2JV0A

Set domain of riz1 tumor suppressor (prdm2)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
162
Chain Sequence
b'GSMDQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYGEDNPEIAAAIEEERASARS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 2
publication title Structural studies of the SET domain from RIZ1 tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 18
structure length 162
sequence length 163
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2jv0A01
4WUYA 5KJNA 2F69A 2W5ZA 5F6LA 4QEPA 4J83A 4RZ0A 3K5KA 5F59A 4AU7A 5KJMA 4MI0A 3S7BA 4IJ8A 5HQ8A 5F5EA 3OOIA 4LDGA 1XQHA 1O9SA 4YNPA 3M58A 3CBMA 3OPEA 3QWVA 3S7DA 3TG5A 4FMUA 5EX0A 1N6CA 3VV0A 3MO2A 2R3AA 4I51A 5HI7A 3KMTA 5JIYA 4YPUA 5ARFA 3RAYA 1N6AA 4JDSA 5TTFA 5T5GA 3SW9A 4C1QA 4O30A 3HNAA 3F9YA 4E47A 1ML9A 3BO5A 5KJLA 1MVHA 4NVQA 2G46A 3KMAA 4YNDA 4J7FA 5CCMA 5AYFA 3OS5A 2BQZA 4BUPA 4NJ5A 4QEOA 2W5YA 2JV0A 1MT6A 5JHNA 5F6KC 3DALA 1H3IA 3OXLA 2O8JA 3MO0A 3TG4A 1N3JA 5JJ0A 5T0KA 4MI5A 5TEGA 3F9WA 5CPRB 3CBPA 3F9XA 4J7IA 3S7JA 4YPAA 3RIBA 3RQ4A 3CBOA 3FPDA 3MO5A 5EG2A 3M59A 1MVXA 3QWWA 1ZKKA 3DB5A 3M53A 3VUZA 3QWPA 3IHXA 3S7FA 5T0MA 4YPEA 3RU0A 5CCLA 5KJKA 4O6FA 3M55A 4J8OA 3S8PA 4QENA 3M57A 4H12A 3M5AA 5LSXA 4YNMA 2QPWA 1PEGA 3M54A 3PDNA 5ARGA 5EX3A 2RFIA 3SWCA 3MEKA 5TH7A 3F9ZA 5JINA 4IJDA 3KMJA 3OXFA 3EP0A 4Z4PA 3RJWA 3OXGA 3M56A 1MUFA 3N71A 4JLGA 2IGQA 5LSZA
chains in the Genus database with same CATH superfamily
4WUYA 5KJNA 2F69A 2W5ZA 5F6LA 4QEPA 4J83A 4RZ0A 3K5KA 5F59A 4AU7A 5KJMA 4MI0A 3S7BA 4IJ8A 5HQ8A 5F5EA 3OOIA 4LDGA 1XQHA 1O9SA 4YNPA 3M58A 3CBMA 3OPEA 3QWVA 3S7DA 3TG5A 4FMUA 5EX0A 1N6CA 3VV0A 3MO2A 2R3AA 4I51A 5HI7A 3KMTA 5JIYA 4YPUA 5ARFA 3RAYA 1N6AA 4JDSA 5TTFA 5T5GA 3SW9A 4C1QA 4O30A 3HNAA 3F9YA 4E47A 1ML9A 3BO5A 5KJLA 1MVHA 4NVQA 2G46A 3KMAA 4YNDA 4J7FA 5CCMA 5AYFA 3OS5A 2BQZA 4BUPA 4NJ5A 4QEOA 2W5YA 2JV0A 1MT6A 5JHNA 5F6KC 3DALA 1H3IA 3OXLA 2O8JA 3MO0A 3TG4A 1N3JA 5JJ0A 5T0KA 4MI5A 5TEGA 3F9WA 5CPRB 3CBPA 3F9XA 4J7IA 3S7JA 4YPAA 3RIBA 3RQ4A 3CBOA 3FPDA 3MO5A 5EG2A 3M59A 1MVXA 3QWWA 1ZKKA 3DB5A 3M53A 3VUZA 3QWPA 3IHXA 3S7FA 5T0MA 4YPEA 3RU0A 5CCLA 5KJKA 4O6FA 3M55A 4J8OA 3S8PA 4QENA 3M57A 4H12A 3M5AA 5LSXA 4YNMA 2QPWA 1PEGA 3M54A 3PDNA 5ARGA 5EX3A 2RFIA 3SWCA 3MEKA 5TH7A 3F9ZA 5JINA 4IJDA 3KMJA 3OXFA 3EP0A 4Z4PA 3RJWA 3OXGA 3M56A 1MUFA 3N71A 4JLGA 2IGQA 5LSZA
chains in the Genus database with same CATH topology
4WUYA 5KJNA 2F69A 2W5ZA 5F6LA 4QEPA 4J83A 4RZ0A 3K5KA 5F59A 4AU7A 5KJMA 4MI0A 3S7BA 4IJ8A 5HQ8A 5F5EA 3OOIA 4LDGA 1XQHA 1O9SA 4YNPA 3M58A 3CBMA 3OPEA 3QWVA 3S7DA 3TG5A 4FMUA 5EX0A 1N6CA 3VV0A 3MO2A 2R3AA 4I51A 5HI7A 3KMTA 5JIYA 4YPUA 5ARFA 3RAYA 1N6AA 4JDSA 5TTFA 5T5GA 3SW9A 4C1QA 4O30A 3HNAA 3F9YA 4E47A 1ML9A 3BO5A 5KJLA 1MVHA 4NVQA 2G46A 3KMAA 4YNDA 4J7FA 5CCMA 5AYFA 3OS5A 2BQZA 4BUPA 4NJ5A 4QEOA 2W5YA 2JV0A 1MT6A 5JHNA 5F6KC 3DALA 1H3IA 3OXLA 2O8JA 3MO0A 3TG4A 1N3JA 5JJ0A 5T0KA 4MI5A 5TEGA 3F9WA 5CPRB 3CBPA 3F9XA 4J7IA 3S7JA 4YPAA 3RIBA 3RQ4A 3CBOA 3FPDA 3MO5A 5EG2A 3M59A 1MVXA 3QWWA 1ZKKA 3DB5A 3M53A 3VUZA 3QWPA 3IHXA 3S7FA 5T0MA 4YPEA 3RU0A 5CCLA 5KJKA 4O6FA 3M55A 4J8OA 3S8PA 4QENA 3M57A 4H12A 3M5AA 5LSXA 4YNMA 2QPWA 1PEGA 3M54A 3PDNA 5ARGA 5EX3A 2RFIA 3SWCA 3MEKA 5TH7A 3F9ZA 5JINA 4IJDA 3KMJA 3OXFA 3EP0A 4Z4PA 3RJWA 3OXGA 3M56A 1MUFA 3N71A 4JLGA 2IGQA 5LSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUY A;  5KJN A;  2F69 A;  2W5Z A;  5F6L A;  4QEP A;  4J83 A;  4RZ0 A;  3K5K A;  5F59 A;  4AU7 A;  5KJM A;  4MI0 A;  3S7B A;  4IJ8 A;  5HQ8 A;  5F5E A;  3OOI A;  4LDG A;  1XQH A;  1O9S A;  4YNP A;  3M58 A;  3CBM A;  3OPE A;  3QWV A;  3S7D A;  3TG5 A;  4FMU A;  5EX0 A;  1N6C A;  3VV0 A;  3MO2 A;  2R3A A;  4I51 A;  5HI7 A;  3KMT A;  5JIY A;  4YPU A;  5ARF A;  3RAY A;  1N6A A;  4JDS A;  5TTF A;  5T5G A;  3SW9 A;  4C1Q A;  4O30 A;  3HNA A;  3F9Y A;  4E47 A;  1ML9 A;  3BO5 A;  5KJL A;  1MVH A;  4NVQ A;  2G46 A;  3KMA A;  4YND A;  4J7F A;  5CCM A;  5AYF A;  3OS5 A;  2BQZ A;  4BUP A;  4NJ5 A;  4QEO A;  2W5Y A;  2JV0 A;  1MT6 A;  5JHN A;  5F6K C;  3DAL A;  1H3I A;  3OXL A;  2O8J A;  3MO0 A;  3TG4 A;  1N3J A;  5JJ0 A;  5T0K A;  4MI5 A;  5TEG A;  3F9W A;  5CPR B;  3CBP A;  3F9X A;  4J7I A;  3S7J A;  4YPA A;  3RIB A;  3RQ4 A;  3CBO A;  3FPD A;  3MO5 A;  5EG2 A;  3M59 A;  1MVX A;  3QWW A;  1ZKK A;  3DB5 A;  3M53 A;  3VUZ A;  3QWP A;  3IHX A;  3S7F A;  5T0M A;  4YPE A;  3RU0 A;  5CCL A;  5KJK A;  4O6F A;  3M55 A;  4J8O A;  3S8P A;  4QEN A;  3M57 A;  4H12 A;  3M5A A;  5LSX A;  4YNM A;  2QPW A;  1PEG A;  3M54 A;  3PDN A;  5ARG A;  5EX3 A;  2RFI A;  3SWC A;  3MEK A;  5TH7 A;  3F9Z A;  5JIN A;  4IJD A;  3KMJ A;  3OXF A;  3EP0 A;  4Z4P A;  3RJW A;  3OXG A;  3M56 A;  1MUF A;  3N71 A;  4JLG A;  2IGQ A;  5LSZ A; 
#chains in the Genus database with same CATH topology
 4WUY A;  5KJN A;  2F69 A;  2W5Z A;  5F6L A;  4QEP A;  4J83 A;  4RZ0 A;  3K5K A;  5F59 A;  4AU7 A;  5KJM A;  4MI0 A;  3S7B A;  4IJ8 A;  5HQ8 A;  5F5E A;  3OOI A;  4LDG A;  1XQH A;  1O9S A;  4YNP A;  3M58 A;  3CBM A;  3OPE A;  3QWV A;  3S7D A;  3TG5 A;  4FMU A;  5EX0 A;  1N6C A;  3VV0 A;  3MO2 A;  2R3A A;  4I51 A;  5HI7 A;  3KMT A;  5JIY A;  4YPU A;  5ARF A;  3RAY A;  1N6A A;  4JDS A;  5TTF A;  5T5G A;  3SW9 A;  4C1Q A;  4O30 A;  3HNA A;  3F9Y A;  4E47 A;  1ML9 A;  3BO5 A;  5KJL A;  1MVH A;  4NVQ A;  2G46 A;  3KMA A;  4YND A;  4J7F A;  5CCM A;  5AYF A;  3OS5 A;  2BQZ A;  4BUP A;  4NJ5 A;  4QEO A;  2W5Y A;  2JV0 A;  1MT6 A;  5JHN A;  5F6K C;  3DAL A;  1H3I A;  3OXL A;  2O8J A;  3MO0 A;  3TG4 A;  1N3J A;  5JJ0 A;  5T0K A;  4MI5 A;  5TEG A;  3F9W A;  5CPR B;  3CBP A;  3F9X A;  4J7I A;  3S7J A;  4YPA A;  3RIB A;  3RQ4 A;  3CBO A;  3FPD A;  3MO5 A;  5EG2 A;  3M59 A;  1MVX A;  3QWW A;  1ZKK A;  3DB5 A;  3M53 A;  3VUZ A;  3QWP A;  3IHX A;  3S7F A;  5T0M A;  4YPE A;  3RU0 A;  5CCL A;  5KJK A;  4O6F A;  3M55 A;  4J8O A;  3S8P A;  4QEN A;  3M57 A;  4H12 A;  3M5A A;  5LSX A;  4YNM A;  2QPW A;  1PEG A;  3M54 A;  3PDN A;  5ARG A;  5EX3 A;  2RFI A;  3SWC A;  3MEK A;  5TH7 A;  3F9Z A;  5JIN A;  4IJD A;  3KMJ A;  3OXF A;  3EP0 A;  4Z4P A;  3RJW A;  3OXG A;  3M56 A;  1MUF A;  3N71 A;  4JLG A;  2IGQ A;  5LSZ A; 
#chains in the Genus database with same CATH homology
 4WUY A;  5KJN A;  2F69 A;  2W5Z A;  5F6L A;  4QEP A;  4J83 A;  4RZ0 A;  3K5K A;  5F59 A;  4AU7 A;  5KJM A;  4MI0 A;  3S7B A;  4IJ8 A;  5HQ8 A;  5F5E A;  3OOI A;  4LDG A;  1XQH A;  1O9S A;  4YNP A;  3M58 A;  3CBM A;  3OPE A;  3QWV A;  3S7D A;  3TG5 A;  4FMU A;  5EX0 A;  1N6C A;  3VV0 A;  3MO2 A;  2R3A A;  4I51 A;  5HI7 A;  3KMT A;  5JIY A;  4YPU A;  5ARF A;  3RAY A;  1N6A A;  4JDS A;  5TTF A;  5T5G A;  3SW9 A;  4C1Q A;  4O30 A;  3HNA A;  3F9Y A;  4E47 A;  1ML9 A;  3BO5 A;  5KJL A;  1MVH A;  4NVQ A;  2G46 A;  3KMA A;  4YND A;  4J7F A;  5CCM A;  5AYF A;  3OS5 A;  2BQZ A;  4BUP A;  4NJ5 A;  4QEO A;  2W5Y A;  2JV0 A;  1MT6 A;  5JHN A;  5F6K C;  3DAL A;  1H3I A;  3OXL A;  2O8J A;  3MO0 A;  3TG4 A;  1N3J A;  5JJ0 A;  5T0K A;  4MI5 A;  5TEG A;  3F9W A;  5CPR B;  3CBP A;  3F9X A;  4J7I A;  3S7J A;  4YPA A;  3RIB A;  3RQ4 A;  3CBO A;  3FPD A;  3MO5 A;  5EG2 A;  3M59 A;  1MVX A;  3QWW A;  1ZKK A;  3DB5 A;  3M53 A;  3VUZ A;  3QWP A;  3IHX A;  3S7F A;  5T0M A;  4YPE A;  3RU0 A;  5CCL A;  5KJK A;  4O6F A;  3M55 A;  4J8O A;  3S8P A;  4QEN A;  3M57 A;  4H12 A;  3M5A A;  5LSX A;  4YNM A;  2QPW A;  1PEG A;  3M54 A;  3PDN A;  5ARG A;  5EX3 A;  2RFI A;  3SWC A;  3MEK A;  5TH7 A;  3F9Z A;  5JIN A;  4IJD A;  3KMJ A;  3OXF A;  3EP0 A;  4Z4P A;  3RJW A;  3OXG A;  3M56 A;  1MUF A;  3N71 A;  4JLG A;  2IGQ A;  5LSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...