3MO5A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e72
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
258
structure length
255
Chain Sequence
IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 255
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo5A00
4I51A 3S7BA 2QPWA 3F9WA 4O6FA 3TG5A 4QENA 4J83A 5CCLA 3OPEA 3VUZA 5F5EA 4BUPA 3DALA 4J7IA 5AYFA 5HQ8A 4YPUA 5HI7A 3OS5A 4FMUA 5TTFA 4MI5A 1ML9A 3OXFA 5JINA 5EX0A 4O30A 2W5YA 5ARFA 3KMTA 3F9YA 1MVHA 3RJWA 3F9XA 3MO5A 5JHNA 1H3IA 5F6LA 5KJNA 5T0MA 3M5AA 1N6AA 3CBOA 3QWWA 4IJ8A 3M58A 4YNDA 5TH7A 4YPAA 3N71A 5EX3A 5T0KA 5JJ0A 3TG4A 5EG2A 1N3JA 3MEKA 3CBPA 4WUYA 3RAYA 1MT6A 2O8JA 4C1QA 3QWPA 3MO0A 3QWVA 5LSZA 3VV0A 2JV0A 4J8OA 5F6KC 3CBMA 4YNPA 1XQHA 4JLGA 3M54A 3M57A 5JIYA 4H12A 3K5KA 4IJDA 3S7FA 1MUFA 4Z4PA 3HNAA 3S7DA 5CCMA 5CPRB 3F9ZA 5F59A 2F69A 1N6CA 3FPDA 3OOIA 4NJ5A 5KJKA 3EP0A 3S7JA 4QEPA 2W5ZA 1O9SA 3DB5A 3M53A 4JDSA 4LDGA 2RFIA 4E47A 3M56A 3M59A 5LSXA 5KJMA 3OXLA 2BQZA 4MI0A 5ARGA 3SW9A 3KMJA 2G46A 5T5GA 5KJLA 3KMAA 3IHXA 3S8PA 5TEGA 4AU7A 3M55A 4J7FA 1MVXA 3BO5A 4RZ0A 3MO2A 3RQ4A 2R3AA 4NVQA 4QEOA 3RU0A 3RIBA 3PDNA 3SWCA 3OXGA 1PEGA 4YPEA 1ZKKA 4YNMA 2IGQA
chains in the Genus database with same CATH superfamily
4I51A 3S7BA 2QPWA 3F9WA 4O6FA 3TG5A 4QENA 4J83A 5CCLA 3OPEA 3VUZA 5F5EA 4BUPA 3DALA 4J7IA 5AYFA 5HQ8A 4YPUA 5HI7A 3OS5A 4FMUA 5TTFA 4MI5A 1ML9A 3OXFA 5JINA 5EX0A 4O30A 2W5YA 5ARFA 3KMTA 3F9YA 1MVHA 3RJWA 3F9XA 3MO5A 5JHNA 1H3IA 5F6LA 5KJNA 5T0MA 3M5AA 1N6AA 3CBOA 3QWWA 4IJ8A 3M58A 4YNDA 5TH7A 4YPAA 3N71A 5EX3A 5T0KA 5JJ0A 3TG4A 5EG2A 1N3JA 3MEKA 3CBPA 4WUYA 3RAYA 1MT6A 2O8JA 4C1QA 3QWPA 3MO0A 3QWVA 5LSZA 3VV0A 2JV0A 4J8OA 5F6KC 3CBMA 4YNPA 1XQHA 4JLGA 3M54A 3M57A 5JIYA 4H12A 3K5KA 4IJDA 3S7FA 1MUFA 4Z4PA 3HNAA 3S7DA 5CCMA 5CPRB 3F9ZA 5F59A 2F69A 1N6CA 3FPDA 3OOIA 4NJ5A 5KJKA 3EP0A 3S7JA 4QEPA 2W5ZA 1O9SA 3DB5A 3M53A 4JDSA 4LDGA 2RFIA 4E47A 3M56A 3M59A 5LSXA 5KJMA 3OXLA 2BQZA 4MI0A 5ARGA 3SW9A 3KMJA 2G46A 5T5GA 5KJLA 3KMAA 3IHXA 3S8PA 5TEGA 4AU7A 3M55A 4J7FA 1MVXA 3BO5A 4RZ0A 3MO2A 3RQ4A 2R3AA 4NVQA 4QEOA 3RU0A 3RIBA 3PDNA 3SWCA 3OXGA 1PEGA 4YPEA 1ZKKA 4YNMA 2IGQA
chains in the Genus database with same CATH topology
4I51A 3S7BA 2QPWA 3F9WA 4O6FA 3TG5A 4QENA 4J83A 5CCLA 3OPEA 3VUZA 5F5EA 4BUPA 3DALA 4J7IA 5AYFA 5HQ8A 4YPUA 5HI7A 3OS5A 4FMUA 5TTFA 4MI5A 1ML9A 3OXFA 5JINA 5EX0A 4O30A 2W5YA 5ARFA 3KMTA 3F9YA 1MVHA 3RJWA 3F9XA 3MO5A 5JHNA 1H3IA 5F6LA 5KJNA 5T0MA 3M5AA 1N6AA 3CBOA 3QWWA 4IJ8A 3M58A 4YNDA 5TH7A 4YPAA 3N71A 5EX3A 5T0KA 5JJ0A 3TG4A 5EG2A 1N3JA 3MEKA 3CBPA 4WUYA 3RAYA 1MT6A 2O8JA 4C1QA 3QWPA 3MO0A 3QWVA 5LSZA 3VV0A 2JV0A 4J8OA 5F6KC 3CBMA 4YNPA 1XQHA 4JLGA 3M54A 3M57A 5JIYA 4H12A 3K5KA 4IJDA 3S7FA 1MUFA 4Z4PA 3HNAA 3S7DA 5CCMA 5CPRB 3F9ZA 5F59A 2F69A 1N6CA 3FPDA 3OOIA 4NJ5A 5KJKA 3EP0A 3S7JA 4QEPA 2W5ZA 1O9SA 3DB5A 3M53A 4JDSA 4LDGA 2RFIA 4E47A 3M56A 3M59A 5LSXA 5KJMA 3OXLA 2BQZA 4MI0A 5ARGA 3SW9A 3KMJA 2G46A 5T5GA 5KJLA 3KMAA 3IHXA 3S8PA 5TEGA 4AU7A 3M55A 4J7FA 1MVXA 3BO5A 4RZ0A 3MO2A 3RQ4A 2R3AA 4NVQA 4QEOA 3RU0A 3RIBA 3PDNA 3SWCA 3OXGA 1PEGA 4YPEA 1ZKKA 4YNMA 2IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I51 A;  3S7B A;  2QPW A;  3F9W A;  4O6F A;  3TG5 A;  4QEN A;  4J83 A;  5CCL A;  3OPE A;  3VUZ A;  5F5E A;  4BUP A;  3DAL A;  4J7I A;  5AYF A;  5HQ8 A;  4YPU A;  5HI7 A;  3OS5 A;  4FMU A;  5TTF A;  4MI5 A;  1ML9 A;  3OXF A;  5JIN A;  5EX0 A;  4O30 A;  2W5Y A;  5ARF A;  3KMT A;  3F9Y A;  1MVH A;  3RJW A;  3F9X A;  3MO5 A;  5JHN A;  1H3I A;  5F6L A;  5KJN A;  5T0M A;  3M5A A;  1N6A A;  3CBO A;  3QWW A;  4IJ8 A;  3M58 A;  4YND A;  5TH7 A;  4YPA A;  3N71 A;  5EX3 A;  5T0K A;  5JJ0 A;  3TG4 A;  5EG2 A;  1N3J A;  3MEK A;  3CBP A;  4WUY A;  3RAY A;  1MT6 A;  2O8J A;  4C1Q A;  3QWP A;  3MO0 A;  3QWV A;  5LSZ A;  3VV0 A;  2JV0 A;  4J8O A;  5F6K C;  3CBM A;  4YNP A;  1XQH A;  4JLG A;  3M54 A;  3M57 A;  5JIY A;  4H12 A;  3K5K A;  4IJD A;  3S7F A;  1MUF A;  4Z4P A;  3HNA A;  3S7D A;  5CCM A;  5CPR B;  3F9Z A;  5F59 A;  2F69 A;  1N6C A;  3FPD A;  3OOI A;  4NJ5 A;  5KJK A;  3EP0 A;  3S7J A;  4QEP A;  2W5Z A;  1O9S A;  3DB5 A;  3M53 A;  4JDS A;  4LDG A;  2RFI A;  4E47 A;  3M56 A;  3M59 A;  5LSX A;  5KJM A;  3OXL A;  2BQZ A;  4MI0 A;  5ARG A;  3SW9 A;  3KMJ A;  2G46 A;  5T5G A;  5KJL A;  3KMA A;  3IHX A;  3S8P A;  5TEG A;  4AU7 A;  3M55 A;  4J7F A;  1MVX A;  3BO5 A;  4RZ0 A;  3MO2 A;  3RQ4 A;  2R3A A;  4NVQ A;  4QEO A;  3RU0 A;  3RIB A;  3PDN A;  3SWC A;  3OXG A;  1PEG A;  4YPE A;  1ZKK A;  4YNM A;  2IGQ A; 
#chains in the Genus database with same CATH topology
 4I51 A;  3S7B A;  2QPW A;  3F9W A;  4O6F A;  3TG5 A;  4QEN A;  4J83 A;  5CCL A;  3OPE A;  3VUZ A;  5F5E A;  4BUP A;  3DAL A;  4J7I A;  5AYF A;  5HQ8 A;  4YPU A;  5HI7 A;  3OS5 A;  4FMU A;  5TTF A;  4MI5 A;  1ML9 A;  3OXF A;  5JIN A;  5EX0 A;  4O30 A;  2W5Y A;  5ARF A;  3KMT A;  3F9Y A;  1MVH A;  3RJW A;  3F9X A;  3MO5 A;  5JHN A;  1H3I A;  5F6L A;  5KJN A;  5T0M A;  3M5A A;  1N6A A;  3CBO A;  3QWW A;  4IJ8 A;  3M58 A;  4YND A;  5TH7 A;  4YPA A;  3N71 A;  5EX3 A;  5T0K A;  5JJ0 A;  3TG4 A;  5EG2 A;  1N3J A;  3MEK A;  3CBP A;  4WUY A;  3RAY A;  1MT6 A;  2O8J A;  4C1Q A;  3QWP A;  3MO0 A;  3QWV A;  5LSZ A;  3VV0 A;  2JV0 A;  4J8O A;  5F6K C;  3CBM A;  4YNP A;  1XQH A;  4JLG A;  3M54 A;  3M57 A;  5JIY A;  4H12 A;  3K5K A;  4IJD A;  3S7F A;  1MUF A;  4Z4P A;  3HNA A;  3S7D A;  5CCM A;  5CPR B;  3F9Z A;  5F59 A;  2F69 A;  1N6C A;  3FPD A;  3OOI A;  4NJ5 A;  5KJK A;  3EP0 A;  3S7J A;  4QEP A;  2W5Z A;  1O9S A;  3DB5 A;  3M53 A;  4JDS A;  4LDG A;  2RFI A;  4E47 A;  3M56 A;  3M59 A;  5LSX A;  5KJM A;  3OXL A;  2BQZ A;  4MI0 A;  5ARG A;  3SW9 A;  3KMJ A;  2G46 A;  5T5G A;  5KJL A;  3KMA A;  3IHX A;  3S8P A;  5TEG A;  4AU7 A;  3M55 A;  4J7F A;  1MVX A;  3BO5 A;  4RZ0 A;  3MO2 A;  3RQ4 A;  2R3A A;  4NVQ A;  4QEO A;  3RU0 A;  3RIB A;  3PDN A;  3SWC A;  3OXG A;  1PEG A;  4YPE A;  1ZKK A;  4YNM A;  2IGQ A; 
#chains in the Genus database with same CATH homology
 4I51 A;  3S7B A;  2QPW A;  3F9W A;  4O6F A;  3TG5 A;  4QEN A;  4J83 A;  5CCL A;  3OPE A;  3VUZ A;  5F5E A;  4BUP A;  3DAL A;  4J7I A;  5AYF A;  5HQ8 A;  4YPU A;  5HI7 A;  3OS5 A;  4FMU A;  5TTF A;  4MI5 A;  1ML9 A;  3OXF A;  5JIN A;  5EX0 A;  4O30 A;  2W5Y A;  5ARF A;  3KMT A;  3F9Y A;  1MVH A;  3RJW A;  3F9X A;  3MO5 A;  5JHN A;  1H3I A;  5F6L A;  5KJN A;  5T0M A;  3M5A A;  1N6A A;  3CBO A;  3QWW A;  4IJ8 A;  3M58 A;  4YND A;  5TH7 A;  4YPA A;  3N71 A;  5EX3 A;  5T0K A;  5JJ0 A;  3TG4 A;  5EG2 A;  1N3J A;  3MEK A;  3CBP A;  4WUY A;  3RAY A;  1MT6 A;  2O8J A;  4C1Q A;  3QWP A;  3MO0 A;  3QWV A;  5LSZ A;  3VV0 A;  2JV0 A;  4J8O A;  5F6K C;  3CBM A;  4YNP A;  1XQH A;  4JLG A;  3M54 A;  3M57 A;  5JIY A;  4H12 A;  3K5K A;  4IJD A;  3S7F A;  1MUF A;  4Z4P A;  3HNA A;  3S7D A;  5CCM A;  5CPR B;  3F9Z A;  5F59 A;  2F69 A;  1N6C A;  3FPD A;  3OOI A;  4NJ5 A;  5KJK A;  3EP0 A;  3S7J A;  4QEP A;  2W5Z A;  1O9S A;  3DB5 A;  3M53 A;  4JDS A;  4LDG A;  2RFI A;  4E47 A;  3M56 A;  3M59 A;  5LSX A;  5KJM A;  3OXL A;  2BQZ A;  4MI0 A;  5ARG A;  3SW9 A;  3KMJ A;  2G46 A;  5T5G A;  5KJL A;  3KMA A;  3IHX A;  3S8P A;  5TEG A;  4AU7 A;  3M55 A;  4J7F A;  1MVX A;  3BO5 A;  4RZ0 A;  3MO2 A;  3RQ4 A;  2R3A A;  4NVQ A;  4QEO A;  3RU0 A;  3RIB A;  3PDN A;  3SWC A;  3OXG A;  1PEG A;  4YPE A;  1ZKK A;  4YNM A;  2IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...