3MO5A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e72
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
258
structure length
255
Chain Sequence
IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 255
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo5A00
5TH7A 5CPRB 1PEGA 2R3AA 5JJ0A 1ZKKA 3M59A 3RQ4A 3F9WA 3KMTA 1MVHA 1O9SA 4J8OA 1MT6A 4NVQA 5ARGA 3EP0A 1N6AA 3MEKA 5AYFA 3QWPA 2QPWA 5F6KC 3SW9A 4MI5A 5LSXA 5F59A 4J83A 5EG2A 3OOIA 3S7BA 2F69A 4BUPA 3IHXA 3F9YA 3DB5A 3M53A 4NJ5A 3MO5A 3S7JA 3S7FA 4YPUA 3S7DA 5F6LA 4C1QA 2IGQA 3QWWA 3FPDA 3PDNA 2G46A 5LSZA 2W5ZA 3DALA 4LDGA 3OS5A 3OXLA 3OXGA 5KJKA 5KJMA 4IJDA 4O6FA 5CCLA 4MI0A 4YPAA 2JV0A 5ARFA 5HI7A 4QEOA 5EX0A 3M55A 5CCMA 3TG4A 5T0MA 5JINA 1N6CA 3RJWA 1H3IA 3M58A 3MO2A 3RU0A 5HQ8A 4WUYA 5JIYA 2W5YA 4IJ8A 3M54A 3HNAA 1N3JA 2BQZA 4RZ0A 3RAYA 3VV0A 3VUZA 1MVXA 5KJLA 4QEPA 5KJNA 4Z4PA 3KMAA 3SWCA 3K5KA 3CBOA 4YNPA 4YNDA 1MUFA 3RIBA 4FMUA 4I51A 3S8PA 4AU7A 3N71A 4JDSA 5EX3A 2O8JA 3CBMA 3KMJA 3MO0A 4H12A 3BO5A 4J7IA 3CBPA 3TG5A 3F9XA 4O30A 3F9ZA 3OPEA 3M5AA 4JLGA 3QWVA 5F5EA 1XQHA 4QENA 4E47A 1ML9A 3OXFA 3M57A 4YPEA 5JHNA 2RFIA 5T5GA 5T0KA 5TTFA 4J7FA 5TEGA 3M56A 4YNMA
chains in the Genus database with same CATH superfamily
5TH7A 5CPRB 1PEGA 2R3AA 5JJ0A 1ZKKA 3M59A 3RQ4A 3F9WA 3KMTA 1MVHA 1O9SA 4J8OA 1MT6A 4NVQA 5ARGA 3EP0A 1N6AA 3MEKA 5AYFA 3QWPA 2QPWA 5F6KC 3SW9A 4MI5A 5LSXA 5F59A 4J83A 5EG2A 3OOIA 3S7BA 2F69A 4BUPA 3IHXA 3F9YA 3DB5A 3M53A 4NJ5A 3MO5A 3S7JA 3S7FA 4YPUA 3S7DA 5F6LA 4C1QA 2IGQA 3QWWA 3FPDA 3PDNA 2G46A 5LSZA 2W5ZA 3DALA 4LDGA 3OS5A 3OXLA 3OXGA 5KJKA 5KJMA 4IJDA 4O6FA 5CCLA 4MI0A 4YPAA 2JV0A 5ARFA 5HI7A 4QEOA 5EX0A 3M55A 5CCMA 3TG4A 5T0MA 5JINA 1N6CA 3RJWA 1H3IA 3M58A 3MO2A 3RU0A 5HQ8A 4WUYA 5JIYA 2W5YA 4IJ8A 3M54A 3HNAA 1N3JA 2BQZA 4RZ0A 3RAYA 3VV0A 3VUZA 1MVXA 5KJLA 4QEPA 5KJNA 4Z4PA 3KMAA 3SWCA 3K5KA 3CBOA 4YNPA 4YNDA 1MUFA 3RIBA 4FMUA 4I51A 3S8PA 4AU7A 3N71A 4JDSA 5EX3A 2O8JA 3CBMA 3KMJA 3MO0A 4H12A 3BO5A 4J7IA 3CBPA 3TG5A 3F9XA 4O30A 3F9ZA 3OPEA 3M5AA 4JLGA 3QWVA 5F5EA 1XQHA 4QENA 4E47A 1ML9A 3OXFA 3M57A 4YPEA 5JHNA 2RFIA 5T5GA 5T0KA 5TTFA 4J7FA 5TEGA 3M56A 4YNMA
chains in the Genus database with same CATH topology
5TH7A 5CPRB 1PEGA 2R3AA 5JJ0A 1ZKKA 3M59A 3RQ4A 3F9WA 3KMTA 1MVHA 1O9SA 4J8OA 1MT6A 4NVQA 5ARGA 3EP0A 1N6AA 3MEKA 5AYFA 3QWPA 2QPWA 5F6KC 3SW9A 4MI5A 5LSXA 5F59A 4J83A 5EG2A 3OOIA 3S7BA 2F69A 4BUPA 3IHXA 3F9YA 3DB5A 3M53A 4NJ5A 3MO5A 3S7JA 3S7FA 4YPUA 3S7DA 5F6LA 4C1QA 2IGQA 3QWWA 3FPDA 3PDNA 2G46A 5LSZA 2W5ZA 3DALA 4LDGA 3OS5A 3OXLA 3OXGA 5KJKA 5KJMA 4IJDA 4O6FA 5CCLA 4MI0A 4YPAA 2JV0A 5ARFA 5HI7A 4QEOA 5EX0A 3M55A 5CCMA 3TG4A 5T0MA 5JINA 1N6CA 3RJWA 1H3IA 3M58A 3MO2A 3RU0A 5HQ8A 4WUYA 5JIYA 2W5YA 4IJ8A 3M54A 3HNAA 1N3JA 2BQZA 4RZ0A 3RAYA 3VV0A 3VUZA 1MVXA 5KJLA 4QEPA 5KJNA 4Z4PA 3KMAA 3SWCA 3K5KA 3CBOA 4YNPA 4YNDA 1MUFA 3RIBA 4FMUA 4I51A 3S8PA 4AU7A 3N71A 4JDSA 5EX3A 2O8JA 3CBMA 3KMJA 3MO0A 4H12A 3BO5A 4J7IA 3CBPA 3TG5A 3F9XA 4O30A 3F9ZA 3OPEA 3M5AA 4JLGA 3QWVA 5F5EA 1XQHA 4QENA 4E47A 1ML9A 3OXFA 3M57A 4YPEA 5JHNA 2RFIA 5T5GA 5T0KA 5TTFA 4J7FA 5TEGA 3M56A 4YNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TH7 A;  5CPR B;  1PEG A;  2R3A A;  5JJ0 A;  1ZKK A;  3M59 A;  3RQ4 A;  3F9W A;  3KMT A;  1MVH A;  1O9S A;  4J8O A;  1MT6 A;  4NVQ A;  5ARG A;  3EP0 A;  1N6A A;  3MEK A;  5AYF A;  3QWP A;  2QPW A;  5F6K C;  3SW9 A;  4MI5 A;  5LSX A;  5F59 A;  4J83 A;  5EG2 A;  3OOI A;  3S7B A;  2F69 A;  4BUP A;  3IHX A;  3F9Y A;  3DB5 A;  3M53 A;  4NJ5 A;  3MO5 A;  3S7J A;  3S7F A;  4YPU A;  3S7D A;  5F6L A;  4C1Q A;  2IGQ A;  3QWW A;  3FPD A;  3PDN A;  2G46 A;  5LSZ A;  2W5Z A;  3DAL A;  4LDG A;  3OS5 A;  3OXL A;  3OXG A;  5KJK A;  5KJM A;  4IJD A;  4O6F A;  5CCL A;  4MI0 A;  4YPA A;  2JV0 A;  5ARF A;  5HI7 A;  4QEO A;  5EX0 A;  3M55 A;  5CCM A;  3TG4 A;  5T0M A;  5JIN A;  1N6C A;  3RJW A;  1H3I A;  3M58 A;  3MO2 A;  3RU0 A;  5HQ8 A;  4WUY A;  5JIY A;  2W5Y A;  4IJ8 A;  3M54 A;  3HNA A;  1N3J A;  2BQZ A;  4RZ0 A;  3RAY A;  3VV0 A;  3VUZ A;  1MVX A;  5KJL A;  4QEP A;  5KJN A;  4Z4P A;  3KMA A;  3SWC A;  3K5K A;  3CBO A;  4YNP A;  4YND A;  1MUF A;  3RIB A;  4FMU A;  4I51 A;  3S8P A;  4AU7 A;  3N71 A;  4JDS A;  5EX3 A;  2O8J A;  3CBM A;  3KMJ A;  3MO0 A;  4H12 A;  3BO5 A;  4J7I A;  3CBP A;  3TG5 A;  3F9X A;  4O30 A;  3F9Z A;  3OPE A;  3M5A A;  4JLG A;  3QWV A;  5F5E A;  1XQH A;  4QEN A;  4E47 A;  1ML9 A;  3OXF A;  3M57 A;  4YPE A;  5JHN A;  2RFI A;  5T5G A;  5T0K A;  5TTF A;  4J7F A;  5TEG A;  3M56 A;  4YNM A; 
#chains in the Genus database with same CATH topology
 5TH7 A;  5CPR B;  1PEG A;  2R3A A;  5JJ0 A;  1ZKK A;  3M59 A;  3RQ4 A;  3F9W A;  3KMT A;  1MVH A;  1O9S A;  4J8O A;  1MT6 A;  4NVQ A;  5ARG A;  3EP0 A;  1N6A A;  3MEK A;  5AYF A;  3QWP A;  2QPW A;  5F6K C;  3SW9 A;  4MI5 A;  5LSX A;  5F59 A;  4J83 A;  5EG2 A;  3OOI A;  3S7B A;  2F69 A;  4BUP A;  3IHX A;  3F9Y A;  3DB5 A;  3M53 A;  4NJ5 A;  3MO5 A;  3S7J A;  3S7F A;  4YPU A;  3S7D A;  5F6L A;  4C1Q A;  2IGQ A;  3QWW A;  3FPD A;  3PDN A;  2G46 A;  5LSZ A;  2W5Z A;  3DAL A;  4LDG A;  3OS5 A;  3OXL A;  3OXG A;  5KJK A;  5KJM A;  4IJD A;  4O6F A;  5CCL A;  4MI0 A;  4YPA A;  2JV0 A;  5ARF A;  5HI7 A;  4QEO A;  5EX0 A;  3M55 A;  5CCM A;  3TG4 A;  5T0M A;  5JIN A;  1N6C A;  3RJW A;  1H3I A;  3M58 A;  3MO2 A;  3RU0 A;  5HQ8 A;  4WUY A;  5JIY A;  2W5Y A;  4IJ8 A;  3M54 A;  3HNA A;  1N3J A;  2BQZ A;  4RZ0 A;  3RAY A;  3VV0 A;  3VUZ A;  1MVX A;  5KJL A;  4QEP A;  5KJN A;  4Z4P A;  3KMA A;  3SWC A;  3K5K A;  3CBO A;  4YNP A;  4YND A;  1MUF A;  3RIB A;  4FMU A;  4I51 A;  3S8P A;  4AU7 A;  3N71 A;  4JDS A;  5EX3 A;  2O8J A;  3CBM A;  3KMJ A;  3MO0 A;  4H12 A;  3BO5 A;  4J7I A;  3CBP A;  3TG5 A;  3F9X A;  4O30 A;  3F9Z A;  3OPE A;  3M5A A;  4JLG A;  3QWV A;  5F5E A;  1XQH A;  4QEN A;  4E47 A;  1ML9 A;  3OXF A;  3M57 A;  4YPE A;  5JHN A;  2RFI A;  5T5G A;  5T0K A;  5TTF A;  4J7F A;  5TEG A;  3M56 A;  4YNM A; 
#chains in the Genus database with same CATH homology
 5TH7 A;  5CPR B;  1PEG A;  2R3A A;  5JJ0 A;  1ZKK A;  3M59 A;  3RQ4 A;  3F9W A;  3KMT A;  1MVH A;  1O9S A;  4J8O A;  1MT6 A;  4NVQ A;  5ARG A;  3EP0 A;  1N6A A;  3MEK A;  5AYF A;  3QWP A;  2QPW A;  5F6K C;  3SW9 A;  4MI5 A;  5LSX A;  5F59 A;  4J83 A;  5EG2 A;  3OOI A;  3S7B A;  2F69 A;  4BUP A;  3IHX A;  3F9Y A;  3DB5 A;  3M53 A;  4NJ5 A;  3MO5 A;  3S7J A;  3S7F A;  4YPU A;  3S7D A;  5F6L A;  4C1Q A;  2IGQ A;  3QWW A;  3FPD A;  3PDN A;  2G46 A;  5LSZ A;  2W5Z A;  3DAL A;  4LDG A;  3OS5 A;  3OXL A;  3OXG A;  5KJK A;  5KJM A;  4IJD A;  4O6F A;  5CCL A;  4MI0 A;  4YPA A;  2JV0 A;  5ARF A;  5HI7 A;  4QEO A;  5EX0 A;  3M55 A;  5CCM A;  3TG4 A;  5T0M A;  5JIN A;  1N6C A;  3RJW A;  1H3I A;  3M58 A;  3MO2 A;  3RU0 A;  5HQ8 A;  4WUY A;  5JIY A;  2W5Y A;  4IJ8 A;  3M54 A;  3HNA A;  1N3J A;  2BQZ A;  4RZ0 A;  3RAY A;  3VV0 A;  3VUZ A;  1MVX A;  5KJL A;  4QEP A;  5KJN A;  4Z4P A;  3KMA A;  3SWC A;  3K5K A;  3CBO A;  4YNP A;  4YND A;  1MUF A;  3RIB A;  4FMU A;  4I51 A;  3S8P A;  4AU7 A;  3N71 A;  4JDS A;  5EX3 A;  2O8J A;  3CBM A;  3KMJ A;  3MO0 A;  4H12 A;  3BO5 A;  4J7I A;  3CBP A;  3TG5 A;  3F9X A;  4O30 A;  3F9Z A;  3OPE A;  3M5A A;  4JLG A;  3QWV A;  5F5E A;  1XQH A;  4QEN A;  4E47 A;  1ML9 A;  3OXF A;  3M57 A;  4YPE A;  5JHN A;  2RFI A;  5T5G A;  5T0K A;  5TTF A;  4J7F A;  5TEG A;  3M56 A;  4YNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...