3MO5A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e72
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
258
structure length
255
Chain Sequence
b'IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
molecule tags Transferase
source organism Homo sapiens
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
total genus 65
structure length 255
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo5A00
4BUPA 3IHXA 2O8JA 4C1QA 4I51A 3F9ZA 5CCMA 3BO5A 4O30A 3M57A 2W5ZA 3MO0A 3MEKA 4YPAA 1N3JA 4YPUA 5T0KA 3M55A 5T5GA 3RAYA 4Z4PA 3TG4A 5EX3A 3OXFA 5JHNA 4O6FA 4LDGA 3M54A 4QENA 3M53A 3KMJA 5JINA 5JJ0A 3F9YA 3KMTA 5CCLA 5TTFA 4H12A 3OXGA 5HI7A 3S7BA 4NJ5A 5F5EA 3QWPA 4MI0A 3OOIA 4JDSA 3PDNA 4J7FA 1O9SA 1PEGA 3N71A 3CBOA 4J83A 3MO5A 1ZKKA 2R3AA 4JLGA 1MVHA 1MUFA 2F69A 4YNMA 5T0MA 3VUZA 3OPEA 3S8PA 5ARGA 2RFIA 3DALA 3RJWA 2IGQA 1N6CA 1MVXA 5KJMA 5ARFA 5LSZA 2G46A 4AU7A 3M58A 3RQ4A 5F6KC 3HNAA 4NVQA 5JIYA 3SW9A 3CBMA 3M5AA 5EG2A 4QEOA 3SWCA 4YNPA 1H3IA 5LSXA 3TG5A 5CPRB 5F6LA 4E47A 3S7FA 3RU0A 4IJ8A 3MO2A 3VV0A 2JV0A 4FMUA 4QEPA 3S7DA 2QPWA 1XQHA 1MT6A 5HQ8A 3RIBA 3S7JA 3KMAA 4YNDA 4IJDA 5KJKA 5TEGA 5AYFA 3M56A 4WUYA 1ML9A 4J8OA 3OS5A 3F9XA 4J7IA 5EX0A 3OXLA 3F9WA 5F59A 2W5YA 3QWVA 5KJLA 4MI5A 3EP0A 1N6AA 3QWWA 4RZ0A 3DB5A 4YPEA 5KJNA 2BQZA 3FPDA 3CBPA 3K5KA 5TH7A 3M59A
chains in the Genus database with same CATH superfamily
4BUPA 3IHXA 2O8JA 4C1QA 4I51A 3F9ZA 5CCMA 3BO5A 4O30A 3M57A 2W5ZA 3MO0A 3MEKA 4YPAA 1N3JA 4YPUA 5T0KA 3M55A 5T5GA 3RAYA 4Z4PA 3TG4A 5EX3A 3OXFA 5JHNA 4O6FA 4LDGA 3M54A 4QENA 3M53A 3KMJA 5JINA 5JJ0A 3F9YA 3KMTA 5CCLA 5TTFA 4H12A 3OXGA 5HI7A 3S7BA 4NJ5A 5F5EA 3QWPA 4MI0A 3OOIA 4JDSA 3PDNA 4J7FA 1O9SA 1PEGA 3N71A 3CBOA 4J83A 3MO5A 1ZKKA 2R3AA 4JLGA 1MVHA 1MUFA 2F69A 4YNMA 5T0MA 3VUZA 3OPEA 3S8PA 5ARGA 2RFIA 3DALA 3RJWA 2IGQA 1N6CA 1MVXA 5KJMA 5ARFA 5LSZA 2G46A 4AU7A 3M58A 3RQ4A 5F6KC 3HNAA 4NVQA 5JIYA 3SW9A 3CBMA 3M5AA 5EG2A 4QEOA 3SWCA 4YNPA 1H3IA 5LSXA 3TG5A 5CPRB 5F6LA 4E47A 3S7FA 3RU0A 4IJ8A 3MO2A 3VV0A 2JV0A 4FMUA 4QEPA 3S7DA 2QPWA 1XQHA 1MT6A 5HQ8A 3RIBA 3S7JA 3KMAA 4YNDA 4IJDA 5KJKA 5TEGA 5AYFA 3M56A 4WUYA 1ML9A 4J8OA 3OS5A 3F9XA 4J7IA 5EX0A 3OXLA 3F9WA 5F59A 2W5YA 3QWVA 5KJLA 4MI5A 3EP0A 1N6AA 3QWWA 4RZ0A 3DB5A 4YPEA 5KJNA 2BQZA 3FPDA 3CBPA 3K5KA 5TH7A 3M59A
chains in the Genus database with same CATH topology
4BUPA 3IHXA 2O8JA 4C1QA 4I51A 3F9ZA 5CCMA 3BO5A 4O30A 3M57A 2W5ZA 3MO0A 3MEKA 4YPAA 1N3JA 4YPUA 5T0KA 3M55A 5T5GA 3RAYA 4Z4PA 3TG4A 5EX3A 3OXFA 5JHNA 4O6FA 4LDGA 3M54A 4QENA 3M53A 3KMJA 5JINA 5JJ0A 3F9YA 3KMTA 5CCLA 5TTFA 4H12A 3OXGA 5HI7A 3S7BA 4NJ5A 5F5EA 3QWPA 4MI0A 3OOIA 4JDSA 3PDNA 4J7FA 1O9SA 1PEGA 3N71A 3CBOA 4J83A 3MO5A 1ZKKA 2R3AA 4JLGA 1MVHA 1MUFA 2F69A 4YNMA 5T0MA 3VUZA 3OPEA 3S8PA 5ARGA 2RFIA 3DALA 3RJWA 2IGQA 1N6CA 1MVXA 5KJMA 5ARFA 5LSZA 2G46A 4AU7A 3M58A 3RQ4A 5F6KC 3HNAA 4NVQA 5JIYA 3SW9A 3CBMA 3M5AA 5EG2A 4QEOA 3SWCA 4YNPA 1H3IA 5LSXA 3TG5A 5CPRB 5F6LA 4E47A 3S7FA 3RU0A 4IJ8A 3MO2A 3VV0A 2JV0A 4FMUA 4QEPA 3S7DA 2QPWA 1XQHA 1MT6A 5HQ8A 3RIBA 3S7JA 3KMAA 4YNDA 4IJDA 5KJKA 5TEGA 5AYFA 3M56A 4WUYA 1ML9A 4J8OA 3OS5A 3F9XA 4J7IA 5EX0A 3OXLA 3F9WA 5F59A 2W5YA 3QWVA 5KJLA 4MI5A 3EP0A 1N6AA 3QWWA 4RZ0A 3DB5A 4YPEA 5KJNA 2BQZA 3FPDA 3CBPA 3K5KA 5TH7A 3M59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUP A;  3IHX A;  2O8J A;  4C1Q A;  4I51 A;  3F9Z A;  5CCM A;  3BO5 A;  4O30 A;  3M57 A;  2W5Z A;  3MO0 A;  3MEK A;  4YPA A;  1N3J A;  4YPU A;  5T0K A;  3M55 A;  5T5G A;  3RAY A;  4Z4P A;  3TG4 A;  5EX3 A;  3OXF A;  5JHN A;  4O6F A;  4LDG A;  3M54 A;  4QEN A;  3M53 A;  3KMJ A;  5JIN A;  5JJ0 A;  3F9Y A;  3KMT A;  5CCL A;  5TTF A;  4H12 A;  3OXG A;  5HI7 A;  3S7B A;  4NJ5 A;  5F5E A;  3QWP A;  4MI0 A;  3OOI A;  4JDS A;  3PDN A;  4J7F A;  1O9S A;  1PEG A;  3N71 A;  3CBO A;  4J83 A;  3MO5 A;  1ZKK A;  2R3A A;  4JLG A;  1MVH A;  1MUF A;  2F69 A;  4YNM A;  5T0M A;  3VUZ A;  3OPE A;  3S8P A;  5ARG A;  2RFI A;  3DAL A;  3RJW A;  2IGQ A;  1N6C A;  1MVX A;  5KJM A;  5ARF A;  5LSZ A;  2G46 A;  4AU7 A;  3M58 A;  3RQ4 A;  5F6K C;  3HNA A;  4NVQ A;  5JIY A;  3SW9 A;  3CBM A;  3M5A A;  5EG2 A;  4QEO A;  3SWC A;  4YNP A;  1H3I A;  5LSX A;  3TG5 A;  5CPR B;  5F6L A;  4E47 A;  3S7F A;  3RU0 A;  4IJ8 A;  3MO2 A;  3VV0 A;  2JV0 A;  4FMU A;  4QEP A;  3S7D A;  2QPW A;  1XQH A;  1MT6 A;  5HQ8 A;  3RIB A;  3S7J A;  3KMA A;  4YND A;  4IJD A;  5KJK A;  5TEG A;  5AYF A;  3M56 A;  4WUY A;  1ML9 A;  4J8O A;  3OS5 A;  3F9X A;  4J7I A;  5EX0 A;  3OXL A;  3F9W A;  5F59 A;  2W5Y A;  3QWV A;  5KJL A;  4MI5 A;  3EP0 A;  1N6A A;  3QWW A;  4RZ0 A;  3DB5 A;  4YPE A;  5KJN A;  2BQZ A;  3FPD A;  3CBP A;  3K5K A;  5TH7 A;  3M59 A; 
#chains in the Genus database with same CATH topology
 4BUP A;  3IHX A;  2O8J A;  4C1Q A;  4I51 A;  3F9Z A;  5CCM A;  3BO5 A;  4O30 A;  3M57 A;  2W5Z A;  3MO0 A;  3MEK A;  4YPA A;  1N3J A;  4YPU A;  5T0K A;  3M55 A;  5T5G A;  3RAY A;  4Z4P A;  3TG4 A;  5EX3 A;  3OXF A;  5JHN A;  4O6F A;  4LDG A;  3M54 A;  4QEN A;  3M53 A;  3KMJ A;  5JIN A;  5JJ0 A;  3F9Y A;  3KMT A;  5CCL A;  5TTF A;  4H12 A;  3OXG A;  5HI7 A;  3S7B A;  4NJ5 A;  5F5E A;  3QWP A;  4MI0 A;  3OOI A;  4JDS A;  3PDN A;  4J7F A;  1O9S A;  1PEG A;  3N71 A;  3CBO A;  4J83 A;  3MO5 A;  1ZKK A;  2R3A A;  4JLG A;  1MVH A;  1MUF A;  2F69 A;  4YNM A;  5T0M A;  3VUZ A;  3OPE A;  3S8P A;  5ARG A;  2RFI A;  3DAL A;  3RJW A;  2IGQ A;  1N6C A;  1MVX A;  5KJM A;  5ARF A;  5LSZ A;  2G46 A;  4AU7 A;  3M58 A;  3RQ4 A;  5F6K C;  3HNA A;  4NVQ A;  5JIY A;  3SW9 A;  3CBM A;  3M5A A;  5EG2 A;  4QEO A;  3SWC A;  4YNP A;  1H3I A;  5LSX A;  3TG5 A;  5CPR B;  5F6L A;  4E47 A;  3S7F A;  3RU0 A;  4IJ8 A;  3MO2 A;  3VV0 A;  2JV0 A;  4FMU A;  4QEP A;  3S7D A;  2QPW A;  1XQH A;  1MT6 A;  5HQ8 A;  3RIB A;  3S7J A;  3KMA A;  4YND A;  4IJD A;  5KJK A;  5TEG A;  5AYF A;  3M56 A;  4WUY A;  1ML9 A;  4J8O A;  3OS5 A;  3F9X A;  4J7I A;  5EX0 A;  3OXL A;  3F9W A;  5F59 A;  2W5Y A;  3QWV A;  5KJL A;  4MI5 A;  3EP0 A;  1N6A A;  3QWW A;  4RZ0 A;  3DB5 A;  4YPE A;  5KJN A;  2BQZ A;  3FPD A;  3CBP A;  3K5K A;  5TH7 A;  3M59 A; 
#chains in the Genus database with same CATH homology
 4BUP A;  3IHX A;  2O8J A;  4C1Q A;  4I51 A;  3F9Z A;  5CCM A;  3BO5 A;  4O30 A;  3M57 A;  2W5Z A;  3MO0 A;  3MEK A;  4YPA A;  1N3J A;  4YPU A;  5T0K A;  3M55 A;  5T5G A;  3RAY A;  4Z4P A;  3TG4 A;  5EX3 A;  3OXF A;  5JHN A;  4O6F A;  4LDG A;  3M54 A;  4QEN A;  3M53 A;  3KMJ A;  5JIN A;  5JJ0 A;  3F9Y A;  3KMT A;  5CCL A;  5TTF A;  4H12 A;  3OXG A;  5HI7 A;  3S7B A;  4NJ5 A;  5F5E A;  3QWP A;  4MI0 A;  3OOI A;  4JDS A;  3PDN A;  4J7F A;  1O9S A;  1PEG A;  3N71 A;  3CBO A;  4J83 A;  3MO5 A;  1ZKK A;  2R3A A;  4JLG A;  1MVH A;  1MUF A;  2F69 A;  4YNM A;  5T0M A;  3VUZ A;  3OPE A;  3S8P A;  5ARG A;  2RFI A;  3DAL A;  3RJW A;  2IGQ A;  1N6C A;  1MVX A;  5KJM A;  5ARF A;  5LSZ A;  2G46 A;  4AU7 A;  3M58 A;  3RQ4 A;  5F6K C;  3HNA A;  4NVQ A;  5JIY A;  3SW9 A;  3CBM A;  3M5A A;  5EG2 A;  4QEO A;  3SWC A;  4YNP A;  1H3I A;  5LSX A;  3TG5 A;  5CPR B;  5F6L A;  4E47 A;  3S7F A;  3RU0 A;  4IJ8 A;  3MO2 A;  3VV0 A;  2JV0 A;  4FMU A;  4QEP A;  3S7D A;  2QPW A;  1XQH A;  1MT6 A;  5HQ8 A;  3RIB A;  3S7J A;  3KMA A;  4YND A;  4IJD A;  5KJK A;  5TEG A;  5AYF A;  3M56 A;  4WUY A;  1ML9 A;  4J8O A;  3OS5 A;  3F9X A;  4J7I A;  5EX0 A;  3OXL A;  3F9W A;  5F59 A;  2W5Y A;  3QWV A;  5KJL A;  4MI5 A;  3EP0 A;  1N6A A;  3QWW A;  4RZ0 A;  3DB5 A;  4YPE A;  5KJN A;  2BQZ A;  3FPD A;  3CBP A;  3K5K A;  5TH7 A;  3M59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...