2JV0A

Set domain of riz1 tumor suppressor (prdm2)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
162
Chain Sequence
GSMDQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYGEDNPEIAAAIEEERASARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 2
publication title Structural studies of the SET domain from RIZ1 tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 18
structure length 162
sequence length 163
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2jv0A01
2RFIA 3QWPA 3EP0A 2QPWA 5F6KC 5EX3A 2G46A 3M5AA 3PDNA 4E47A 3S7BA 2JV0A 3RU0A 5JJ0A 4IJ8A 4O30A 4JLGA 3KMJA 3RJWA 4BUPA 5KJNA 3F9ZA 2O8JA 5HQ8A 5TH7A 5JHNA 3RIBA 3M59A 3VV0A 5F6LA 5T0KA 4H12A 5CCLA 5KJKA 4O6FA 3TG4A 3OOIA 5CPRB 5JINA 1N6CA 5EG2A 2R3AA 1MUFA 3SW9A 3OXLA 3HNAA 3CBMA 1N3JA 3MO5A 3QWWA 4QEOA 3OS5A 5LSZA 3QWVA 4J8OA 4YPUA 3DB5A 1N6AA 2BQZA 3M55A 3M54A 4J83A 5TEGA 3FPDA 3SWCA 5JIYA 1PEGA 4IJDA 4I51A 4Z4PA 4NVQA 3MO2A 4MI0A 3M57A 3F9WA 4QENA 3F9YA 3TG5A 5CCMA 4YNMA 3S7FA 2F69A 4YNDA 5F5EA 5HI7A 3S7JA 2W5ZA 4YPAA 5TTFA 3BO5A 4WUYA 3S7DA 1MT6A 1ML9A 3OXFA 2IGQA 3M56A 3DALA 5ARFA 5T0MA 3KMTA 3MEKA 3K5KA 4YNPA 5F59A 3KMAA 1MVHA 3IHXA 4J7IA 3M53A 3MO0A 1H3IA 1MVXA 5AYFA 1ZKKA 3OXGA 2W5YA 5KJLA 4RZ0A 4LDGA 5ARGA 4C1QA 4JDSA 4YPEA 3CBOA 4MI5A 4FMUA 3N71A 5T5GA 4QEPA 1XQHA 4J7FA 3S8PA 3OPEA 3RQ4A 5EX0A 4NJ5A 3CBPA 3RAYA 3M58A 4AU7A 1O9SA 3VUZA 5LSXA 3F9XA 5KJMA
chains in the Genus database with same CATH superfamily
2RFIA 3QWPA 3EP0A 2QPWA 5F6KC 5EX3A 2G46A 3M5AA 3PDNA 4E47A 3S7BA 2JV0A 3RU0A 5JJ0A 4IJ8A 4O30A 4JLGA 3KMJA 3RJWA 4BUPA 5KJNA 3F9ZA 2O8JA 5HQ8A 5TH7A 5JHNA 3RIBA 3M59A 3VV0A 5F6LA 5T0KA 4H12A 5CCLA 5KJKA 4O6FA 3TG4A 3OOIA 5CPRB 5JINA 1N6CA 5EG2A 2R3AA 1MUFA 3SW9A 3OXLA 3HNAA 3CBMA 1N3JA 3MO5A 3QWWA 4QEOA 3OS5A 5LSZA 3QWVA 4J8OA 4YPUA 3DB5A 1N6AA 2BQZA 3M55A 3M54A 4J83A 5TEGA 3FPDA 3SWCA 5JIYA 1PEGA 4IJDA 4I51A 4Z4PA 4NVQA 3MO2A 4MI0A 3M57A 3F9WA 4QENA 3F9YA 3TG5A 5CCMA 4YNMA 3S7FA 2F69A 4YNDA 5F5EA 5HI7A 3S7JA 2W5ZA 4YPAA 5TTFA 3BO5A 4WUYA 3S7DA 1MT6A 1ML9A 3OXFA 2IGQA 3M56A 3DALA 5ARFA 5T0MA 3KMTA 3MEKA 3K5KA 4YNPA 5F59A 3KMAA 1MVHA 3IHXA 4J7IA 3M53A 3MO0A 1H3IA 1MVXA 5AYFA 1ZKKA 3OXGA 2W5YA 5KJLA 4RZ0A 4LDGA 5ARGA 4C1QA 4JDSA 4YPEA 3CBOA 4MI5A 4FMUA 3N71A 5T5GA 4QEPA 1XQHA 4J7FA 3S8PA 3OPEA 3RQ4A 5EX0A 4NJ5A 3CBPA 3RAYA 3M58A 4AU7A 1O9SA 3VUZA 5LSXA 3F9XA 5KJMA
chains in the Genus database with same CATH topology
2RFIA 3QWPA 3EP0A 2QPWA 5F6KC 5EX3A 2G46A 3M5AA 3PDNA 4E47A 3S7BA 2JV0A 3RU0A 5JJ0A 4IJ8A 4O30A 4JLGA 3KMJA 3RJWA 4BUPA 5KJNA 3F9ZA 2O8JA 5HQ8A 5TH7A 5JHNA 3RIBA 3M59A 3VV0A 5F6LA 5T0KA 4H12A 5CCLA 5KJKA 4O6FA 3TG4A 3OOIA 5CPRB 5JINA 1N6CA 5EG2A 2R3AA 1MUFA 3SW9A 3OXLA 3HNAA 3CBMA 1N3JA 3MO5A 3QWWA 4QEOA 3OS5A 5LSZA 3QWVA 4J8OA 4YPUA 3DB5A 1N6AA 2BQZA 3M55A 3M54A 4J83A 5TEGA 3FPDA 3SWCA 5JIYA 1PEGA 4IJDA 4I51A 4Z4PA 4NVQA 3MO2A 4MI0A 3M57A 3F9WA 4QENA 3F9YA 3TG5A 5CCMA 4YNMA 3S7FA 2F69A 4YNDA 5F5EA 5HI7A 3S7JA 2W5ZA 4YPAA 5TTFA 3BO5A 4WUYA 3S7DA 1MT6A 1ML9A 3OXFA 2IGQA 3M56A 3DALA 5ARFA 5T0MA 3KMTA 3MEKA 3K5KA 4YNPA 5F59A 3KMAA 1MVHA 3IHXA 4J7IA 3M53A 3MO0A 1H3IA 1MVXA 5AYFA 1ZKKA 3OXGA 2W5YA 5KJLA 4RZ0A 4LDGA 5ARGA 4C1QA 4JDSA 4YPEA 3CBOA 4MI5A 4FMUA 3N71A 5T5GA 4QEPA 1XQHA 4J7FA 3S8PA 3OPEA 3RQ4A 5EX0A 4NJ5A 3CBPA 3RAYA 3M58A 4AU7A 1O9SA 3VUZA 5LSXA 3F9XA 5KJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RFI A;  3QWP A;  3EP0 A;  2QPW A;  5F6K C;  5EX3 A;  2G46 A;  3M5A A;  3PDN A;  4E47 A;  3S7B A;  2JV0 A;  3RU0 A;  5JJ0 A;  4IJ8 A;  4O30 A;  4JLG A;  3KMJ A;  3RJW A;  4BUP A;  5KJN A;  3F9Z A;  2O8J A;  5HQ8 A;  5TH7 A;  5JHN A;  3RIB A;  3M59 A;  3VV0 A;  5F6L A;  5T0K A;  4H12 A;  5CCL A;  5KJK A;  4O6F A;  3TG4 A;  3OOI A;  5CPR B;  5JIN A;  1N6C A;  5EG2 A;  2R3A A;  1MUF A;  3SW9 A;  3OXL A;  3HNA A;  3CBM A;  1N3J A;  3MO5 A;  3QWW A;  4QEO A;  3OS5 A;  5LSZ A;  3QWV A;  4J8O A;  4YPU A;  3DB5 A;  1N6A A;  2BQZ A;  3M55 A;  3M54 A;  4J83 A;  5TEG A;  3FPD A;  3SWC A;  5JIY A;  1PEG A;  4IJD A;  4I51 A;  4Z4P A;  4NVQ A;  3MO2 A;  4MI0 A;  3M57 A;  3F9W A;  4QEN A;  3F9Y A;  3TG5 A;  5CCM A;  4YNM A;  3S7F A;  2F69 A;  4YND A;  5F5E A;  5HI7 A;  3S7J A;  2W5Z A;  4YPA A;  5TTF A;  3BO5 A;  4WUY A;  3S7D A;  1MT6 A;  1ML9 A;  3OXF A;  2IGQ A;  3M56 A;  3DAL A;  5ARF A;  5T0M A;  3KMT A;  3MEK A;  3K5K A;  4YNP A;  5F59 A;  3KMA A;  1MVH A;  3IHX A;  4J7I A;  3M53 A;  3MO0 A;  1H3I A;  1MVX A;  5AYF A;  1ZKK A;  3OXG A;  2W5Y A;  5KJL A;  4RZ0 A;  4LDG A;  5ARG A;  4C1Q A;  4JDS A;  4YPE A;  3CBO A;  4MI5 A;  4FMU A;  3N71 A;  5T5G A;  4QEP A;  1XQH A;  4J7F A;  3S8P A;  3OPE A;  3RQ4 A;  5EX0 A;  4NJ5 A;  3CBP A;  3RAY A;  3M58 A;  4AU7 A;  1O9S A;  3VUZ A;  5LSX A;  3F9X A;  5KJM A; 
#chains in the Genus database with same CATH topology
 2RFI A;  3QWP A;  3EP0 A;  2QPW A;  5F6K C;  5EX3 A;  2G46 A;  3M5A A;  3PDN A;  4E47 A;  3S7B A;  2JV0 A;  3RU0 A;  5JJ0 A;  4IJ8 A;  4O30 A;  4JLG A;  3KMJ A;  3RJW A;  4BUP A;  5KJN A;  3F9Z A;  2O8J A;  5HQ8 A;  5TH7 A;  5JHN A;  3RIB A;  3M59 A;  3VV0 A;  5F6L A;  5T0K A;  4H12 A;  5CCL A;  5KJK A;  4O6F A;  3TG4 A;  3OOI A;  5CPR B;  5JIN A;  1N6C A;  5EG2 A;  2R3A A;  1MUF A;  3SW9 A;  3OXL A;  3HNA A;  3CBM A;  1N3J A;  3MO5 A;  3QWW A;  4QEO A;  3OS5 A;  5LSZ A;  3QWV A;  4J8O A;  4YPU A;  3DB5 A;  1N6A A;  2BQZ A;  3M55 A;  3M54 A;  4J83 A;  5TEG A;  3FPD A;  3SWC A;  5JIY A;  1PEG A;  4IJD A;  4I51 A;  4Z4P A;  4NVQ A;  3MO2 A;  4MI0 A;  3M57 A;  3F9W A;  4QEN A;  3F9Y A;  3TG5 A;  5CCM A;  4YNM A;  3S7F A;  2F69 A;  4YND A;  5F5E A;  5HI7 A;  3S7J A;  2W5Z A;  4YPA A;  5TTF A;  3BO5 A;  4WUY A;  3S7D A;  1MT6 A;  1ML9 A;  3OXF A;  2IGQ A;  3M56 A;  3DAL A;  5ARF A;  5T0M A;  3KMT A;  3MEK A;  3K5K A;  4YNP A;  5F59 A;  3KMA A;  1MVH A;  3IHX A;  4J7I A;  3M53 A;  3MO0 A;  1H3I A;  1MVX A;  5AYF A;  1ZKK A;  3OXG A;  2W5Y A;  5KJL A;  4RZ0 A;  4LDG A;  5ARG A;  4C1Q A;  4JDS A;  4YPE A;  3CBO A;  4MI5 A;  4FMU A;  3N71 A;  5T5G A;  4QEP A;  1XQH A;  4J7F A;  3S8P A;  3OPE A;  3RQ4 A;  5EX0 A;  4NJ5 A;  3CBP A;  3RAY A;  3M58 A;  4AU7 A;  1O9S A;  3VUZ A;  5LSX A;  3F9X A;  5KJM A; 
#chains in the Genus database with same CATH homology
 2RFI A;  3QWP A;  3EP0 A;  2QPW A;  5F6K C;  5EX3 A;  2G46 A;  3M5A A;  3PDN A;  4E47 A;  3S7B A;  2JV0 A;  3RU0 A;  5JJ0 A;  4IJ8 A;  4O30 A;  4JLG A;  3KMJ A;  3RJW A;  4BUP A;  5KJN A;  3F9Z A;  2O8J A;  5HQ8 A;  5TH7 A;  5JHN A;  3RIB A;  3M59 A;  3VV0 A;  5F6L A;  5T0K A;  4H12 A;  5CCL A;  5KJK A;  4O6F A;  3TG4 A;  3OOI A;  5CPR B;  5JIN A;  1N6C A;  5EG2 A;  2R3A A;  1MUF A;  3SW9 A;  3OXL A;  3HNA A;  3CBM A;  1N3J A;  3MO5 A;  3QWW A;  4QEO A;  3OS5 A;  5LSZ A;  3QWV A;  4J8O A;  4YPU A;  3DB5 A;  1N6A A;  2BQZ A;  3M55 A;  3M54 A;  4J83 A;  5TEG A;  3FPD A;  3SWC A;  5JIY A;  1PEG A;  4IJD A;  4I51 A;  4Z4P A;  4NVQ A;  3MO2 A;  4MI0 A;  3M57 A;  3F9W A;  4QEN A;  3F9Y A;  3TG5 A;  5CCM A;  4YNM A;  3S7F A;  2F69 A;  4YND A;  5F5E A;  5HI7 A;  3S7J A;  2W5Z A;  4YPA A;  5TTF A;  3BO5 A;  4WUY A;  3S7D A;  1MT6 A;  1ML9 A;  3OXF A;  2IGQ A;  3M56 A;  3DAL A;  5ARF A;  5T0M A;  3KMT A;  3MEK A;  3K5K A;  4YNP A;  5F59 A;  3KMA A;  1MVH A;  3IHX A;  4J7I A;  3M53 A;  3MO0 A;  1H3I A;  1MVX A;  5AYF A;  1ZKK A;  3OXG A;  2W5Y A;  5KJL A;  4RZ0 A;  4LDG A;  5ARG A;  4C1Q A;  4JDS A;  4YPE A;  3CBO A;  4MI5 A;  4FMU A;  3N71 A;  5T5G A;  4QEP A;  1XQH A;  4J7F A;  3S8P A;  3OPE A;  3RQ4 A;  5EX0 A;  4NJ5 A;  3CBP A;  3RAY A;  3M58 A;  4AU7 A;  1O9S A;  3VUZ A;  5LSX A;  3F9X A;  5KJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...