2JV0A

Set domain of riz1 tumor suppressor (prdm2)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
162
Chain Sequence
GSMDQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYGEDNPEIAAAIEEERASARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of the SET domain from RIZ1 tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PR domain zinc finger protein 2
total genus 18
structure length 162
sequence length 163
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2jv0A01
1O9SA 3OXLA 3RJWA 5TEGA 3BO5A 1ML9A 3S7JA 3M54A 5CCLA 4YNPA 4JLGA 4JDSA 5KJNA 5LSZA 4H12A 4J83A 3S7DA 3CBPA 5T5GA 4J7FA 3S7BA 3KMTA 4YNMA 1MUFA 4QEPA 3DB5A 3S7FA 5F59A 4BUPA 5ARGA 5HI7A 3RAYA 3MO5A 3SWCA 3MEKA 5JJ0A 3F9XA 5F6KC 3OS5A 5HQ8A 3VV0A 4NVQA 1N6CA 2R3AA 4LDGA 3M5AA 3TG5A 5EG2A 3M53A 4MI0A 4Z4PA 4QENA 2JV0A 2F69A 5TTFA 5LSXA 3PDNA 3S8PA 4C1QA 4YPAA 1ZKKA 4WUYA 3TG4A 2G46A 4YNDA 5EX3A 5T0KA 5CPRB 3F9YA 3RU0A 4J7IA 2W5YA 4YPUA 3RIBA 5F6LA 1N3JA 3KMJA 3OPEA 3QWWA 3MO2A 4O6FA 3OOIA 5TH7A 4AU7A 3MO0A 3QWPA 4J8OA 1XQHA 3DALA 3EP0A 5EX0A 4QEOA 3F9WA 3OXFA 5T0MA 3VUZA 4O30A 3SW9A 5ARFA 4FMUA 2QPWA 4E47A 3CBOA 3M58A 5JIYA 3N71A 4IJ8A 4I51A 5KJMA 3OXGA 5KJLA 2IGQA 3IHXA 1N6AA 5CCMA 5JINA 5F5EA 2W5ZA 1MVHA 3QWVA 5JHNA 3F9ZA 4MI5A 2O8JA 3FPDA 3M56A 4NJ5A 4RZ0A 3RQ4A 4IJDA 1MT6A 5KJKA 3KMAA 3HNAA 1MVXA 1H3IA 3M57A 3CBMA 5AYFA 3K5KA 3M59A 2BQZA 4YPEA 2RFIA 3M55A 1PEGA
chains in the Genus database with same CATH superfamily
1O9SA 3OXLA 3RJWA 5TEGA 3BO5A 1ML9A 3S7JA 3M54A 5CCLA 4YNPA 4JLGA 4JDSA 5KJNA 5LSZA 4H12A 4J83A 3S7DA 3CBPA 5T5GA 4J7FA 3S7BA 3KMTA 4YNMA 1MUFA 4QEPA 3DB5A 3S7FA 5F59A 4BUPA 5ARGA 5HI7A 3RAYA 3MO5A 3SWCA 3MEKA 5JJ0A 3F9XA 5F6KC 3OS5A 5HQ8A 3VV0A 4NVQA 1N6CA 2R3AA 4LDGA 3M5AA 3TG5A 5EG2A 3M53A 4MI0A 4Z4PA 4QENA 2JV0A 2F69A 5TTFA 5LSXA 3PDNA 3S8PA 4C1QA 4YPAA 1ZKKA 4WUYA 3TG4A 2G46A 4YNDA 5EX3A 5T0KA 5CPRB 3F9YA 3RU0A 4J7IA 2W5YA 4YPUA 3RIBA 5F6LA 1N3JA 3KMJA 3OPEA 3QWWA 3MO2A 4O6FA 3OOIA 5TH7A 4AU7A 3MO0A 3QWPA 4J8OA 1XQHA 3DALA 3EP0A 5EX0A 4QEOA 3F9WA 3OXFA 5T0MA 3VUZA 4O30A 3SW9A 5ARFA 4FMUA 2QPWA 4E47A 3CBOA 3M58A 5JIYA 3N71A 4IJ8A 4I51A 5KJMA 3OXGA 5KJLA 2IGQA 3IHXA 1N6AA 5CCMA 5JINA 5F5EA 2W5ZA 1MVHA 3QWVA 5JHNA 3F9ZA 4MI5A 2O8JA 3FPDA 3M56A 4NJ5A 4RZ0A 3RQ4A 4IJDA 1MT6A 5KJKA 3KMAA 3HNAA 1MVXA 1H3IA 3M57A 3CBMA 5AYFA 3K5KA 3M59A 2BQZA 4YPEA 2RFIA 3M55A 1PEGA
chains in the Genus database with same CATH topology
1O9SA 3OXLA 3RJWA 5TEGA 3BO5A 1ML9A 3S7JA 3M54A 5CCLA 4YNPA 4JLGA 4JDSA 5KJNA 5LSZA 4H12A 4J83A 3S7DA 3CBPA 5T5GA 4J7FA 3S7BA 3KMTA 4YNMA 1MUFA 4QEPA 3DB5A 3S7FA 5F59A 4BUPA 5ARGA 5HI7A 3RAYA 3MO5A 3SWCA 3MEKA 5JJ0A 3F9XA 5F6KC 3OS5A 5HQ8A 3VV0A 4NVQA 1N6CA 2R3AA 4LDGA 3M5AA 3TG5A 5EG2A 3M53A 4MI0A 4Z4PA 4QENA 2JV0A 2F69A 5TTFA 5LSXA 3PDNA 3S8PA 4C1QA 4YPAA 1ZKKA 4WUYA 3TG4A 2G46A 4YNDA 5EX3A 5T0KA 5CPRB 3F9YA 3RU0A 4J7IA 2W5YA 4YPUA 3RIBA 5F6LA 1N3JA 3KMJA 3OPEA 3QWWA 3MO2A 4O6FA 3OOIA 5TH7A 4AU7A 3MO0A 3QWPA 4J8OA 1XQHA 3DALA 3EP0A 5EX0A 4QEOA 3F9WA 3OXFA 5T0MA 3VUZA 4O30A 3SW9A 5ARFA 4FMUA 2QPWA 4E47A 3CBOA 3M58A 5JIYA 3N71A 4IJ8A 4I51A 5KJMA 3OXGA 5KJLA 2IGQA 3IHXA 1N6AA 5CCMA 5JINA 5F5EA 2W5ZA 1MVHA 3QWVA 5JHNA 3F9ZA 4MI5A 2O8JA 3FPDA 3M56A 4NJ5A 4RZ0A 3RQ4A 4IJDA 1MT6A 5KJKA 3KMAA 3HNAA 1MVXA 1H3IA 3M57A 3CBMA 5AYFA 3K5KA 3M59A 2BQZA 4YPEA 2RFIA 3M55A 1PEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9S A;  3OXL A;  3RJW A;  5TEG A;  3BO5 A;  1ML9 A;  3S7J A;  3M54 A;  5CCL A;  4YNP A;  4JLG A;  4JDS A;  5KJN A;  5LSZ A;  4H12 A;  4J83 A;  3S7D A;  3CBP A;  5T5G A;  4J7F A;  3S7B A;  3KMT A;  4YNM A;  1MUF A;  4QEP A;  3DB5 A;  3S7F A;  5F59 A;  4BUP A;  5ARG A;  5HI7 A;  3RAY A;  3MO5 A;  3SWC A;  3MEK A;  5JJ0 A;  3F9X A;  5F6K C;  3OS5 A;  5HQ8 A;  3VV0 A;  4NVQ A;  1N6C A;  2R3A A;  4LDG A;  3M5A A;  3TG5 A;  5EG2 A;  3M53 A;  4MI0 A;  4Z4P A;  4QEN A;  2JV0 A;  2F69 A;  5TTF A;  5LSX A;  3PDN A;  3S8P A;  4C1Q A;  4YPA A;  1ZKK A;  4WUY A;  3TG4 A;  2G46 A;  4YND A;  5EX3 A;  5T0K A;  5CPR B;  3F9Y A;  3RU0 A;  4J7I A;  2W5Y A;  4YPU A;  3RIB A;  5F6L A;  1N3J A;  3KMJ A;  3OPE A;  3QWW A;  3MO2 A;  4O6F A;  3OOI A;  5TH7 A;  4AU7 A;  3MO0 A;  3QWP A;  4J8O A;  1XQH A;  3DAL A;  3EP0 A;  5EX0 A;  4QEO A;  3F9W A;  3OXF A;  5T0M A;  3VUZ A;  4O30 A;  3SW9 A;  5ARF A;  4FMU A;  2QPW A;  4E47 A;  3CBO A;  3M58 A;  5JIY A;  3N71 A;  4IJ8 A;  4I51 A;  5KJM A;  3OXG A;  5KJL A;  2IGQ A;  3IHX A;  1N6A A;  5CCM A;  5JIN A;  5F5E A;  2W5Z A;  1MVH A;  3QWV A;  5JHN A;  3F9Z A;  4MI5 A;  2O8J A;  3FPD A;  3M56 A;  4NJ5 A;  4RZ0 A;  3RQ4 A;  4IJD A;  1MT6 A;  5KJK A;  3KMA A;  3HNA A;  1MVX A;  1H3I A;  3M57 A;  3CBM A;  5AYF A;  3K5K A;  3M59 A;  2BQZ A;  4YPE A;  2RFI A;  3M55 A;  1PEG A; 
#chains in the Genus database with same CATH topology
 1O9S A;  3OXL A;  3RJW A;  5TEG A;  3BO5 A;  1ML9 A;  3S7J A;  3M54 A;  5CCL A;  4YNP A;  4JLG A;  4JDS A;  5KJN A;  5LSZ A;  4H12 A;  4J83 A;  3S7D A;  3CBP A;  5T5G A;  4J7F A;  3S7B A;  3KMT A;  4YNM A;  1MUF A;  4QEP A;  3DB5 A;  3S7F A;  5F59 A;  4BUP A;  5ARG A;  5HI7 A;  3RAY A;  3MO5 A;  3SWC A;  3MEK A;  5JJ0 A;  3F9X A;  5F6K C;  3OS5 A;  5HQ8 A;  3VV0 A;  4NVQ A;  1N6C A;  2R3A A;  4LDG A;  3M5A A;  3TG5 A;  5EG2 A;  3M53 A;  4MI0 A;  4Z4P A;  4QEN A;  2JV0 A;  2F69 A;  5TTF A;  5LSX A;  3PDN A;  3S8P A;  4C1Q A;  4YPA A;  1ZKK A;  4WUY A;  3TG4 A;  2G46 A;  4YND A;  5EX3 A;  5T0K A;  5CPR B;  3F9Y A;  3RU0 A;  4J7I A;  2W5Y A;  4YPU A;  3RIB A;  5F6L A;  1N3J A;  3KMJ A;  3OPE A;  3QWW A;  3MO2 A;  4O6F A;  3OOI A;  5TH7 A;  4AU7 A;  3MO0 A;  3QWP A;  4J8O A;  1XQH A;  3DAL A;  3EP0 A;  5EX0 A;  4QEO A;  3F9W A;  3OXF A;  5T0M A;  3VUZ A;  4O30 A;  3SW9 A;  5ARF A;  4FMU A;  2QPW A;  4E47 A;  3CBO A;  3M58 A;  5JIY A;  3N71 A;  4IJ8 A;  4I51 A;  5KJM A;  3OXG A;  5KJL A;  2IGQ A;  3IHX A;  1N6A A;  5CCM A;  5JIN A;  5F5E A;  2W5Z A;  1MVH A;  3QWV A;  5JHN A;  3F9Z A;  4MI5 A;  2O8J A;  3FPD A;  3M56 A;  4NJ5 A;  4RZ0 A;  3RQ4 A;  4IJD A;  1MT6 A;  5KJK A;  3KMA A;  3HNA A;  1MVX A;  1H3I A;  3M57 A;  3CBM A;  5AYF A;  3K5K A;  3M59 A;  2BQZ A;  4YPE A;  2RFI A;  3M55 A;  1PEG A; 
#chains in the Genus database with same CATH homology
 1O9S A;  3OXL A;  3RJW A;  5TEG A;  3BO5 A;  1ML9 A;  3S7J A;  3M54 A;  5CCL A;  4YNP A;  4JLG A;  4JDS A;  5KJN A;  5LSZ A;  4H12 A;  4J83 A;  3S7D A;  3CBP A;  5T5G A;  4J7F A;  3S7B A;  3KMT A;  4YNM A;  1MUF A;  4QEP A;  3DB5 A;  3S7F A;  5F59 A;  4BUP A;  5ARG A;  5HI7 A;  3RAY A;  3MO5 A;  3SWC A;  3MEK A;  5JJ0 A;  3F9X A;  5F6K C;  3OS5 A;  5HQ8 A;  3VV0 A;  4NVQ A;  1N6C A;  2R3A A;  4LDG A;  3M5A A;  3TG5 A;  5EG2 A;  3M53 A;  4MI0 A;  4Z4P A;  4QEN A;  2JV0 A;  2F69 A;  5TTF A;  5LSX A;  3PDN A;  3S8P A;  4C1Q A;  4YPA A;  1ZKK A;  4WUY A;  3TG4 A;  2G46 A;  4YND A;  5EX3 A;  5T0K A;  5CPR B;  3F9Y A;  3RU0 A;  4J7I A;  2W5Y A;  4YPU A;  3RIB A;  5F6L A;  1N3J A;  3KMJ A;  3OPE A;  3QWW A;  3MO2 A;  4O6F A;  3OOI A;  5TH7 A;  4AU7 A;  3MO0 A;  3QWP A;  4J8O A;  1XQH A;  3DAL A;  3EP0 A;  5EX0 A;  4QEO A;  3F9W A;  3OXF A;  5T0M A;  3VUZ A;  4O30 A;  3SW9 A;  5ARF A;  4FMU A;  2QPW A;  4E47 A;  3CBO A;  3M58 A;  5JIY A;  3N71 A;  4IJ8 A;  4I51 A;  5KJM A;  3OXG A;  5KJL A;  2IGQ A;  3IHX A;  1N6A A;  5CCM A;  5JIN A;  5F5E A;  2W5Z A;  1MVH A;  3QWV A;  5JHN A;  3F9Z A;  4MI5 A;  2O8J A;  3FPD A;  3M56 A;  4NJ5 A;  4RZ0 A;  3RQ4 A;  4IJD A;  1MT6 A;  5KJK A;  3KMA A;  3HNA A;  1MVX A;  1H3I A;  3M57 A;  3CBM A;  5AYF A;  3K5K A;  3M59 A;  2BQZ A;  4YPE A;  2RFI A;  3M55 A;  1PEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...