2JV0A

Set domain of riz1 tumor suppressor (prdm2)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
162
Chain Sequence
GSMDQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYGEDNPEIAAAIEEERASARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 2
publication title Structural studies of the SET domain from RIZ1 tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 18
structure length 162
sequence length 163
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2jv0A01
4IJDA 4MI0A 3SW9A 5LSZA 3S7JA 5JHNA 3F9XA 3RIBA 3VUZA 5CCMA 3CBPA 3M59A 1H3IA 3S7BA 3SWCA 3F9WA 3M58A 1MVHA 3KMJA 5F5EA 5ARFA 5JIYA 4YNDA 1ML9A 3CBMA 3M55A 5JJ0A 3HNAA 3KMAA 3S8PA 4I51A 5JINA 4MI5A 1XQHA 4J7IA 1MVXA 3MO2A 4J83A 3EP0A 5F59A 3OXGA 5HI7A 3M5AA 3OOIA 5KJLA 4H12A 4AU7A 4O6FA 5EX3A 4Z4PA 5F6KC 4YPAA 2JV0A 4JDSA 3RQ4A 5ARGA 5TH7A 5HQ8A 3PDNA 1MUFA 4C1QA 1MT6A 3F9YA 2IGQA 3S7DA 4YNMA 3M56A 4YPUA 4FMUA 2W5YA 4NJ5A 3OPEA 3DB5A 4QEOA 1N3JA 3F9ZA 3M57A 3RU0A 4YNPA 3TG4A 2O8JA 2F69A 3IHXA 1N6CA 3M54A 4QENA 5TEGA 4J7FA 5EG2A 5T0KA 4IJ8A 4O30A 4YPEA 4WUYA 3KMTA 2BQZA 3CBOA 5F6LA 5LSXA 1N6AA 4JLGA 4LDGA 4BUPA 3MO5A 3S7FA 1O9SA 3TG5A 3M53A 2W5ZA 3RJWA 3QWPA 3MEKA 5EX0A 3K5KA 4NVQA 5CPRB 3MO0A 5CCLA 3OS5A 3QWWA 3QWVA 2RFIA 3OXFA 5TTFA 2G46A 3FPDA 5T0MA 4J8OA 3DALA 3VV0A 1ZKKA 3BO5A 3RAYA 1PEGA 5KJMA 4RZ0A 5KJKA 5T5GA 4QEPA 2R3AA 4E47A 3N71A 3OXLA 2QPWA 5KJNA 5AYFA
chains in the Genus database with same CATH superfamily
4IJDA 4MI0A 3SW9A 5LSZA 3S7JA 5JHNA 3F9XA 3RIBA 3VUZA 5CCMA 3CBPA 3M59A 1H3IA 3S7BA 3SWCA 3F9WA 3M58A 1MVHA 3KMJA 5F5EA 5ARFA 5JIYA 4YNDA 1ML9A 3CBMA 3M55A 5JJ0A 3HNAA 3KMAA 3S8PA 4I51A 5JINA 4MI5A 1XQHA 4J7IA 1MVXA 3MO2A 4J83A 3EP0A 5F59A 3OXGA 5HI7A 3M5AA 3OOIA 5KJLA 4H12A 4AU7A 4O6FA 5EX3A 4Z4PA 5F6KC 4YPAA 2JV0A 4JDSA 3RQ4A 5ARGA 5TH7A 5HQ8A 3PDNA 1MUFA 4C1QA 1MT6A 3F9YA 2IGQA 3S7DA 4YNMA 3M56A 4YPUA 4FMUA 2W5YA 4NJ5A 3OPEA 3DB5A 4QEOA 1N3JA 3F9ZA 3M57A 3RU0A 4YNPA 3TG4A 2O8JA 2F69A 3IHXA 1N6CA 3M54A 4QENA 5TEGA 4J7FA 5EG2A 5T0KA 4IJ8A 4O30A 4YPEA 4WUYA 3KMTA 2BQZA 3CBOA 5F6LA 5LSXA 1N6AA 4JLGA 4LDGA 4BUPA 3MO5A 3S7FA 1O9SA 3TG5A 3M53A 2W5ZA 3RJWA 3QWPA 3MEKA 5EX0A 3K5KA 4NVQA 5CPRB 3MO0A 5CCLA 3OS5A 3QWWA 3QWVA 2RFIA 3OXFA 5TTFA 2G46A 3FPDA 5T0MA 4J8OA 3DALA 3VV0A 1ZKKA 3BO5A 3RAYA 1PEGA 5KJMA 4RZ0A 5KJKA 5T5GA 4QEPA 2R3AA 4E47A 3N71A 3OXLA 2QPWA 5KJNA 5AYFA
chains in the Genus database with same CATH topology
4IJDA 4MI0A 3SW9A 5LSZA 3S7JA 5JHNA 3F9XA 3RIBA 3VUZA 5CCMA 3CBPA 3M59A 1H3IA 3S7BA 3SWCA 3F9WA 3M58A 1MVHA 3KMJA 5F5EA 5ARFA 5JIYA 4YNDA 1ML9A 3CBMA 3M55A 5JJ0A 3HNAA 3KMAA 3S8PA 4I51A 5JINA 4MI5A 1XQHA 4J7IA 1MVXA 3MO2A 4J83A 3EP0A 5F59A 3OXGA 5HI7A 3M5AA 3OOIA 5KJLA 4H12A 4AU7A 4O6FA 5EX3A 4Z4PA 5F6KC 4YPAA 2JV0A 4JDSA 3RQ4A 5ARGA 5TH7A 5HQ8A 3PDNA 1MUFA 4C1QA 1MT6A 3F9YA 2IGQA 3S7DA 4YNMA 3M56A 4YPUA 4FMUA 2W5YA 4NJ5A 3OPEA 3DB5A 4QEOA 1N3JA 3F9ZA 3M57A 3RU0A 4YNPA 3TG4A 2O8JA 2F69A 3IHXA 1N6CA 3M54A 4QENA 5TEGA 4J7FA 5EG2A 5T0KA 4IJ8A 4O30A 4YPEA 4WUYA 3KMTA 2BQZA 3CBOA 5F6LA 5LSXA 1N6AA 4JLGA 4LDGA 4BUPA 3MO5A 3S7FA 1O9SA 3TG5A 3M53A 2W5ZA 3RJWA 3QWPA 3MEKA 5EX0A 3K5KA 4NVQA 5CPRB 3MO0A 5CCLA 3OS5A 3QWWA 3QWVA 2RFIA 3OXFA 5TTFA 2G46A 3FPDA 5T0MA 4J8OA 3DALA 3VV0A 1ZKKA 3BO5A 3RAYA 1PEGA 5KJMA 4RZ0A 5KJKA 5T5GA 4QEPA 2R3AA 4E47A 3N71A 3OXLA 2QPWA 5KJNA 5AYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  4MI0 A;  3SW9 A;  5LSZ A;  3S7J A;  5JHN A;  3F9X A;  3RIB A;  3VUZ A;  5CCM A;  3CBP A;  3M59 A;  1H3I A;  3S7B A;  3SWC A;  3F9W A;  3M58 A;  1MVH A;  3KMJ A;  5F5E A;  5ARF A;  5JIY A;  4YND A;  1ML9 A;  3CBM A;  3M55 A;  5JJ0 A;  3HNA A;  3KMA A;  3S8P A;  4I51 A;  5JIN A;  4MI5 A;  1XQH A;  4J7I A;  1MVX A;  3MO2 A;  4J83 A;  3EP0 A;  5F59 A;  3OXG A;  5HI7 A;  3M5A A;  3OOI A;  5KJL A;  4H12 A;  4AU7 A;  4O6F A;  5EX3 A;  4Z4P A;  5F6K C;  4YPA A;  2JV0 A;  4JDS A;  3RQ4 A;  5ARG A;  5TH7 A;  5HQ8 A;  3PDN A;  1MUF A;  4C1Q A;  1MT6 A;  3F9Y A;  2IGQ A;  3S7D A;  4YNM A;  3M56 A;  4YPU A;  4FMU A;  2W5Y A;  4NJ5 A;  3OPE A;  3DB5 A;  4QEO A;  1N3J A;  3F9Z A;  3M57 A;  3RU0 A;  4YNP A;  3TG4 A;  2O8J A;  2F69 A;  3IHX A;  1N6C A;  3M54 A;  4QEN A;  5TEG A;  4J7F A;  5EG2 A;  5T0K A;  4IJ8 A;  4O30 A;  4YPE A;  4WUY A;  3KMT A;  2BQZ A;  3CBO A;  5F6L A;  5LSX A;  1N6A A;  4JLG A;  4LDG A;  4BUP A;  3MO5 A;  3S7F A;  1O9S A;  3TG5 A;  3M53 A;  2W5Z A;  3RJW A;  3QWP A;  3MEK A;  5EX0 A;  3K5K A;  4NVQ A;  5CPR B;  3MO0 A;  5CCL A;  3OS5 A;  3QWW A;  3QWV A;  2RFI A;  3OXF A;  5TTF A;  2G46 A;  3FPD A;  5T0M A;  4J8O A;  3DAL A;  3VV0 A;  1ZKK A;  3BO5 A;  3RAY A;  1PEG A;  5KJM A;  4RZ0 A;  5KJK A;  5T5G A;  4QEP A;  2R3A A;  4E47 A;  3N71 A;  3OXL A;  2QPW A;  5KJN A;  5AYF A; 
#chains in the Genus database with same CATH topology
 4IJD A;  4MI0 A;  3SW9 A;  5LSZ A;  3S7J A;  5JHN A;  3F9X A;  3RIB A;  3VUZ A;  5CCM A;  3CBP A;  3M59 A;  1H3I A;  3S7B A;  3SWC A;  3F9W A;  3M58 A;  1MVH A;  3KMJ A;  5F5E A;  5ARF A;  5JIY A;  4YND A;  1ML9 A;  3CBM A;  3M55 A;  5JJ0 A;  3HNA A;  3KMA A;  3S8P A;  4I51 A;  5JIN A;  4MI5 A;  1XQH A;  4J7I A;  1MVX A;  3MO2 A;  4J83 A;  3EP0 A;  5F59 A;  3OXG A;  5HI7 A;  3M5A A;  3OOI A;  5KJL A;  4H12 A;  4AU7 A;  4O6F A;  5EX3 A;  4Z4P A;  5F6K C;  4YPA A;  2JV0 A;  4JDS A;  3RQ4 A;  5ARG A;  5TH7 A;  5HQ8 A;  3PDN A;  1MUF A;  4C1Q A;  1MT6 A;  3F9Y A;  2IGQ A;  3S7D A;  4YNM A;  3M56 A;  4YPU A;  4FMU A;  2W5Y A;  4NJ5 A;  3OPE A;  3DB5 A;  4QEO A;  1N3J A;  3F9Z A;  3M57 A;  3RU0 A;  4YNP A;  3TG4 A;  2O8J A;  2F69 A;  3IHX A;  1N6C A;  3M54 A;  4QEN A;  5TEG A;  4J7F A;  5EG2 A;  5T0K A;  4IJ8 A;  4O30 A;  4YPE A;  4WUY A;  3KMT A;  2BQZ A;  3CBO A;  5F6L A;  5LSX A;  1N6A A;  4JLG A;  4LDG A;  4BUP A;  3MO5 A;  3S7F A;  1O9S A;  3TG5 A;  3M53 A;  2W5Z A;  3RJW A;  3QWP A;  3MEK A;  5EX0 A;  3K5K A;  4NVQ A;  5CPR B;  3MO0 A;  5CCL A;  3OS5 A;  3QWW A;  3QWV A;  2RFI A;  3OXF A;  5TTF A;  2G46 A;  3FPD A;  5T0M A;  4J8O A;  3DAL A;  3VV0 A;  1ZKK A;  3BO5 A;  3RAY A;  1PEG A;  5KJM A;  4RZ0 A;  5KJK A;  5T5G A;  4QEP A;  2R3A A;  4E47 A;  3N71 A;  3OXL A;  2QPW A;  5KJN A;  5AYF A; 
#chains in the Genus database with same CATH homology
 4IJD A;  4MI0 A;  3SW9 A;  5LSZ A;  3S7J A;  5JHN A;  3F9X A;  3RIB A;  3VUZ A;  5CCM A;  3CBP A;  3M59 A;  1H3I A;  3S7B A;  3SWC A;  3F9W A;  3M58 A;  1MVH A;  3KMJ A;  5F5E A;  5ARF A;  5JIY A;  4YND A;  1ML9 A;  3CBM A;  3M55 A;  5JJ0 A;  3HNA A;  3KMA A;  3S8P A;  4I51 A;  5JIN A;  4MI5 A;  1XQH A;  4J7I A;  1MVX A;  3MO2 A;  4J83 A;  3EP0 A;  5F59 A;  3OXG A;  5HI7 A;  3M5A A;  3OOI A;  5KJL A;  4H12 A;  4AU7 A;  4O6F A;  5EX3 A;  4Z4P A;  5F6K C;  4YPA A;  2JV0 A;  4JDS A;  3RQ4 A;  5ARG A;  5TH7 A;  5HQ8 A;  3PDN A;  1MUF A;  4C1Q A;  1MT6 A;  3F9Y A;  2IGQ A;  3S7D A;  4YNM A;  3M56 A;  4YPU A;  4FMU A;  2W5Y A;  4NJ5 A;  3OPE A;  3DB5 A;  4QEO A;  1N3J A;  3F9Z A;  3M57 A;  3RU0 A;  4YNP A;  3TG4 A;  2O8J A;  2F69 A;  3IHX A;  1N6C A;  3M54 A;  4QEN A;  5TEG A;  4J7F A;  5EG2 A;  5T0K A;  4IJ8 A;  4O30 A;  4YPE A;  4WUY A;  3KMT A;  2BQZ A;  3CBO A;  5F6L A;  5LSX A;  1N6A A;  4JLG A;  4LDG A;  4BUP A;  3MO5 A;  3S7F A;  1O9S A;  3TG5 A;  3M53 A;  2W5Z A;  3RJW A;  3QWP A;  3MEK A;  5EX0 A;  3K5K A;  4NVQ A;  5CPR B;  3MO0 A;  5CCL A;  3OS5 A;  3QWW A;  3QWV A;  2RFI A;  3OXF A;  5TTF A;  2G46 A;  3FPD A;  5T0M A;  4J8O A;  3DAL A;  3VV0 A;  1ZKK A;  3BO5 A;  3RAY A;  1PEG A;  5KJM A;  4RZ0 A;  5KJK A;  5T5G A;  4QEP A;  2R3A A;  4E47 A;  3N71 A;  3OXL A;  2QPW A;  5KJN A;  5AYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...