2JABA 2EINE 4DX5D 1KZPA 3CQCB 3FUEA 4N2SA 2B0OE 3FTVA 1HE8A 4NACA 4TXQA 2FULA 1E7VA 4NURA 1ELKA 5CCMA 5C1DA 4N3CA 4CZ2D 4RG9A 3APFA 2IO3C 4AJWA 2C0LA 1KPSB 3QWWA 1QBQA 4XI9A 2WQ7A 1G3NB 3GZSA 4U63A 1KLXA 4UUCA 1IQUA 4MBGA 3UXGA 2YHCA 4D10C 3UTMA 3Q4AB 2AXZA 2ETBA 3PZ3A 2OVFA 4YPAA 4GCNA 4PUCA 1LD7A 3B7TA 1U3CA 3PZ4A 4U7EB 3V31A 2VSXE 5ITZF 3RAYA 4ABNA 5KJLA 3C3RA 4A63B 3L16A 2PM7A 3AG1E 3ZHEA 2X6JA 3PE3A 4N5QA 3C72A 4WNGA 1K3ZD 3FU0A 5FTPA 3S7JA 3E4BA 2FI7A 4RZ0A 4I43A 3RRMB 2MHKA 4JD2G 4B8AA 3TG5A 4JDSA 1Z3XA 3Q73A 3K5KA 4GZ6A 3NF1A 3UIOC 4UWLA 1TN7A 2L6JA 2B6CA 2I9CA 1IHBA 3JUEA 3DBSA 2R59A 5T0MA 1HZ4A 5AQAA 5CBNA 1N9AA 5HKPA 3MZLB 2WXGA 4H7YA 1N4PA 3DSTA 3RRNB 4XKBA 2WXHA 3ZYLA 1OWPA 2NYJA 2CG2A 2Q7FA 3DEOA 4CDRA 3I5PA 2XHEA 5JJTA 2BEDA 1TNZA 5FIOA 5CPRB 2J49A 3TXNA 2QY7A 3CQGB 4BY6A 4WNEA 1HU3A 3AU5A 1EYHA 4I17A 5FJYA 2V0PA 3QOUA 3ZVVA 4PS3A 1H3IA 3MCXA 2MRIA 2Y0BG 4LSZE 1PY1A 1V54E 3T8KA 1HG2A 1KT1A 2DWZA 2PM6A 4GTSA 2WQ6A 4ILGA 3ZPJA 3S7FA 5BPPA 1IKND 2F69A 3UM3A 1QQEA 3O4ZA 1BD8A 3ZFWA 3MKRA 4LCTA 5IY5E 3FU5A 2ONDA 3HVEB 3RIBA 3JUIA 5LCWC 3PZ2A 3DSSA 2L0TB 3ZHEB 3LY7A 5CBOA 2IY0C 3ZYMA 4A55A 1HS6A 5HRYA 5BV1A 3K9IA 5ENOD 5AQBA 1N4QA 4DI4A 2DYSE 3CBOA 4ANUA 2J09A 3L6AA 4OAVB 3L17A 4FU3A 4UQYA 3B7BA 1U3DA 3UINC 3MV3B 2P9PG 3S8PA 3FUIA 4F7AA 5FT9A 5E75A 3EU5A 5BT1A 3SBSA 3V79K 4QQIA 4X8QA 4UWGA 3LVQE 3UUXA 2WXRA 2EIKE 3NOCD 3URZA 3EDTB 4G2VA 4BETA 2IF4A 1SA5A 2OCCE 3N71A 1UOHA 2ETAA 2EILE 4GMRA 3PS6A 4L2YA 4YVOA 3AG3E 3LKUA 1NI1A 1W3BA 4BWRA 2QFCA 3FH5A 4QEOA 3KAEA 4A1GA 1TJFA 4PDXA 4LUNU 5LSXA 4J7IA 3Q78A 3SI5A 3CEQA 3C98A 3MYVA 5FINA 3S7BA 4FC8A 4TRQA 1YYHA 2OEWA 4FLHA 3EIQC 1E7UA 2HYZA 3BEEA 3UT4A 3FTWA 3S2AA 3HHMA 3BU8A 3UM1A 2MOWA 3D9MA 1XNFA 3PEVB 2XEVA 3WG7E 3PNLB 4CGVA 1SW6A 1H19A 2XS1A 4MI5A 3ZXSA 2J08A 1D9SA 3FUJA 5AYFA 3ESLA 4I6GA 3UM2A 3PZDA 2A5EA 3SFYA 2J4BA 3TAXA 4I1OB 3VTXA 3DEPA 4APFA 3O48A 3ZYQA 4MI0A 3D9IA 3CVUA 2X6FA 3JQ0A 1BLXB 3SO8A 4ME2A 3CVXA 3AAAC 5EILA 5D0OD 1X81A 2WXMA 4GA1A 2QZAA 3AU4A 3S7DA 1E8ZA 4G26A 4JZYA 2ZGDA 2AW6A 4GTRA 1A17A 2XEEA 2WM9A 3CHPA 1FVFA 4C1QA 4C9BB 4AM9A 1JWFA 4TUUA 1MHQA 5LSZA 5F6LA 4HRMB 2XPIA 1TNUA 1TNYA 4K03A 1MJ0A 2KXPC 3Q75A 3T5XA 3FULA 1K1BA 4JA9A 3HRAA 3DSUA 3KD7A 3F6QA 3LJNA 3CIAA 4AOFA 4DX6D 3DSVA 2UY1A 2GRLA 2CG3A 4YPEA 4MRUA 4YDOA 1EDUA 4EQFA 3DXMG 5BXOA 2WMNA 4F1PA 1NZNA 5H7PA 2KZTA 3ZU7B 2RFMA 1PEGA 2PL2A 3FWVA 2AXVA 1O5MA 2FF4A 1O1RA 2FEZA 3EHMA 3V2XA 1SZAA 2R05A 3PE4A 3AS8A 2WXPA 2HM8A 4QFVA 3SD5A 5ARGA 2XPZA 3LY8A 4WNFA 1JCQA 4Y6WA 4OVVA 1OCZE 2YHEA 4GTPA 2H6FA 3HDXA 3PZ1A 4G8KA 5JJ7A 3CK9A 5FZSA 3UI2A 4CT4A 5FQ4A 4YNPA 4BUPA 2KCKA 3IV0A 4OAUC 4HRLA 1E8XA 4TXRA 5EIDA 3ULEG 1HX8A 2E2EA 2X6KA 4N3BA 1HG5A 2OVBA 5CMWA 4V3IA 3TJPA 2PNNA 2XGMA 2XRYA 1SQMA 2NXPA 3R9MA 1ML9A 3BQOA 1EPUA 3QKYA 4C0MA 4JL0A 1UN9A 1IYGA 4BT9A 2ZISA 3L54A 5ENSD 2YQ8A 2L0IA 3L82A 2AWIA 2XQ0A 4G11A 2F8YA 4G25A 2WXLA 5LOZA 2GRQB 3V2OA 1DCEA 3DB5A 5AAOA 3B7RL 2BQZA 1Z3YA 4GZCA 3TWTA 1N4RA 5D66A 1B89A 1PC2A 4AXHA 3RO2A 5KJMA 3LVRE 4YVQC 3CBMA 2A5UA 3D9NA 1GW6A 3TG4A 4O6FA 3M57A 1U2VG 3HXFA 4DPRA 3CVNA 3OTNA 4BEPA 3BUAA 4RG6A 5M72A 4F53A 3QNKA 3GZ1A 1JWGA 5JHBA 2FO7A 1OCCE 3D9KA 3EHRA 3Q49B 3C5RA 2GROB 3T5VA 2OOEA 4XEIG 1BPOA 5CEDB 5JHAA 4HORA 4EZKA 3TWSA 3PUKA 4XE0A 3MKQA 2VTBA 4JC8A 2V8SE 3F9ZA 2XZTG 4YDWA 2XCBA 4HBDA 3PDNA 3M58A 5EN5D 4HNAD 2X38A 4L9PA 2V5QC 4H7XA 3CR3A 1DC2A 3UMVA 2X6IA 3D9JA 1O1TA 4GAAA 4UWHA 3E37A 2EIME 3DPDA 4ANWA 4ANXA 3L08A 4U0ZA 3MO0A 4RVBA 3U4TA 3RKVA 4EECA 3LS8A 1N6CA 2J9QA 3CHMA 4U0UA 5A23A 4HFGA 4B94A 3D9LA 4FADA 4DUIA 1FT1A 4DX1A 3FUNA 1SA4A 3SFXA 4JW1A 1SZ9A 3TWWA 4GB9A 1D8EA 3EU9A 1DCQA 3DPYA 2VSNA 1FPPA 4UWKA 2W5YA 4B89A 2ZGGA 1QZ2A 1BI8B 4I9CA 2DZNA 2IFUA 2CHWA 3ENEA 2KBXA 3VLFA 2VTBB 3Q5MA 3FH7A 3CHOA 5T4YA 3MO5A 4DLQA 3PNTB 4I6JA 3ABME 3QDNA 3BG1B 1H6OA 2RG8A 5AYWD 3RAUA 5D2MC 3ZIMA 5DIZA 4YDYA 1HFAA 5EYPF 4CT0A 4U04A 3MGBA 1S63A 3NZUA 4I6EA 3UPVA 4CCAA 4LNUD 3JYSA 3PREA 3E30A 2Y4TA 1N3JA 3TWRA 3IKOB 3P1UA 2W5ZA 4I1AA 4YNDA 4BT8A 4CEMA 5EDSA 4DX7D 2QYUA 2LXMA 3T9KA 3CSTA 1WG0A 2MYOA 4I2WA 2A4ZA 2DCPA 4Z68A 3CVLA 4F1SA 4GA2A 2WXIA 4U95D 3QWPA 2WXFA 4Y6CA 4YDEA 2VGYA 4GYWA 1OWLA 4WNDA 1E8WA 3NAWA 5C2YA 3T8MA 3JCKC 1OY3D 3MX3A 1K1AA 3ZN3A 1YA0A 3V30A 3PUJA 3ML8A 3PRZA 3LCAA 3PVLA 2C2LA 2F0YA 3P2BA 4K5AB 4HXIA 2LAHA 3TGOA 3ASFA 3ISMC 5G2NA 3UM0A 3CK7A 4URKA 5B1AE 3CV0A 3GZ2A 2BF0X 3HXEA 1AWCB 4KBQA 4KVOA 5FQ6A 3R7QA 4WUYA 2UY1B 2ZXWE 4FA6A 2NSZA 4I1MA 4G8LA 5CECB 5BUZA 3JXJA 3Q9UC 4G24A 4DJAA 1OCRE 2E0IA 3CVYA 2P2CP 2Y1LE 3KEZA 4P29A 4Q96A 1TN8A 3ASOE 3KMJA 5EIBE 4IYPA 3ZRHA 4B0ZA 4MS6A 3W9GA 1KT0A 4APOA 2H6IA 3IHYA 3NB2A 3FTSA 1UJKA 3CGHA
chains in the Genus database with same CATH topology
1PEGA 4RG9A 5A6CA 2PL2A 2WXOA 4GPKA 3FWVA 4K0RA 3APFA 4AJWA 3KS2A 2AXVA 3CK8A 4GZ3A 2FF4A 3WXXA 4E47A 2C0LA 3QJZA 1INZA 2FEZA 2YINA 4M3OA 1WM5A 4AP2A 2I2OA 3EHMA 2LNIA 3QWWA 3OPEA 3NZSA 1SZAA 2J4DA 4XI9A 3KMAA 3PE4A 4HOQA 3AS8A 2KATA 2WXPA 2HM8A 2ILRA 2IU1A 1N54A 3ZEFA 4A1SA 4AIFA 3ML9A 5AJDA 3GZSA 2WQ7A 3LEWA 4U63A 1KLXA 4QFVA 3SD5A 1IQUA 2XPZA 1OWMA 3LY8A 5ARGA 4WNFA 2XGSA 2VQ2A 2YHCA 3FEYA 1XQHA 2DIWA 3TXMA 3CVQA 3FEXA 4Y6WA 4WAFA 4A3VA 4OVVA 4D10C 3KMTA 2YHEA 3Q4AB 4GMLA 2AXZA 3HDXA 2OVFA 4YPAA 4GYOA 4GCNA 5HI7A 3MV2B 4FHKA 2KCLA 4PUCA 2L9BA 3HIZA 4DI3A 5JJ7A 3B7TA 1U3CA 3CK9A 5FZSA 4CT4A 5FQ4A 4YNPA 4BUPA 2KCKA 3IV0A 2VSXE 1Y8MA 4DLOA 1E8XA 5J90A 3RAYA 4ABNA 2KM4A 4BX8A 5KJLA 3CKBA 1HX8A 4GMJA 2GGFA 4YNMA 3L16A 2E2EA 2X6KA 4N3BA 1HG5A 2PM7A 2OVBA 5F5EA 2LSUA 3L13A 1OWNA 5CMWA 2QPWA 2NC9A 4V3IA 5G04J 3HNAA 3TJPA 3ZHEA 4WWNA 4XI0A 2X6JA 2XGMA 2XRYA 1SQMA 2NXPA 3PE3A 4UQXA 2V5FA 3SF4A 1ML9A 4J8OA 1UW4B 4WNGA 3GYZA 2IGQA 3FU0A 5JJ0A 1EPUA 3VUZA 5KCMA 3ESKA 3QKYA 3FTXA 4C0MA 4GA0A 1UN9A 3LJ3A 4JL0A 4WWPA 4FLBA 5E76A 3U64A 3RO3A 5CCLA 1IYGA 5FTPA 3S7JA 2X3MA 3E4BA 4BT9A 2FI7A 2GW1A 3ASGA 3L54A 5F59A 4RZ0A 4I43A 3RRMB 2MHKA 5JJ6A 2YQ8A 4B8AA 3TG5A 3L22A 4U07A 2L0IA 5G05C 3ONKA 2AWIA 2UWJG 2XQ0A 4JDSA 1Z3XA 3OXGA 4KXKB 4HOSA 4G11A 3SHFA 4J8SA 2G46A 4G25A 2WXLA 5LOZA 3FUHA 5FZQA 3K5KA 2WXKA 4GZ6A 3NF1A 2GRMA 4UWLA 3DB5A 2L6JA 4N39A 2I9CA 3B7RL 4EBAG 3DBSA 2R59A 3Q15A 2BQZA 5T0MA 1Z3YA 2I6HA 1HZ4A 4GZCA 4J83A 4EZJA 1ELRA 1E96B 3ASHA 1B89A 1PC2A 4XZ4A 1NP7A 3CSFA 4AXHA 5FWQA 1N6AA 2VJ8A 3RO2A 5KJMA 3EP0A 4QEPA 3MZLB 4XIFA 2WXGA 3LVRE 4H7YA 4YVQC 2PQRA 3FU6A 3CBMA 2A5UA 5TTFA 3D9NA 4EPZA 4J6IA 3RRNB 1GW6A 4XKBA 2WXHA 3ZYLA 1OWPA 2R17C 2WXQA 4L7TA 4G1TA 4GZ5A 3TG4A 2CG2A 4O6FA 2JLBA 2Q7FA 2VYIA 2RFIA 3M57A 5EG2A 4DPRA 3CVNA 3OTNA 4I2ZA 3SGHA 2O8JA 3ZW3A 4CDRA 3I5PA 2LO6A 4WWOA 3TL5A 5A7DB 4EBAA 5BNWA 4IJ8A 3VV0A 5ANRA 3FP3A 4RG6A 5M72A 4F53A 1HO8A 3QNKA 2XHEA 3U9WA 5JJTA 4YPUA 4H12A 4N3AA 2WPVA 3GZ1A 5FQ7A 3FUFA 1JWGA 3OAWA 5JHBA 3QAQA 2FO7A 3B13A 3R9AB 2CFZA 1HH8A 5CPRB 3D9KA 2J49A 3RQ4A 3Q49B 4AVXA 2PQNA 3EHNA 3TXNA 2QY7A 3CQGB 4BY6A 2HO1A 3T5VA 2OOEA 1BPOA 4WNEA 1HU3A 4IN3B 4ACKA 5JHAA 3AU5A 1EYHA 2JEKA 4HORA 4I17A 4KZCA 5FJYA 4F3VA 2V0PA 3QOUA 3ZVVA 4PS3A 1H3IA 4EZKA 4U0SA 5EX0A 3MCXA 3PUKA 2MRIA 5KJNA 4XE0A 4L2LA 3MEKA 3LY9A 1PY1A 3F9XA 4IJDA 1HG2A 1KT1A 3APCA 3MKQA 1MUFA 2VTBA 4TV3A 1TJCA 4JC8A 4BTAA 2V8SE 3LDZA 2PM6A 4AEZC 3F9ZA 2XCBA 2WQ6A 4ILGA 3ZPJA 3S7FA 5BPPA 3B7UX 1NA0A 1WY6A 3CVPA 3PDNA 4C0EA 4U8HA 3M58A 4N5CA 1P5QA 3PH0C 4CGWA 4JVSA 2F69A 2X38A 1QNFA 1N52A 4H7XA 3CR3A 2IOSA 1QQEA 3FUKA 4B8CB 3M54A 4GCOA 3UMVA 2X6IA 3D9JA 3HVEA 2XRZA 3O4ZA 3I4RB 3ZFWA 4GAAA 2EQXA 4OYSA 4OVUA 3MKRA 2PZIA 2R5SA 3UQ3A 2Y3AA 4UWHA 2HR2A 4AU7A 2BTDA 4LCTA 3VLDA 3DPDA 5ANLA 4ANWA 2CHXA 4ANXA 5LFAA 3FU5A 4J8DA 3L08A 2ONDA 4U0ZA 5G04C 3MO0A 3D9OA 3HVEB 4RVBA 3RIBA 3JUIA 3U4TA 3RKVA 4EECA 3LS8A 5LCWC 1N6CA 3CHRA 3VLEA 4LEUA 4BFRA 2J9QA 3CHMA 3FUDA 4LERA 4U0UA 5A23A 5AIJA 1PAQA 2L0TB 3I3NA 4GU5A 4PS7A 3G2VA 4HFGA 3RRUA 3ZHEB 3D9LA 3LY7A 4B94A 4FADA 3DALA 4NJ5A 3SWCA 3SBTB 3FUNA 3BG0B 4J8FA 3ZYMA 5KJKA 3ASDA 1OUVA 4A55A 4JW1A 4JHKA 1HS6A 5BV1A 3K9IA 1SZ9A 3IHVA 4BTBA 2VSYA 1XGWA 2CHZA 1MQSA 4GB9A 5G05J 3RU0A 4DI4A 5T8IA 3CBOA 2KZTB 1Y6IA 2WXNA 3GW4A 2J09A 4ANUA 3L6AA 4ANVA 4BX9A 5AENA 3L17A 2VSNA 4AV7A 4RSYA 1O9SA 4UWKA 2WMOA 3IEGA 4MKTA 5T3RA 4FU3A 5LP0A 4UQYA 2W5YA 4KYOB 3M59A 1UG3A 4FJYA 1U3DA 4JHRA 5BW8C 4HOUA 4B89A 1MVHA 3MV3B 1QZ2A 3S8PA 3G2TA 3FUIA 5FQ8A 4I9CA 2IJGX 1X5BA 4JPSA 4F7AA 2IFUA 4JEUA 5G55A 3NQPA 5FT9A 4AY6A 5E75A 1ZKKA 2CHWA 3ENEA 1HXIA 3G2WA 2OV8A 1FVHA 4KZ0A 5BT1A 3SBSA 4IULA 1OWOA 3VLFA 2VTBB 5TEGA 3Q5MA 5CMYA 4UWGA 4ATGA 3UT8A 3UX4A 3LVQE 3FTYA 3UUXA 3FH7A 1ELWA 3CHOA 3RK6A 2WXRA 4GZDA 5T4YA 2M63A 2VGXB 3FDHA 4UQZA 4CDMA 3EIJA 3MO5A 4IRUA 3URZA 1DNPA 4Q94A 4Q69A 4KT6B 4JXTA 3EDTB 4DLQA 3PNTB 3OXLA 4I6JA 4G2VA 3QDNA 2IONA 3CHSA 3BG1B 3RJWA 2IF4A 2RG8A 5AYWD 3CVVA 4G23A 3FTZA 3ZIMA 4FJZA 5DIZA 4PH4B 3N71A 2X6HA 3M53A 3QARA 4UWFA 3SFZA 5T5GA 3PS6A 3CHQA 4LRZA 4L2YA 3VTYA 3FUMA 1HFAA 5FZRA 1MVXA 4CT0A 4FHJA 1Z6TA 3LXUX 4FMUA 4U04A 1UJJA 1VDYA 3MGBA 3IBEA 3NZUA 4I6EA 4MLPA 4YVOA 1H2VC 3I4GA 5T0KA 4CCAA 3UPVA 2LSVA 5DBKA 1NA3A 5EX3A 5JIYA 3JYSA 3PREA 2R3AA 3IHXA 3LKUA 2Y4TA 3MJWA 5LX8A 1W3BA 3MKQB 2QFCA 4BWRA 3FH5A 1MT6A 1N3JA 4QEOA 3KAEA 2P58C 3IKOB 3P1UA 3QWVA 1E8YA 4HVBA 4J0UA 2W5ZA 5F6KC 4I1AA 4JHJA 4E85A 3FTUA 3CVWA 4A1GA 4KMOA 4YNDA 4BT8A 4CEMA 3R7RA 5EDSA 1TJFA 4PDXA 3CKCA 4LUNU 4L1BA 3BO5A 4JLGA 5LSXA 4J7IA 1JPLA 5LCWJ 4XX5A 5EKQD 3SI5A 3HYMB 3CEQA 3FHEA 2I1JA 3C98A 3MYVA 3QC1A 5JHNA 3FY4A 4KVMA 3CSTA 3S7BA 4FC8A 4TRQA 3SNXA 5ARFA 4I2WA 2A4ZA 1ZBPA 4FLHA 4W9RA 4HS2A 4NVQA 2DCPA 3EIQC 2XPYA 3FFLA 3OS5A 3D9PA 3CVLA 4F1SA 4GA2A 3OOIA 1E7UA 2DBAA 2HYZA 4R7LA 1IQRA 3BEEA 2WXIA 3UT4A 1WAO1 5AJLA 1HF8A 3B7SA 3FTWA 3QK0A 2C0MA 4ILIA 3S2AA 4FULA 4EZLA 2YNQA 3FPDA 3HHMA 3QWPA 2WXFA 4Y6CA 2MOWA 2VGYA 2XGOA 3D9MA 3JQ1A 4GYWA 1EF1C 1XNFA 2I1KA 4CRWA 1OWLA 2KC7A 1ZU2A 4I9EA 3PEVB 4WNDA 1E8WA 5C2YA 2JV0A 3T8MA 3JCKC 2XEVA 5CHEE 3PNLB 4ILHB 4CGVA 4JEHA 1FCHA 1H19A 3MX3A 3ZN3A 2XCCA 4MI5A 1YA0A 3ZXSA 4GYYA 3Q47B 2J08A 1S0PA 3PUJA 3ML8A 3OXFA 3SZ7A 3FUJA 3PRZA 4ACLA 4E6HA 4I51A 4CDNA 5AYFA 3ESLA 3F9WA 2WB2A 3UT7A 4PS8A 4DK5A 4I6GA 1H2UA 4HOTA 2VSOE 3PZDA 3LCAA 2FBNA 3FH8A 3PEUB 2J4BA 2C2LA 3D3MA 3PVLA 3TAXA 4O30A 5D0QD 4UI9K 3P2BA 2WVIA 4I1OB 5HQ8A 4Z4PA 3VTXA 4HXIA 5JINA 2LAHA 4APFA 3TGOA 3ASFA 3O48A 3ZYQA 3EJNA 3D9IA 4XKCA 2CFUA 3AS4A 5G2NA 4MI0A 3CVUA 2X6FA 3JQ0A 3CK7A 4URKA 1DVPA 5J08A 1JUQA 4ME2A 3CV0A 3GZ2A 5BV0A 2BF0X 3CVXA 2AVPA 5D0OD 4L23A 2WXMA 5TH7A 4GA1A 4FP7A 3AU4A 3F9YA 3G2UA 3S7DA 1E8ZA 4G26A 4JZYA 2KCVA 2IOLA 4KBQA 2AW6A 1A17A 3APDA 3MO2A 3LPZA 2WM9A 4LDGA 2RD0A 3CHPA 4KVOA 5ENNA 1FVFA 5FQ6A 4WUYA 3R7QA 4C1QA 2BUGA 4JA7A 4C9BB 2UY1B 4J8EA 3CLJA 2LAIA 4FA6A 2NSZA 1H6KA 3G2SA 4I1MA 3M56A 4AM9A 3MA5A 1LF8A 1JWFA 2WQHA 4TUUA 4NQ0A 1MHQA 5LSZA 3M5AA 3U66A 5F6LA 2XPIA 3RJVA 4AY5A 2VGXA 1UN8A 2ZU6B 3QB2A 4K03A 5BUZA 4G24A 1TEZA 2Y4UA 3T5XA 3FULA 4UI9J 2E0IA 4DJAA 3CVYA 4BSXA 4QENA 4JA9A 3KEZA 3ZYKA 3CBPA 4P29A 4Q96A 4N2QA 1H2TC 1E90A 3KMJA 3KD7A 3ULQA 3ONLA 3LYAA 3U3WA 3CIAA 4IYPA 4A3TA 4AOFA 2UY1A 3ZRHA 1IHGA 2J07A 2V4LA 4MS6A 4NRHB 4B0ZA 1L5JA 2GRLA 2CG3A 3CQCB 1KT0A 3M55A 4YPEA 3FUEA 4MRUA 1EDUA 4EQFA 4N2SA 4APOA 2WXJA 3SW9A 3FTVA 2WMNA 2IQCA 1HE8A 2AXUA 1H0AA 3IHYA 2FULA 1E7VA 1NZNA 4NACA 4UI9C 3ZGQA 3FU3A 2KZTA 4NURA 4J7FA 1ELKA 3AS5A 3FTSA 5CCMA 1UJKA 3CGHA 5C1DA 4N3CA 4HLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PEG A;  4RG9 A;  5A6C A;  2PL2 A;  4GPK A;  3FWV A;  3KS2 A;  3CK8 A;  4GZ3 A;  2FF4 A;  3WXX A;  4E47 A;  2C0L A;  2FEZ A;  1WM5 A;  3OPE A;  3QWW A;  2LNI A;  4XI9 A;  3KMA A;  3PE4 A;  4HOQ A;  3AS8 A;  2KAT A;  2G46 A;  4A1S A;  4AIF A;  1KLX A;  5ARG A;  3LY8 A;  4WNF A;  2XGS A;  2VQ2 A;  2YHC A;  1XQH A;  3CVQ A;  4Y6W A;  3KMT A;  3Q4A B;  4YPA A;  4GYO A;  4GCN A;  5HI7 A;  3MV2 B;  2KCL A;  5JJ7 A;  3CK9 A;  5FZS A;  4YNP A;  4BUP A;  2KCK A;  1Y8M A;  3RAY A;  4ABN A;  5KJL A;  3CKB A;  4YNM A;  2E2E A;  4N3B A;  5F5E A;  2LSU A;  2QPW A;  2NC9 A;  5G04 J;  3HNA A;  3ZHE A;  4XI0 A;  2XGM A;  3PE3 A;  4UQX A;  2V5F A;  3SF4 A;  1ML9 A;  4J8O A;  4WNG A;  3GYZ A;  2IGQ A;  5JJ0 A;  3VUZ A;  3ESK A;  3QKY A;  4GA0 A;  4JL0 A;  3RO3 A;  5CCL A;  1IYG A;  5FTP A;  3S7J A;  3E4B A;  4BT9 A;  2FI7 A;  2GW1 A;  3ASG A;  5F59 A;  4RZ0 A;  2MHK A;  5JJ6 A;  2YQ8 A;  3TG5 A;  4U07 A;  5G05 C;  2UWJ G;  4JDS A;  4HOS A;  3OXG A;  4KXK B;  4G25 A;  5FZQ A;  3K5K A;  4GZ6 A;  3NF1 A;  3DB5 A;  2L6J A;  4N39 A;  3Q15 A;  2BQZ A;  5T0M A;  2I6H A;  1HZ4 A;  4J83 A;  1ELR A;  1E96 B;  1B89 A;  3ASH A;  1PC2 A;  1N6A A;  3RO2 A;  5KJM A;  3EP0 A;  4QEP A;  4XIF A;  4H7Y A;  4YVQ C;  2PQR A;  3CBM A;  5TTF A;  4G1T A;  4GZ5 A;  3TG4 A;  4O6F A;  2JLB A;  2Q7F A;  2VYI A;  2RFI A;  3M57 A;  5EG2 A;  3CVN A;  4I2Z A;  2O8J A;  4CDR A;  4IJ8 A;  5A7D B;  3VV0 A;  5BNW A;  3FP3 A;  4RG6 A;  5M72 A;  5JJT A;  4YPU A;  4H12 A;  4N3A A;  2WPV A;  3GZ1 A;  2FO7 A;  3R9A B;  1HH8 A;  5CPR B;  3RQ4 A;  3Q49 B;  2PQN A;  2HO1 A;  2OOE A;  4WNE A;  4IN3 B;  4HOR A;  4I17 A;  5FJY A;  4F3V A;  3QOU A;  1H3I A;  4U0S A;  5EX0 A;  5KJN A;  3MEK A;  3LY9 A;  3F9X A;  4IJD A;  1KT1 A;  1MUF A;  1TJC A;  4BTA A;  3F9Z A;  2XCB A;  3ZPJ A;  3S7F A;  1NA0 A;  3CVP A;  3PDN A;  3M58 A;  4N5C A;  1P5Q A;  4CGW A;  2F69 A;  4H7X A;  1QQE A;  3M54 A;  4GCO A;  3ZFW A;  3MKR A;  2PZI A;  3UQ3 A;  2R5S A;  2HR2 A;  4AU7 A;  4J8D A;  2OND A;  4U0Z A;  5G04 C;  3MO0 A;  3RIB A;  3U4T A;  3RKV A;  5LCW C;  1N6C A;  4LEU A;  2J9Q A;  4U0U A;  3ZHE B;  4B94 A;  3LY7 A;  3DAL A;  4NJ5 A;  3SWC A;  4J8F A;  3ASD A;  1OUV A;  3K9I A;  4BTB A;  2VSY A;  5G05 J;  3RU0 A;  3CBO A;  3GW4 A;  2VSN A;  1O9S A;  3IEG A;  4UQY A;  2W5Y A;  4KYO B;  3M59 A;  4JHR A;  5BW8 C;  4HOU A;  1MVH A;  3MV3 B;  1QZ2 A;  3S8P A;  4I9C A;  2IFU A;  4AY6 A;  5FT9 A;  1ZKK A;  1HXI A;  5BT1 A;  5TEG A;  3Q5M A;  3UUX A;  1ELW A;  2VGX B;  4UQZ A;  3MO5 A;  3URZ A;  3EDT B;  3OXL A;  4G2V A;  3QDN A;  3RJW A;  2IF4 A;  5AYW D;  4G23 A;  5DIZ A;  3N71 A;  3M53 A;  5T5G A;  3VTY A;  5FZR A;  1MVX A;  4FMU A;  4U04 A;  4YVO A;  5T0K A;  3UPV A;  2LSV A;  5DBK A;  1NA3 A;  5EX3 A;  5JIY A;  3JYS A;  2R3A A;  3IHX A;  3LKU A;  2Y4T A;  1W3B A;  4BWR A;  2QFC A;  1N3J A;  1MT6 A;  4QEO A;  3KAE A;  2P58 C;  3QWV A;  4J0U A;  2W5Z A;  5F6K C;  4I1A A;  4YND A;  4BT8 A;  3CKC A;  4JLG A;  3BO5 A;  5LSX A;  4J7I A;  5LCW J;  5EKQ D;  3HYM B;  3CEQ A;  5JHN A;  3S7B A;  5ARF A;  4I2W A;  1ZBP A;  4W9R A;  4NVQ A;  3FFL A;  3OS5 A;  3CVL A;  4GA2 A;  3OOI A;  2DBA A;  2HYZ A;  3BEE A;  1WAO 1;  2C0M A;  3FPD A;  3QWP A;  4Y6C A;  2XGO A;  2VGY A;  4GYW A;  1XNF A;  2KC7 A;  1ZU2 A;  4I9E A;  4WND A;  2JV0 A;  2XEV A;  5CHE E;  4CGV A;  1FCH A;  3ZN3 A;  4MI5 A;  2XCC A;  1YA0 A;  4GYY A;  3Q47 B;  3OXF A;  3SZ7 A;  4I51 A;  5AYF A;  3F9W A;  4HOT A;  3LCA A;  2FBN A;  4O30 A;  2C2L A;  3TAX A;  5D0Q D;  4UI9 K;  5HQ8 A;  4Z4P A;  3VTX A;  5JIN A;  3TGO A;  3ASF A;  3O48 A;  4MI0 A;  3AS4 A;  3CK7 A;  4ME2 A;  3CV0 A;  3GZ2 A;  2AVP A;  5D0O D;  5TH7 A;  4GA1 A;  3F9Y A;  3S7D A;  4G26 A;  2KCV A;  4KBQ A;  1A17 A;  3MO2 A;  3LPZ A;  4LDG A;  4WUY A;  4C1Q A;  2BUG A;  4JA7 A;  2UY1 B;  4J8E A;  3M56 A;  4AM9 A;  3MA5 A;  2WQH A;  4NQ0 A;  5LSZ A;  3M5A A;  5F6L A;  2XPI A;  3RJV A;  4AY5 A;  2VGX A;  4G24 A;  2Y4U A;  4UI9 J;  4QEN A;  4JA9 A;  3CBP A;  4N2Q A;  3KMJ A;  3KD7 A;  3ULQ A;  3LYA A;  3U3W A;  5KJK A;  2UY1 A;  1IHG A;  4NRH B;  1KT0 A;  3M55 A;  4YPE A;  4N2S A;  4EQF A;  4APO A;  3SW9 A;  4UI9 C;  3ZGQ A;  1NZN A;  4J7F A;  3AS5 A;  5CCM A;  5C1D A;  4N3C A; 
#chains in the Genus database with same CATH topology
 4K0R A;  3CK8 A;  4E47 A;  3B95 A;  1INZ A;  4GTO A;  2YIN A;  4AP2 A;  2I2O A;  4B93 B;  2LNI A;  3NZS A;  2J4D A;  3KMA A;  1YMP A;  4HOQ A;  2KAT A;  4A1S A;  2IU1 A;  2IO2 C;  4AIF A;  3LEW A;  4HQD A;  1OWM A;  2XGS A;  2VQ2 A;  3ASN E;  3FEY A;  3KSQ A;  3TXM A;  3CVQ A;  3FEX A;  3KMT A;  1WDY A;  3DWL G;  5HI7 A;  4DI3 A;  3DSW A;  1Y8M A;  4DLO A;  5J90 A;  3CKB A;  4GMJ A;  2GGF A;  2XZD G;  4YNM A;  2DYR E;  5F5E A;  2LSU A;  1OWN A;  5G04 J;  4WWN A;  4XI0 A;  4TUM A;  1OCO E;  1NFI E;  4UQX A;  3GYZ A;  2IGQ A;  5JJ0 A;  3VUZ A;  5KCM A;  3ESK A;  3FTX A;  4WWP A;  1TNB A;  4FLB A;  5CEA A;  3IXE A;  3ASG A;  3UKU G;  5JJ6 A;  4HB5 A;  4U07 A;  5G05 C;  3OXG A;  3SHF A;  3SQV A;  4J8S A;  5FZQ A;  2WXK A;  5JA4 D;  2GRM A;  4N39 A;  3Q15 A;  4EZJ A;  1ELR A;  3RSE G;  3ASH A;  3CSF A;  2VJ8 A;  3EP0 A;  5ENT D;  4GPM A;  4XIF A;  2V4H C;  3KSL A;  2PQR A;  2R03 A;  3FU6 A;  5TTF A;  4J6I A;  1K8K G;  2WXQ A;  4GZ5 A;  2JLB A;  3AG2 E;  5ENQ D;  5EG2 A;  2O8J A;  3ZW3 A;  2LO6 A;  4WWO A;  5BNW A;  1HO8 A;  4YPU A;  4H12 A;  5FQ7 A;  3FUF A;  3QAQ A;  3B13 A;  2CFZ A;  5JMN D;  1N0R A;  3C3O A;  3RQ4 A;  1OT8 A;  2HO1 A;  1N0Q A;  2JEK A;  1RZ4 A;  4KZC A;  1AP7 A;  4U0S A;  5EX0 A;  3DXK G;  3APC A;  4TV3 A;  4BTA A;  2F8X K;  2ETC A;  3B7U X;  2DZO A;  4CGW A;  4JVS A;  1QNF A;  1N52 A;  2QC9 A;  2IOS A;  3FUK A;  4B8C B;  4GCO A;  3HVE A;  3I4R B;  2PZI A;  4J8Y A;  2R5S A;  4AU7 A;  2BTD A;  5ANL A;  2HE0 A;  2LUH A;  4J8D A;  3D9O A;  4BER A;  3CHR A;  3VLE A;  4BFR A;  4LER A;  3ZUV B;  5AIJ A;  1PAQ A;  4GU5 A;  4PS7 A;  3G2V A;  3DAL A;  3SWC A;  3BG0 B;  4J8F A;  1ZB1 A;  3ASD A;  4U8Y D;  1OUV A;  3TWQ A;  4ATZ D;  2VSY A;  3W9F A;  1XGW A;  2CHZ A;  3JXI A;  3RU0 A;  5G05 J;  5T8I A;  1Y6I A;  2WXN A;  3GW4 A;  4ANV A;  4C48 B;  4RSY A;  5ENR D;  1O9S A;  5T3R A;  2WMO A;  1OXJ A;  5LP0 A;  1UG3 A;  4FJY A;  4JHR A;  4HOU A;  4HI8 A;  4NIK A;  4O1O A;  4JEU A;  3NQP A;  1ZKK A;  2OV8 A;  1FVH A;  4IUL A;  5TEG A;  3UT8 A;  3UX4 A;  1ELW A;  4GZD A;  4CDM A;  3EIJ A;  1TN6 A;  2L6B A;  4IRU A;  3ZNG A;  3HXC A;  3RJW A;  5CRU A;  3FTZ A;  4FJZ A;  1TR4 A;  4PH4 B;  2J8S D;  2LXL A;  3QAR A;  4LRZ A;  3FUM A;  4LG6 A;  5FZR A;  1MVX A;  4FHJ A;  1Z6T A;  3LXU X;  1TYQ G;  2P9N G;  3IBE A;  4MLP A;  4ZHB A;  3I4G A;  5T0K A;  3MKQ B;  1MT6 A;  5KWD A;  3QWV A;  1E8Y A;  4HVB A;  4BSZ B;  5AQ7 A;  3CVW A;  1MX4 A;  3J5P A;  2XEN A;  4JLG A;  3BO5 A;  1JPL A;  4XX5 A;  5EKQ D;  2I1J A;  3QC1 A;  2ZIR A;  4GTM A;  5JHN A;  3SNX A;  2P9U G;  1ZBP A;  4W9R A;  4HS2 A;  2XPY A;  3OS5 A;  3D9P A;  1IQR A;  2H6G A;  1MYO A;  2BKK B;  1WAO 1;  3Q7F A;  3B7S A;  3QK0 A;  4FUL A;  4EZL A;  4J7W A;  3FPD A;  3JQ1 A;  2I1K A;  4CRW A;  1FT2 A;  2KC7 A;  5HS0 A;  1ZU2 A;  4I9E A;  3X2Q E;  3ZKJ A;  1FCH A;  3D9H A;  1KZO A;  2XCC A;  4JB8 P;  4GYY A;  3SZ7 A;  4E6H A;  3F9W A;  2WB2 A;  3UT7 A;  4DK5 A;  4HOT A;  2XS8 A;  3FH8 A;  3PEU B;  5D0Q D;  4UI9 K;  4HI9 A;  5HQ8 A;  4Z4P A;  5JIN A;  5EYL A;  2P9S G;  3AS4 A;  4RLY A;  1DVP A;  1JUQ A;  2AVP A;  4L23 A;  5TH7 A;  3F9Y A;  3APD A;  3MO2 A;  3LPZ A;  4LDG A;  2RD0 A;  5ENN A;  2BUG A;  1LF8 A;  2WQH A;  4NQ0 A;  3M5A A;  3HXB A;  3RJV A;  4AY5 A;  1UN8 A;  2ZU6 B;  4BSX A;  1Q2Z A;  3ZYK A;  1H2T C;  3L9T A;  2DVW A;  3LYA A;  4O60 A;  4A3T A;  2V4L A;  4NRH B;  1L5J A;  3M55 A;  1MZC A;  2WXJ A;  3SW9 A;  2IQC A;  2AXU A;  4UI9 C;  1H0A A;  3ZGQ A;  3FU3 A;  4J7F A;  1Z5S C;  3AS5 A;  5CER B;  4HLE A;  5A6C A;  2IEJ A;  2R02 A;  2WXO A;  3UIP C;  4GPK A;  1JCR A;  3KS2 A;  4GZ3 A;  3WXX A;  3QJZ A;  3ZXP A;  4M3O A;  1WM5 A;  3OPE A;  2XEH A;  2G46 A;  2ILR A;  3ZEF A;  1N54 A;  3ML9 A;  5AJD A;  2EIJ E;  1XQH A;  2DIW A;  1SVX A;  3E33 A;  4WAF A;  4A3V A;  4GML A;  4GYO A;  3MV2 B;  4FHK A;  2KCL A;  2L9B A;  3HIZ A;  5KNH D;  1BI7 B;  2RKK A;  2KM4 A;  4BX8 A;  1LD8 A;  3L13 A;  2QPW A;  2NC9 A;  3HNA A;  1QYM A;  3AG4 E;  1BU9 A;  2V5F A;  3SF4 A;  4J8O A;  1UW4 B;  4GA0 A;  3U64 A;  3LJ3 A;  5E76 A;  3RO3 A;  5CCL A;  4HRN A;  2X3M A;  2GW1 A;  5F59 A;  3HG0 D;  1N11 A;  2GRN B;  3L22 A;  3ONK A;  2UWJ G;  4HOS A;  4KXK B;  3FUH A;  1YCS B;  3J5Q B;  4EBA G;  1N4S A;  2I6H A;  4DX2 A;  4J83 A;  1E96 B;  4XZ4 A;  1NP7 A;  5FWQ A;  1N6A A;  4QEP A;  4M7C A;  2P9I G;  1V55 E;  4EPZ A;  2R17 C;  4L7T A;  4G1T A;  2Y69 E;  3TWX A;  2VYI A;  2RFI A;  4U96 D;  4I2Z A;  3SGH A;  3TL5 A;  4EBA A;  5A7D B;  4IJ8 A;  3VV0 A;  1IXV A;  1JCS A;  5ANR A;  3FP3 A;  3U9W A;  2GRR B;  4N3A A;  2WPV A;  3EUV A;  5B1B E;  3HXD A;  4RQI A;  3OAW A;  5BXU A;  3R9A B;  1HH8 A;  4AVX A;  2PQN A;  3EHN A;  4GTV A;  4IN3 B;  4ACK A;  3E34 A;  4F3V A;  5KJN A;  4L2L A;  3MEK A;  3LY9 A;  3F9X A;  4IJD A;  3Q9N C;  4GTQ A;  1MUF A;  1TJC A;  3LDZ A;  4AEZ C;  3AJI A;  1NA0 A;  1WY6 A;  3CVP A;  4C0E A;  4U8H A;  4N5C A;  1P5Q A;  3PH0 C;  1D8D A;  3M54 A;  4K5B A;  2XRZ A;  4U8V D;  2EQX A;  4OYS A;  4OVU A;  2P9K G;  3UQ3 A;  2Y3A A;  2HR2 A;  3VLD A;  2CHX A;  5LFA A;  1N94 A;  5G04 C;  1S70 B;  4BES A;  4LEU A;  5ENP D;  3FUD A;  2BKG A;  3I3N A;  4ZFH A;  3RRU A;  4O1P A;  4NJ5 A;  3SBT B;  4JHK A;  5KNG A;  3IHV A;  4BTB A;  2OEV A;  1MQS A;  2KZT B;  4BX9 A;  5AEN A;  4AV7 A;  3IEG A;  4MKT A;  3M59 A;  4KYO B;  3Q79 A;  5BW8 C;  1MVH A;  4GTT A;  3G2T A;  5FQ8 A;  2IJG X;  1X5B A;  4JPS A;  5G55 A;  4AY6 A;  1HXI A;  3G2W A;  4KZ0 A;  4LNG A;  5CRV A;  1OWO A;  5CMY A;  4ATG A;  3FTY A;  3RK6 A;  2M63 A;  5AQ9 A;  2VGX B;  3FDH A;  4UQZ A;  1DNP A;  4Q69 A;  4Q94 A;  3TWV A;  4KT6 B;  4JXT A;  1H6P A;  3OXL A;  2ION A;  3CHS A;  1LTX A;  1S64 A;  5KBA A;  3CVV A;  4G23 A;  2X6H A;  3M53 A;  3SFZ A;  4UWF A;  1TNO A;  5T5G A;  3CHQ A;  3VTY A;  1N95 A;  4FMU A;  1NL4 A;  1UJJ A;  1VDY A;  1H2V C;  2LSV A;  5DBK A;  1NA3 A;  5EX3 A;  3TWU A;  2R3A A;  3ULY A;  3IHX A;  2VGE A;  5JIY A;  2QYJ A;  3C3Q A;  3MJW A;  5LX8 A;  2P58 C;  4J0U A;  5F6K C;  4E85 A;  4JHJ A;  3FTU A;  4KMO A;  1A5E A;  3R7R A;  1MX6 A;  3CKC A;  4L1B A;  3DSX A;  5LCW J;  3HYM B;  3FHE A;  4DRX E;  3FY4 A;  3Q7A A;  4KVM A;  5ARF A;  4EHM A;  4NVQ A;  3FFL A;  3OOI A;  2DBA A;  4R7L A;  5AJL A;  1HF8 A;  2C0M A;  4ILI A;  2YNQ A;  3DRA A;  2XGO A;  2GRP B;  3NBN B;  1EF1 C;  1O1S A;  3KEA A;  2JV0 A;  5CHE E;  2AJA A;  4ILH B;  4JEH A;  2H6H A;  3Q47 B;  1S0P A;  2R2L A;  2FO1 E;  3OXF A;  2RFA A;  4F6R D;  1RW2 A;  4ACL A;  4I51 A;  4K5C A;  4CDN A;  4PS8 A;  1H2U A;  2VSO E;  5B3S E;  2FBN A;  4O30 A;  3D3M A;  3UKR G;  2WVI A;  3ABK E;  2F37 A;  3EJN A;  4XKC A;  2CFU A;  5J08 A;  4LNB A;  4TXP A;  5BV0 A;  4CYM D;  4FP7 A;  3G2U A;  1MX2 A;  2KCV A;  2IOL A;  3E32 A;  3NOG D;  3ABL E;  4JA7 A;  4HLL A;  2P9L G;  4J8E A;  3CLJ A;  2LAI A;  3G2S A;  1H6K A;  3M56 A;  5AAR A;  3MA5 A;  3U66 A;  2VGX A;  3QB2 A;  3EHQ A;  1TEZ A;  2Y4U A;  4UI9 J;  3SY2 A;  4QEN A;  3CBP A;  4N2Q A;  1E90 A;  3ULQ A;  3ONL A;  3U3W A;  5KJK A;  1IHG A;  2J07 A;  5AN8 A;  2JAB A;  2EIN E;  4DX5 D;  1KZP A;  3CQC B;  3FUE A;  4N2S A;  2B0O E;  3FTV A;  1HE8 A;  4NAC A;  4TXQ A;  2FUL A;  1E7V A;  4NUR A;  1ELK A;  5CCM A;  5C1D A;  4N3C A;  4CZ2 D;  4RG9 A;  3APF A;  2IO3 C;  4AJW A;  2C0L A;  1KPS B;  3QWW A;  1QBQ A;  4XI9 A;  2WQ7 A;  1G3N B;  3GZS A;  4U63 A;  1KLX A;  4UUC A;  1IQU A;  4MBG A;  3UXG A;  2YHC A;  4D10 C;  3UTM A;  3Q4A B;  2AXZ A;  2ETB A;  3PZ3 A;  2OVF A;  4YPA A;  4GCN A;  4PUC A;  1LD7 A;  3B7T A;  1U3C A;  3PZ4 A;  4U7E B;  3V31 A;  2VSX E;  5ITZ F;  3RAY A;  4ABN A;  5KJL A;  3C3R A;  4A63 B;  3L16 A;  2PM7 A;  3AG1 E;  3ZHE A;  2X6J A;  3PE3 A;  4N5Q A;  3C72 A;  4WNG A;  1K3Z D;  3FU0 A;  5FTP A;  3S7J A;  3E4B A;  2FI7 A;  4RZ0 A;  4I43 A;  3RRM B;  2MHK A;  4JD2 G;  4B8A A;  3TG5 A;  4JDS A;  1Z3X A;  3Q73 A;  3K5K A;  4GZ6 A;  3NF1 A;  3UIO C;  4UWL A;  1TN7 A;  2L6J A;  2B6C A;  2I9C A;  1IHB A;  3JUE A;  3DBS A;  2R59 A;  5T0M A;  1HZ4 A;  5AQA A;  5CBN A;  1N9A A;  5HKP A;  3MZL B;  2WXG A;  4H7Y A;  1N4P A;  3DST A;  3RRN B;  4XKB A;  2WXH A;  3ZYL A;  1OWP A;  2NYJ A;  2CG2 A;  2Q7F A;  3DEO A;  4CDR A;  3I5P A;  2XHE A;  5JJT A;  2BED A;  1TNZ A;  5FIO A;  5CPR B;  2J49 A;  3TXN A;  2QY7 A;  3CQG B;  4BY6 A;  4WNE A;  1HU3 A;  3AU5 A;  1EYH A;  4I17 A;  5FJY A;  2V0P A;  3QOU A;  3ZVV A;  4PS3 A;  1H3I A;  3MCX A;  2MRI A;  2Y0B G;  4LSZ E;  1PY1 A;  1V54 E;  3T8K A;  1HG2 A;  1KT1 A;  2DWZ A;  2PM6 A;  4GTS A;  2WQ6 A;  4ILG A;  3ZPJ A;  3S7F A;  5BPP A;  1IKN D;  2F69 A;  3UM3 A;  1QQE A;  3O4Z A;  1BD8 A;  3ZFW A;  3MKR A;  4LCT A;  5IY5 E;  3FU5 A;  2OND A;  3HVE B;  3RIB A;  3JUI A;  5LCW C;  3PZ2 A;  3DSS A;  2L0T B;  3ZHE B;  3LY7 A;  5CBO A;  2IY0 C;  3ZYM A;  4A55 A;  1HS6 A;  5HRY A;  5BV1 A;  3K9I A;  5ENO D;  5AQB A;  1N4Q A;  4DI4 A;  2DYS E;  3CBO A;  4ANU A;  2J09 A;  3L6A A;  4OAV B;  3L17 A;  4FU3 A;  4UQY A;  3B7B A;  1U3D A;  3UIN C;  3MV3 B;  2P9P G;  3S8P A;  3FUI A;  4F7A A;  5FT9 A;  5E75 A;  3EU5 A;  5BT1 A;  3SBS A;  3V79 K;  4QQI A;  4X8Q A;  4UWG A;  3LVQ E;  3UUX A;  2WXR A;  2EIK E;  3NOC D;  3URZ A;  3EDT B;  4G2V A;  4BET A;  2IF4 A;  1SA5 A;  2OCC E;  3N71 A;  1UOH A;  2ETA A;  2EIL E;  4GMR A;  3PS6 A;  4L2Y A;  4YVO A;  3AG3 E;  3LKU A;  1NI1 A;  1W3B A;  4BWR A;  2QFC A;  3FH5 A;  4QEO A;  3KAE A;  4A1G A;  1TJF A;  4PDX A;  4LUN U;  5LSX A;  4J7I A;  3Q78 A;  3SI5 A;  3CEQ A;  3C98 A;  3MYV A;  5FIN A;  3S7B A;  4FC8 A;  4TRQ A;  1YYH A;  2OEW A;  4FLH A;  3EIQ C;  1E7U A;  2HYZ A;  3BEE A;  3UT4 A;  3FTW A;  3S2A A;  3HHM A;  3BU8 A;  3UM1 A;  2MOW A;  3D9M A;  1XNF A;  3PEV B;  2XEV A;  3WG7 E;  3PNL B;  4CGV A;  1SW6 A;  1H19 A;  2XS1 A;  4MI5 A;  3ZXS A;  2J08 A;  1D9S A;  3FUJ A;  5AYF A;  3ESL A;  4I6G A;  3UM2 A;  3PZD A;  2A5E A;  3SFY A;  2J4B A;  3TAX A;  4I1O B;  3VTX A;  3DEP A;  4APF A;  3O48 A;  3ZYQ A;  4MI0 A;  3D9I A;  3CVU A;  2X6F A;  3JQ0 A;  1BLX B;  3SO8 A;  4ME2 A;  3CVX A;  3AAA C;  5EIL A;  5D0O D;  1X81 A;  2WXM A;  4GA1 A;  2QZA A;  3AU4 A;  3S7D A;  1E8Z A;  4G26 A;  4JZY A;  2ZGD A;  2AW6 A;  4GTR A;  1A17 A;  2XEE A;  2WM9 A;  3CHP A;  1FVF A;  4C1Q A;  4C9B B;  4AM9 A;  1JWF A;  4TUU A;  1MHQ A;  5LSZ A;  5F6L A;  4HRM B;  2XPI A;  1TNU A;  1TNY A;  4K03 A;  1MJ0 A;  2KXP C;  3Q75 A;  3T5X A;  3FUL A;  1K1B A;  4JA9 A;  3HRA A;  3DSU A;  3KD7 A;  3F6Q A;  3LJN A;  3CIA A;  4AOF A;  4DX6 D;  3DSV A;  2UY1 A;  2GRL A;  2CG3 A;  4YPE A;  4MRU A;  4YDO A;  1EDU A;  4EQF A;  3DXM G;  5BXO A;  2WMN A;  4F1P A;  1NZN A;  5H7P A;  2KZT A;  3ZU7 B;  2RFM A;  1PEG A;  2PL2 A;  3FWV A;  2AXV A;  1O5M A;  2FF4 A;  1O1R A;  2FEZ A;  3EHM A;  3V2X A;  1SZA A;  2R05 A;  3PE4 A;  3AS8 A;  2WXP A;  2HM8 A;  4QFV A;  3SD5 A;  5ARG A;  2XPZ A;  3LY8 A;  4WNF A;  1JCQ A;  4Y6W A;  4OVV A;  1OCZ E;  2YHE A;  4GTP A;  2H6F A;  3HDX A;  3PZ1 A;  4G8K A;  5JJ7 A;  3CK9 A;  5FZS A;  3UI2 A;  4CT4 A;  5FQ4 A;  4YNP A;  4BUP A;  2KCK A;  3IV0 A;  4OAU C;  4HRL A;  1E8X A;  4TXR A;  5EID A;  3ULE G;  1HX8 A;  2E2E A;  2X6K A;  4N3B A;  1HG5 A;  2OVB A;  5CMW A;  4V3I A;  3TJP A;  2PNN A;  2XGM A;  2XRY A;  1SQM A;  2NXP A;  3R9M A;  1ML9 A;  3BQO A;  1EPU A;  3QKY A;  4C0M A;  4JL0 A;  1UN9 A;  1IYG A;  4BT9 A;  2ZIS A;  3L54 A;  5ENS D;  2YQ8 A;  2L0I A;  3L82 A;  2AWI A;  2XQ0 A;  4G11 A;  2F8Y A;  4G25 A;  2WXL A;  5LOZ A;  2GRQ B;  3V2O A;  1DCE A;  3DB5 A;  5AAO A;  3B7R L;  2BQZ A;  1Z3Y A;  4GZC A;  3TWT A;  1N4R A;  5D66 A;  1B89 A;  1PC2 A;  4AXH A;  3RO2 A;  5KJM A;  3LVR E;  4YVQ C;  3CBM A;  2A5U A;  3D9N A;  1GW6 A;  3TG4 A;  4O6F A;  3M57 A;  1U2V G;  3HXF A;  4DPR A;  3CVN A;  3OTN A;  4BEP A;  3BUA A;  4RG6 A;  5M72 A;  4F53 A;  3QNK A;  3GZ1 A;  1JWG A;  5JHB A;  2FO7 A;  1OCC E;  3D9K A;  3EHR A;  3Q49 B;  3C5R A;  2GRO B;  3T5V A;  2OOE A;  4XEI G;  1BPO A;  5CED B;  5JHA A;  4HOR A;  4EZK A;  3TWS A;  3PUK A;  4XE0 A;  3MKQ A;  2VTB A;  4JC8 A;  2V8S E;  3F9Z A;  2XZT G;  4YDW A;  2XCB A;  4HBD A;  3PDN A;  3M58 A;  5EN5 D;  4HNA D;  2X38 A;  4L9P A;  2V5Q C;  4H7X A;  3CR3 A;  1DC2 A;  3UMV A;  2X6I A;  3D9J A;  1O1T A;  4GAA A;  4UWH A;  3E37 A;  2EIM E;  3DPD A;  4ANW A;  4ANX A;  3L08 A;  4U0Z A;  3MO0 A;  4RVB A;  3U4T A;  3RKV A;  4EEC A;  3LS8 A;  1N6C A;  2J9Q A;  3CHM A;  4U0U A;  5A23 A;  4HFG A;  4B94 A;  3D9L A;  4FAD A;  4DUI A;  1FT1 A;  4DX1 A;  3FUN A;  1SA4 A;  3SFX A;  4JW1 A;  1SZ9 A;  3TWW A;  4GB9 A;  1D8E A;  3EU9 A;  1DCQ A;  3DPY A;  2VSN A;  1FPP A;  4UWK A;  2W5Y A;  4B89 A;  2ZGG A;  1QZ2 A;  1BI8 B;  4I9C A;  2DZN A;  2IFU A;  2CHW A;  3ENE A;  2KBX A;  3VLF A;  2VTB B;  3Q5M A;  3FH7 A;  3CHO A;  5T4Y A;  3MO5 A;  4DLQ A;  3PNT B;  4I6J A;  3ABM E;  3QDN A;  3BG1 B;  1H6O A;  2RG8 A;  5AYW D;  3RAU A;  5D2M C;  3ZIM A;  5DIZ A;  4YDY A;  1HFA A;  5EYP F;  4CT0 A;  4U04 A;  3MGB A;  1S63 A;  3NZU A;  4I6E A;  3UPV A;  4CCA A;  4LNU D;  3JYS A;  3PRE A;  3E30 A;  2Y4T A;  1N3J A;  3TWR A;  3IKO B;  3P1U A;  2W5Z A;  4I1A A;  4YND A;  4BT8 A;  4CEM A;  5EDS A;  4DX7 D;  2QYU A;  2LXM A;  3T9K A;  3CST A;  1WG0 A;  2MYO A;  4I2W A;  2A4Z A;  2DCP A;  4Z68 A;  3CVL A;  4F1S A;  4GA2 A;  2WXI A;  4U95 D;  3QWP A;  2WXF A;  4Y6C A;  4YDE A;  2VGY A;  4GYW A;  1OWL A;  4WND A;  1E8W A;  3NAW A;  5C2Y A;  3T8M A;  3JCK C;  1OY3 D;  3MX3 A;  1K1A A;  3ZN3 A;  1YA0 A;  3V30 A;  3PUJ A;  3ML8 A;  3PRZ A;  3LCA A;  3PVL A;  2C2L A;  2F0Y A;  3P2B A;  4K5A B;  4HXI A;  2LAH A;  3TGO A;  3ASF A;  3ISM C;  5G2N A;  3UM0 A;  3CK7 A;  4URK A;  5B1A E;  3CV0 A;  3GZ2 A;  2BF0 X;  3HXE A;  1AWC B;  4KBQ A;  4KVO A;  5FQ6 A;  3R7Q A;  4WUY A;  2UY1 B;  2ZXW E;  4FA6 A;  2NSZ A;  4I1M A;  4G8L A;  5CEC B;  5BUZ A;  3JXJ A;  3Q9U C;  4G24 A;  4DJA A;  1OCR E;  2E0I A;  3CVY A;  2P2C P;  2Y1L E;  3KEZ A;  4P29 A;  4Q96 A;  1TN8 A;  3ASO E;  3KMJ A;  5EIB E;  4IYP A;  3ZRH A;  4B0Z A;  4MS6 A;  3W9G A;  1KT0 A;  4APO A;  2H6I A;  3IHY A;  3NB2 A;  3FTS A;  1UJK A;  3CGH A; 
#chains in the Genus database with same CATH homology
 1PEG A;  4RG9 A;  5A6C A;  2PL2 A;  2WXO A;  4GPK A;  3FWV A;  4K0R A;  3APF A;  4AJW A;  3KS2 A;  2AXV A;  3CK8 A;  4GZ3 A;  2FF4 A;  3WXX A;  4E47 A;  2C0L A;  3QJZ A;  1INZ A;  2FEZ A;  2YIN A;  4M3O A;  1WM5 A;  4AP2 A;  2I2O A;  3EHM A;  2LNI A;  3QWW A;  3OPE A;  3NZS A;  1SZA A;  2J4D A;  4XI9 A;  3KMA A;  3PE4 A;  4HOQ A;  3AS8 A;  2KAT A;  2WXP A;  2HM8 A;  2ILR A;  2IU1 A;  1N54 A;  3ZEF A;  4A1S A;  4AIF A;  3ML9 A;  5AJD A;  3GZS A;  2WQ7 A;  3LEW A;  4U63 A;  1KLX A;  4QFV A;  3SD5 A;  1IQU A;  2XPZ A;  1OWM A;  3LY8 A;  5ARG A;  4WNF A;  2XGS A;  2VQ2 A;  2YHC A;  3FEY A;  1XQH A;  2DIW A;  3TXM A;  3CVQ A;  3FEX A;  4Y6W A;  4WAF A;  4A3V A;  4OVV A;  4D10 C;  3KMT A;  2YHE A;  3Q4A B;  4GML A;  2AXZ A;  3HDX A;  2OVF A;  4YPA A;  4GYO A;  4GCN A;  5HI7 A;  3MV2 B;  4FHK A;  2KCL A;  4PUC A;  2L9B A;  3HIZ A;  4DI3 A;  5JJ7 A;  3B7T A;  1U3C A;  3CK9 A;  5FZS A;  4CT4 A;  5FQ4 A;  4YNP A;  4BUP A;  2KCK A;  3IV0 A;  2VSX E;  1Y8M A;  4DLO A;  1E8X A;  5J90 A;  3RAY A;  4ABN A;  2KM4 A;  4BX8 A;  5KJL A;  3CKB A;  1HX8 A;  4GMJ A;  2GGF A;  4YNM A;  3L16 A;  2E2E A;  2X6K A;  4N3B A;  1HG5 A;  2PM7 A;  2OVB A;  5F5E A;  2LSU A;  3L13 A;  1OWN A;  5CMW A;  2QPW A;  2NC9 A;  4V3I A;  5G04 J;  3HNA A;  3TJP A;  3ZHE A;  4WWN A;  4XI0 A;  2X6J A;  2XGM A;  2XRY A;  1SQM A;  2NXP A;  3PE3 A;  4UQX A;  2V5F A;  3SF4 A;  1ML9 A;  4J8O A;  1UW4 B;  4WNG A;  3GYZ A;  2IGQ A;  3FU0 A;  5JJ0 A;  1EPU A;  3VUZ A;  5KCM A;  3ESK A;  3QKY A;  3FTX A;  4C0M A;  4GA0 A;  1UN9 A;  3LJ3 A;  4JL0 A;  4WWP A;  4FLB A;  5E76 A;  3U64 A;  3RO3 A;  5CCL A;  1IYG A;  5FTP A;  3S7J A;  2X3M A;  3E4B A;  4BT9 A;  2FI7 A;  2GW1 A;  3ASG A;  3L54 A;  5F59 A;  4RZ0 A;  4I43 A;  3RRM B;  2MHK A;  5JJ6 A;  2YQ8 A;  4B8A A;  3TG5 A;  3L22 A;  4U07 A;  2L0I A;  5G05 C;  3ONK A;  2AWI A;  2UWJ G;  2XQ0 A;  4JDS A;  1Z3X A;  3OXG A;  4KXK B;  4HOS A;  4G11 A;  3SHF A;  4J8S A;  2G46 A;  4G25 A;  2WXL A;  5LOZ A;  3FUH A;  5FZQ A;  3K5K A;  2WXK A;  4GZ6 A;  3NF1 A;  2GRM A;  4UWL A;  3DB5 A;  2L6J A;  4N39 A;  2I9C A;  3B7R L;  4EBA G;  3DBS A;  2R59 A;  3Q15 A;  2BQZ A;  5T0M A;  1Z3Y A;  2I6H A;  1HZ4 A;  4GZC A;  4J83 A;  4EZJ A;  1ELR A;  1E96 B;  3ASH A;  1B89 A;  1PC2 A;  4XZ4 A;  1NP7 A;  3CSF A;  4AXH A;  5FWQ A;  1N6A A;  2VJ8 A;  3RO2 A;  5KJM A;  3EP0 A;  4QEP A;  3MZL B;  4XIF A;  2WXG A;  3LVR E;  4H7Y A;  4YVQ C;  2PQR A;  3FU6 A;  3CBM A;  2A5U A;  5TTF A;  3D9N A;  4EPZ A;  4J6I A;  3RRN B;  1GW6 A;  4XKB A;  2WXH A;  3ZYL A;  1OWP A;  2R17 C;  2WXQ A;  4L7T A;  4G1T A;  4GZ5 A;  3TG4 A;  2CG2 A;  4O6F A;  2JLB A;  2Q7F A;  2VYI A;  2RFI A;  3M57 A;  5EG2 A;  4DPR A;  3CVN A;  3OTN A;  4I2Z A;  3SGH A;  2O8J A;  3ZW3 A;  4CDR A;  3I5P A;  2LO6 A;  4WWO A;  3TL5 A;  5A7D B;  4EBA A;  5BNW A;  4IJ8 A;  3VV0 A;  5ANR A;  3FP3 A;  4RG6 A;  5M72 A;  4F53 A;  1HO8 A;  3QNK A;  2XHE A;  3U9W A;  5JJT A;  4YPU A;  4H12 A;  4N3A A;  2WPV A;  3GZ1 A;  5FQ7 A;  3FUF A;  1JWG A;  3OAW A;  5JHB A;  3QAQ A;  2FO7 A;  3B13 A;  3R9A B;  2CFZ A;  1HH8 A;  5CPR B;  3D9K A;  2J49 A;  3RQ4 A;  3Q49 B;  4AVX A;  2PQN A;  3EHN A;  3TXN A;  2QY7 A;  3CQG B;  4BY6 A;  2HO1 A;  3T5V A;  2OOE A;  1BPO A;  4WNE A;  1HU3 A;  4IN3 B;  4ACK A;  5JHA A;  3AU5 A;  1EYH A;  2JEK A;  4HOR A;  4I17 A;  4KZC A;  5FJY A;  4F3V A;  2V0P A;  3QOU A;  3ZVV A;  4PS3 A;  1H3I A;  4EZK A;  4U0S A;  5EX0 A;  3MCX A;  3PUK A;  2MRI A;  5KJN A;  4XE0 A;  4L2L A;  3MEK A;  3LY9 A;  1PY1 A;  3F9X A;  4IJD A;  1HG2 A;  1KT1 A;  3APC A;  3MKQ A;  1MUF A;  2VTB A;  4TV3 A;  1TJC A;  4JC8 A;  4BTA A;  2V8S E;  3LDZ A;  2PM6 A;  4AEZ C;  3F9Z A;  2XCB A;  2WQ6 A;  4ILG A;  3ZPJ A;  3S7F A;  5BPP A;  3B7U X;  1NA0 A;  1WY6 A;  3CVP A;  3PDN A;  4C0E A;  4U8H A;  3M58 A;  4N5C A;  1P5Q A;  3PH0 C;  4CGW A;  4JVS A;  2F69 A;  2X38 A;  1QNF A;  1N52 A;  4H7X A;  3CR3 A;  2IOS A;  1QQE A;  3FUK A;  4B8C B;  3M54 A;  4GCO A;  3UMV A;  2X6I A;  3D9J A;  3HVE A;  2XRZ A;  3O4Z A;  3I4R B;  3ZFW A;  4GAA A;  2EQX A;  4OYS A;  4OVU A;  3MKR A;  2PZI A;  2R5S A;  3UQ3 A;  2Y3A A;  4UWH A;  2HR2 A;  4AU7 A;  2BTD A;  4LCT A;  3VLD A;  3DPD A;  5ANL A;  4ANW A;  2CHX A;  4ANX A;  5LFA A;  3FU5 A;  4J8D A;  3L08 A;  2OND A;  4U0Z A;  5G04 C;  3MO0 A;  3D9O A;  3HVE B;  4RVB A;  3RIB A;  3JUI A;  3U4T A;  3RKV A;  4EEC A;  3LS8 A;  5LCW C;  1N6C A;  3CHR A;  3VLE A;  4LEU A;  4BFR A;  2J9Q A;  3CHM A;  3FUD A;  4LER A;  4U0U A;  5A23 A;  5AIJ A;  1PAQ A;  2L0T B;  3I3N A;  4GU5 A;  4PS7 A;  3G2V A;  4HFG A;  3RRU A;  3ZHE B;  3D9L A;  3LY7 A;  4B94 A;  4FAD A;  3DAL A;  4NJ5 A;  3SWC A;  3SBT B;  3FUN A;  3BG0 B;  4J8F A;  3ZYM A;  5KJK A;  3ASD A;  1OUV A;  4A55 A;  4JW1 A;  4JHK A;  1HS6 A;  5BV1 A;  3K9I A;  1SZ9 A;  3IHV A;  4BTB A;  2VSY A;  1XGW A;  2CHZ A;  1MQS A;  4GB9 A;  5G05 J;  3RU0 A;  4DI4 A;  5T8I A;  3CBO A;  2KZT B;  1Y6I A;  2WXN A;  3GW4 A;  2J09 A;  4ANU A;  3L6A A;  4ANV A;  4BX9 A;  5AEN A;  3L17 A;  2VSN A;  4AV7 A;  4RSY A;  1O9S A;  4UWK A;  2WMO A;  3IEG A;  4MKT A;  5T3R A;  4FU3 A;  5LP0 A;  4UQY A;  2W5Y A;  4KYO B;  3M59 A;  1UG3 A;  4FJY A;  1U3D A;  4JHR A;  5BW8 C;  4HOU A;  4B89 A;  1MVH A;  3MV3 B;  1QZ2 A;  3S8P A;  3G2T A;  3FUI A;  5FQ8 A;  4I9C A;  2IJG X;  1X5B A;  4JPS A;  4F7A A;  2IFU A;  4JEU A;  5G55 A;  3NQP A;  5FT9 A;  4AY6 A;  5E75 A;  1ZKK A;  2CHW A;  3ENE A;  1HXI A;  3G2W A;  2OV8 A;  1FVH A;  4KZ0 A;  5BT1 A;  3SBS A;  4IUL A;  1OWO A;  3VLF A;  2VTB B;  5TEG A;  3Q5M A;  5CMY A;  4UWG A;  4ATG A;  3UT8 A;  3UX4 A;  3LVQ E;  3FTY A;  3UUX A;  3FH7 A;  1ELW A;  3CHO A;  3RK6 A;  2WXR A;  4GZD A;  5T4Y A;  2M63 A;  2VGX B;  3FDH A;  4UQZ A;  4CDM A;  3EIJ A;  3MO5 A;  4IRU A;  3URZ A;  1DNP A;  4Q94 A;  4Q69 A;  4KT6 B;  4JXT A;  3EDT B;  4DLQ A;  3PNT B;  3OXL A;  4I6J A;  4G2V A;  3QDN A;  2ION A;  3CHS A;  3BG1 B;  3RJW A;  2IF4 A;  2RG8 A;  5AYW D;  3CVV A;  4G23 A;  3FTZ A;  3ZIM A;  4FJZ A;  5DIZ A;  4PH4 B;  3N71 A;  2X6H A;  3M53 A;  3QAR A;  4UWF A;  3SFZ A;  5T5G A;  3PS6 A;  3CHQ A;  4LRZ A;  4L2Y A;  3VTY A;  3FUM A;  1HFA A;  5FZR A;  1MVX A;  4CT0 A;  4FHJ A;  1Z6T A;  3LXU X;  4FMU A;  4U04 A;  1UJJ A;  1VDY A;  3MGB A;  3IBE A;  3NZU A;  4I6E A;  4MLP A;  4YVO A;  1H2V C;  3I4G A;  5T0K A;  4CCA A;  3UPV A;  2LSV A;  5DBK A;  1NA3 A;  5EX3 A;  5JIY A;  3JYS A;  3PRE A;  2R3A A;  3IHX A;  3LKU A;  2Y4T A;  3MJW A;  5LX8 A;  1W3B A;  3MKQ B;  2QFC A;  4BWR A;  3FH5 A;  1MT6 A;  1N3J A;  4QEO A;  3KAE A;  2P58 C;  3IKO B;  3P1U A;  3QWV A;  1E8Y A;  4HVB A;  4J0U A;  2W5Z A;  5F6K C;  4I1A A;  4JHJ A;  4E85 A;  3FTU A;  3CVW A;  4A1G A;  4KMO A;  4YND A;  4BT8 A;  4CEM A;  3R7R A;  5EDS A;  1TJF A;  4PDX A;  3CKC A;  4LUN U;  4L1B A;  3BO5 A;  4JLG A;  5LSX A;  4J7I A;  1JPL A;  5LCW J;  4XX5 A;  5EKQ D;  3SI5 A;  3HYM B;  3CEQ A;  3FHE A;  2I1J A;  3C98 A;  3MYV A;  3QC1 A;  5JHN A;  3FY4 A;  4KVM A;  3CST A;  3S7B A;  4FC8 A;  4TRQ A;  3SNX A;  5ARF A;  4I2W A;  2A4Z A;  1ZBP A;  4FLH A;  4W9R A;  4HS2 A;  4NVQ A;  2DCP A;  3EIQ C;  2XPY A;  3FFL A;  3OS5 A;  3D9P A;  3CVL A;  4F1S A;  4GA2 A;  3OOI A;  1E7U A;  2DBA A;  2HYZ A;  4R7L A;  1IQR A;  3BEE A;  2WXI A;  3UT4 A;  1WAO 1;  5AJL A;  1HF8 A;  3B7S A;  3FTW A;  3QK0 A;  2C0M A;  4ILI A;  3S2A A;  4FUL A;  4EZL A;  2YNQ A;  3FPD A;  3HHM A;  3QWP A;  2WXF A;  4Y6C A;  2MOW A;  2VGY A;  2XGO A;  3D9M A;  3JQ1 A;  4GYW A;  1EF1 C;  1XNF A;  2I1K A;  4CRW A;  1OWL A;  2KC7 A;  1ZU2 A;  4I9E A;  3PEV B;  4WND A;  1E8W A;  5C2Y A;  2JV0 A;  3T8M A;  3JCK C;  2XEV A;  5CHE E;  3PNL B;  4ILH B;  4CGV A;  4JEH A;  1FCH A;  1H19 A;  3MX3 A;  3ZN3 A;  2XCC A;  4MI5 A;  1YA0 A;  3ZXS A;  4GYY A;  3Q47 B;  2J08 A;  1S0P A;  3PUJ A;  3ML8 A;  3OXF A;  3SZ7 A;  3FUJ A;  3PRZ A;  4ACL A;  4E6H A;  4I51 A;  4CDN A;  5AYF A;  3ESL A;  3F9W A;  2WB2 A;  3UT7 A;  4PS8 A;  4DK5 A;  4I6G A;  1H2U A;  4HOT A;  2VSO E;  3PZD A;  3LCA A;  2FBN A;  3FH8 A;  3PEU B;  2J4B A;  2C2L A;  3D3M A;  3PVL A;  3TAX A;  4O30 A;  5D0Q D;  4UI9 K;  3P2B A;  2WVI A;  4I1O B;  5HQ8 A;  4Z4P A;  3VTX A;  4HXI A;  5JIN A;  2LAH A;  4APF A;  3TGO A;  3ASF A;  3O48 A;  3ZYQ A;  3EJN A;  3D9I A;  4XKC A;  2CFU A;  3AS4 A;  5G2N A;  4MI0 A;  3CVU A;  2X6F A;  3JQ0 A;  3CK7 A;  4URK A;  1DVP A;  5J08 A;  1JUQ A;  4ME2 A;  3CV0 A;  3GZ2 A;  5BV0 A;  2BF0 X;  3CVX A;  2AVP A;  5D0O D;  4L23 A;  2WXM A;  5TH7 A;  4GA1 A;  4FP7 A;  3AU4 A;  3F9Y A;  3G2U A;  3S7D A;  1E8Z A;  4G26 A;  4JZY A;  2KCV A;  2IOL A;  4KBQ A;  2AW6 A;  1A17 A;  3APD A;  3MO2 A;  3LPZ A;  2WM9 A;  4LDG A;  2RD0 A;  3CHP A;  4KVO A;  5ENN A;  1FVF A;  5FQ6 A;  4WUY A;  3R7Q A;  4C1Q A;  2BUG A;  4JA7 A;  4C9B B;  2UY1 B;  4J8E A;  3CLJ A;  2LAI A;  4FA6 A;  2NSZ A;  1H6K A;  3G2S A;  4I1M A;  3M56 A;  4AM9 A;  3MA5 A;  1LF8 A;  1JWF A;  2WQH A;  4TUU A;  4NQ0 A;  1MHQ A;  5LSZ A;  3M5A A;  3U66 A;  5F6L A;  2XPI A;  3RJV A;  4AY5 A;  2VGX A;  1UN8 A;  2ZU6 B;  3QB2 A;  4K03 A;  5BUZ A;  4G24 A;  1TEZ A;  2Y4U A;  3T5X A;  3FUL A;  4UI9 J;  2E0I A;  4DJA A;  3CVY A;  4BSX A;  4QEN A;  4JA9 A;  3KEZ A;  3ZYK A;  3CBP A;  4P29 A;  4Q96 A;  4N2Q A;  1H2T C;  1E90 A;  3KMJ A;  3KD7 A;  3ULQ A;  3ONL A;  3LYA A;  3U3W A;  3CIA A;  4IYP A;  4A3T A;  4AOF A;  2UY1 A;  3ZRH A;  1IHG A;  2J07 A;  2V4L A;  4MS6 A;  4NRH B;  4B0Z A;  1L5J A;  2GRL A;  2CG3 A;  3CQC B;  1KT0 A;  3M55 A;  4YPE A;  3FUE A;  4MRU A;  1EDU A;  4EQF A;  4N2S A;  4APO A;  2WXJ A;  3SW9 A;  3FTV A;  2WMN A;  2IQC A;  1HE8 A;  2AXU A;  1H0A A;  3IHY A;  2FUL A;  1E7V A;  1NZN A;  4NAC A;  4UI9 C;  3ZGQ A;  3FU3 A;  2KZT A;  4NUR A;  4J7F A;  1ELK A;  3AS5 A;  3FTS A;  5CCM A;  1UJK A;  3CGH A;  5C1D A;  4N3C A;  4HLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...