3RAYA

Crystal structure of methyltransferase domain of human pr domain-containing protein 11
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
159
Chain Sequence
b'DFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQFFSWLIVDKNNRYKSIDGSDETKANWMRYVVISREEREQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain-containing protein 11
molecule tags Transcription
source organism Homo sapiens
publication title Crystal structure of Methyltransferase domain of human PR domain-containing protein 11
rcsb
total genus 42
structure length 159
sequence length 164
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3rayA00
4Z4PA 5F59A 4O30A 4YNDA 1N3JA 4O6FA 4IJ8A 4IJDA 5CPRB 2IGQA 5EX0A 3CBMA 4FMUA 3MO2A 4J7IA 5LSXA 3M5AA 5JHNA 5ARFA 5JINA 3QWPA 2QPWA 5KJNA 3M57A 3M56A 4LDGA 1PEGA 3RAYA 2R3AA 3RU0A 3S7BA 3QWVA 4YNPA 3HNAA 3M58A 3M55A 4YPEA 5EG2A 3SWCA 3IHXA 5T0KA 5KJMA 3K5KA 3OPEA 5JJ0A 2W5YA 1N6CA 1O9SA 3M53A 3EP0A 3M54A 5F6LA 1ZKKA 3TG4A 4JLGA 3F9ZA 1ML9A 3OS5A 5F5EA 3OOIA 3TG5A 3OXLA 2O8JA 4MI5A 1N6AA 4J8OA 4NVQA 3S7JA 4E47A 3MO0A 3CBPA 3S7FA 3DALA 4YPAA 3F9YA 3RIBA 2JV0A 3OXFA 3PDNA 4RZ0A 3DB5A 2F69A 4J7FA 3F9WA 3VV0A 3VUZA 3M59A 2RFIA 5CCLA 4YPUA 5EX3A 3QWWA 5T5GA 3F9XA 5TH7A 3BO5A 4BUPA 1XQHA 5HI7A 5ARGA 4I51A 3KMTA 1MVXA 3SW9A 3RJWA 4J83A 4YNMA 5LSZA 3KMAA 4AU7A 3N71A 4C1QA 1MUFA 1MT6A 3MO5A 2BQZA 2G46A 3MEKA 4QEOA 3S8PA 5HQ8A 5KJLA 3S7DA 4H12A 3RQ4A 5TEGA 5CCMA 4MI0A 5JIYA 5KJKA 4NJ5A 4QENA 1H3IA 1MVHA 3CBOA 5AYFA 5T0MA 3OXGA 5TTFA 3KMJA 2W5ZA 5F6KC 4JDSA 3FPDA 4QEPA 4WUYA
chains in the Genus database with same CATH superfamily
4Z4PA 5F59A 4O30A 4YNDA 1N3JA 4O6FA 4IJ8A 4IJDA 5CPRB 2IGQA 5EX0A 3CBMA 4FMUA 3MO2A 4J7IA 5LSXA 3M5AA 5JHNA 5ARFA 5JINA 3QWPA 2QPWA 5KJNA 3M57A 3M56A 4LDGA 1PEGA 3RAYA 2R3AA 3RU0A 3S7BA 3QWVA 4YNPA 3HNAA 3M58A 3M55A 4YPEA 5EG2A 3SWCA 3IHXA 5T0KA 5KJMA 3K5KA 3OPEA 5JJ0A 2W5YA 1N6CA 1O9SA 3M53A 3EP0A 3M54A 5F6LA 1ZKKA 3TG4A 4JLGA 3F9ZA 1ML9A 3OS5A 5F5EA 3OOIA 3TG5A 3OXLA 2O8JA 4MI5A 1N6AA 4J8OA 4NVQA 3S7JA 4E47A 3MO0A 3CBPA 3S7FA 3DALA 4YPAA 3F9YA 3RIBA 2JV0A 3OXFA 3PDNA 4RZ0A 3DB5A 2F69A 4J7FA 3F9WA 3VV0A 3VUZA 3M59A 2RFIA 5CCLA 4YPUA 5EX3A 3QWWA 5T5GA 3F9XA 5TH7A 3BO5A 4BUPA 1XQHA 5HI7A 5ARGA 4I51A 3KMTA 1MVXA 3SW9A 3RJWA 4J83A 4YNMA 5LSZA 3KMAA 4AU7A 3N71A 4C1QA 1MUFA 1MT6A 3MO5A 2BQZA 2G46A 3MEKA 4QEOA 3S8PA 5HQ8A 5KJLA 3S7DA 4H12A 3RQ4A 5TEGA 5CCMA 4MI0A 5JIYA 5KJKA 4NJ5A 4QENA 1H3IA 1MVHA 3CBOA 5AYFA 5T0MA 3OXGA 5TTFA 3KMJA 2W5ZA 5F6KC 4JDSA 3FPDA 4QEPA 4WUYA
chains in the Genus database with same CATH topology
4Z4PA 5F59A 4O30A 4YNDA 1N3JA 4O6FA 4IJ8A 4IJDA 5CPRB 2IGQA 5EX0A 3CBMA 4FMUA 3MO2A 4J7IA 5LSXA 3M5AA 5JHNA 5ARFA 5JINA 3QWPA 2QPWA 5KJNA 3M57A 3M56A 4LDGA 1PEGA 3RAYA 2R3AA 3RU0A 3S7BA 3QWVA 4YNPA 3HNAA 3M58A 3M55A 4YPEA 5EG2A 3SWCA 3IHXA 5T0KA 5KJMA 3K5KA 3OPEA 5JJ0A 2W5YA 1N6CA 1O9SA 3M53A 3EP0A 3M54A 5F6LA 1ZKKA 3TG4A 4JLGA 3F9ZA 1ML9A 3OS5A 5F5EA 3OOIA 3TG5A 3OXLA 2O8JA 4MI5A 1N6AA 4J8OA 4NVQA 3S7JA 4E47A 3MO0A 3CBPA 3S7FA 3DALA 4YPAA 3F9YA 3RIBA 2JV0A 3OXFA 3PDNA 4RZ0A 3DB5A 2F69A 4J7FA 3F9WA 3VV0A 3VUZA 3M59A 2RFIA 5CCLA 4YPUA 5EX3A 3QWWA 5T5GA 3F9XA 5TH7A 3BO5A 4BUPA 1XQHA 5HI7A 5ARGA 4I51A 3KMTA 1MVXA 3SW9A 3RJWA 4J83A 4YNMA 5LSZA 3KMAA 4AU7A 3N71A 4C1QA 1MUFA 1MT6A 3MO5A 2BQZA 2G46A 3MEKA 4QEOA 3S8PA 5HQ8A 5KJLA 3S7DA 4H12A 3RQ4A 5TEGA 5CCMA 4MI0A 5JIYA 5KJKA 4NJ5A 4QENA 1H3IA 1MVHA 3CBOA 5AYFA 5T0MA 3OXGA 5TTFA 3KMJA 2W5ZA 5F6KC 4JDSA 3FPDA 4QEPA 4WUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4P A;  5F59 A;  4O30 A;  4YND A;  1N3J A;  4O6F A;  4IJ8 A;  4IJD A;  5CPR B;  2IGQ A;  5EX0 A;  3CBM A;  4FMU A;  3MO2 A;  4J7I A;  5LSX A;  3M5A A;  5JHN A;  5ARF A;  5JIN A;  3QWP A;  2QPW A;  5KJN A;  3M57 A;  3M56 A;  4LDG A;  1PEG A;  3RAY A;  2R3A A;  3RU0 A;  3S7B A;  3QWV A;  4YNP A;  3HNA A;  3M58 A;  3M55 A;  4YPE A;  5EG2 A;  3SWC A;  3IHX A;  5T0K A;  5KJM A;  3K5K A;  3OPE A;  5JJ0 A;  2W5Y A;  1N6C A;  1O9S A;  3M53 A;  3EP0 A;  3M54 A;  5F6L A;  1ZKK A;  3TG4 A;  4JLG A;  3F9Z A;  1ML9 A;  3OS5 A;  5F5E A;  3OOI A;  3TG5 A;  3OXL A;  2O8J A;  4MI5 A;  1N6A A;  4J8O A;  4NVQ A;  3S7J A;  4E47 A;  3MO0 A;  3CBP A;  3S7F A;  3DAL A;  4YPA A;  3F9Y A;  3RIB A;  2JV0 A;  3OXF A;  3PDN A;  4RZ0 A;  3DB5 A;  2F69 A;  4J7F A;  3F9W A;  3VV0 A;  3VUZ A;  3M59 A;  2RFI A;  5CCL A;  4YPU A;  5EX3 A;  3QWW A;  5T5G A;  3F9X A;  5TH7 A;  3BO5 A;  4BUP A;  1XQH A;  5HI7 A;  5ARG A;  4I51 A;  3KMT A;  1MVX A;  3SW9 A;  3RJW A;  4J83 A;  4YNM A;  5LSZ A;  3KMA A;  4AU7 A;  3N71 A;  4C1Q A;  1MUF A;  1MT6 A;  3MO5 A;  2BQZ A;  2G46 A;  3MEK A;  4QEO A;  3S8P A;  5HQ8 A;  5KJL A;  3S7D A;  4H12 A;  3RQ4 A;  5TEG A;  5CCM A;  4MI0 A;  5JIY A;  5KJK A;  4NJ5 A;  4QEN A;  1H3I A;  1MVH A;  3CBO A;  5AYF A;  5T0M A;  3OXG A;  5TTF A;  3KMJ A;  2W5Z A;  5F6K C;  4JDS A;  3FPD A;  4QEP A;  4WUY A; 
#chains in the Genus database with same CATH topology
 4Z4P A;  5F59 A;  4O30 A;  4YND A;  1N3J A;  4O6F A;  4IJ8 A;  4IJD A;  5CPR B;  2IGQ A;  5EX0 A;  3CBM A;  4FMU A;  3MO2 A;  4J7I A;  5LSX A;  3M5A A;  5JHN A;  5ARF A;  5JIN A;  3QWP A;  2QPW A;  5KJN A;  3M57 A;  3M56 A;  4LDG A;  1PEG A;  3RAY A;  2R3A A;  3RU0 A;  3S7B A;  3QWV A;  4YNP A;  3HNA A;  3M58 A;  3M55 A;  4YPE A;  5EG2 A;  3SWC A;  3IHX A;  5T0K A;  5KJM A;  3K5K A;  3OPE A;  5JJ0 A;  2W5Y A;  1N6C A;  1O9S A;  3M53 A;  3EP0 A;  3M54 A;  5F6L A;  1ZKK A;  3TG4 A;  4JLG A;  3F9Z A;  1ML9 A;  3OS5 A;  5F5E A;  3OOI A;  3TG5 A;  3OXL A;  2O8J A;  4MI5 A;  1N6A A;  4J8O A;  4NVQ A;  3S7J A;  4E47 A;  3MO0 A;  3CBP A;  3S7F A;  3DAL A;  4YPA A;  3F9Y A;  3RIB A;  2JV0 A;  3OXF A;  3PDN A;  4RZ0 A;  3DB5 A;  2F69 A;  4J7F A;  3F9W A;  3VV0 A;  3VUZ A;  3M59 A;  2RFI A;  5CCL A;  4YPU A;  5EX3 A;  3QWW A;  5T5G A;  3F9X A;  5TH7 A;  3BO5 A;  4BUP A;  1XQH A;  5HI7 A;  5ARG A;  4I51 A;  3KMT A;  1MVX A;  3SW9 A;  3RJW A;  4J83 A;  4YNM A;  5LSZ A;  3KMA A;  4AU7 A;  3N71 A;  4C1Q A;  1MUF A;  1MT6 A;  3MO5 A;  2BQZ A;  2G46 A;  3MEK A;  4QEO A;  3S8P A;  5HQ8 A;  5KJL A;  3S7D A;  4H12 A;  3RQ4 A;  5TEG A;  5CCM A;  4MI0 A;  5JIY A;  5KJK A;  4NJ5 A;  4QEN A;  1H3I A;  1MVH A;  3CBO A;  5AYF A;  5T0M A;  3OXG A;  5TTF A;  3KMJ A;  2W5Z A;  5F6K C;  4JDS A;  3FPD A;  4QEP A;  4WUY A; 
#chains in the Genus database with same CATH homology
 4Z4P A;  5F59 A;  4O30 A;  4YND A;  1N3J A;  4O6F A;  4IJ8 A;  4IJD A;  5CPR B;  2IGQ A;  5EX0 A;  3CBM A;  4FMU A;  3MO2 A;  4J7I A;  5LSX A;  3M5A A;  5JHN A;  5ARF A;  5JIN A;  3QWP A;  2QPW A;  5KJN A;  3M57 A;  3M56 A;  4LDG A;  1PEG A;  3RAY A;  2R3A A;  3RU0 A;  3S7B A;  3QWV A;  4YNP A;  3HNA A;  3M58 A;  3M55 A;  4YPE A;  5EG2 A;  3SWC A;  3IHX A;  5T0K A;  5KJM A;  3K5K A;  3OPE A;  5JJ0 A;  2W5Y A;  1N6C A;  1O9S A;  3M53 A;  3EP0 A;  3M54 A;  5F6L A;  1ZKK A;  3TG4 A;  4JLG A;  3F9Z A;  1ML9 A;  3OS5 A;  5F5E A;  3OOI A;  3TG5 A;  3OXL A;  2O8J A;  4MI5 A;  1N6A A;  4J8O A;  4NVQ A;  3S7J A;  4E47 A;  3MO0 A;  3CBP A;  3S7F A;  3DAL A;  4YPA A;  3F9Y A;  3RIB A;  2JV0 A;  3OXF A;  3PDN A;  4RZ0 A;  3DB5 A;  2F69 A;  4J7F A;  3F9W A;  3VV0 A;  3VUZ A;  3M59 A;  2RFI A;  5CCL A;  4YPU A;  5EX3 A;  3QWW A;  5T5G A;  3F9X A;  5TH7 A;  3BO5 A;  4BUP A;  1XQH A;  5HI7 A;  5ARG A;  4I51 A;  3KMT A;  1MVX A;  3SW9 A;  3RJW A;  4J83 A;  4YNM A;  5LSZ A;  3KMA A;  4AU7 A;  3N71 A;  4C1Q A;  1MUF A;  1MT6 A;  3MO5 A;  2BQZ A;  2G46 A;  3MEK A;  4QEO A;  3S8P A;  5HQ8 A;  5KJL A;  3S7D A;  4H12 A;  3RQ4 A;  5TEG A;  5CCM A;  4MI0 A;  5JIY A;  5KJK A;  4NJ5 A;  4QEN A;  1H3I A;  1MVH A;  3CBO A;  5AYF A;  5T0M A;  3OXG A;  5TTF A;  3KMJ A;  2W5Z A;  5F6K C;  4JDS A;  3FPD A;  4QEP A;  4WUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...