2JV0A

Set domain of riz1 tumor suppressor (prdm2)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
162
Chain Sequence
GSMDQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYGEDNPEIAAAIEEERASARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of the SET domain from RIZ1 tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PR domain zinc finger protein 2
total genus 18
structure length 162
sequence length 163
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2jv0A01
1MUFA 1XQHA 3F9WA 4QENA 5T0KA 3KMAA 4IJDA 4AU7A 2IGQA 2QPWA 4IJ8A 2W5ZA 2R3AA 3S7DA 3IHXA 3S8PA 4J7FA 3M53A 5KJMA 4J7IA 3DB5A 5TTFA 3OS5A 3RU0A 2O8JA 3OXLA 3S7BA 4QEPA 4JLGA 5JIYA 5T5GA 3OPEA 3M56A 5F6KC 3F9YA 4O6FA 5LSXA 4YNMA 2JV0A 3RJWA 3MO2A 1H3IA 5KJKA 4YPEA 3S7JA 5JJ0A 1N3JA 3HNAA 3M54A 4FMUA 4YPUA 3RQ4A 5F5EA 3M5AA 3F9XA 4J8OA 3KMTA 5EX0A 3CBOA 3K5KA 5TEGA 3MEKA 3M55A 3TG4A 1PEGA 5F6LA 3SW9A 5CPRB 3QWVA 2G46A 3N71A 5KJLA 3QWWA 3KMJA 4RZ0A 5TH7A 1N6AA 3OOIA 4C1QA 3CBMA 4BUPA 5EX3A 3F9ZA 5EG2A 4YNPA 1O9SA 4H12A 4I51A 4Z4PA 5JINA 5T0MA 3RIBA 2RFIA 3VV0A 3OXFA 4YPAA 3M58A 3PDNA 1N6CA 3MO5A 4J83A 4LDGA 4E47A 5ARFA 4WUYA 3MO0A 3OXGA 4YNDA 5AYFA 3CBPA 5F59A 5LSZA 3QWPA 4QEOA 4MI0A 3DALA 4MI5A 2F69A 1ML9A 3S7FA 4NVQA 5HI7A 3RAYA 4NJ5A 1MT6A 5HQ8A 3TG5A 2BQZA 3BO5A 1MVXA 3EP0A 3VUZA 1MVHA 3M57A 5CCMA 5CCLA 3M59A 4O30A 5ARGA 5JHNA 2W5YA 3FPDA 4JDSA 5KJNA 1ZKKA 3SWCA
chains in the Genus database with same CATH superfamily
1MUFA 1XQHA 3F9WA 4QENA 5T0KA 3KMAA 4IJDA 4AU7A 2IGQA 2QPWA 4IJ8A 2W5ZA 2R3AA 3S7DA 3IHXA 3S8PA 4J7FA 3M53A 5KJMA 4J7IA 3DB5A 5TTFA 3OS5A 3RU0A 2O8JA 3OXLA 3S7BA 4QEPA 4JLGA 5JIYA 5T5GA 3OPEA 3M56A 5F6KC 3F9YA 4O6FA 5LSXA 4YNMA 2JV0A 3RJWA 3MO2A 1H3IA 5KJKA 4YPEA 3S7JA 5JJ0A 1N3JA 3HNAA 3M54A 4FMUA 4YPUA 3RQ4A 5F5EA 3M5AA 3F9XA 4J8OA 3KMTA 5EX0A 3CBOA 3K5KA 5TEGA 3MEKA 3M55A 3TG4A 1PEGA 5F6LA 3SW9A 5CPRB 3QWVA 2G46A 3N71A 5KJLA 3QWWA 3KMJA 4RZ0A 5TH7A 1N6AA 3OOIA 4C1QA 3CBMA 4BUPA 5EX3A 3F9ZA 5EG2A 4YNPA 1O9SA 4H12A 4I51A 4Z4PA 5JINA 5T0MA 3RIBA 2RFIA 3VV0A 3OXFA 4YPAA 3M58A 3PDNA 1N6CA 3MO5A 4J83A 4LDGA 4E47A 5ARFA 4WUYA 3MO0A 3OXGA 4YNDA 5AYFA 3CBPA 5F59A 5LSZA 3QWPA 4QEOA 4MI0A 3DALA 4MI5A 2F69A 1ML9A 3S7FA 4NVQA 5HI7A 3RAYA 4NJ5A 1MT6A 5HQ8A 3TG5A 2BQZA 3BO5A 1MVXA 3EP0A 3VUZA 1MVHA 3M57A 5CCMA 5CCLA 3M59A 4O30A 5ARGA 5JHNA 2W5YA 3FPDA 4JDSA 5KJNA 1ZKKA 3SWCA
chains in the Genus database with same CATH topology
1MUFA 1XQHA 3F9WA 4QENA 5T0KA 3KMAA 4IJDA 4AU7A 2IGQA 2QPWA 4IJ8A 2W5ZA 2R3AA 3S7DA 3IHXA 3S8PA 4J7FA 3M53A 5KJMA 4J7IA 3DB5A 5TTFA 3OS5A 3RU0A 2O8JA 3OXLA 3S7BA 4QEPA 4JLGA 5JIYA 5T5GA 3OPEA 3M56A 5F6KC 3F9YA 4O6FA 5LSXA 4YNMA 2JV0A 3RJWA 3MO2A 1H3IA 5KJKA 4YPEA 3S7JA 5JJ0A 1N3JA 3HNAA 3M54A 4FMUA 4YPUA 3RQ4A 5F5EA 3M5AA 3F9XA 4J8OA 3KMTA 5EX0A 3CBOA 3K5KA 5TEGA 3MEKA 3M55A 3TG4A 1PEGA 5F6LA 3SW9A 5CPRB 3QWVA 2G46A 3N71A 5KJLA 3QWWA 3KMJA 4RZ0A 5TH7A 1N6AA 3OOIA 4C1QA 3CBMA 4BUPA 5EX3A 3F9ZA 5EG2A 4YNPA 1O9SA 4H12A 4I51A 4Z4PA 5JINA 5T0MA 3RIBA 2RFIA 3VV0A 3OXFA 4YPAA 3M58A 3PDNA 1N6CA 3MO5A 4J83A 4LDGA 4E47A 5ARFA 4WUYA 3MO0A 3OXGA 4YNDA 5AYFA 3CBPA 5F59A 5LSZA 3QWPA 4QEOA 4MI0A 3DALA 4MI5A 2F69A 1ML9A 3S7FA 4NVQA 5HI7A 3RAYA 4NJ5A 1MT6A 5HQ8A 3TG5A 2BQZA 3BO5A 1MVXA 3EP0A 3VUZA 1MVHA 3M57A 5CCMA 5CCLA 3M59A 4O30A 5ARGA 5JHNA 2W5YA 3FPDA 4JDSA 5KJNA 1ZKKA 3SWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUF A;  1XQH A;  3F9W A;  4QEN A;  5T0K A;  3KMA A;  4IJD A;  4AU7 A;  2IGQ A;  2QPW A;  4IJ8 A;  2W5Z A;  2R3A A;  3S7D A;  3IHX A;  3S8P A;  4J7F A;  3M53 A;  5KJM A;  4J7I A;  3DB5 A;  5TTF A;  3OS5 A;  3RU0 A;  2O8J A;  3OXL A;  3S7B A;  4QEP A;  4JLG A;  5JIY A;  5T5G A;  3OPE A;  3M56 A;  5F6K C;  3F9Y A;  4O6F A;  5LSX A;  4YNM A;  2JV0 A;  3RJW A;  3MO2 A;  1H3I A;  5KJK A;  4YPE A;  3S7J A;  5JJ0 A;  1N3J A;  3HNA A;  3M54 A;  4FMU A;  4YPU A;  3RQ4 A;  5F5E A;  3M5A A;  3F9X A;  4J8O A;  3KMT A;  5EX0 A;  3CBO A;  3K5K A;  5TEG A;  3MEK A;  3M55 A;  3TG4 A;  1PEG A;  5F6L A;  3SW9 A;  5CPR B;  3QWV A;  2G46 A;  3N71 A;  5KJL A;  3QWW A;  3KMJ A;  4RZ0 A;  5TH7 A;  1N6A A;  3OOI A;  4C1Q A;  3CBM A;  4BUP A;  5EX3 A;  3F9Z A;  5EG2 A;  4YNP A;  1O9S A;  4H12 A;  4I51 A;  4Z4P A;  5JIN A;  5T0M A;  3RIB A;  2RFI A;  3VV0 A;  3OXF A;  4YPA A;  3M58 A;  3PDN A;  1N6C A;  3MO5 A;  4J83 A;  4LDG A;  4E47 A;  5ARF A;  4WUY A;  3MO0 A;  3OXG A;  4YND A;  5AYF A;  3CBP A;  5F59 A;  5LSZ A;  3QWP A;  4QEO A;  4MI0 A;  3DAL A;  4MI5 A;  2F69 A;  1ML9 A;  3S7F A;  4NVQ A;  5HI7 A;  3RAY A;  4NJ5 A;  1MT6 A;  5HQ8 A;  3TG5 A;  2BQZ A;  3BO5 A;  1MVX A;  3EP0 A;  3VUZ A;  1MVH A;  3M57 A;  5CCM A;  5CCL A;  3M59 A;  4O30 A;  5ARG A;  5JHN A;  2W5Y A;  3FPD A;  4JDS A;  5KJN A;  1ZKK A;  3SWC A; 
#chains in the Genus database with same CATH topology
 1MUF A;  1XQH A;  3F9W A;  4QEN A;  5T0K A;  3KMA A;  4IJD A;  4AU7 A;  2IGQ A;  2QPW A;  4IJ8 A;  2W5Z A;  2R3A A;  3S7D A;  3IHX A;  3S8P A;  4J7F A;  3M53 A;  5KJM A;  4J7I A;  3DB5 A;  5TTF A;  3OS5 A;  3RU0 A;  2O8J A;  3OXL A;  3S7B A;  4QEP A;  4JLG A;  5JIY A;  5T5G A;  3OPE A;  3M56 A;  5F6K C;  3F9Y A;  4O6F A;  5LSX A;  4YNM A;  2JV0 A;  3RJW A;  3MO2 A;  1H3I A;  5KJK A;  4YPE A;  3S7J A;  5JJ0 A;  1N3J A;  3HNA A;  3M54 A;  4FMU A;  4YPU A;  3RQ4 A;  5F5E A;  3M5A A;  3F9X A;  4J8O A;  3KMT A;  5EX0 A;  3CBO A;  3K5K A;  5TEG A;  3MEK A;  3M55 A;  3TG4 A;  1PEG A;  5F6L A;  3SW9 A;  5CPR B;  3QWV A;  2G46 A;  3N71 A;  5KJL A;  3QWW A;  3KMJ A;  4RZ0 A;  5TH7 A;  1N6A A;  3OOI A;  4C1Q A;  3CBM A;  4BUP A;  5EX3 A;  3F9Z A;  5EG2 A;  4YNP A;  1O9S A;  4H12 A;  4I51 A;  4Z4P A;  5JIN A;  5T0M A;  3RIB A;  2RFI A;  3VV0 A;  3OXF A;  4YPA A;  3M58 A;  3PDN A;  1N6C A;  3MO5 A;  4J83 A;  4LDG A;  4E47 A;  5ARF A;  4WUY A;  3MO0 A;  3OXG A;  4YND A;  5AYF A;  3CBP A;  5F59 A;  5LSZ A;  3QWP A;  4QEO A;  4MI0 A;  3DAL A;  4MI5 A;  2F69 A;  1ML9 A;  3S7F A;  4NVQ A;  5HI7 A;  3RAY A;  4NJ5 A;  1MT6 A;  5HQ8 A;  3TG5 A;  2BQZ A;  3BO5 A;  1MVX A;  3EP0 A;  3VUZ A;  1MVH A;  3M57 A;  5CCM A;  5CCL A;  3M59 A;  4O30 A;  5ARG A;  5JHN A;  2W5Y A;  3FPD A;  4JDS A;  5KJN A;  1ZKK A;  3SWC A; 
#chains in the Genus database with same CATH homology
 1MUF A;  1XQH A;  3F9W A;  4QEN A;  5T0K A;  3KMA A;  4IJD A;  4AU7 A;  2IGQ A;  2QPW A;  4IJ8 A;  2W5Z A;  2R3A A;  3S7D A;  3IHX A;  3S8P A;  4J7F A;  3M53 A;  5KJM A;  4J7I A;  3DB5 A;  5TTF A;  3OS5 A;  3RU0 A;  2O8J A;  3OXL A;  3S7B A;  4QEP A;  4JLG A;  5JIY A;  5T5G A;  3OPE A;  3M56 A;  5F6K C;  3F9Y A;  4O6F A;  5LSX A;  4YNM A;  2JV0 A;  3RJW A;  3MO2 A;  1H3I A;  5KJK A;  4YPE A;  3S7J A;  5JJ0 A;  1N3J A;  3HNA A;  3M54 A;  4FMU A;  4YPU A;  3RQ4 A;  5F5E A;  3M5A A;  3F9X A;  4J8O A;  3KMT A;  5EX0 A;  3CBO A;  3K5K A;  5TEG A;  3MEK A;  3M55 A;  3TG4 A;  1PEG A;  5F6L A;  3SW9 A;  5CPR B;  3QWV A;  2G46 A;  3N71 A;  5KJL A;  3QWW A;  3KMJ A;  4RZ0 A;  5TH7 A;  1N6A A;  3OOI A;  4C1Q A;  3CBM A;  4BUP A;  5EX3 A;  3F9Z A;  5EG2 A;  4YNP A;  1O9S A;  4H12 A;  4I51 A;  4Z4P A;  5JIN A;  5T0M A;  3RIB A;  2RFI A;  3VV0 A;  3OXF A;  4YPA A;  3M58 A;  3PDN A;  1N6C A;  3MO5 A;  4J83 A;  4LDG A;  4E47 A;  5ARF A;  4WUY A;  3MO0 A;  3OXG A;  4YND A;  5AYF A;  3CBP A;  5F59 A;  5LSZ A;  3QWP A;  4QEO A;  4MI0 A;  3DAL A;  4MI5 A;  2F69 A;  1ML9 A;  3S7F A;  4NVQ A;  5HI7 A;  3RAY A;  4NJ5 A;  1MT6 A;  5HQ8 A;  3TG5 A;  2BQZ A;  3BO5 A;  1MVX A;  3EP0 A;  3VUZ A;  1MVH A;  3M57 A;  5CCM A;  5CCL A;  3M59 A;  4O30 A;  5ARG A;  5JHN A;  2W5Y A;  3FPD A;  4JDS A;  5KJN A;  1ZKK A;  3SWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...