3RAYA

Crystal structure of methyltransferase domain of human pr domain-containing protein 11
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
159
Chain Sequence
DFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQFFSWLIVDKNNRYKSIDGSDETKANWMRYVVISREEREQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Methyltransferase domain of human PR domain-containing protein 11
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PR domain-containing protein 11
total genus 42
structure length 159
sequence length 164
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3rayA00
1XQHA 3CBMA 3CBOA 5EX0A 4E47A 3OS5A 5HI7A 4YNMA 4YPUA 4QEPA 5KJNA 5F59A 4NVQA 2QPWA 3TG5A 5KJKA 3MO2A 1N6CA 4Z4PA 4QEOA 5ARFA 3QWVA 5ARGA 5T0KA 3OOIA 3DALA 3M58A 3VV0A 5HQ8A 4J7IA 4I51A 4JLGA 2O8JA 1MUFA 3S7FA 4MI0A 5LSXA 3OPEA 3QWPA 5CCLA 3RU0A 4O6FA 5JINA 3SW9A 2R3AA 1MVHA 3F9WA 3EP0A 3OXGA 4H12A 4J7FA 4MI5A 3FPDA 1MT6A 3K5KA 5EX3A 3CBPA 4YPEA 5F5EA 4FMUA 4YPAA 5KJMA 3M55A 3F9ZA 1MVXA 1PEGA 3PDNA 4YNPA 4RZ0A 3TG4A 4JDSA 5T5GA 3DB5A 3RAYA 4J8OA 3S8PA 2F69A 5KJLA 3M54A 3IHXA 1O9SA 5JIYA 1ZKKA 5TH7A 2BQZA 5CPRB 2W5YA 3VUZA 4AU7A 5JHNA 5AYFA 2JV0A 3M57A 4BUPA 3F9YA 1N3JA 4IJ8A 3KMTA 4WUYA 3RQ4A 4YNDA 4C1QA 5JJ0A 3RIBA 2W5ZA 3KMJA 4IJDA 3MO0A 3M53A 2IGQA 3OXFA 1H3IA 3QWWA 1ML9A 5F6LA 5LSZA 1N6AA 3SWCA 5F6KC 4QENA 2RFIA 3M56A 4O30A 4J83A 3S7JA 4NJ5A 4LDGA 5CCMA 5TTFA 3F9XA 3RJWA 3OXLA 5EG2A 2G46A 3HNAA 3MEKA 3S7DA 3M5AA 5TEGA 5T0MA 3M59A 3S7BA 3BO5A 3N71A 3MO5A 3KMAA
chains in the Genus database with same CATH superfamily
1XQHA 3CBMA 3CBOA 5EX0A 4E47A 3OS5A 5HI7A 4YNMA 4YPUA 4QEPA 5KJNA 5F59A 4NVQA 2QPWA 3TG5A 5KJKA 3MO2A 1N6CA 4Z4PA 4QEOA 5ARFA 3QWVA 5ARGA 5T0KA 3OOIA 3DALA 3M58A 3VV0A 5HQ8A 4J7IA 4I51A 4JLGA 2O8JA 1MUFA 3S7FA 4MI0A 5LSXA 3OPEA 3QWPA 5CCLA 3RU0A 4O6FA 5JINA 3SW9A 2R3AA 1MVHA 3F9WA 3EP0A 3OXGA 4H12A 4J7FA 4MI5A 3FPDA 1MT6A 3K5KA 5EX3A 3CBPA 4YPEA 5F5EA 4FMUA 4YPAA 5KJMA 3M55A 3F9ZA 1MVXA 1PEGA 3PDNA 4YNPA 4RZ0A 3TG4A 4JDSA 5T5GA 3DB5A 3RAYA 4J8OA 3S8PA 2F69A 5KJLA 3M54A 3IHXA 1O9SA 5JIYA 1ZKKA 5TH7A 2BQZA 5CPRB 2W5YA 3VUZA 4AU7A 5JHNA 5AYFA 2JV0A 3M57A 4BUPA 3F9YA 1N3JA 4IJ8A 3KMTA 4WUYA 3RQ4A 4YNDA 4C1QA 5JJ0A 3RIBA 2W5ZA 3KMJA 4IJDA 3MO0A 3M53A 2IGQA 3OXFA 1H3IA 3QWWA 1ML9A 5F6LA 5LSZA 1N6AA 3SWCA 5F6KC 4QENA 2RFIA 3M56A 4O30A 4J83A 3S7JA 4NJ5A 4LDGA 5CCMA 5TTFA 3F9XA 3RJWA 3OXLA 5EG2A 2G46A 3HNAA 3MEKA 3S7DA 3M5AA 5TEGA 5T0MA 3M59A 3S7BA 3BO5A 3N71A 3MO5A 3KMAA
chains in the Genus database with same CATH topology
1XQHA 3CBMA 3CBOA 5EX0A 4E47A 3OS5A 5HI7A 4YNMA 4YPUA 4QEPA 5KJNA 5F59A 4NVQA 2QPWA 3TG5A 5KJKA 3MO2A 1N6CA 4Z4PA 4QEOA 5ARFA 3QWVA 5ARGA 5T0KA 3OOIA 3DALA 3M58A 3VV0A 5HQ8A 4J7IA 4I51A 4JLGA 2O8JA 1MUFA 3S7FA 4MI0A 5LSXA 3OPEA 3QWPA 5CCLA 3RU0A 4O6FA 5JINA 3SW9A 2R3AA 1MVHA 3F9WA 3EP0A 3OXGA 4H12A 4J7FA 4MI5A 3FPDA 1MT6A 3K5KA 5EX3A 3CBPA 4YPEA 5F5EA 4FMUA 4YPAA 5KJMA 3M55A 3F9ZA 1MVXA 1PEGA 3PDNA 4YNPA 4RZ0A 3TG4A 4JDSA 5T5GA 3DB5A 3RAYA 4J8OA 3S8PA 2F69A 5KJLA 3M54A 3IHXA 1O9SA 5JIYA 1ZKKA 5TH7A 2BQZA 5CPRB 2W5YA 3VUZA 4AU7A 5JHNA 5AYFA 2JV0A 3M57A 4BUPA 3F9YA 1N3JA 4IJ8A 3KMTA 4WUYA 3RQ4A 4YNDA 4C1QA 5JJ0A 3RIBA 2W5ZA 3KMJA 4IJDA 3MO0A 3M53A 2IGQA 3OXFA 1H3IA 3QWWA 1ML9A 5F6LA 5LSZA 1N6AA 3SWCA 5F6KC 4QENA 2RFIA 3M56A 4O30A 4J83A 3S7JA 4NJ5A 4LDGA 5CCMA 5TTFA 3F9XA 3RJWA 3OXLA 5EG2A 2G46A 3HNAA 3MEKA 3S7DA 3M5AA 5TEGA 5T0MA 3M59A 3S7BA 3BO5A 3N71A 3MO5A 3KMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQH A;  3CBM A;  3CBO A;  5EX0 A;  4E47 A;  3OS5 A;  5HI7 A;  4YNM A;  4YPU A;  4QEP A;  5KJN A;  5F59 A;  4NVQ A;  2QPW A;  3TG5 A;  5KJK A;  3MO2 A;  1N6C A;  4Z4P A;  4QEO A;  5ARF A;  3QWV A;  5ARG A;  5T0K A;  3OOI A;  3DAL A;  3M58 A;  3VV0 A;  5HQ8 A;  4J7I A;  4I51 A;  4JLG A;  2O8J A;  1MUF A;  3S7F A;  4MI0 A;  5LSX A;  3OPE A;  3QWP A;  5CCL A;  3RU0 A;  4O6F A;  5JIN A;  3SW9 A;  2R3A A;  1MVH A;  3F9W A;  3EP0 A;  3OXG A;  4H12 A;  4J7F A;  4MI5 A;  3FPD A;  1MT6 A;  3K5K A;  5EX3 A;  3CBP A;  4YPE A;  5F5E A;  4FMU A;  4YPA A;  5KJM A;  3M55 A;  3F9Z A;  1MVX A;  1PEG A;  3PDN A;  4YNP A;  4RZ0 A;  3TG4 A;  4JDS A;  5T5G A;  3DB5 A;  3RAY A;  4J8O A;  3S8P A;  2F69 A;  5KJL A;  3M54 A;  3IHX A;  1O9S A;  5JIY A;  1ZKK A;  5TH7 A;  2BQZ A;  5CPR B;  2W5Y A;  3VUZ A;  4AU7 A;  5JHN A;  5AYF A;  2JV0 A;  3M57 A;  4BUP A;  3F9Y A;  1N3J A;  4IJ8 A;  3KMT A;  4WUY A;  3RQ4 A;  4YND A;  4C1Q A;  5JJ0 A;  3RIB A;  2W5Z A;  3KMJ A;  4IJD A;  3MO0 A;  3M53 A;  2IGQ A;  3OXF A;  1H3I A;  3QWW A;  1ML9 A;  5F6L A;  5LSZ A;  1N6A A;  3SWC A;  5F6K C;  4QEN A;  2RFI A;  3M56 A;  4O30 A;  4J83 A;  3S7J A;  4NJ5 A;  4LDG A;  5CCM A;  5TTF A;  3F9X A;  3RJW A;  3OXL A;  5EG2 A;  2G46 A;  3HNA A;  3MEK A;  3S7D A;  3M5A A;  5TEG A;  5T0M A;  3M59 A;  3S7B A;  3BO5 A;  3N71 A;  3MO5 A;  3KMA A; 
#chains in the Genus database with same CATH topology
 1XQH A;  3CBM A;  3CBO A;  5EX0 A;  4E47 A;  3OS5 A;  5HI7 A;  4YNM A;  4YPU A;  4QEP A;  5KJN A;  5F59 A;  4NVQ A;  2QPW A;  3TG5 A;  5KJK A;  3MO2 A;  1N6C A;  4Z4P A;  4QEO A;  5ARF A;  3QWV A;  5ARG A;  5T0K A;  3OOI A;  3DAL A;  3M58 A;  3VV0 A;  5HQ8 A;  4J7I A;  4I51 A;  4JLG A;  2O8J A;  1MUF A;  3S7F A;  4MI0 A;  5LSX A;  3OPE A;  3QWP A;  5CCL A;  3RU0 A;  4O6F A;  5JIN A;  3SW9 A;  2R3A A;  1MVH A;  3F9W A;  3EP0 A;  3OXG A;  4H12 A;  4J7F A;  4MI5 A;  3FPD A;  1MT6 A;  3K5K A;  5EX3 A;  3CBP A;  4YPE A;  5F5E A;  4FMU A;  4YPA A;  5KJM A;  3M55 A;  3F9Z A;  1MVX A;  1PEG A;  3PDN A;  4YNP A;  4RZ0 A;  3TG4 A;  4JDS A;  5T5G A;  3DB5 A;  3RAY A;  4J8O A;  3S8P A;  2F69 A;  5KJL A;  3M54 A;  3IHX A;  1O9S A;  5JIY A;  1ZKK A;  5TH7 A;  2BQZ A;  5CPR B;  2W5Y A;  3VUZ A;  4AU7 A;  5JHN A;  5AYF A;  2JV0 A;  3M57 A;  4BUP A;  3F9Y A;  1N3J A;  4IJ8 A;  3KMT A;  4WUY A;  3RQ4 A;  4YND A;  4C1Q A;  5JJ0 A;  3RIB A;  2W5Z A;  3KMJ A;  4IJD A;  3MO0 A;  3M53 A;  2IGQ A;  3OXF A;  1H3I A;  3QWW A;  1ML9 A;  5F6L A;  5LSZ A;  1N6A A;  3SWC A;  5F6K C;  4QEN A;  2RFI A;  3M56 A;  4O30 A;  4J83 A;  3S7J A;  4NJ5 A;  4LDG A;  5CCM A;  5TTF A;  3F9X A;  3RJW A;  3OXL A;  5EG2 A;  2G46 A;  3HNA A;  3MEK A;  3S7D A;  3M5A A;  5TEG A;  5T0M A;  3M59 A;  3S7B A;  3BO5 A;  3N71 A;  3MO5 A;  3KMA A; 
#chains in the Genus database with same CATH homology
 1XQH A;  3CBM A;  3CBO A;  5EX0 A;  4E47 A;  3OS5 A;  5HI7 A;  4YNM A;  4YPU A;  4QEP A;  5KJN A;  5F59 A;  4NVQ A;  2QPW A;  3TG5 A;  5KJK A;  3MO2 A;  1N6C A;  4Z4P A;  4QEO A;  5ARF A;  3QWV A;  5ARG A;  5T0K A;  3OOI A;  3DAL A;  3M58 A;  3VV0 A;  5HQ8 A;  4J7I A;  4I51 A;  4JLG A;  2O8J A;  1MUF A;  3S7F A;  4MI0 A;  5LSX A;  3OPE A;  3QWP A;  5CCL A;  3RU0 A;  4O6F A;  5JIN A;  3SW9 A;  2R3A A;  1MVH A;  3F9W A;  3EP0 A;  3OXG A;  4H12 A;  4J7F A;  4MI5 A;  3FPD A;  1MT6 A;  3K5K A;  5EX3 A;  3CBP A;  4YPE A;  5F5E A;  4FMU A;  4YPA A;  5KJM A;  3M55 A;  3F9Z A;  1MVX A;  1PEG A;  3PDN A;  4YNP A;  4RZ0 A;  3TG4 A;  4JDS A;  5T5G A;  3DB5 A;  3RAY A;  4J8O A;  3S8P A;  2F69 A;  5KJL A;  3M54 A;  3IHX A;  1O9S A;  5JIY A;  1ZKK A;  5TH7 A;  2BQZ A;  5CPR B;  2W5Y A;  3VUZ A;  4AU7 A;  5JHN A;  5AYF A;  2JV0 A;  3M57 A;  4BUP A;  3F9Y A;  1N3J A;  4IJ8 A;  3KMT A;  4WUY A;  3RQ4 A;  4YND A;  4C1Q A;  5JJ0 A;  3RIB A;  2W5Z A;  3KMJ A;  4IJD A;  3MO0 A;  3M53 A;  2IGQ A;  3OXF A;  1H3I A;  3QWW A;  1ML9 A;  5F6L A;  5LSZ A;  1N6A A;  3SWC A;  5F6K C;  4QEN A;  2RFI A;  3M56 A;  4O30 A;  4J83 A;  3S7J A;  4NJ5 A;  4LDG A;  5CCM A;  5TTF A;  3F9X A;  3RJW A;  3OXL A;  5EG2 A;  2G46 A;  3HNA A;  3MEK A;  3S7D A;  3M5A A;  5TEG A;  5T0M A;  3M59 A;  3S7B A;  3BO5 A;  3N71 A;  3MO5 A;  3KMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...