3MO5A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e72
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
258
structure length
255
Chain Sequence
IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
total genus 65
structure length 255
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo5A00
4I51A 3QWVA 2BQZA 5HI7A 2QPWA 2W5YA 4YPAA 5T0KA 4QENA 3CBOA 4YNPA 4O30A 3QWWA 1N6CA 5ARFA 5JJ0A 3OOIA 3PDNA 5EG2A 3TG5A 4WUYA 3SW9A 3M59A 3S7DA 5KJMA 2IGQA 5TH7A 3S7BA 3OPEA 4H12A 3M57A 1MT6A 3F9ZA 5F5EA 5KJKA 4J7IA 5CCLA 4IJ8A 4MI0A 3RU0A 3RJWA 5ARGA 4O6FA 2O8JA 5F6LA 3DALA 3RAYA 3VUZA 4YPUA 4J83A 5TEGA 5LSXA 3SWCA 5JHNA 1N6AA 3KMTA 4QEOA 3OXFA 5F6KC 3MO5A 4YPEA 2F69A 4QEPA 4JDSA 1N3JA 3S7JA 4AU7A 5JIYA 3K5KA 5JINA 3HNAA 2G46A 3M58A 4BUPA 2W5ZA 3VV0A 4Z4PA 3MO2A 4YNDA 5TTFA 1PEGA 5T0MA 1XQHA 4NJ5A 3OXLA 2R3AA 3EP0A 5CCMA 5KJLA 4IJDA 1MVHA 3FPDA 3OS5A 4YNMA 4C1QA 3M53A 5HQ8A 1H3IA 3M54A 3S7FA 3M56A 3MO0A 5KJNA 3OXGA 4J8OA 3MEKA 3IHXA 4MI5A 1ML9A 4LDGA 1MUFA 3TG4A 5LSZA 3CBPA 3F9XA 3CBMA 5AYFA 4RZ0A 3BO5A 4JLGA 3KMAA 3M5AA 5F59A 2JV0A 4NVQA 2RFIA 3RQ4A 3S8PA 1MVXA 1O9SA 3F9YA 5CPRB 3N71A 3QWPA 3RIBA 3F9WA 5T5GA 3KMJA 4FMUA 4J7FA 5EX0A 3DB5A 5EX3A 1ZKKA 3M55A 4E47A
chains in the Genus database with same CATH superfamily
4I51A 3QWVA 2BQZA 5HI7A 2QPWA 2W5YA 4YPAA 5T0KA 4QENA 3CBOA 4YNPA 4O30A 3QWWA 1N6CA 5ARFA 5JJ0A 3OOIA 3PDNA 5EG2A 3TG5A 4WUYA 3SW9A 3M59A 3S7DA 5KJMA 2IGQA 5TH7A 3S7BA 3OPEA 4H12A 3M57A 1MT6A 3F9ZA 5F5EA 5KJKA 4J7IA 5CCLA 4IJ8A 4MI0A 3RU0A 3RJWA 5ARGA 4O6FA 2O8JA 5F6LA 3DALA 3RAYA 3VUZA 4YPUA 4J83A 5TEGA 5LSXA 3SWCA 5JHNA 1N6AA 3KMTA 4QEOA 3OXFA 5F6KC 3MO5A 4YPEA 2F69A 4QEPA 4JDSA 1N3JA 3S7JA 4AU7A 5JIYA 3K5KA 5JINA 3HNAA 2G46A 3M58A 4BUPA 2W5ZA 3VV0A 4Z4PA 3MO2A 4YNDA 5TTFA 1PEGA 5T0MA 1XQHA 4NJ5A 3OXLA 2R3AA 3EP0A 5CCMA 5KJLA 4IJDA 1MVHA 3FPDA 3OS5A 4YNMA 4C1QA 3M53A 5HQ8A 1H3IA 3M54A 3S7FA 3M56A 3MO0A 5KJNA 3OXGA 4J8OA 3MEKA 3IHXA 4MI5A 1ML9A 4LDGA 1MUFA 3TG4A 5LSZA 3CBPA 3F9XA 3CBMA 5AYFA 4RZ0A 3BO5A 4JLGA 3KMAA 3M5AA 5F59A 2JV0A 4NVQA 2RFIA 3RQ4A 3S8PA 1MVXA 1O9SA 3F9YA 5CPRB 3N71A 3QWPA 3RIBA 3F9WA 5T5GA 3KMJA 4FMUA 4J7FA 5EX0A 3DB5A 5EX3A 1ZKKA 3M55A 4E47A
chains in the Genus database with same CATH topology
4I51A 3QWVA 2BQZA 5HI7A 2QPWA 2W5YA 4YPAA 5T0KA 4QENA 3CBOA 4YNPA 4O30A 3QWWA 1N6CA 5ARFA 5JJ0A 3OOIA 3PDNA 5EG2A 3TG5A 4WUYA 3SW9A 3M59A 3S7DA 5KJMA 2IGQA 5TH7A 3S7BA 3OPEA 4H12A 3M57A 1MT6A 3F9ZA 5F5EA 5KJKA 4J7IA 5CCLA 4IJ8A 4MI0A 3RU0A 3RJWA 5ARGA 4O6FA 2O8JA 5F6LA 3DALA 3RAYA 3VUZA 4YPUA 4J83A 5TEGA 5LSXA 3SWCA 5JHNA 1N6AA 3KMTA 4QEOA 3OXFA 5F6KC 3MO5A 4YPEA 2F69A 4QEPA 4JDSA 1N3JA 3S7JA 4AU7A 5JIYA 3K5KA 5JINA 3HNAA 2G46A 3M58A 4BUPA 2W5ZA 3VV0A 4Z4PA 3MO2A 4YNDA 5TTFA 1PEGA 5T0MA 1XQHA 4NJ5A 3OXLA 2R3AA 3EP0A 5CCMA 5KJLA 4IJDA 1MVHA 3FPDA 3OS5A 4YNMA 4C1QA 3M53A 5HQ8A 1H3IA 3M54A 3S7FA 3M56A 3MO0A 5KJNA 3OXGA 4J8OA 3MEKA 3IHXA 4MI5A 1ML9A 4LDGA 1MUFA 3TG4A 5LSZA 3CBPA 3F9XA 3CBMA 5AYFA 4RZ0A 3BO5A 4JLGA 3KMAA 3M5AA 5F59A 2JV0A 4NVQA 2RFIA 3RQ4A 3S8PA 1MVXA 1O9SA 3F9YA 5CPRB 3N71A 3QWPA 3RIBA 3F9WA 5T5GA 3KMJA 4FMUA 4J7FA 5EX0A 3DB5A 5EX3A 1ZKKA 3M55A 4E47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I51 A;  3QWV A;  2BQZ A;  5HI7 A;  2QPW A;  2W5Y A;  4YPA A;  5T0K A;  4QEN A;  3CBO A;  4YNP A;  4O30 A;  3QWW A;  1N6C A;  5ARF A;  5JJ0 A;  3OOI A;  3PDN A;  5EG2 A;  3TG5 A;  4WUY A;  3SW9 A;  3M59 A;  3S7D A;  5KJM A;  2IGQ A;  5TH7 A;  3S7B A;  3OPE A;  4H12 A;  3M57 A;  1MT6 A;  3F9Z A;  5F5E A;  5KJK A;  4J7I A;  5CCL A;  4IJ8 A;  4MI0 A;  3RU0 A;  3RJW A;  5ARG A;  4O6F A;  2O8J A;  5F6L A;  3DAL A;  3RAY A;  3VUZ A;  4YPU A;  4J83 A;  5TEG A;  5LSX A;  3SWC A;  5JHN A;  1N6A A;  3KMT A;  4QEO A;  3OXF A;  5F6K C;  3MO5 A;  4YPE A;  2F69 A;  4QEP A;  4JDS A;  1N3J A;  3S7J A;  4AU7 A;  5JIY A;  3K5K A;  5JIN A;  3HNA A;  2G46 A;  3M58 A;  4BUP A;  2W5Z A;  3VV0 A;  4Z4P A;  3MO2 A;  4YND A;  5TTF A;  1PEG A;  5T0M A;  1XQH A;  4NJ5 A;  3OXL A;  2R3A A;  3EP0 A;  5CCM A;  5KJL A;  4IJD A;  1MVH A;  3FPD A;  3OS5 A;  4YNM A;  4C1Q A;  3M53 A;  5HQ8 A;  1H3I A;  3M54 A;  3S7F A;  3M56 A;  3MO0 A;  5KJN A;  3OXG A;  4J8O A;  3MEK A;  3IHX A;  4MI5 A;  1ML9 A;  4LDG A;  1MUF A;  3TG4 A;  5LSZ A;  3CBP A;  3F9X A;  3CBM A;  5AYF A;  4RZ0 A;  3BO5 A;  4JLG A;  3KMA A;  3M5A A;  5F59 A;  2JV0 A;  4NVQ A;  2RFI A;  3RQ4 A;  3S8P A;  1MVX A;  1O9S A;  3F9Y A;  5CPR B;  3N71 A;  3QWP A;  3RIB A;  3F9W A;  5T5G A;  3KMJ A;  4FMU A;  4J7F A;  5EX0 A;  3DB5 A;  5EX3 A;  1ZKK A;  3M55 A;  4E47 A; 
#chains in the Genus database with same CATH topology
 4I51 A;  3QWV A;  2BQZ A;  5HI7 A;  2QPW A;  2W5Y A;  4YPA A;  5T0K A;  4QEN A;  3CBO A;  4YNP A;  4O30 A;  3QWW A;  1N6C A;  5ARF A;  5JJ0 A;  3OOI A;  3PDN A;  5EG2 A;  3TG5 A;  4WUY A;  3SW9 A;  3M59 A;  3S7D A;  5KJM A;  2IGQ A;  5TH7 A;  3S7B A;  3OPE A;  4H12 A;  3M57 A;  1MT6 A;  3F9Z A;  5F5E A;  5KJK A;  4J7I A;  5CCL A;  4IJ8 A;  4MI0 A;  3RU0 A;  3RJW A;  5ARG A;  4O6F A;  2O8J A;  5F6L A;  3DAL A;  3RAY A;  3VUZ A;  4YPU A;  4J83 A;  5TEG A;  5LSX A;  3SWC A;  5JHN A;  1N6A A;  3KMT A;  4QEO A;  3OXF A;  5F6K C;  3MO5 A;  4YPE A;  2F69 A;  4QEP A;  4JDS A;  1N3J A;  3S7J A;  4AU7 A;  5JIY A;  3K5K A;  5JIN A;  3HNA A;  2G46 A;  3M58 A;  4BUP A;  2W5Z A;  3VV0 A;  4Z4P A;  3MO2 A;  4YND A;  5TTF A;  1PEG A;  5T0M A;  1XQH A;  4NJ5 A;  3OXL A;  2R3A A;  3EP0 A;  5CCM A;  5KJL A;  4IJD A;  1MVH A;  3FPD A;  3OS5 A;  4YNM A;  4C1Q A;  3M53 A;  5HQ8 A;  1H3I A;  3M54 A;  3S7F A;  3M56 A;  3MO0 A;  5KJN A;  3OXG A;  4J8O A;  3MEK A;  3IHX A;  4MI5 A;  1ML9 A;  4LDG A;  1MUF A;  3TG4 A;  5LSZ A;  3CBP A;  3F9X A;  3CBM A;  5AYF A;  4RZ0 A;  3BO5 A;  4JLG A;  3KMA A;  3M5A A;  5F59 A;  2JV0 A;  4NVQ A;  2RFI A;  3RQ4 A;  3S8P A;  1MVX A;  1O9S A;  3F9Y A;  5CPR B;  3N71 A;  3QWP A;  3RIB A;  3F9W A;  5T5G A;  3KMJ A;  4FMU A;  4J7F A;  5EX0 A;  3DB5 A;  5EX3 A;  1ZKK A;  3M55 A;  4E47 A; 
#chains in the Genus database with same CATH homology
 4I51 A;  3QWV A;  2BQZ A;  5HI7 A;  2QPW A;  2W5Y A;  4YPA A;  5T0K A;  4QEN A;  3CBO A;  4YNP A;  4O30 A;  3QWW A;  1N6C A;  5ARF A;  5JJ0 A;  3OOI A;  3PDN A;  5EG2 A;  3TG5 A;  4WUY A;  3SW9 A;  3M59 A;  3S7D A;  5KJM A;  2IGQ A;  5TH7 A;  3S7B A;  3OPE A;  4H12 A;  3M57 A;  1MT6 A;  3F9Z A;  5F5E A;  5KJK A;  4J7I A;  5CCL A;  4IJ8 A;  4MI0 A;  3RU0 A;  3RJW A;  5ARG A;  4O6F A;  2O8J A;  5F6L A;  3DAL A;  3RAY A;  3VUZ A;  4YPU A;  4J83 A;  5TEG A;  5LSX A;  3SWC A;  5JHN A;  1N6A A;  3KMT A;  4QEO A;  3OXF A;  5F6K C;  3MO5 A;  4YPE A;  2F69 A;  4QEP A;  4JDS A;  1N3J A;  3S7J A;  4AU7 A;  5JIY A;  3K5K A;  5JIN A;  3HNA A;  2G46 A;  3M58 A;  4BUP A;  2W5Z A;  3VV0 A;  4Z4P A;  3MO2 A;  4YND A;  5TTF A;  1PEG A;  5T0M A;  1XQH A;  4NJ5 A;  3OXL A;  2R3A A;  3EP0 A;  5CCM A;  5KJL A;  4IJD A;  1MVH A;  3FPD A;  3OS5 A;  4YNM A;  4C1Q A;  3M53 A;  5HQ8 A;  1H3I A;  3M54 A;  3S7F A;  3M56 A;  3MO0 A;  5KJN A;  3OXG A;  4J8O A;  3MEK A;  3IHX A;  4MI5 A;  1ML9 A;  4LDG A;  1MUF A;  3TG4 A;  5LSZ A;  3CBP A;  3F9X A;  3CBM A;  5AYF A;  4RZ0 A;  3BO5 A;  4JLG A;  3KMA A;  3M5A A;  5F59 A;  2JV0 A;  4NVQ A;  2RFI A;  3RQ4 A;  3S8P A;  1MVX A;  1O9S A;  3F9Y A;  5CPR B;  3N71 A;  3QWP A;  3RIB A;  3F9W A;  5T5G A;  3KMJ A;  4FMU A;  4J7F A;  5EX0 A;  3DB5 A;  5EX3 A;  1ZKK A;  3M55 A;  4E47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...