3RAYA

Crystal structure of methyltransferase domain of human pr domain-containing protein 11
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
159
Chain Sequence
DFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQFFSWLIVDKNNRYKSIDGSDETKANWMRYVVISREEREQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain-containing protein 11
publication title Crystal structure of Methyltransferase domain of human PR domain-containing protein 11
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 159
sequence length 164
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3rayA00
3VUZA 5JIYA 5HI7A 3OXGA 3K5KA 3CBPA 5HQ8A 1O9SA 3HNAA 5T0KA 4QEOA 1XQHA 3OS5A 4YPEA 3F9ZA 3MO0A 1MVHA 4YNDA 4IJ8A 1MUFA 4H12A 5KJNA 3BO5A 4JDSA 5ARFA 4FMUA 4YPUA 1ZKKA 1N3JA 3RQ4A 4MI0A 5EX0A 3F9XA 3M58A 1MT6A 5T5GA 4BUPA 3SW9A 5F6LA 3SWCA 3M57A 5KJLA 2W5YA 3M55A 5LSXA 1MVXA 3S7JA 2O8JA 3TG4A 3DALA 3PDNA 3M5AA 4QEPA 1N6AA 2IGQA 2RFIA 3N71A 3OOIA 4J7FA 5AYFA 3S7FA 3RU0A 3CBMA 3FPDA 3QWWA 3S7DA 2QPWA 4J7IA 3TG5A 5JINA 4IJDA 4QENA 1ML9A 3M53A 3MEKA 5CPRB 5EG2A 4I51A 3S8PA 2G46A 3OXLA 3OXFA 4NVQA 5T0MA 5JJ0A 1N6CA 3M54A 1PEGA 4O6FA 4WUYA 3M56A 4NJ5A 4YPAA 5CCLA 3QWPA 5ARGA 2JV0A 5KJMA 4C1QA 3KMJA 3RJWA 5F5EA 4JLGA 3MO2A 2BQZA 3MO5A 4RZ0A 5EX3A 3OPEA 4AU7A 4YNPA 3F9WA 2F69A 4J8OA 4J83A 3RAYA 3KMAA 5LSZA 5F59A 3EP0A 3QWVA 5TEGA 3RIBA 2R3AA 4YNMA 3VV0A 5JHNA 4E47A 1H3IA 5CCMA 5TH7A 2W5ZA 3IHXA 4LDGA 3DB5A 4O30A 4Z4PA 3KMTA 5TTFA 3M59A 4MI5A 3S7BA 5F6KC 3CBOA 3F9YA 5KJKA
chains in the Genus database with same CATH superfamily
3VUZA 5JIYA 5HI7A 3OXGA 3K5KA 3CBPA 5HQ8A 1O9SA 3HNAA 5T0KA 4QEOA 1XQHA 3OS5A 4YPEA 3F9ZA 3MO0A 1MVHA 4YNDA 4IJ8A 1MUFA 4H12A 5KJNA 3BO5A 4JDSA 5ARFA 4FMUA 4YPUA 1ZKKA 1N3JA 3RQ4A 4MI0A 5EX0A 3F9XA 3M58A 1MT6A 5T5GA 4BUPA 3SW9A 5F6LA 3SWCA 3M57A 5KJLA 2W5YA 3M55A 5LSXA 1MVXA 3S7JA 2O8JA 3TG4A 3DALA 3PDNA 3M5AA 4QEPA 1N6AA 2IGQA 2RFIA 3N71A 3OOIA 4J7FA 5AYFA 3S7FA 3RU0A 3CBMA 3FPDA 3QWWA 3S7DA 2QPWA 4J7IA 3TG5A 5JINA 4IJDA 4QENA 1ML9A 3M53A 3MEKA 5CPRB 5EG2A 4I51A 3S8PA 2G46A 3OXLA 3OXFA 4NVQA 5T0MA 5JJ0A 1N6CA 3M54A 1PEGA 4O6FA 4WUYA 3M56A 4NJ5A 4YPAA 5CCLA 3QWPA 5ARGA 2JV0A 5KJMA 4C1QA 3KMJA 3RJWA 5F5EA 4JLGA 3MO2A 2BQZA 3MO5A 4RZ0A 5EX3A 3OPEA 4AU7A 4YNPA 3F9WA 2F69A 4J8OA 4J83A 3RAYA 3KMAA 5LSZA 5F59A 3EP0A 3QWVA 5TEGA 3RIBA 2R3AA 4YNMA 3VV0A 5JHNA 4E47A 1H3IA 5CCMA 5TH7A 2W5ZA 3IHXA 4LDGA 3DB5A 4O30A 4Z4PA 3KMTA 5TTFA 3M59A 4MI5A 3S7BA 5F6KC 3CBOA 3F9YA 5KJKA
chains in the Genus database with same CATH topology
3VUZA 5JIYA 5HI7A 3OXGA 3K5KA 3CBPA 5HQ8A 1O9SA 3HNAA 5T0KA 4QEOA 1XQHA 3OS5A 4YPEA 3F9ZA 3MO0A 1MVHA 4YNDA 4IJ8A 1MUFA 4H12A 5KJNA 3BO5A 4JDSA 5ARFA 4FMUA 4YPUA 1ZKKA 1N3JA 3RQ4A 4MI0A 5EX0A 3F9XA 3M58A 1MT6A 5T5GA 4BUPA 3SW9A 5F6LA 3SWCA 3M57A 5KJLA 2W5YA 3M55A 5LSXA 1MVXA 3S7JA 2O8JA 3TG4A 3DALA 3PDNA 3M5AA 4QEPA 1N6AA 2IGQA 2RFIA 3N71A 3OOIA 4J7FA 5AYFA 3S7FA 3RU0A 3CBMA 3FPDA 3QWWA 3S7DA 2QPWA 4J7IA 3TG5A 5JINA 4IJDA 4QENA 1ML9A 3M53A 3MEKA 5CPRB 5EG2A 4I51A 3S8PA 2G46A 3OXLA 3OXFA 4NVQA 5T0MA 5JJ0A 1N6CA 3M54A 1PEGA 4O6FA 4WUYA 3M56A 4NJ5A 4YPAA 5CCLA 3QWPA 5ARGA 2JV0A 5KJMA 4C1QA 3KMJA 3RJWA 5F5EA 4JLGA 3MO2A 2BQZA 3MO5A 4RZ0A 5EX3A 3OPEA 4AU7A 4YNPA 3F9WA 2F69A 4J8OA 4J83A 3RAYA 3KMAA 5LSZA 5F59A 3EP0A 3QWVA 5TEGA 3RIBA 2R3AA 4YNMA 3VV0A 5JHNA 4E47A 1H3IA 5CCMA 5TH7A 2W5ZA 3IHXA 4LDGA 3DB5A 4O30A 4Z4PA 3KMTA 5TTFA 3M59A 4MI5A 3S7BA 5F6KC 3CBOA 3F9YA 5KJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUZ A;  5JIY A;  5HI7 A;  3OXG A;  3K5K A;  3CBP A;  5HQ8 A;  1O9S A;  3HNA A;  5T0K A;  4QEO A;  1XQH A;  3OS5 A;  4YPE A;  3F9Z A;  3MO0 A;  1MVH A;  4YND A;  4IJ8 A;  1MUF A;  4H12 A;  5KJN A;  3BO5 A;  4JDS A;  5ARF A;  4FMU A;  4YPU A;  1ZKK A;  1N3J A;  3RQ4 A;  4MI0 A;  5EX0 A;  3F9X A;  3M58 A;  1MT6 A;  5T5G A;  4BUP A;  3SW9 A;  5F6L A;  3SWC A;  3M57 A;  5KJL A;  2W5Y A;  3M55 A;  5LSX A;  1MVX A;  3S7J A;  2O8J A;  3TG4 A;  3DAL A;  3PDN A;  3M5A A;  4QEP A;  1N6A A;  2IGQ A;  2RFI A;  3N71 A;  3OOI A;  4J7F A;  5AYF A;  3S7F A;  3RU0 A;  3CBM A;  3FPD A;  3QWW A;  3S7D A;  2QPW A;  4J7I A;  3TG5 A;  5JIN A;  4IJD A;  4QEN A;  1ML9 A;  3M53 A;  3MEK A;  5CPR B;  5EG2 A;  4I51 A;  3S8P A;  2G46 A;  3OXL A;  3OXF A;  4NVQ A;  5T0M A;  5JJ0 A;  1N6C A;  3M54 A;  1PEG A;  4O6F A;  4WUY A;  3M56 A;  4NJ5 A;  4YPA A;  5CCL A;  3QWP A;  5ARG A;  2JV0 A;  5KJM A;  4C1Q A;  3KMJ A;  3RJW A;  5F5E A;  4JLG A;  3MO2 A;  2BQZ A;  3MO5 A;  4RZ0 A;  5EX3 A;  3OPE A;  4AU7 A;  4YNP A;  3F9W A;  2F69 A;  4J8O A;  4J83 A;  3RAY A;  3KMA A;  5LSZ A;  5F59 A;  3EP0 A;  3QWV A;  5TEG A;  3RIB A;  2R3A A;  4YNM A;  3VV0 A;  5JHN A;  4E47 A;  1H3I A;  5CCM A;  5TH7 A;  2W5Z A;  3IHX A;  4LDG A;  3DB5 A;  4O30 A;  4Z4P A;  3KMT A;  5TTF A;  3M59 A;  4MI5 A;  3S7B A;  5F6K C;  3CBO A;  3F9Y A;  5KJK A; 
#chains in the Genus database with same CATH topology
 3VUZ A;  5JIY A;  5HI7 A;  3OXG A;  3K5K A;  3CBP A;  5HQ8 A;  1O9S A;  3HNA A;  5T0K A;  4QEO A;  1XQH A;  3OS5 A;  4YPE A;  3F9Z A;  3MO0 A;  1MVH A;  4YND A;  4IJ8 A;  1MUF A;  4H12 A;  5KJN A;  3BO5 A;  4JDS A;  5ARF A;  4FMU A;  4YPU A;  1ZKK A;  1N3J A;  3RQ4 A;  4MI0 A;  5EX0 A;  3F9X A;  3M58 A;  1MT6 A;  5T5G A;  4BUP A;  3SW9 A;  5F6L A;  3SWC A;  3M57 A;  5KJL A;  2W5Y A;  3M55 A;  5LSX A;  1MVX A;  3S7J A;  2O8J A;  3TG4 A;  3DAL A;  3PDN A;  3M5A A;  4QEP A;  1N6A A;  2IGQ A;  2RFI A;  3N71 A;  3OOI A;  4J7F A;  5AYF A;  3S7F A;  3RU0 A;  3CBM A;  3FPD A;  3QWW A;  3S7D A;  2QPW A;  4J7I A;  3TG5 A;  5JIN A;  4IJD A;  4QEN A;  1ML9 A;  3M53 A;  3MEK A;  5CPR B;  5EG2 A;  4I51 A;  3S8P A;  2G46 A;  3OXL A;  3OXF A;  4NVQ A;  5T0M A;  5JJ0 A;  1N6C A;  3M54 A;  1PEG A;  4O6F A;  4WUY A;  3M56 A;  4NJ5 A;  4YPA A;  5CCL A;  3QWP A;  5ARG A;  2JV0 A;  5KJM A;  4C1Q A;  3KMJ A;  3RJW A;  5F5E A;  4JLG A;  3MO2 A;  2BQZ A;  3MO5 A;  4RZ0 A;  5EX3 A;  3OPE A;  4AU7 A;  4YNP A;  3F9W A;  2F69 A;  4J8O A;  4J83 A;  3RAY A;  3KMA A;  5LSZ A;  5F59 A;  3EP0 A;  3QWV A;  5TEG A;  3RIB A;  2R3A A;  4YNM A;  3VV0 A;  5JHN A;  4E47 A;  1H3I A;  5CCM A;  5TH7 A;  2W5Z A;  3IHX A;  4LDG A;  3DB5 A;  4O30 A;  4Z4P A;  3KMT A;  5TTF A;  3M59 A;  4MI5 A;  3S7B A;  5F6K C;  3CBO A;  3F9Y A;  5KJK A; 
#chains in the Genus database with same CATH homology
 3VUZ A;  5JIY A;  5HI7 A;  3OXG A;  3K5K A;  3CBP A;  5HQ8 A;  1O9S A;  3HNA A;  5T0K A;  4QEO A;  1XQH A;  3OS5 A;  4YPE A;  3F9Z A;  3MO0 A;  1MVH A;  4YND A;  4IJ8 A;  1MUF A;  4H12 A;  5KJN A;  3BO5 A;  4JDS A;  5ARF A;  4FMU A;  4YPU A;  1ZKK A;  1N3J A;  3RQ4 A;  4MI0 A;  5EX0 A;  3F9X A;  3M58 A;  1MT6 A;  5T5G A;  4BUP A;  3SW9 A;  5F6L A;  3SWC A;  3M57 A;  5KJL A;  2W5Y A;  3M55 A;  5LSX A;  1MVX A;  3S7J A;  2O8J A;  3TG4 A;  3DAL A;  3PDN A;  3M5A A;  4QEP A;  1N6A A;  2IGQ A;  2RFI A;  3N71 A;  3OOI A;  4J7F A;  5AYF A;  3S7F A;  3RU0 A;  3CBM A;  3FPD A;  3QWW A;  3S7D A;  2QPW A;  4J7I A;  3TG5 A;  5JIN A;  4IJD A;  4QEN A;  1ML9 A;  3M53 A;  3MEK A;  5CPR B;  5EG2 A;  4I51 A;  3S8P A;  2G46 A;  3OXL A;  3OXF A;  4NVQ A;  5T0M A;  5JJ0 A;  1N6C A;  3M54 A;  1PEG A;  4O6F A;  4WUY A;  3M56 A;  4NJ5 A;  4YPA A;  5CCL A;  3QWP A;  5ARG A;  2JV0 A;  5KJM A;  4C1Q A;  3KMJ A;  3RJW A;  5F5E A;  4JLG A;  3MO2 A;  2BQZ A;  3MO5 A;  4RZ0 A;  5EX3 A;  3OPE A;  4AU7 A;  4YNP A;  3F9W A;  2F69 A;  4J8O A;  4J83 A;  3RAY A;  3KMA A;  5LSZ A;  5F59 A;  3EP0 A;  3QWV A;  5TEG A;  3RIB A;  2R3A A;  4YNM A;  3VV0 A;  5JHN A;  4E47 A;  1H3I A;  5CCM A;  5TH7 A;  2W5Z A;  3IHX A;  4LDG A;  3DB5 A;  4O30 A;  4Z4P A;  3KMT A;  5TTF A;  3M59 A;  4MI5 A;  3S7B A;  5F6K C;  3CBO A;  3F9Y A;  5KJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...