3RAYA

Crystal structure of methyltransferase domain of human pr domain-containing protein 11
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
159
Chain Sequence
DFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQFFSWLIVDKNNRYKSIDGSDETKANWMRYVVISREEREQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PR domain-containing protein 11
publication title Crystal structure of Methyltransferase domain of human PR domain-containing protein 11
rcsb
source organism Homo sapiens
total genus 42
structure length 159
sequence length 164
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3rayA00
2IGQA 3OXGA 4JDSA 1H3IA 3S7DA 5CCLA 4H12A 5ARGA 3VUZA 4E47A 4JLGA 3RAYA 4YPUA 4IJDA 3M58A 4QEPA 3SW9A 4C1QA 3EP0A 4YNMA 3S7BA 1MUFA 5F5EA 5KJNA 5JINA 4YPEA 1N6AA 1O9SA 4MI0A 2W5YA 4YNPA 5KJLA 3M59A 3M55A 3TG4A 4J7FA 3CBPA 1MT6A 3N71A 3S7FA 3CBMA 2G46A 4YNDA 3DALA 3QWVA 1PEGA 3CBOA 5HI7A 3BO5A 3KMJA 5TTFA 1XQHA 3M54A 4NJ5A 5EG2A 3F9WA 5EX0A 4RZ0A 3F9XA 4J7IA 4O30A 3KMAA 3HNAA 2JV0A 2O8JA 5ARFA 1ML9A 5HQ8A 3M53A 4BUPA 5TH7A 4MI5A 3MO2A 5CPRB 5T5GA 3QWPA 1MVXA 2R3AA 3MO0A 3S7JA 5KJMA 3M56A 4FMUA 3TG5A 4QEOA 3OXFA 3F9YA 4NVQA 3M57A 5F6KC 5KJKA 5JJ0A 3FPDA 3MO5A 4AU7A 5CCMA 5EX3A 5LSXA 1MVHA 4YPAA 3QWWA 5T0KA 5LSZA 4LDGA 3F9ZA 3RU0A 3S8PA 1ZKKA 3OXLA 2QPWA 3RJWA 3RQ4A 4QENA 4O6FA 2F69A 3OOIA 5JIYA 2RFIA 5TEGA 3OS5A 3VV0A 5JHNA 4Z4PA 3KMTA 4I51A 3DB5A 3M5AA 2BQZA 3IHXA 3PDNA 5T0MA 3MEKA 5F59A 5F6LA 1N3JA 3SWCA 4J8OA 2W5ZA 4J83A 1N6CA 3RIBA 3OPEA 4IJ8A 3K5KA 4WUYA 5AYFA
chains in the Genus database with same CATH superfamily
2IGQA 3OXGA 4JDSA 1H3IA 3S7DA 5CCLA 4H12A 5ARGA 3VUZA 4E47A 4JLGA 3RAYA 4YPUA 4IJDA 3M58A 4QEPA 3SW9A 4C1QA 3EP0A 4YNMA 3S7BA 1MUFA 5F5EA 5KJNA 5JINA 4YPEA 1N6AA 1O9SA 4MI0A 2W5YA 4YNPA 5KJLA 3M59A 3M55A 3TG4A 4J7FA 3CBPA 1MT6A 3N71A 3S7FA 3CBMA 2G46A 4YNDA 3DALA 3QWVA 1PEGA 3CBOA 5HI7A 3BO5A 3KMJA 5TTFA 1XQHA 3M54A 4NJ5A 5EG2A 3F9WA 5EX0A 4RZ0A 3F9XA 4J7IA 4O30A 3KMAA 3HNAA 2JV0A 2O8JA 5ARFA 1ML9A 5HQ8A 3M53A 4BUPA 5TH7A 4MI5A 3MO2A 5CPRB 5T5GA 3QWPA 1MVXA 2R3AA 3MO0A 3S7JA 5KJMA 3M56A 4FMUA 3TG5A 4QEOA 3OXFA 3F9YA 4NVQA 3M57A 5F6KC 5KJKA 5JJ0A 3FPDA 3MO5A 4AU7A 5CCMA 5EX3A 5LSXA 1MVHA 4YPAA 3QWWA 5T0KA 5LSZA 4LDGA 3F9ZA 3RU0A 3S8PA 1ZKKA 3OXLA 2QPWA 3RJWA 3RQ4A 4QENA 4O6FA 2F69A 3OOIA 5JIYA 2RFIA 5TEGA 3OS5A 3VV0A 5JHNA 4Z4PA 3KMTA 4I51A 3DB5A 3M5AA 2BQZA 3IHXA 3PDNA 5T0MA 3MEKA 5F59A 5F6LA 1N3JA 3SWCA 4J8OA 2W5ZA 4J83A 1N6CA 3RIBA 3OPEA 4IJ8A 3K5KA 4WUYA 5AYFA
chains in the Genus database with same CATH topology
2IGQA 3OXGA 4JDSA 1H3IA 3S7DA 5CCLA 4H12A 5ARGA 3VUZA 4E47A 4JLGA 3RAYA 4YPUA 4IJDA 3M58A 4QEPA 3SW9A 4C1QA 3EP0A 4YNMA 3S7BA 1MUFA 5F5EA 5KJNA 5JINA 4YPEA 1N6AA 1O9SA 4MI0A 2W5YA 4YNPA 5KJLA 3M59A 3M55A 3TG4A 4J7FA 3CBPA 1MT6A 3N71A 3S7FA 3CBMA 2G46A 4YNDA 3DALA 3QWVA 1PEGA 3CBOA 5HI7A 3BO5A 3KMJA 5TTFA 1XQHA 3M54A 4NJ5A 5EG2A 3F9WA 5EX0A 4RZ0A 3F9XA 4J7IA 4O30A 3KMAA 3HNAA 2JV0A 2O8JA 5ARFA 1ML9A 5HQ8A 3M53A 4BUPA 5TH7A 4MI5A 3MO2A 5CPRB 5T5GA 3QWPA 1MVXA 2R3AA 3MO0A 3S7JA 5KJMA 3M56A 4FMUA 3TG5A 4QEOA 3OXFA 3F9YA 4NVQA 3M57A 5F6KC 5KJKA 5JJ0A 3FPDA 3MO5A 4AU7A 5CCMA 5EX3A 5LSXA 1MVHA 4YPAA 3QWWA 5T0KA 5LSZA 4LDGA 3F9ZA 3RU0A 3S8PA 1ZKKA 3OXLA 2QPWA 3RJWA 3RQ4A 4QENA 4O6FA 2F69A 3OOIA 5JIYA 2RFIA 5TEGA 3OS5A 3VV0A 5JHNA 4Z4PA 3KMTA 4I51A 3DB5A 3M5AA 2BQZA 3IHXA 3PDNA 5T0MA 3MEKA 5F59A 5F6LA 1N3JA 3SWCA 4J8OA 2W5ZA 4J83A 1N6CA 3RIBA 3OPEA 4IJ8A 3K5KA 4WUYA 5AYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGQ A;  3OXG A;  4JDS A;  1H3I A;  3S7D A;  5CCL A;  4H12 A;  5ARG A;  3VUZ A;  4E47 A;  4JLG A;  3RAY A;  4YPU A;  4IJD A;  3M58 A;  4QEP A;  3SW9 A;  4C1Q A;  3EP0 A;  4YNM A;  3S7B A;  1MUF A;  5F5E A;  5KJN A;  5JIN A;  4YPE A;  1N6A A;  1O9S A;  4MI0 A;  2W5Y A;  4YNP A;  5KJL A;  3M59 A;  3M55 A;  3TG4 A;  4J7F A;  3CBP A;  1MT6 A;  3N71 A;  3S7F A;  3CBM A;  2G46 A;  4YND A;  3DAL A;  3QWV A;  1PEG A;  3CBO A;  5HI7 A;  3BO5 A;  3KMJ A;  5TTF A;  1XQH A;  3M54 A;  4NJ5 A;  5EG2 A;  3F9W A;  5EX0 A;  4RZ0 A;  3F9X A;  4J7I A;  4O30 A;  3KMA A;  3HNA A;  2JV0 A;  2O8J A;  5ARF A;  1ML9 A;  5HQ8 A;  3M53 A;  4BUP A;  5TH7 A;  4MI5 A;  3MO2 A;  5CPR B;  5T5G A;  3QWP A;  1MVX A;  2R3A A;  3MO0 A;  3S7J A;  5KJM A;  3M56 A;  4FMU A;  3TG5 A;  4QEO A;  3OXF A;  3F9Y A;  4NVQ A;  3M57 A;  5F6K C;  5KJK A;  5JJ0 A;  3FPD A;  3MO5 A;  4AU7 A;  5CCM A;  5EX3 A;  5LSX A;  1MVH A;  4YPA A;  3QWW A;  5T0K A;  5LSZ A;  4LDG A;  3F9Z A;  3RU0 A;  3S8P A;  1ZKK A;  3OXL A;  2QPW A;  3RJW A;  3RQ4 A;  4QEN A;  4O6F A;  2F69 A;  3OOI A;  5JIY A;  2RFI A;  5TEG A;  3OS5 A;  3VV0 A;  5JHN A;  4Z4P A;  3KMT A;  4I51 A;  3DB5 A;  3M5A A;  2BQZ A;  3IHX A;  3PDN A;  5T0M A;  3MEK A;  5F59 A;  5F6L A;  1N3J A;  3SWC A;  4J8O A;  2W5Z A;  4J83 A;  1N6C A;  3RIB A;  3OPE A;  4IJ8 A;  3K5K A;  4WUY A;  5AYF A; 
#chains in the Genus database with same CATH topology
 2IGQ A;  3OXG A;  4JDS A;  1H3I A;  3S7D A;  5CCL A;  4H12 A;  5ARG A;  3VUZ A;  4E47 A;  4JLG A;  3RAY A;  4YPU A;  4IJD A;  3M58 A;  4QEP A;  3SW9 A;  4C1Q A;  3EP0 A;  4YNM A;  3S7B A;  1MUF A;  5F5E A;  5KJN A;  5JIN A;  4YPE A;  1N6A A;  1O9S A;  4MI0 A;  2W5Y A;  4YNP A;  5KJL A;  3M59 A;  3M55 A;  3TG4 A;  4J7F A;  3CBP A;  1MT6 A;  3N71 A;  3S7F A;  3CBM A;  2G46 A;  4YND A;  3DAL A;  3QWV A;  1PEG A;  3CBO A;  5HI7 A;  3BO5 A;  3KMJ A;  5TTF A;  1XQH A;  3M54 A;  4NJ5 A;  5EG2 A;  3F9W A;  5EX0 A;  4RZ0 A;  3F9X A;  4J7I A;  4O30 A;  3KMA A;  3HNA A;  2JV0 A;  2O8J A;  5ARF A;  1ML9 A;  5HQ8 A;  3M53 A;  4BUP A;  5TH7 A;  4MI5 A;  3MO2 A;  5CPR B;  5T5G A;  3QWP A;  1MVX A;  2R3A A;  3MO0 A;  3S7J A;  5KJM A;  3M56 A;  4FMU A;  3TG5 A;  4QEO A;  3OXF A;  3F9Y A;  4NVQ A;  3M57 A;  5F6K C;  5KJK A;  5JJ0 A;  3FPD A;  3MO5 A;  4AU7 A;  5CCM A;  5EX3 A;  5LSX A;  1MVH A;  4YPA A;  3QWW A;  5T0K A;  5LSZ A;  4LDG A;  3F9Z A;  3RU0 A;  3S8P A;  1ZKK A;  3OXL A;  2QPW A;  3RJW A;  3RQ4 A;  4QEN A;  4O6F A;  2F69 A;  3OOI A;  5JIY A;  2RFI A;  5TEG A;  3OS5 A;  3VV0 A;  5JHN A;  4Z4P A;  3KMT A;  4I51 A;  3DB5 A;  3M5A A;  2BQZ A;  3IHX A;  3PDN A;  5T0M A;  3MEK A;  5F59 A;  5F6L A;  1N3J A;  3SWC A;  4J8O A;  2W5Z A;  4J83 A;  1N6C A;  3RIB A;  3OPE A;  4IJ8 A;  3K5K A;  4WUY A;  5AYF A; 
#chains in the Genus database with same CATH homology
 2IGQ A;  3OXG A;  4JDS A;  1H3I A;  3S7D A;  5CCL A;  4H12 A;  5ARG A;  3VUZ A;  4E47 A;  4JLG A;  3RAY A;  4YPU A;  4IJD A;  3M58 A;  4QEP A;  3SW9 A;  4C1Q A;  3EP0 A;  4YNM A;  3S7B A;  1MUF A;  5F5E A;  5KJN A;  5JIN A;  4YPE A;  1N6A A;  1O9S A;  4MI0 A;  2W5Y A;  4YNP A;  5KJL A;  3M59 A;  3M55 A;  3TG4 A;  4J7F A;  3CBP A;  1MT6 A;  3N71 A;  3S7F A;  3CBM A;  2G46 A;  4YND A;  3DAL A;  3QWV A;  1PEG A;  3CBO A;  5HI7 A;  3BO5 A;  3KMJ A;  5TTF A;  1XQH A;  3M54 A;  4NJ5 A;  5EG2 A;  3F9W A;  5EX0 A;  4RZ0 A;  3F9X A;  4J7I A;  4O30 A;  3KMA A;  3HNA A;  2JV0 A;  2O8J A;  5ARF A;  1ML9 A;  5HQ8 A;  3M53 A;  4BUP A;  5TH7 A;  4MI5 A;  3MO2 A;  5CPR B;  5T5G A;  3QWP A;  1MVX A;  2R3A A;  3MO0 A;  3S7J A;  5KJM A;  3M56 A;  4FMU A;  3TG5 A;  4QEO A;  3OXF A;  3F9Y A;  4NVQ A;  3M57 A;  5F6K C;  5KJK A;  5JJ0 A;  3FPD A;  3MO5 A;  4AU7 A;  5CCM A;  5EX3 A;  5LSX A;  1MVH A;  4YPA A;  3QWW A;  5T0K A;  5LSZ A;  4LDG A;  3F9Z A;  3RU0 A;  3S8P A;  1ZKK A;  3OXL A;  2QPW A;  3RJW A;  3RQ4 A;  4QEN A;  4O6F A;  2F69 A;  3OOI A;  5JIY A;  2RFI A;  5TEG A;  3OS5 A;  3VV0 A;  5JHN A;  4Z4P A;  3KMT A;  4I51 A;  3DB5 A;  3M5A A;  2BQZ A;  3IHX A;  3PDN A;  5T0M A;  3MEK A;  5F59 A;  5F6L A;  1N3J A;  3SWC A;  4J8O A;  2W5Z A;  4J83 A;  1N6C A;  3RIB A;  3OPE A;  4IJ8 A;  3K5K A;  4WUY A;  5AYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...