3MO5A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e72
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
258
structure length
255
Chain Sequence
IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 255
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo5A00
5KJNA 3S7BA 4MI0A 3IHXA 4J7FA 3RIBA 5KJKA 3SWCA 4J83A 5JIYA 2RFIA 5F59A 5EX3A 5F6LA 3QWPA 5TH7A 1ML9A 4YNDA 4J7IA 1N6AA 3RU0A 4WUYA 3MO0A 3M5AA 4J8OA 4IJ8A 3OPEA 4YPEA 2IGQA 4LDGA 3MEKA 3M53A 5EG2A 1N3JA 1N6CA 3EP0A 3F9ZA 4YPAA 5AYFA 4QENA 4FMUA 1ZKKA 3VUZA 3TG5A 2G46A 5TTFA 2R3AA 4QEPA 2O8JA 3KMTA 5CCLA 3N71A 3MO2A 3CBPA 4I51A 4NJ5A 5LSZA 4YNPA 5F6KC 4E47A 2W5ZA 5LSXA 3VV0A 4NVQA 3QWWA 4QEOA 3S7DA 5JJ0A 3CBOA 3CBMA 3S7FA 3DALA 5CPRB 3SW9A 4C1QA 4IJDA 3F9YA 3OXLA 3OXFA 3S7JA 2BQZA 4BUPA 3OS5A 5JHNA 3M59A 4H12A 1XQHA 4O6FA 3KMAA 3PDNA 3OXGA 1MT6A 5T0MA 5TEGA 4AU7A 3BO5A 5F5EA 3FPDA 1MVXA 5T5GA 3S8PA 3QWVA 1PEGA 5EX0A 5KJLA 3K5KA 3M55A 5ARFA 5HI7A 3RQ4A 3TG4A 5JINA 3DB5A 4YPUA 4JDSA 1O9SA 4JLGA 5T0KA 3OOIA 3F9WA 3MO5A 2QPWA 5KJMA 3RJWA 3RAYA 5ARGA 3M56A 3M54A 3HNAA 1H3IA 3M57A 3F9XA 4RZ0A 4YNMA 5HQ8A 1MVHA 3KMJA 4O30A 2F69A 3M58A 4MI5A 2JV0A 4Z4PA 1MUFA 2W5YA 5CCMA
chains in the Genus database with same CATH superfamily
5KJNA 3S7BA 4MI0A 3IHXA 4J7FA 3RIBA 5KJKA 3SWCA 4J83A 5JIYA 2RFIA 5F59A 5EX3A 5F6LA 3QWPA 5TH7A 1ML9A 4YNDA 4J7IA 1N6AA 3RU0A 4WUYA 3MO0A 3M5AA 4J8OA 4IJ8A 3OPEA 4YPEA 2IGQA 4LDGA 3MEKA 3M53A 5EG2A 1N3JA 1N6CA 3EP0A 3F9ZA 4YPAA 5AYFA 4QENA 4FMUA 1ZKKA 3VUZA 3TG5A 2G46A 5TTFA 2R3AA 4QEPA 2O8JA 3KMTA 5CCLA 3N71A 3MO2A 3CBPA 4I51A 4NJ5A 5LSZA 4YNPA 5F6KC 4E47A 2W5ZA 5LSXA 3VV0A 4NVQA 3QWWA 4QEOA 3S7DA 5JJ0A 3CBOA 3CBMA 3S7FA 3DALA 5CPRB 3SW9A 4C1QA 4IJDA 3F9YA 3OXLA 3OXFA 3S7JA 2BQZA 4BUPA 3OS5A 5JHNA 3M59A 4H12A 1XQHA 4O6FA 3KMAA 3PDNA 3OXGA 1MT6A 5T0MA 5TEGA 4AU7A 3BO5A 5F5EA 3FPDA 1MVXA 5T5GA 3S8PA 3QWVA 1PEGA 5EX0A 5KJLA 3K5KA 3M55A 5ARFA 5HI7A 3RQ4A 3TG4A 5JINA 3DB5A 4YPUA 4JDSA 1O9SA 4JLGA 5T0KA 3OOIA 3F9WA 3MO5A 2QPWA 5KJMA 3RJWA 3RAYA 5ARGA 3M56A 3M54A 3HNAA 1H3IA 3M57A 3F9XA 4RZ0A 4YNMA 5HQ8A 1MVHA 3KMJA 4O30A 2F69A 3M58A 4MI5A 2JV0A 4Z4PA 1MUFA 2W5YA 5CCMA
chains in the Genus database with same CATH topology
5KJNA 3S7BA 4MI0A 3IHXA 4J7FA 3RIBA 5KJKA 3SWCA 4J83A 5JIYA 2RFIA 5F59A 5EX3A 5F6LA 3QWPA 5TH7A 1ML9A 4YNDA 4J7IA 1N6AA 3RU0A 4WUYA 3MO0A 3M5AA 4J8OA 4IJ8A 3OPEA 4YPEA 2IGQA 4LDGA 3MEKA 3M53A 5EG2A 1N3JA 1N6CA 3EP0A 3F9ZA 4YPAA 5AYFA 4QENA 4FMUA 1ZKKA 3VUZA 3TG5A 2G46A 5TTFA 2R3AA 4QEPA 2O8JA 3KMTA 5CCLA 3N71A 3MO2A 3CBPA 4I51A 4NJ5A 5LSZA 4YNPA 5F6KC 4E47A 2W5ZA 5LSXA 3VV0A 4NVQA 3QWWA 4QEOA 3S7DA 5JJ0A 3CBOA 3CBMA 3S7FA 3DALA 5CPRB 3SW9A 4C1QA 4IJDA 3F9YA 3OXLA 3OXFA 3S7JA 2BQZA 4BUPA 3OS5A 5JHNA 3M59A 4H12A 1XQHA 4O6FA 3KMAA 3PDNA 3OXGA 1MT6A 5T0MA 5TEGA 4AU7A 3BO5A 5F5EA 3FPDA 1MVXA 5T5GA 3S8PA 3QWVA 1PEGA 5EX0A 5KJLA 3K5KA 3M55A 5ARFA 5HI7A 3RQ4A 3TG4A 5JINA 3DB5A 4YPUA 4JDSA 1O9SA 4JLGA 5T0KA 3OOIA 3F9WA 3MO5A 2QPWA 5KJMA 3RJWA 3RAYA 5ARGA 3M56A 3M54A 3HNAA 1H3IA 3M57A 3F9XA 4RZ0A 4YNMA 5HQ8A 1MVHA 3KMJA 4O30A 2F69A 3M58A 4MI5A 2JV0A 4Z4PA 1MUFA 2W5YA 5CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJN A;  3S7B A;  4MI0 A;  3IHX A;  4J7F A;  3RIB A;  5KJK A;  3SWC A;  4J83 A;  5JIY A;  2RFI A;  5F59 A;  5EX3 A;  5F6L A;  3QWP A;  5TH7 A;  1ML9 A;  4YND A;  4J7I A;  1N6A A;  3RU0 A;  4WUY A;  3MO0 A;  3M5A A;  4J8O A;  4IJ8 A;  3OPE A;  4YPE A;  2IGQ A;  4LDG A;  3MEK A;  3M53 A;  5EG2 A;  1N3J A;  1N6C A;  3EP0 A;  3F9Z A;  4YPA A;  5AYF A;  4QEN A;  4FMU A;  1ZKK A;  3VUZ A;  3TG5 A;  2G46 A;  5TTF A;  2R3A A;  4QEP A;  2O8J A;  3KMT A;  5CCL A;  3N71 A;  3MO2 A;  3CBP A;  4I51 A;  4NJ5 A;  5LSZ A;  4YNP A;  5F6K C;  4E47 A;  2W5Z A;  5LSX A;  3VV0 A;  4NVQ A;  3QWW A;  4QEO A;  3S7D A;  5JJ0 A;  3CBO A;  3CBM A;  3S7F A;  3DAL A;  5CPR B;  3SW9 A;  4C1Q A;  4IJD A;  3F9Y A;  3OXL A;  3OXF A;  3S7J A;  2BQZ A;  4BUP A;  3OS5 A;  5JHN A;  3M59 A;  4H12 A;  1XQH A;  4O6F A;  3KMA A;  3PDN A;  3OXG A;  1MT6 A;  5T0M A;  5TEG A;  4AU7 A;  3BO5 A;  5F5E A;  3FPD A;  1MVX A;  5T5G A;  3S8P A;  3QWV A;  1PEG A;  5EX0 A;  5KJL A;  3K5K A;  3M55 A;  5ARF A;  5HI7 A;  3RQ4 A;  3TG4 A;  5JIN A;  3DB5 A;  4YPU A;  4JDS A;  1O9S A;  4JLG A;  5T0K A;  3OOI A;  3F9W A;  3MO5 A;  2QPW A;  5KJM A;  3RJW A;  3RAY A;  5ARG A;  3M56 A;  3M54 A;  3HNA A;  1H3I A;  3M57 A;  3F9X A;  4RZ0 A;  4YNM A;  5HQ8 A;  1MVH A;  3KMJ A;  4O30 A;  2F69 A;  3M58 A;  4MI5 A;  2JV0 A;  4Z4P A;  1MUF A;  2W5Y A;  5CCM A; 
#chains in the Genus database with same CATH topology
 5KJN A;  3S7B A;  4MI0 A;  3IHX A;  4J7F A;  3RIB A;  5KJK A;  3SWC A;  4J83 A;  5JIY A;  2RFI A;  5F59 A;  5EX3 A;  5F6L A;  3QWP A;  5TH7 A;  1ML9 A;  4YND A;  4J7I A;  1N6A A;  3RU0 A;  4WUY A;  3MO0 A;  3M5A A;  4J8O A;  4IJ8 A;  3OPE A;  4YPE A;  2IGQ A;  4LDG A;  3MEK A;  3M53 A;  5EG2 A;  1N3J A;  1N6C A;  3EP0 A;  3F9Z A;  4YPA A;  5AYF A;  4QEN A;  4FMU A;  1ZKK A;  3VUZ A;  3TG5 A;  2G46 A;  5TTF A;  2R3A A;  4QEP A;  2O8J A;  3KMT A;  5CCL A;  3N71 A;  3MO2 A;  3CBP A;  4I51 A;  4NJ5 A;  5LSZ A;  4YNP A;  5F6K C;  4E47 A;  2W5Z A;  5LSX A;  3VV0 A;  4NVQ A;  3QWW A;  4QEO A;  3S7D A;  5JJ0 A;  3CBO A;  3CBM A;  3S7F A;  3DAL A;  5CPR B;  3SW9 A;  4C1Q A;  4IJD A;  3F9Y A;  3OXL A;  3OXF A;  3S7J A;  2BQZ A;  4BUP A;  3OS5 A;  5JHN A;  3M59 A;  4H12 A;  1XQH A;  4O6F A;  3KMA A;  3PDN A;  3OXG A;  1MT6 A;  5T0M A;  5TEG A;  4AU7 A;  3BO5 A;  5F5E A;  3FPD A;  1MVX A;  5T5G A;  3S8P A;  3QWV A;  1PEG A;  5EX0 A;  5KJL A;  3K5K A;  3M55 A;  5ARF A;  5HI7 A;  3RQ4 A;  3TG4 A;  5JIN A;  3DB5 A;  4YPU A;  4JDS A;  1O9S A;  4JLG A;  5T0K A;  3OOI A;  3F9W A;  3MO5 A;  2QPW A;  5KJM A;  3RJW A;  3RAY A;  5ARG A;  3M56 A;  3M54 A;  3HNA A;  1H3I A;  3M57 A;  3F9X A;  4RZ0 A;  4YNM A;  5HQ8 A;  1MVH A;  3KMJ A;  4O30 A;  2F69 A;  3M58 A;  4MI5 A;  2JV0 A;  4Z4P A;  1MUF A;  2W5Y A;  5CCM A; 
#chains in the Genus database with same CATH homology
 5KJN A;  3S7B A;  4MI0 A;  3IHX A;  4J7F A;  3RIB A;  5KJK A;  3SWC A;  4J83 A;  5JIY A;  2RFI A;  5F59 A;  5EX3 A;  5F6L A;  3QWP A;  5TH7 A;  1ML9 A;  4YND A;  4J7I A;  1N6A A;  3RU0 A;  4WUY A;  3MO0 A;  3M5A A;  4J8O A;  4IJ8 A;  3OPE A;  4YPE A;  2IGQ A;  4LDG A;  3MEK A;  3M53 A;  5EG2 A;  1N3J A;  1N6C A;  3EP0 A;  3F9Z A;  4YPA A;  5AYF A;  4QEN A;  4FMU A;  1ZKK A;  3VUZ A;  3TG5 A;  2G46 A;  5TTF A;  2R3A A;  4QEP A;  2O8J A;  3KMT A;  5CCL A;  3N71 A;  3MO2 A;  3CBP A;  4I51 A;  4NJ5 A;  5LSZ A;  4YNP A;  5F6K C;  4E47 A;  2W5Z A;  5LSX A;  3VV0 A;  4NVQ A;  3QWW A;  4QEO A;  3S7D A;  5JJ0 A;  3CBO A;  3CBM A;  3S7F A;  3DAL A;  5CPR B;  3SW9 A;  4C1Q A;  4IJD A;  3F9Y A;  3OXL A;  3OXF A;  3S7J A;  2BQZ A;  4BUP A;  3OS5 A;  5JHN A;  3M59 A;  4H12 A;  1XQH A;  4O6F A;  3KMA A;  3PDN A;  3OXG A;  1MT6 A;  5T0M A;  5TEG A;  4AU7 A;  3BO5 A;  5F5E A;  3FPD A;  1MVX A;  5T5G A;  3S8P A;  3QWV A;  1PEG A;  5EX0 A;  5KJL A;  3K5K A;  3M55 A;  5ARF A;  5HI7 A;  3RQ4 A;  3TG4 A;  5JIN A;  3DB5 A;  4YPU A;  4JDS A;  1O9S A;  4JLG A;  5T0K A;  3OOI A;  3F9W A;  3MO5 A;  2QPW A;  5KJM A;  3RJW A;  3RAY A;  5ARG A;  3M56 A;  3M54 A;  3HNA A;  1H3I A;  3M57 A;  3F9X A;  4RZ0 A;  4YNM A;  5HQ8 A;  1MVH A;  3KMJ A;  4O30 A;  2F69 A;  3M58 A;  4MI5 A;  2JV0 A;  4Z4P A;  1MUF A;  2W5Y A;  5CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...