2JV0A

Set domain of riz1 tumor suppressor (prdm2)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
162
Chain Sequence
GSMDQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYGEDNPEIAAAIEEERASARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PR domain zinc finger protein 2
publication title Structural studies of the SET domain from RIZ1 tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 162
sequence length 163
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2jv0A01
4IJDA 3OXGA 4LDGA 3M59A 1N6AA 5CCMA 3S7FA 5JJ0A 3F9WA 5KJMA 3S7JA 5EG2A 4Z4PA 2RFIA 3CBPA 2G46A 3M56A 3M54A 3PDNA 4RZ0A 2F69A 3SW9A 2QPWA 4QEPA 3RAYA 3KMJA 3RJWA 3K5KA 5ARGA 3S8PA 5EX0A 2W5YA 3VV0A 3EP0A 3SWCA 3MEKA 5ARFA 4JDSA 5JIYA 4NJ5A 1XQHA 5TEGA 3RU0A 3F9ZA 3OS5A 4NVQA 3M5AA 1MT6A 4QENA 1ML9A 3S7BA 3TG4A 5F5EA 4YPEA 5TTFA 4C1QA 1MVXA 1N6CA 3OXFA 3FPDA 1N3JA 3RQ4A 4MI5A 3N71A 4E47A 5KJKA 5LSZA 2IGQA 5TH7A 4JLGA 5JINA 3MO0A 3HNAA 3M58A 5JHNA 3M53A 3KMTA 4YNPA 4J8OA 5CCLA 3BO5A 2JV0A 3CBMA 4AU7A 4J83A 3DALA 4J7FA 5T0KA 5F59A 4MI0A 5AYFA 4FMUA 1ZKKA 4QEOA 5KJLA 1PEGA 4H12A 3OPEA 3IHXA 5HQ8A 1H3IA 4YPAA 4WUYA 3QWVA 3KMAA 4O30A 4J7IA 3MO2A 5T5GA 3RIBA 4YPUA 3DB5A 5KJNA 3F9YA 5CPRB 5T0MA 3QWPA 3M57A 3CBOA 2W5ZA 3OXLA 5F6LA 5LSXA 1MUFA 3VUZA 3M55A 4I51A 4YNDA 3TG5A 3OOIA 4IJ8A 3F9XA 4YNMA 1O9SA 4O6FA 5EX3A 5F6KC 1MVHA 5HI7A 3MO5A 3S7DA 4BUPA 2BQZA 3QWWA 2R3AA 2O8JA
chains in the Genus database with same CATH superfamily
4IJDA 3OXGA 4LDGA 3M59A 1N6AA 5CCMA 3S7FA 5JJ0A 3F9WA 5KJMA 3S7JA 5EG2A 4Z4PA 2RFIA 3CBPA 2G46A 3M56A 3M54A 3PDNA 4RZ0A 2F69A 3SW9A 2QPWA 4QEPA 3RAYA 3KMJA 3RJWA 3K5KA 5ARGA 3S8PA 5EX0A 2W5YA 3VV0A 3EP0A 3SWCA 3MEKA 5ARFA 4JDSA 5JIYA 4NJ5A 1XQHA 5TEGA 3RU0A 3F9ZA 3OS5A 4NVQA 3M5AA 1MT6A 4QENA 1ML9A 3S7BA 3TG4A 5F5EA 4YPEA 5TTFA 4C1QA 1MVXA 1N6CA 3OXFA 3FPDA 1N3JA 3RQ4A 4MI5A 3N71A 4E47A 5KJKA 5LSZA 2IGQA 5TH7A 4JLGA 5JINA 3MO0A 3HNAA 3M58A 5JHNA 3M53A 3KMTA 4YNPA 4J8OA 5CCLA 3BO5A 2JV0A 3CBMA 4AU7A 4J83A 3DALA 4J7FA 5T0KA 5F59A 4MI0A 5AYFA 4FMUA 1ZKKA 4QEOA 5KJLA 1PEGA 4H12A 3OPEA 3IHXA 5HQ8A 1H3IA 4YPAA 4WUYA 3QWVA 3KMAA 4O30A 4J7IA 3MO2A 5T5GA 3RIBA 4YPUA 3DB5A 5KJNA 3F9YA 5CPRB 5T0MA 3QWPA 3M57A 3CBOA 2W5ZA 3OXLA 5F6LA 5LSXA 1MUFA 3VUZA 3M55A 4I51A 4YNDA 3TG5A 3OOIA 4IJ8A 3F9XA 4YNMA 1O9SA 4O6FA 5EX3A 5F6KC 1MVHA 5HI7A 3MO5A 3S7DA 4BUPA 2BQZA 3QWWA 2R3AA 2O8JA
chains in the Genus database with same CATH topology
4IJDA 3OXGA 4LDGA 3M59A 1N6AA 5CCMA 3S7FA 5JJ0A 3F9WA 5KJMA 3S7JA 5EG2A 4Z4PA 2RFIA 3CBPA 2G46A 3M56A 3M54A 3PDNA 4RZ0A 2F69A 3SW9A 2QPWA 4QEPA 3RAYA 3KMJA 3RJWA 3K5KA 5ARGA 3S8PA 5EX0A 2W5YA 3VV0A 3EP0A 3SWCA 3MEKA 5ARFA 4JDSA 5JIYA 4NJ5A 1XQHA 5TEGA 3RU0A 3F9ZA 3OS5A 4NVQA 3M5AA 1MT6A 4QENA 1ML9A 3S7BA 3TG4A 5F5EA 4YPEA 5TTFA 4C1QA 1MVXA 1N6CA 3OXFA 3FPDA 1N3JA 3RQ4A 4MI5A 3N71A 4E47A 5KJKA 5LSZA 2IGQA 5TH7A 4JLGA 5JINA 3MO0A 3HNAA 3M58A 5JHNA 3M53A 3KMTA 4YNPA 4J8OA 5CCLA 3BO5A 2JV0A 3CBMA 4AU7A 4J83A 3DALA 4J7FA 5T0KA 5F59A 4MI0A 5AYFA 4FMUA 1ZKKA 4QEOA 5KJLA 1PEGA 4H12A 3OPEA 3IHXA 5HQ8A 1H3IA 4YPAA 4WUYA 3QWVA 3KMAA 4O30A 4J7IA 3MO2A 5T5GA 3RIBA 4YPUA 3DB5A 5KJNA 3F9YA 5CPRB 5T0MA 3QWPA 3M57A 3CBOA 2W5ZA 3OXLA 5F6LA 5LSXA 1MUFA 3VUZA 3M55A 4I51A 4YNDA 3TG5A 3OOIA 4IJ8A 3F9XA 4YNMA 1O9SA 4O6FA 5EX3A 5F6KC 1MVHA 5HI7A 3MO5A 3S7DA 4BUPA 2BQZA 3QWWA 2R3AA 2O8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  3OXG A;  4LDG A;  3M59 A;  1N6A A;  5CCM A;  3S7F A;  5JJ0 A;  3F9W A;  5KJM A;  3S7J A;  5EG2 A;  4Z4P A;  2RFI A;  3CBP A;  2G46 A;  3M56 A;  3M54 A;  3PDN A;  4RZ0 A;  2F69 A;  3SW9 A;  2QPW A;  4QEP A;  3RAY A;  3KMJ A;  3RJW A;  3K5K A;  5ARG A;  3S8P A;  5EX0 A;  2W5Y A;  3VV0 A;  3EP0 A;  3SWC A;  3MEK A;  5ARF A;  4JDS A;  5JIY A;  4NJ5 A;  1XQH A;  5TEG A;  3RU0 A;  3F9Z A;  3OS5 A;  4NVQ A;  3M5A A;  1MT6 A;  4QEN A;  1ML9 A;  3S7B A;  3TG4 A;  5F5E A;  4YPE A;  5TTF A;  4C1Q A;  1MVX A;  1N6C A;  3OXF A;  3FPD A;  1N3J A;  3RQ4 A;  4MI5 A;  3N71 A;  4E47 A;  5KJK A;  5LSZ A;  2IGQ A;  5TH7 A;  4JLG A;  5JIN A;  3MO0 A;  3HNA A;  3M58 A;  5JHN A;  3M53 A;  3KMT A;  4YNP A;  4J8O A;  5CCL A;  3BO5 A;  2JV0 A;  3CBM A;  4AU7 A;  4J83 A;  3DAL A;  4J7F A;  5T0K A;  5F59 A;  4MI0 A;  5AYF A;  4FMU A;  1ZKK A;  4QEO A;  5KJL A;  1PEG A;  4H12 A;  3OPE A;  3IHX A;  5HQ8 A;  1H3I A;  4YPA A;  4WUY A;  3QWV A;  3KMA A;  4O30 A;  4J7I A;  3MO2 A;  5T5G A;  3RIB A;  4YPU A;  3DB5 A;  5KJN A;  3F9Y A;  5CPR B;  5T0M A;  3QWP A;  3M57 A;  3CBO A;  2W5Z A;  3OXL A;  5F6L A;  5LSX A;  1MUF A;  3VUZ A;  3M55 A;  4I51 A;  4YND A;  3TG5 A;  3OOI A;  4IJ8 A;  3F9X A;  4YNM A;  1O9S A;  4O6F A;  5EX3 A;  5F6K C;  1MVH A;  5HI7 A;  3MO5 A;  3S7D A;  4BUP A;  2BQZ A;  3QWW A;  2R3A A;  2O8J A; 
#chains in the Genus database with same CATH topology
 4IJD A;  3OXG A;  4LDG A;  3M59 A;  1N6A A;  5CCM A;  3S7F A;  5JJ0 A;  3F9W A;  5KJM A;  3S7J A;  5EG2 A;  4Z4P A;  2RFI A;  3CBP A;  2G46 A;  3M56 A;  3M54 A;  3PDN A;  4RZ0 A;  2F69 A;  3SW9 A;  2QPW A;  4QEP A;  3RAY A;  3KMJ A;  3RJW A;  3K5K A;  5ARG A;  3S8P A;  5EX0 A;  2W5Y A;  3VV0 A;  3EP0 A;  3SWC A;  3MEK A;  5ARF A;  4JDS A;  5JIY A;  4NJ5 A;  1XQH A;  5TEG A;  3RU0 A;  3F9Z A;  3OS5 A;  4NVQ A;  3M5A A;  1MT6 A;  4QEN A;  1ML9 A;  3S7B A;  3TG4 A;  5F5E A;  4YPE A;  5TTF A;  4C1Q A;  1MVX A;  1N6C A;  3OXF A;  3FPD A;  1N3J A;  3RQ4 A;  4MI5 A;  3N71 A;  4E47 A;  5KJK A;  5LSZ A;  2IGQ A;  5TH7 A;  4JLG A;  5JIN A;  3MO0 A;  3HNA A;  3M58 A;  5JHN A;  3M53 A;  3KMT A;  4YNP A;  4J8O A;  5CCL A;  3BO5 A;  2JV0 A;  3CBM A;  4AU7 A;  4J83 A;  3DAL A;  4J7F A;  5T0K A;  5F59 A;  4MI0 A;  5AYF A;  4FMU A;  1ZKK A;  4QEO A;  5KJL A;  1PEG A;  4H12 A;  3OPE A;  3IHX A;  5HQ8 A;  1H3I A;  4YPA A;  4WUY A;  3QWV A;  3KMA A;  4O30 A;  4J7I A;  3MO2 A;  5T5G A;  3RIB A;  4YPU A;  3DB5 A;  5KJN A;  3F9Y A;  5CPR B;  5T0M A;  3QWP A;  3M57 A;  3CBO A;  2W5Z A;  3OXL A;  5F6L A;  5LSX A;  1MUF A;  3VUZ A;  3M55 A;  4I51 A;  4YND A;  3TG5 A;  3OOI A;  4IJ8 A;  3F9X A;  4YNM A;  1O9S A;  4O6F A;  5EX3 A;  5F6K C;  1MVH A;  5HI7 A;  3MO5 A;  3S7D A;  4BUP A;  2BQZ A;  3QWW A;  2R3A A;  2O8J A; 
#chains in the Genus database with same CATH homology
 4IJD A;  3OXG A;  4LDG A;  3M59 A;  1N6A A;  5CCM A;  3S7F A;  5JJ0 A;  3F9W A;  5KJM A;  3S7J A;  5EG2 A;  4Z4P A;  2RFI A;  3CBP A;  2G46 A;  3M56 A;  3M54 A;  3PDN A;  4RZ0 A;  2F69 A;  3SW9 A;  2QPW A;  4QEP A;  3RAY A;  3KMJ A;  3RJW A;  3K5K A;  5ARG A;  3S8P A;  5EX0 A;  2W5Y A;  3VV0 A;  3EP0 A;  3SWC A;  3MEK A;  5ARF A;  4JDS A;  5JIY A;  4NJ5 A;  1XQH A;  5TEG A;  3RU0 A;  3F9Z A;  3OS5 A;  4NVQ A;  3M5A A;  1MT6 A;  4QEN A;  1ML9 A;  3S7B A;  3TG4 A;  5F5E A;  4YPE A;  5TTF A;  4C1Q A;  1MVX A;  1N6C A;  3OXF A;  3FPD A;  1N3J A;  3RQ4 A;  4MI5 A;  3N71 A;  4E47 A;  5KJK A;  5LSZ A;  2IGQ A;  5TH7 A;  4JLG A;  5JIN A;  3MO0 A;  3HNA A;  3M58 A;  5JHN A;  3M53 A;  3KMT A;  4YNP A;  4J8O A;  5CCL A;  3BO5 A;  2JV0 A;  3CBM A;  4AU7 A;  4J83 A;  3DAL A;  4J7F A;  5T0K A;  5F59 A;  4MI0 A;  5AYF A;  4FMU A;  1ZKK A;  4QEO A;  5KJL A;  1PEG A;  4H12 A;  3OPE A;  3IHX A;  5HQ8 A;  1H3I A;  4YPA A;  4WUY A;  3QWV A;  3KMA A;  4O30 A;  4J7I A;  3MO2 A;  5T5G A;  3RIB A;  4YPU A;  3DB5 A;  5KJN A;  3F9Y A;  5CPR B;  5T0M A;  3QWP A;  3M57 A;  3CBO A;  2W5Z A;  3OXL A;  5F6L A;  5LSX A;  1MUF A;  3VUZ A;  3M55 A;  4I51 A;  4YND A;  3TG5 A;  3OOI A;  4IJ8 A;  3F9X A;  4YNM A;  1O9S A;  4O6F A;  5EX3 A;  5F6K C;  1MVH A;  5HI7 A;  3MO5 A;  3S7D A;  4BUP A;  2BQZ A;  3QWW A;  2R3A A;  2O8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...