3RAYA

Crystal structure of methyltransferase domain of human pr domain-containing protein 11
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
159
Chain Sequence
DFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQFFSWLIVDKNNRYKSIDGSDETKANWMRYVVISREEREQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain-containing protein 11
publication title Crystal structure of Methyltransferase domain of human PR domain-containing protein 11
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 159
sequence length 164
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3rayA00
5TTFA 3QWWA 4YPUA 4NJ5A 3QWPA 5JJ0A 4C1QA 3TG5A 1N3JA 4QENA 2BQZA 2O8JA 4QEPA 5ARGA 5KJNA 5JIYA 1ML9A 3DB5A 5EX3A 1ZKKA 1O9SA 3DALA 3S7BA 3VUZA 3EP0A 4AU7A 5TEGA 4RZ0A 4BUPA 3OXGA 2RFIA 2F69A 5T0MA 4H12A 3S7DA 5TH7A 3N71A 5F5EA 3M54A 1XQHA 5KJKA 1MUFA 5JINA 4J8OA 4E47A 5LSZA 3QWVA 3M59A 3FPDA 3MEKA 4QEOA 5CCMA 5ARFA 4MI0A 3RJWA 1MVHA 2W5YA 3MO5A 3OS5A 3F9WA 4O30A 2R3AA 5KJMA 5AYFA 5CPRB 3SWCA 2JV0A 3S7FA 3RIBA 4YPAA 3S7JA 4MI5A 3KMJA 4YNMA 4YNPA 5EG2A 5HQ8A 4Z4PA 3KMTA 4J83A 3TG4A 3RU0A 3M5AA 1N6AA 3CBMA 3BO5A 3OXFA 4FMUA 5F6LA 1N6CA 3M56A 5T0KA 3SW9A 3M57A 3M55A 4WUYA 1H3IA 3MO2A 3F9ZA 3PDNA 4NVQA 4IJDA 3F9YA 4I51A 5F6KC 3RAYA 3IHXA 3HNAA 3OOIA 3MO0A 3VV0A 5JHNA 4YPEA 3OPEA 4YNDA 4JLGA 4O6FA 3S8PA 2QPWA 5EX0A 3F9XA 3K5KA 5LSXA 2W5ZA 2G46A 3OXLA 1MT6A 5CCLA 4IJ8A 2IGQA 1MVXA 3M58A 1PEGA 3RQ4A 3KMAA 5HI7A 5F59A 4J7FA 4J7IA 5T5GA 3CBPA 3M53A 3CBOA 5KJLA 4JDSA 4LDGA
chains in the Genus database with same CATH superfamily
5TTFA 3QWWA 4YPUA 4NJ5A 3QWPA 5JJ0A 4C1QA 3TG5A 1N3JA 4QENA 2BQZA 2O8JA 4QEPA 5ARGA 5KJNA 5JIYA 1ML9A 3DB5A 5EX3A 1ZKKA 1O9SA 3DALA 3S7BA 3VUZA 3EP0A 4AU7A 5TEGA 4RZ0A 4BUPA 3OXGA 2RFIA 2F69A 5T0MA 4H12A 3S7DA 5TH7A 3N71A 5F5EA 3M54A 1XQHA 5KJKA 1MUFA 5JINA 4J8OA 4E47A 5LSZA 3QWVA 3M59A 3FPDA 3MEKA 4QEOA 5CCMA 5ARFA 4MI0A 3RJWA 1MVHA 2W5YA 3MO5A 3OS5A 3F9WA 4O30A 2R3AA 5KJMA 5AYFA 5CPRB 3SWCA 2JV0A 3S7FA 3RIBA 4YPAA 3S7JA 4MI5A 3KMJA 4YNMA 4YNPA 5EG2A 5HQ8A 4Z4PA 3KMTA 4J83A 3TG4A 3RU0A 3M5AA 1N6AA 3CBMA 3BO5A 3OXFA 4FMUA 5F6LA 1N6CA 3M56A 5T0KA 3SW9A 3M57A 3M55A 4WUYA 1H3IA 3MO2A 3F9ZA 3PDNA 4NVQA 4IJDA 3F9YA 4I51A 5F6KC 3RAYA 3IHXA 3HNAA 3OOIA 3MO0A 3VV0A 5JHNA 4YPEA 3OPEA 4YNDA 4JLGA 4O6FA 3S8PA 2QPWA 5EX0A 3F9XA 3K5KA 5LSXA 2W5ZA 2G46A 3OXLA 1MT6A 5CCLA 4IJ8A 2IGQA 1MVXA 3M58A 1PEGA 3RQ4A 3KMAA 5HI7A 5F59A 4J7FA 4J7IA 5T5GA 3CBPA 3M53A 3CBOA 5KJLA 4JDSA 4LDGA
chains in the Genus database with same CATH topology
5TTFA 3QWWA 4YPUA 4NJ5A 3QWPA 5JJ0A 4C1QA 3TG5A 1N3JA 4QENA 2BQZA 2O8JA 4QEPA 5ARGA 5KJNA 5JIYA 1ML9A 3DB5A 5EX3A 1ZKKA 1O9SA 3DALA 3S7BA 3VUZA 3EP0A 4AU7A 5TEGA 4RZ0A 4BUPA 3OXGA 2RFIA 2F69A 5T0MA 4H12A 3S7DA 5TH7A 3N71A 5F5EA 3M54A 1XQHA 5KJKA 1MUFA 5JINA 4J8OA 4E47A 5LSZA 3QWVA 3M59A 3FPDA 3MEKA 4QEOA 5CCMA 5ARFA 4MI0A 3RJWA 1MVHA 2W5YA 3MO5A 3OS5A 3F9WA 4O30A 2R3AA 5KJMA 5AYFA 5CPRB 3SWCA 2JV0A 3S7FA 3RIBA 4YPAA 3S7JA 4MI5A 3KMJA 4YNMA 4YNPA 5EG2A 5HQ8A 4Z4PA 3KMTA 4J83A 3TG4A 3RU0A 3M5AA 1N6AA 3CBMA 3BO5A 3OXFA 4FMUA 5F6LA 1N6CA 3M56A 5T0KA 3SW9A 3M57A 3M55A 4WUYA 1H3IA 3MO2A 3F9ZA 3PDNA 4NVQA 4IJDA 3F9YA 4I51A 5F6KC 3RAYA 3IHXA 3HNAA 3OOIA 3MO0A 3VV0A 5JHNA 4YPEA 3OPEA 4YNDA 4JLGA 4O6FA 3S8PA 2QPWA 5EX0A 3F9XA 3K5KA 5LSXA 2W5ZA 2G46A 3OXLA 1MT6A 5CCLA 4IJ8A 2IGQA 1MVXA 3M58A 1PEGA 3RQ4A 3KMAA 5HI7A 5F59A 4J7FA 4J7IA 5T5GA 3CBPA 3M53A 3CBOA 5KJLA 4JDSA 4LDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TTF A;  3QWW A;  4YPU A;  4NJ5 A;  3QWP A;  5JJ0 A;  4C1Q A;  3TG5 A;  1N3J A;  4QEN A;  2BQZ A;  2O8J A;  4QEP A;  5ARG A;  5KJN A;  5JIY A;  1ML9 A;  3DB5 A;  5EX3 A;  1ZKK A;  1O9S A;  3DAL A;  3S7B A;  3VUZ A;  3EP0 A;  4AU7 A;  5TEG A;  4RZ0 A;  4BUP A;  3OXG A;  2RFI A;  2F69 A;  5T0M A;  4H12 A;  3S7D A;  5TH7 A;  3N71 A;  5F5E A;  3M54 A;  1XQH A;  5KJK A;  1MUF A;  5JIN A;  4J8O A;  4E47 A;  5LSZ A;  3QWV A;  3M59 A;  3FPD A;  3MEK A;  4QEO A;  5CCM A;  5ARF A;  4MI0 A;  3RJW A;  1MVH A;  2W5Y A;  3MO5 A;  3OS5 A;  3F9W A;  4O30 A;  2R3A A;  5KJM A;  5AYF A;  5CPR B;  3SWC A;  2JV0 A;  3S7F A;  3RIB A;  4YPA A;  3S7J A;  4MI5 A;  3KMJ A;  4YNM A;  4YNP A;  5EG2 A;  5HQ8 A;  4Z4P A;  3KMT A;  4J83 A;  3TG4 A;  3RU0 A;  3M5A A;  1N6A A;  3CBM A;  3BO5 A;  3OXF A;  4FMU A;  5F6L A;  1N6C A;  3M56 A;  5T0K A;  3SW9 A;  3M57 A;  3M55 A;  4WUY A;  1H3I A;  3MO2 A;  3F9Z A;  3PDN A;  4NVQ A;  4IJD A;  3F9Y A;  4I51 A;  5F6K C;  3RAY A;  3IHX A;  3HNA A;  3OOI A;  3MO0 A;  3VV0 A;  5JHN A;  4YPE A;  3OPE A;  4YND A;  4JLG A;  4O6F A;  3S8P A;  2QPW A;  5EX0 A;  3F9X A;  3K5K A;  5LSX A;  2W5Z A;  2G46 A;  3OXL A;  1MT6 A;  5CCL A;  4IJ8 A;  2IGQ A;  1MVX A;  3M58 A;  1PEG A;  3RQ4 A;  3KMA A;  5HI7 A;  5F59 A;  4J7F A;  4J7I A;  5T5G A;  3CBP A;  3M53 A;  3CBO A;  5KJL A;  4JDS A;  4LDG A; 
#chains in the Genus database with same CATH topology
 5TTF A;  3QWW A;  4YPU A;  4NJ5 A;  3QWP A;  5JJ0 A;  4C1Q A;  3TG5 A;  1N3J A;  4QEN A;  2BQZ A;  2O8J A;  4QEP A;  5ARG A;  5KJN A;  5JIY A;  1ML9 A;  3DB5 A;  5EX3 A;  1ZKK A;  1O9S A;  3DAL A;  3S7B A;  3VUZ A;  3EP0 A;  4AU7 A;  5TEG A;  4RZ0 A;  4BUP A;  3OXG A;  2RFI A;  2F69 A;  5T0M A;  4H12 A;  3S7D A;  5TH7 A;  3N71 A;  5F5E A;  3M54 A;  1XQH A;  5KJK A;  1MUF A;  5JIN A;  4J8O A;  4E47 A;  5LSZ A;  3QWV A;  3M59 A;  3FPD A;  3MEK A;  4QEO A;  5CCM A;  5ARF A;  4MI0 A;  3RJW A;  1MVH A;  2W5Y A;  3MO5 A;  3OS5 A;  3F9W A;  4O30 A;  2R3A A;  5KJM A;  5AYF A;  5CPR B;  3SWC A;  2JV0 A;  3S7F A;  3RIB A;  4YPA A;  3S7J A;  4MI5 A;  3KMJ A;  4YNM A;  4YNP A;  5EG2 A;  5HQ8 A;  4Z4P A;  3KMT A;  4J83 A;  3TG4 A;  3RU0 A;  3M5A A;  1N6A A;  3CBM A;  3BO5 A;  3OXF A;  4FMU A;  5F6L A;  1N6C A;  3M56 A;  5T0K A;  3SW9 A;  3M57 A;  3M55 A;  4WUY A;  1H3I A;  3MO2 A;  3F9Z A;  3PDN A;  4NVQ A;  4IJD A;  3F9Y A;  4I51 A;  5F6K C;  3RAY A;  3IHX A;  3HNA A;  3OOI A;  3MO0 A;  3VV0 A;  5JHN A;  4YPE A;  3OPE A;  4YND A;  4JLG A;  4O6F A;  3S8P A;  2QPW A;  5EX0 A;  3F9X A;  3K5K A;  5LSX A;  2W5Z A;  2G46 A;  3OXL A;  1MT6 A;  5CCL A;  4IJ8 A;  2IGQ A;  1MVX A;  3M58 A;  1PEG A;  3RQ4 A;  3KMA A;  5HI7 A;  5F59 A;  4J7F A;  4J7I A;  5T5G A;  3CBP A;  3M53 A;  3CBO A;  5KJL A;  4JDS A;  4LDG A; 
#chains in the Genus database with same CATH homology
 5TTF A;  3QWW A;  4YPU A;  4NJ5 A;  3QWP A;  5JJ0 A;  4C1Q A;  3TG5 A;  1N3J A;  4QEN A;  2BQZ A;  2O8J A;  4QEP A;  5ARG A;  5KJN A;  5JIY A;  1ML9 A;  3DB5 A;  5EX3 A;  1ZKK A;  1O9S A;  3DAL A;  3S7B A;  3VUZ A;  3EP0 A;  4AU7 A;  5TEG A;  4RZ0 A;  4BUP A;  3OXG A;  2RFI A;  2F69 A;  5T0M A;  4H12 A;  3S7D A;  5TH7 A;  3N71 A;  5F5E A;  3M54 A;  1XQH A;  5KJK A;  1MUF A;  5JIN A;  4J8O A;  4E47 A;  5LSZ A;  3QWV A;  3M59 A;  3FPD A;  3MEK A;  4QEO A;  5CCM A;  5ARF A;  4MI0 A;  3RJW A;  1MVH A;  2W5Y A;  3MO5 A;  3OS5 A;  3F9W A;  4O30 A;  2R3A A;  5KJM A;  5AYF A;  5CPR B;  3SWC A;  2JV0 A;  3S7F A;  3RIB A;  4YPA A;  3S7J A;  4MI5 A;  3KMJ A;  4YNM A;  4YNP A;  5EG2 A;  5HQ8 A;  4Z4P A;  3KMT A;  4J83 A;  3TG4 A;  3RU0 A;  3M5A A;  1N6A A;  3CBM A;  3BO5 A;  3OXF A;  4FMU A;  5F6L A;  1N6C A;  3M56 A;  5T0K A;  3SW9 A;  3M57 A;  3M55 A;  4WUY A;  1H3I A;  3MO2 A;  3F9Z A;  3PDN A;  4NVQ A;  4IJD A;  3F9Y A;  4I51 A;  5F6K C;  3RAY A;  3IHX A;  3HNA A;  3OOI A;  3MO0 A;  3VV0 A;  5JHN A;  4YPE A;  3OPE A;  4YND A;  4JLG A;  4O6F A;  3S8P A;  2QPW A;  5EX0 A;  3F9X A;  3K5K A;  5LSX A;  2W5Z A;  2G46 A;  3OXL A;  1MT6 A;  5CCL A;  4IJ8 A;  2IGQ A;  1MVX A;  3M58 A;  1PEG A;  3RQ4 A;  3KMA A;  5HI7 A;  5F59 A;  4J7F A;  4J7I A;  5T5G A;  3CBP A;  3M53 A;  3CBO A;  5KJL A;  4JDS A;  4LDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...