3RIBA

Human lysine methyltransferase smyd2 in complex with adohcy
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
430
structure length
430
Chain Sequence
GGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESHLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human lysine methyltransferase Smyd2 reveals insights into the substrate divergence in Smyd proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 139
structure length 430
sequence length 430
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ribA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ribA01
3CK8A 4NQ0A 4G23A 3JYSA 1N6AA 2GW1A 1ELWA 2VSYA 3AS8A 3PE4A 3AS5A 3QKYA 3GW4A 4GA2A 4JHRA 2ONDA 3CEQA 4I17A 4H7YA 3ZFWA 3CVQA 4YNPA 2KCKA 3M5AA 5A7DB 4CGWA 3MV2B 1ZBPA 3MEKA 5EX0A 4NRHB 2YQ8A 4WNEA 3HYMB 1HZ4A 2XCCA 4GPKA 4XIFA 4QENA 3S7DA 5JJ7A 5FTPA 4J7FA 4N3CA 3O48A 4EQFA 3U4TA 3LKUA 3MA5A 3CKCA 4O6FA 4Y6CA 4HOSA 4J83A 1WAO1 2VSNA 4YPUA 2FI7A 4LEUA 4A1SA 4GCOA 5EKQD 2VYIA 4JDSA 3PE3A 5BW8C 2JLBA 4HORA 2F69A 3TG5A 4CGVA 4N3BA 4IJDA 4UQYA 3IHXA 1NZNA 4GA0A 5AYFA 4O30A 4YPAA 1ZKKA 2VQ2A 2KC7A 1MT6A 3U3WA 1ZU2A 3MV3B 2KATA 4AY5A 5A6CA 5TTFA 2KCVA 1ELRA 1FCHA 1KT1A 3LY9A 1ML9A 3RU0A 3F9WA 3OXLA 1H3IA 4AY6A 4FMUA 4UI9C 2HO1A 4RG9A 2RFIA 1PEGA 5M72A 3MO0A 4N3AA 4QEPA 3CBOA 4U0UA 3KS2A 4I2WA 2W5ZA 3OOIA 5JINA 1N3JA 2P58C 2VGXB 1A17A 3EDTB 2PQNA 3LCAA 3CBPA 3SWCA 3ASFA 2BUGA 2O8JA 4G25A 3CVPA 4B94A 5CCMA 3CVLA 4UI9J 2NC9A 4RG6A 2WPVA 4J8DA 3RAYA 3M58A 4J0UA 3ZHEA 3ZGQA 4GA1A 3RIBA 2JV0A 4IN3B 4N2SA 3M56A 3OXGA 1KT0A 4BTBA 3AS4A 2V5FA 4F3VA 3N71A 5LSXA 3VTXA 3HNAA 1E96B 4WNFA 3WXXA 1TJCA 4J8FA 5D0OD 3S8PA 3EP0A 3ESKA 4LDGA 2PQRA 4I2ZA 3CK7A 3Q47B 2WQHA 4JA9A 4UI9K 1MVXA 3SW9A 3ZHEB 4ME2A 4UQZA 1B89A 5D0QD 5G04C 4HOQA 4J8OA 4YVOA 4BUPA 5T0MA 4YNDA 3KMJA 1OUVA 4GZ3A 4GYYA 3BEEA 4YNMA 4YPEA 1YA0A 3GYZA 2UWJG 5ARFA 3CVNA 2HR2A 4G26A 5EG2A 2W5YA 3Q5MA 3URZA 4NVQA 4BTAA 2C2LA 5T5GA 1QQEA 4GYWA 5G04J 4I9EA 3SZ7A 2IF4A 3QWVA 4H12A 4N39A 4W9RA 5JJ6A 4U07A 3M59A 1IYGA 5LSZA 4WNGA 5FZSA 4MI5A 3LYAA 2IGQA 5BNWA 2VGXA 3TAXA 5DBKA 5KJMA 2XGMA 3TGOA 4G24A 5JHNA 1QZ2A 3CKBA 5KJKA 4G2VA 3S7BA 3RJVA 1N6CA 3Q4AB 4JLGA 4WUYA 3ZN3A 2PZIA 2Y4TA 2FEZA 4ABNA 5JIYA 2HYZA 4WNDA 2R3AA 3F9YA 2UY1A 2FO7A 5HI7A 4I1AA 5FT9A 4BT9A 3ASGA 3QWWA 2QFCA 3QDNA 3ASHA 2LSVA 3UPVA 3RKVA 2XGOA 4KYOB 3ZPJA 1KLXA 5FZRA 5TH7A 2FBNA 2KCLA 4RZ0A 2AVPA 2PL2A 4U0ZA 3QOUA 3UQ3A 2UY1B 3LPZA 3RJWA 2XPIA 3PDNA 4AIFA 5FJYA 2G46A 5G05J 2LSUA 3OXFA 4UQXA 3LY8A 5AYWD 3RO3A 1PC2A 3S7JA 3DALA 3Q49B 5C1DA 3QWPA 3M55A 5CPRB 3TG4A 3F9XA 1O9SA 3Q15A 3KMAA 3GZ2A 5BT1A 1MVHA 4BWRA 2YHCA 4I9CA 5LCWC 3CBMA 5DIZA 2E2EA 1WM5A 4C1QA 3F9ZA 4G1TA 5JJ0A 4HOUA 2L6JA 3MO2A 3S7FA 3E4BA 5CCLA 2R5SA 4GCNA 4CDRA 3M57A 1NA0A 5LCWJ 2OOEA 4I51A 3VTYA 2IFUA 4GZ5A 4GYOA 4U0SA 3MO5A 2C0MA 3CK9A 4JL0A 1W3BA 5ARGA 3DB5A 1NA3A 5KJNA 1HH8A 2Y4UA 3KD7A 4HOTA 1Y8MA 5JJTA 5F5EA 3MKRA 3ULQA 4J7IA 4YVQC 2XGSA 1MUFA 2XEVA 2MHKA 4QEOA 3K9IA 4APOA 3FP3A 3OS5A 5F6KC 5F6LA 4XI9A 3VUZA 4Y6WA 2QPWA 1XQHA 5EX3A 1HXIA 3NF1A 5CHEE 1XNFA 5FZQA 2BQZA 4XI0A 3CV0A 3GZ1A 3KAEA 4N5CA 3M54A 4AU7A 2I6HA 3LY7A 5KJLA 2FF4A 4AM9A 1P5QA 3VV0A 2XCBA 3ASDA 4U04A 5G05C 2DBAA 3M53A 4J8EA 4JA7A 5HQ8A 2LNIA 2VGYA 3BO5A 4IJ8A 4N2QA 4NJ5A 5T0KA 3IEGA 3FFLA 3UUXA 5TEGA 1IHGA 2Q7FA 4Z4PA 4GZ6A 3FWVA 3K5KA 4MI0A 5F59A 3RQ4A 3SF4A 4E47A 4BT8A 3RO2A 4H7XA 3R9AB 3FPDA 2J9QA 3OPEA 4KBQA 3KMTA 4KXKB 2C0LA
chains in the Genus database with same CATH superfamily
4EHMA 3I4RB 4B8CB 3CLJA 3DSUA 2KZTB 3AS5A 3GW4A 3UX4A 3CEQA 4H7YA 2IONA 4YNPA 4U8HA 2B6CA 1TN8A 4FLBA 1A5EA 3MV2B 4DX7D 5CBNA 3MEKA 4O60A 3MGBA 4NRHB 4ATZD 5AQ9A 3ZEFA 2WQ7A 2X6HA 4OYSA 1EPUA 5FTPA 2A5UA 2L0TB 4QQIA 4I6GA 4CDMA 5D2MC 3MA5A 1N52A 3CKCA 4J83A 1WAO1 4YPUA 4U63A 2FI7A 3CHSA 3T8KA 2V5QC 4A1SA 4OVVA 3SFXA 2CG2A 5EKQD 4JDSA 1TJFA 2JLBA 4IULA 2F69A 2V4LA 3T5VA 4CGVA 4J8SA 4UQYA 5BV1A 1NZNA 5AYFA 3ULYA 3QJZA 4HLLA 1N4QA 1WDYA 3MV3B 1VDYA 4AY5A 4HFGA 3DEOA 4I6JA 3HDXA 1BPOA 1KT1A 3LY9A 1ML9A 1MYOA 3CHQA 3RU0A 3L17A 4AY6A 4FMUA 5M72A 4F1SA 3KS2A 2W5ZA 4K5BA 2WXRA 4IYPA 3FTWA 4GMJA 5BPPA 3ZYMA 2PQNA 3LCAA 3SWCA 3ASFA 2BUGA 2HM8A 1D9SA 2O8JA 4B94A 5CCMA 3FUJA 2F0YA 4M3OA 5CBOA 3FU3A 3NZSA 3ZGQA 4GA1A 3FTYA 4B8AA 4IN3B 4N5QA 4B89A 2WVIA 2WXPA 3M56A 1Z3YA 1BD8A 3C3OA 3Q9NC 3LXUX 1SZ9A 4LNGA 4XEIG 4TXPA 2ZGGA 3E37A 1MX6A 1N9AA 1TJCA 1QNFA 1OWMA 4I2ZA 3HRAA 3Q47B 2WQHA 1TNOA 4URKA 2CFZA 3O4ZA 4HOQA 5T0MA 4YNDA 2P9IG 1MZCA 1OUVA 4HB5A 3DEPA 1XGWA 1YA0A 3MYVA 1H6OA 2HR2A 4G26A 3TWUA 4MKTA 1L5JA 4HBDA 3Q5MA 2XPYA 4JPSA 2C2LA 2BTDA 3AAAC 5T5GA 2V4HC 3SZ7A 4H12A 1KZPA 2ZXWE 1U3CA 5LSZA 3V2OA 4RQIA 3DSSA 2IGQA 4G24A 2I1JA 5JHNA 1QZ2A 4CDNA 3MCXA 2LXLA 3ML9A 3RJVA 3Q4AB 5LOZA 4JLGA 5LFAA 3FTUA 4DI4A 2FEZA 4FHKA 2UY1A 4ATGA 4HVBA 3UINC 3PUJA 5LX8A 3HXEA 5HI7A 1HF8A 2OVBA 1H2TC 4BT9A 2X6FA 2GGFA 2R59A 4GTMA 2QFCA 2R02A 2BF0X 3ASHA 2LSVA 3RAUA 3ZU7B 4Z68A 3RKVA 1S64A 1HE8A 2P9SG 1KPSB 3E30A 5FINA 2KCLA 3JQ0A 2AVPA 1OCRE 4U0ZA 3J5QB 2EILE 2JEKA 3UT8A 2IY0C 2NYJA 4NACA 4BETA 4TV3A 2AXZA 3T5XA 2IEJA 4UQXA 3B13A 4DRXE 4EBAG 5AYWD 1PC2A 3S7JA 3Q49B 3D9HA 1E8ZA 2RD0A 1O9SA 3Q15A 3KMAA 1OCZE 1MVHA 3ZW3A 3MZLB 4GTVA 1WM5A 2OEWA 3CVWA 1TN7A 4HXIA 3RRUA 2YINA 4CRWA 4HOUA 5BV0A 3S7FA 3OAWA 2GRQB 1UN9A 2IJGX 2DVWA 4HQDA 3CQCB 5EIBE 2WXGA 4GCNA 2CHXA 4LERA 4L2YA 4GMRA 4Q94A 3MO5A 4J6IA 3QARA 2OVFA 4JL0A 2A4ZA 3CHRA 1W3BA 3L13A 5ARGA 4L23A 3APDA 3NB2A 1NA3A 1WG0A 2Y4UA 5JJTA 1OWOA 4ACKA 3ULQA 4J7IA 1Z5SC 1DCEA 1LD8A 2WXKA 1DVPA 3HVEB 3TXNA 1SA5A 3LEWA 2QPWA 1N54A 4BSZB 3FTVA 2ETAA 4F1PA 3DRAA 4UWFA 4GTOA 2J4BA 5FQ6A 3FUNA 3G2UA 1E7UA 3HXDA 4F53A 3LY7A 4EZKA 1HG2A 3ML8A 4UWLA 3VV0A 2DBAA 3M53A 2V0PA 3PVLA 5HQ8A 1UJKA 2XHEA 4EBAA 4BY6A 5FIOA 5T0KA 3IEGA 2B0OE 3FFLA 1BI7B 2F37A 2WM9A 4A63B 4GZ6A 3FWVA 2WMOA 3K5KA 4U8YD 5F59A 3RQ4A 3L08A 3D9IA 3PZ3A 4OAVB 3UIOC 1Z3XA 3DXKG 3FPDA 2J9QA 3OPEA 4KXKB 2WXNA 4WWNA 2J8SD 4NQ0A 3JYSA 2KM4A 4CYMD 2GW1A 3DSVA 3ZYQA 2VJ8A 2VSYA 3AS8A 2RFMA 4I6EA 2ONDA 1HO8A 1V54E 5JMND 3M5AA 3PREA 5A7DB 1DNPA 5T3RA 2PNNA 3IHVA 1ZB1A 1ZBPA 2AWIA 4LSZE 3SFZA 4JHJA 4E6HA 2X38A 4EECA 3HG0D 2YQ8A 1BI8B 2OV8A 2XCCA 4XIFA 4BESA 1IXVA 4N3CA 3TWVA 4EQFA 4HLEA 5LP0A 1NI1A 3LKUA 1O1TA 3ASOE 4XKBA 3UT7A 3FULA 2YHEA 3KEAA 4LEUA 3RRNB 2X3MA 2NSZA 2I2OA 3BUAA 4PH4B 1QBQA 2Y0BG 1FT2A 1U2VG 2E0IA 4O30A 2GRPB 4JXTA 2QYJA 2YNQA 4L2LA 3FUFA 2KC7A 2H6GA 3C98A 1ZU2A 3RSEG 4DJAA 2RFAA 5A6CA 4KVOA 4U7EB 3OXLA 2CHWA 1H3IA 2MRIA 3ESLA 2RFIA 1PEGA 4QEPA 3R7RA 3LS8A 1LD7A 4O1PA 2VGXB 5KWDA 3EDTB 5IY5E 5T8IA 1E7VA 3Q7AA 3CVYA 1H6KA 3CVLA 4DX5D 4RLYA 4J8DA 2QY7A 3UI2A 5ANLA 4B93B 4J0UA 5ENSD 3TWXA 3L6AA 4GTQA 4GTRA 2LXMA 2Y3AA 4AV7A 1KT0A 4BTBA 2V5FA 3EJNA 3C5RA 2R17C 4F3VA 4G8LA 3CSFA 3VTXA 1H2UA 1HU3A 3HNAA 1E96B 4WNFA 5FWQA 4UUCA 2IO3C 2WB2A 3EP0A 2VGEA 4F7AA 3V79K 2EINE 2QC9A 2ZIRA 5AQBA 2CG3A 3AG4E 4YVOA 2FO1E 3KMJA 3CQGB 3V31A 4GYYA 4YDWA 3BEEA 3NBNB 4YNMA 3ZNGA 4DLOA 3URZA 3G2VA 5EN5D 3SFYA 3FEXA 3AJIA 2WMNA 2LAHA 4BERA 4I9EA 5CMWA 4N39A 5JJ6A 3U64A 1K1AA 3DXMG 4KVMA 3GZSA 3LYAA 2VGXA 4ANUA 3TGOA 2AXUA 3F6QA 3QAQA 3IXEA 3CKBA 4PDXA 1N4RA 3S7BA 2MYOA 1N6CA 2OCCE 2WXLA 3W9GA 2PM7A 3ZN3A 2HYZA 4WNDA 5KCMA 5AJDA 3ABME 3G2SA 3DSTA 3ZVVA 4CT4A 3T9KA 3QDNA 5AENA 4EZJA 4QFVA 3UPVA 1OCOE 5B1BE 5J90A 2Y69E 1KLXA 4J7WA 4YDEA 1EYHA 5TH7A 1RW2A 5KNGA 2PL2A 3UQ3A 1IHBA 2UY1B 1BU9A 1WY6A 3JUEA 5ENQD 3JCKC 3PH0C 3PEUB 2XPIA 4AIFA 3TJPA 2EIJE 2LSUA 3UT4A 3RO3A 5A23A 3UKRG 3SY2A 3QWPA 5BXOA 3KEZA 1S0PA 3FU6A 3GZ2A 5BT1A 2V8SE 3R9MA 4BX8A 4I9CA 3MJWA 4ILGA 5DIZA 2XS8A 4TUMA 5AARA 3F9ZA 3TWWA 2L6JA 3DBSA 3PUKA 2WXMA 5AQ7A 1D8DA 2XZTG 3D9NA 4JVSA 4Q69A 4I51A 2IFUA 3FY4A 1FVHA 3ABKE 5ITZF 2L0IA 3NOCD 3I5PA 3E32A 2H6IA 5CERB 4HI9A 4GTSA 5KJNA 4P29A 4U96D 3KD7A 1Y8MA 5ENNA 1JUQA 2LO6A 5F5EA 2WXHA 1SVXA 2XGSA 2MHKA 3K9IA 4FHJA 3OS5A 3FP3A 5F6KC 3I3NA 3OTNA 2IOSA 5AJLA 4FULA 3MX3A 4XI9A 3VUZA 3CVXA 3B7TA 3NZUA 1XQHA 2J08A 3FUKA 5EX3A 3LDZA 5HS0A 1HXIA 4LNUD 2RKKA 5CEAA 1IQRA 1JCRA 4LUNU 3CSTA 4FA6A 2FF4A 2XCBA 3Q7FA 3ASDA 4U04A 1INZA 5ENOD 1TNUA 4JA7A 3BO5A 4N2QA 3W9FA 4ANVA 2RG8A 3HXCA 5G2NA 1BLXB 4K5AB 3ONLA 5TEGA 4Z4PA 1MJ0A 4BT8A 3E34A 4NURA 3RO2A 3TWQA 3ZYKA 2XQ0A 4PS8A 3FEYA 4L1BA 4APFA 4GAAA 1TNZA 5J08A 2GRRB 4G23A 1N6AA 2DYSE 1ELWA 4JHKA 3WG7E 4B0ZA 4DLQA 2EIKE 3PE4A 2GRLA 3QKYA 2Y1LE 4GA2A 4JHRA 3PRZA 1DCQA 4I17A 3UKUG 3ZFWA 3CVQA 4ACLA 2KCKA 2R05A 1SZAA 1MHQA 5EIDA 3BG0B 4MBGA 5EX0A 3ONKA 3U9WA 3HYMB 5JA4D 1HZ4A 4GPKA 4JD2G 4LNBA 4O1OA 3S7DA 5JJ7A 4J7FA 3O48A 3L54A 3U4TA 3CGHA 4Y6CA 3LJ3A 2VSNA 4EPZA 5BUZA 3LJNA 4GCOA 5EYPF 2VYIA 2AW6A 3AG3E 5D66A 2WXOA 2KBXA 4IRUA 3PE3A 5BW8C 1TYQG 1FPPA 4N3BA 2ZU6B 3IHXA 4ILHB 3ZXSA 4TXQA 3U3WA 4UWKA 4C9BB 1X81A 5TTFA 1AWCB 1ELRA 1FCHA 1U3DA 3FDHA 3NQPA 3F9WA 3ZYLA 5FQ7A 4UI9C 2HO1A 1N4PA 4N3AA 3R7QA 4U0UA 4UWGA 5B3SE 5JINA 1N3JA 4HI8A 3AG2E 3APFA 1A17A 3B95A 1UOHA 3CBPA 3SGHA 1NL4A 4G25A 3CVPA 4KT6B 2CHZA 4UI9J 3HIZA 4XKCA 3RAYA 5EYLA 3ZHEA 1Z6TA 2ZGDA 3FTSA 2EIME 3J5PA 3SD5A 4C0MA 1DC2A 1N4SA 3OXGA 4BFRA 3KSLA 4KZCA 1ELKA 3N71A 4BEPA 3B7RL 4MRUA 3L22A 3WXXA 3S8PA 4AVXA 3ESKA 4LDGA 2PQRA 3CK7A 3RK6A 3TWRA 4ZFHA 2VTBA 1MVXA 1D8EA 3QB2A 4ME2A 4UQZA 1B89A 5D0QD 4J8OA 4BUPA 1AP7A 3BG1B 4GZ3A 4MS6A 4YPEA 1K3ZD 3GYZA 2UWJG 5ARFA 3CVNA 3L9TA 2W5YA 4DUIA 3IHYA 4BTAA 3EHQA 2DIWA 1H0AA 1UG3A 1TEZA 1E90A 2VSOE 3Q78A 2IF4A 1SQMA 3QWVA 4W9RA 1UW4B 4U07A 2R2LA 3M59A 3IV0A 2L6BA 2ETBA 4JC8A 4WNGA 5FZSA 3PNLB 3PZDA 5EDSA 4A1GA 5BNWA 3TAXA 5DBKA 2XGMA 4K5CA 3HXBA 4XZ4A 3QNKA 4HS2A 1TN6A 2PZIA 2QYUA 2Y4TA 2R3AA 3F9YA 4TXRA 4FADA 4AEZC 4AXHA 1JCSA 4RSYA 2XENA 3ZXPA 1EDUA 2J07A 3ISMC 4ILIA 2XZDG 4GPMA 5FT9A 4DX2A 4ZHBA 2WXFA 3JUIA 1PAQA 4DK5A 3DPYA 4A55A 3ZPJA 4AJWA 4FP7A 3LVRE 5FZRA 2FBNA 2P9LG 3FU0A 4DI3A 3QOUA 1IQUA 1SA4A 4FU3A 1K8KG 4GMLA 4CEMA 3EIJA 4X8QA 3ZKJA 2G46A 3UM3A 5G05J 2H6HA 5CECB 1H2VC 1H19A 3DALA 1N94A 5ANRA 4TUUA 5CPRB 3VLFA 3NOGD 4AP2A 3MKQA 3U66A 4FC8A 2BKKB 3G2WA 1UJJA 4U8VD 2P9NG 5LCWC 4L9PA 1LF8A 3TWSA 3UXGA 4C1QA 1Q2ZA 4WWPA 1V55E 4G1TA 5JJ0A 4HNAD 4C0EA 3MO2A 3D9PA 1HFAA 2R5SA 3B7SA 3M57A 2LUHA 1NA0A 5LCWJ 2OOEA 3EU9A 3VTYA 3UM1A 4GZ5A 4E85A 4U0SA 3UM2A 3ENEA 3CK9A 3SO8A 3EHRA 1S63A 3BQOA 1TNYA 2WXQA 2AXVA 3MKRA 4GB9A 2P9KG 4FJZA 2I1KA 4FJYA 1MQSA 4APOA 4XX5A 1MX2A 3UMVA 5AIJA 5F6LA 3KSQA 4Y6WA 2WQ6A 3EHMA 1O1RA 3NF1A 2H6FA 1N11A 5FQ4A 5CHEE 1XNFA 5FZQA 2J09A 3FUDA 3V2XA 4M7CA 3AG1E 3CV0A 3KAEA 4N5CA 3LVQE 3M54A 4AU7A 2I6HA 1E8XA 3AU4A 1OWNA 4U95D 1O5MA 4V3IA 2WXJA 3EU5A 3IBEA 4AM9A 3L16A 2XS1A 3FH8A 1P5QA 4EZLA 3ABLE 1OWLA 2LNIA 2VGYA 4IJ8A 3SBSA 3BU8A 4NJ5A 2EQXA 4LCTA 2KZTA 1HG5A 4A3VA 3UTMA 4MI0A 3CVVA 4E47A 5G55A 3EIQC 1H6PA 4R7LA 3PEVB 1JCQA 4KBQA 3KMTA 5JHBA 1IKND 4AOFA 3QC1A 2DZOA 1HX8A 3CK8A 3D9JA 5CRUA 3C3QA 3P2BA 1FVFA 1E8WA 3FUEA 2J49A 3UIPC 3QK0A 4OVUA 1OT8A 3JXIA 1X5BA 4GTTA 3G2TA 5ENPD 4JZYA 1TR4A 4CGWA 4DX1A 4ANWA 1O1SA 2JABA 4I43A 5E76A 1UN8A 2A5EA 4WNEA 4QENA 1FT1A 4LRZA 2XPZA 1N95A 4BX9A 4GU5A 2BKGA 4K03A 4O6FA 4HOSA 3FH7A 4LG6A 3SQVA 2IOLA 3EUVA 3TXMA 2PM6A 3TWTA 4FLHA 4HORA 3CVUA 3TG5A 5CEDB 3NAWA 5H7PA 4BSXA 4IJDA 4GA0A 4ANXA 4YPAA 1ZKKA 2IQCA 2VQ2A 2F8XK 4JEUA 1MT6A 3B7UX 5KNHD 3IKOB 2KATA 2L9BA 3FUMA 2KCVA 4JEHA 1S70B 5CRVA 5E75A 3D9MA 2QZAA 1JWFA 1E8YA 3D9LA 4D10C 3HHMA 4RG9A 2IO2C 4G11A 3MO0A 3CBOA 4I2WA 3OOIA 4WAFA 2P58C 4WWOA 2XRYA 3ULEG 4HRNA 3S2AA 2NC9A 4RG6A 2WPVA 2CFUA 5AQAA 3TL5A 1OXJA 5AN8A 3M58A 1GW6A 2FULA 3RIBA 4GTPA 2JV0A 4N2SA 3PZ2A 4Q96A 4HRLA 1MX4A 3AS4A 4C48B 5LSXA 2M63A 1G3NB 3I4GA 2DWZA 4DX6D 4J8FA 2XEEA 5D0OD 2DYRE 1RZ4A 3FTZA 2J4DA 4I1MA 3VLEA 4JA9A 4UI9K 3SW9A 3ZHEB 5G04C 3CHMA 4GZDA 4KZ0A 1OWPA 3ZIMA 3UM0A 5EG2A 3CHOA 1Y6IA 4NVQA 1QQEA 4GYWA 2GROB 3D9OA 1K1BA 5G04J 3C3RA 4PS3A 1IYGA 2VTBB 4MI5A 2ETCA 3X2QE 5KJMA 3APCA 2HE0A 2P9UG 5C2YA 2X6JA 3DWLG 5KJKA 4G2VA 3C72A 4WUYA 2MOWA 4ABNA 5JIYA 2BEDA 3PNTB 3Q73A 3SBTB 4XE0A 2FO7A 1JWGA 1EF1C 2P9PG 4GZCA 2R03A 1N0QA 4I1AA 3ASGA 4NIKA 3QWWA 5AAOA 3D9KA 2XGOA 4KYOB 2DCPA 2F8YA 1OY3D 2P2CP 3SHFA 3ZUVB 4RZ0A 3ASNE 3FU5A 5FQ8A 3LPZA 1NFIE 1YMPA 1YYHA 3RJWA 3PZ1A 3VLDA 2KXPC 3DSXA 4CT0A 3PDNA 4PUCA 5FJYA 4DPRA 4I1OB 3SI5A 3OXFA 3LY8A 5KBAA 2ILRA 4CZ2D 5ENRD 5C1DA 2NXPA 3M55A 3PZ4A 3TG4A 3F9XA 4TRQA 5CMYA 2X6IA 1PY1A 4BWRA 2YHCA 3V30A 1N0RA 4PS7A 3CBMA 4OAUC 2E2EA 3Q9UC 2AJAA 1OCCE 5BXUA 3E33A 3E4BA 2X6KA 5CCLA 1JPLA 5EILA 4CDRA 1NP7A 3HVEA 4L7TA 3L82A 4GYOA 3JXJA 2C0MA 3MKQB 3T8MA 5HRYA 4KMOA 3DB5A 3D3MA 5HKPA 3JQ1A 3CIAA 1HH8A 2GRMA 3Q79A 4HOTA 4K0RA 4RVBA 1SW6A 5T4YA 4YVQC 5JHAA 2IU1A 1MUFA 2XEVA 1QYMA 4QEOA 2OEVA 3DPDA 3CR3A 2XRZA 1HS6A 2XEHA 2LAIA 3B7BA 5ENTD 3P1UA 2WXIA 2BQZA 4XI0A 4MLPA 3GZ1A 1TNBA 2VSXE 4YDYA 3RRMB 1KZOA 1YCSB 5KJLA 2GRNB 4UWHA 2I9CA 4JB8P 3ZRHA 5G05C 4A3TA 4J8EA 3SNXA 3CHPA 1LTXA 3EHNA 3FUHA 5B1AE 4J8YA 2DZNA 3AU5A 4JW1A 2ZISA 3FUIA 3UUXA 1IHGA 2Q7FA 3DSWA 3FHEA 4F6RD 3SF4A 4G8KA 3FTXA 3HXFA 4YDOA 4H7XA 3R9AB 4HRMB 3Q75A 3PS6A 3FH5A 4CCAA 2C0LA
chains in the Genus database with same CATH topology
4WWNA 3CK8A 3D9JA 4NQ0A 4G23A 3JYSA 1N6AA 2KM4A 3P2BA 2GW1A 3ZYQA 1ELWA 3I4RB 1FVFA 2VJ8A 4B8CB 4JHKA 3CLJA 1E8WA 3FUEA 2J49A 4B0ZA 4DLQA 2VSYA 3AS8A 3QK0A 3PE4A 2KZTB 2GRLA 3AS5A 4OVUA 3QKYA 4I6EA 3GW4A 4GA2A 3UX4A 4JHRA 2ONDA 3CEQA 1X5BA 3PRZA 4H7YA 4I17A 1HO8A 3G2TA 2IONA 3ZFWA 3CVQA 4JZYA 4U8HA 4ACLA 2KCKA 4YNPA 3M5AA 3PREA 5A7DB 4FLBA 1SZAA 1DNPA 5T3RA 4CGWA 1MHQA 3IHVA 4ANWA 3MV2B 4I43A 1ZBPA 2AWIA 3SFZA 4JHJA 3BG0B 3MEKA 5EX0A 3ONKA 2X38A 4E6HA 3MGBA 1UN8A 5E76A 4NRHB 3U9WA 4EECA 2YQ8A 4WNEA 3HYMB 3ZEFA 2WQ7A 2OV8A 1HZ4A 2XCCA 4GPKA 2X6HA 4OYSA 4XIFA 4QENA 1EPUA 3S7DA 5JJ7A 4LRZA 5FTPA 2XPZA 4N3CA 4J7FA 3O48A 4EQFA 4HLEA 2A5UA 2L0TB 3L54A 5LP0A 3U4TA 4BX9A 3LKUA 4I6GA 4CDMA 3MA5A 1N52A 3CGHA 4GU5A 4K03A 3CKCA 4O6FA 4Y6CA 4HOSA 3FH7A 4J83A 3LJ3A 1WAO1 2VSNA 3FULA 4XKBA 3UT7A 2YHEA 2FI7A 3CHSA 4U63A 4YPUA 4LEUA 4A1SA 4OVVA 4EPZA 5BUZA 2CG2A 3RRNB 2IOLA 4GCOA 2X3MA 5EKQD 3TXMA 2VYIA 2NSZA 2PM6A 2I2OA 2AW6A 4FLHA 2WXOA 4IRUA 4JDSA 1TJFA 3PE3A 2JLBA 5BW8C 4HORA 4PH4B 4IULA 2F69A 3CVUA 3TG5A 2V4LA 3T5VA 4CGVA 4BSXA 4N3BA 4J8SA 4IJDA 2ZU6B 4UQYA 1NZNA 2E0IA 4GA0A 4ILHB 3ZXSA 5BV1A 4ANXA 3IHXA 1ZKKA 4O30A 4YPAA 5AYFA 4JXTA 2YNQA 4L2LA 2IQCA 2VQ2A 3QJZA 3FUFA 2KC7A 4JEUA 1MT6A 3C98A 3U3WA 1ZU2A 3B7UX 3MV3B 4UWKA 1VDYA 2KATA 3IKOB 4AY5A 4HFGA 4C9BB 2L9BA 4DJAA 3FUMA 5A6CA 5TTFA 4I6JA 2KCVA 3HDXA 4KVOA 1ELRA 1BPOA 1FCHA 1U3DA 3FDHA 1KT1A 3NQPA 4JEHA 3LY9A 1ML9A 3RU0A 3CHQA 3F9WA 3OXLA 3D9MA 5E75A 2CHWA 1JWFA 3ZYLA 1H3IA 3L17A 1E8YA 3D9LA 5FQ7A 4AY6A 2MRIA 4FMUA 4UI9C 4D10C 2HO1A 3ESLA 3HHMA 4RG9A 2RFIA 1PEGA 4G11A 5M72A 3MO0A 4N3AA 4F1SA 3R7QA 3R7RA 3CBOA 3LS8A 3KS2A 4I2WA 4U0UA 4UWGA 2W5ZA 3OOIA 5JINA 2WXRA 1N3JA 4IYPA 3FTWA 4GMJA 4WAFA 5BPPA 3ZYMA 2P58C 2VGXB 1A17A 3APFA 3EDTB 2PQNA 4WWOA 3LCAA 5T8IA 2XRYA 3CBPA 1E7VA 3SWCA 3ASFA 2BUGA 2HM8A 3SGHA 3CVYA 1H6KA 2O8JA 4G25A 3CVPA 4KT6B 3S2AA 4B94A 5CCMA 2CHZA 3CVLA 4UI9J 3FUJA 2NC9A 4M3OA 4RG6A 2WPVA 2CFUA 3FU3A 3NZSA 4J8DA 3TL5A 3HIZA 2QY7A 4XKCA 3RAYA 5ANLA 3M58A 1GW6A 4J0UA 3ZHEA 3ZGQA 2FULA 4GA1A 4QEPA 1Z6TA 3RIBA 2JV0A 3FTSA 3FTYA 4B8AA 3L6AA 4IN3B 4N2SA 4B89A 2WVIA 2WXPA 3SD5A 3M56A 2Y3AA 4Q96A 4AV7A 1Z3YA 4C0MA 3OXGA 1KT0A 4BTBA 3AS4A 4BFRA 2V5FA 3EJNA 2R17C 4KZCA 4F3VA 1ELKA 3N71A 5LSXA 3CSFA 3LXUX 1SZ9A 3VTXA 2M63A 3B7RL 1H2UA 1HU3A 3HNAA 1E96B 4WNFA 4MRUA 5FWQA 3I4GA 3L22A 3WXXA 1TJCA 4J8FA 2WB2A 1QNFA 5D0OD 3S8PA 4AVXA 3EP0A 3ESKA 4LDGA 2PQRA 4F7AA 1OWMA 3FTZA 2J4DA 4I2ZA 3CK7A 4I1MA 3Q47B 3RK6A 2WQHA 3VLEA 2VTBA 4JA9A 4UI9K 4URKA 1MVXA 3ZHEB 3QB2A 2CFZA 2CG3A 4ME2A 3SW9A 4UQZA 3O4ZA 1B89A 5D0QD 5G04C 4HOQA 4J8OA 4YVOA 4BUPA 5T0MA 4YNDA 3KMJA 3BG1B 3CHMA 1OUVA 3CQGB 4GZ3A 4GYYA 4GZDA 3BEEA 4MS6A 4YNMA 1XGWA 4KZ0A 1YA0A 4YPEA 1OWPA 3MYVA 3GYZA 2UWJG 3ZIMA 5ARFA 3CVNA 2HR2A 4G26A 5EG2A 2W5YA 4MKTA 1L5JA 3Q5MA 2XPYA 4DLOA 3CHOA 1Y6IA 3URZA 3G2VA 3IHYA 4JPSA 4NVQA 4BTAA 2C2LA 2BTDA 2DIWA 5T5GA 1H0AA 1UG3A 1TEZA 1E90A 1QQEA 3FEXA 4GYWA 3D9OA 2WMNA 2LAHA 2VSOE 5G04J 4I9EA 3SZ7A 2IF4A 1SQMA 3QWVA 5CMWA 4H12A 4N39A 4W9RA 5JJ6A 1UW4B 4U07A 3U64A 1U3CA 4PS3A 3IV0A 3M59A 1IYGA 5LSZA 4WNGA 4JC8A 2VTBB 5FZSA 4KVMA 3GZSA 3PNLB 3LYAA 4MI5A 3PZDA 5EDSA 4A1GA 2IGQA 5BNWA 2VGXA 3TAXA 5DBKA 4ANUA 5KJMA 2XGMA 3APCA 3TGOA 2AXUA 3QAQA 4G24A 2I1JA 5JHNA 1QZ2A 4XZ4A 3CKBA 5C2YA 3QNKA 4CDNA 3MCXA 2X6JA 4PDXA 5KJKA 4G2VA 3ML9A 4HS2A 3RJVA 3S7BA 1N6CA 3Q4AB 5LOZA 4JLGA 2WXLA 5LFAA 3FTUA 4WUYA 4DI4A 2MOWA 2PM7A 3ZN3A 2PZIA 2Y4TA 2FEZA 4ABNA 5JIYA 2HYZA 4WNDA 2R3AA 3PNTB 5KCMA 4FHKA 3F9YA 2UY1A 4FADA 4ATGA 4HVBA 5AJDA 4AEZC 3PUJA 3SBTB 4AXHA 4RSYA 5LX8A 4XE0A 2FO7A 1JWGA 1EF1C 3G2SA 1EDUA 3ZVVA 4GZCA 5HI7A 4CT4A 2J07A 1HF8A 4ILIA 2OVBA 1H2TC 4I1AA 5FT9A 4BT9A 2X6FA 2GGFA 3ASGA 2R59A 3QWWA 2QFCA 3QDNA 2BF0X 3ASHA 4EZJA 2LSVA 4QFVA 5AENA 2WXFA 3UPVA 3D9KA 3JUIA 1PAQA 4DK5A 5J90A 4A55A 3RKVA 2XGOA 4KYOB 3ZPJA 1KLXA 4AJWA 2DCPA 4FP7A 3LVRE 5FZRA 3SHFA 1HE8A 1EYHA 5TH7A 2FBNA 2KCLA 3JQ0A 4RZ0A 2AVPA 2PL2A 3FU0A 4U0ZA 4DI3A 3QOUA 3UQ3A 1IQUA 2JEKA 2UY1B 4FU3A 1WY6A 3FU5A 5FQ8A 3JCKC 4GMLA 3PH0C 3LPZA 3PEUB 3UT8A 4CEMA 3EIJA 3RJWA 3VLDA 4NACA 2XPIA 4CT0A 3PDNA 4TV3A 4PUCA 4AIFA 5FJYA 2G46A 2AXZA 5G05J 3TJPA 4DPRA 3T5XA 4I1OB 2LSUA 3SI5A 3OXFA 4UQXA 3LY8A 3B13A 3UT4A 2ILRA 4EBAG 5AYWD 1H2VC 3RO3A 1PC2A 5A23A 3S7JA 1H19A 3DALA 3Q49B 5ANRA 4TUUA 5C1DA 2NXPA 3QWPA 3M55A 3VLFA 5CPRB 3TG4A 1E8ZA 3F9XA 3KEZA 3MKQA 4TRQA 4AP2A 2RD0A 1O9SA 3Q15A 5CMYA 3U66A 4FC8A 2X6IA 3KMAA 3G2WA 1UJJA 1S0PA 3FU6A 3GZ2A 5BT1A 1PY1A 4BWRA 1MVHA 2V8SE 2YHCA 3ZW3A 4BX8A 4I9CA 3MJWA 5LCWC 4PS7A 3CBMA 4ILGA 5DIZA 2E2EA 3MZLB 1WM5A 1LF8A 3CVWA 4C1QA 4WWPA 3F9ZA 4G1TA 4HXIA 3RRUA 5JJ0A 2YINA 4CRWA 4HOUA 5BV0A 2L6JA 4C0EA 3MO2A 3S7FA 3OAWA 3DBSA 3D9PA 1HFAA 3PUKA 1UN9A 2WXMA 3E4BA 2IJGX 2X6KA 5CCLA 2R5SA 1JPLA 3CQCB 2WXGA 4GCNA 3B7SA 2CHXA 1NP7A 3D9NA 3HVEA 4LERA 4JVSA 4L2YA 4L7TA 4CDRA 4Q69A 1NA0A 5LCWJ 2OOEA 4I51A 4Q94A 3VTYA 2IFUA 4GZ5A 4E85A 4GYOA 3FY4A 1FVHA 3ENEA 4U0SA 2L0IA 3MO5A 2C0MA 3MKQB 3I5PA 4J6IA 3CK9A 3QARA 2OVFA 4JL0A 2A4ZA 3CHRA 1W3BA 3L13A 3T8MA 5ARGA 4L23A 3M57A 4KMOA 3DB5A 3APDA 1NA3A 3D3MA 5KJNA 3JQ1A 4P29A 3CIAA 1HH8A 2Y4UA 2GRMA 3KD7A 2WXQA 1Y8MA 5ENNA 5JJTA 1JUQA 2LO6A 4HOTA 4K0RA 2AXVA 4RVBA 5F5EA 2WXHA 1OWOA 4ACKA 3MKRA 4GB9A 5T4YA 3ULQA 4J7IA 4YVQC 2XGSA 4FJZA 5JHAA 2IU1A 2I1KA 1MUFA 2XEVA 4FJYA 2MHKA 4QEOA 1MQSA 3K9IA 4FHJA 4APOA 3FP3A 2WXKA 4XX5A 3UMVA 1DVPA 5AIJA 3OS5A 5F6KC 3I3NA 5F6LA 3DPDA 3CR3A 3HVEB 3OTNA 2IOSA 5AJLA 4FULA 3MX3A 3TXNA 4XI9A 3VUZA 3CVXA 3LEWA 4Y6WA 2QPWA 3B7TA 3NZUA 1N54A 2XRZA 1XQHA 2WQ6A 1HS6A 2J08A 3FUKA 5EX3A 3EHMA 3LDZA 2LAIA 1HXIA 3FTVA 3NF1A 5FQ4A 5CHEE 1XNFA 3P1UA 1IQRA 2J09A 3FUDA 2WXIA 5FZQA 4UWFA 2BQZA 4XI0A 4MLPA 3CV0A 3GZ1A 2J4BA 3KAEA 4N5CA 3LVQE 5FQ6A 3M54A 2VSXE 4AU7A 2I6HA 1E8XA 3AU4A 3G2UA 3FUNA 3RRMB 1E7UA 1OWNA 4F53A 3LY7A 4LUNU 4EZKA 4V3IA 5KJLA 2WXJA 3CSTA 4FA6A 4UWHA 2FF4A 3IBEA 4AM9A 1HG2A 2I9CA 3L16A 3FH8A 3ML8A 4UWLA 1P5QA 3VV0A 3ZRHA 2XCBA 4EZLA 3ASDA 4U04A 5G05C 4A3TA 1OWLA 1INZA 2DBAA 3M53A 4J8EA 2V0PA 3PVLA 3SNXA 4JA7A 1UJKA 2LNIA 2VGYA 2XHEA 4EBAA 5HQ8A 4BY6A 3BO5A 4IJ8A 4N2QA 3CHPA 3SBSA 4ANVA 4NJ5A 2RG8A 3EHNA 2EQXA 3FUHA 5T0KA 3IEGA 4LCTA 5G2NA 3AU5A 4JW1A 3FFLA 3FUIA 3UUXA 3ONLA 5TEGA 1IHGA 2KZTA 2Q7FA 2WM9A 4GZ6A 3FWVA 4Z4PA 1HG5A 4A3VA 2WMOA 3FHEA 3K5KA 4MI0A 5F59A 3RQ4A 3L08A 3SF4A 3CVVA 3D9IA 4E47A 4BT8A 5G55A 4NURA 3FTXA 3EIQC 1Z3XA 3RO2A 4R7LA 4H7XA 3PEVB 3R9AB 3FPDA 2J9QA 3ZYKA 3OPEA 4KBQA 2XQ0A 4PS8A 3PS6A 3KMTA 3FEYA 4L1BA 4APFA 5JHBA 4AOFA 3QC1A 3FH5A 4CCAA 4KXKB 2C0LA 4GAAA 2WXNA 1HX8A 5J08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK8 A;  4NQ0 A;  4G23 A;  3JYS A;  1N6A A;  2GW1 A;  1ELW A;  2VSY A;  3AS8 A;  3PE4 A;  3AS5 A;  3QKY A;  3GW4 A;  4GA2 A;  4JHR A;  2OND A;  3CEQ A;  4I17 A;  4H7Y A;  3ZFW A;  3CVQ A;  4YNP A;  2KCK A;  3M5A A;  5A7D B;  4CGW A;  3MV2 B;  1ZBP A;  3MEK A;  5EX0 A;  4NRH B;  2YQ8 A;  4WNE A;  3HYM B;  1HZ4 A;  2XCC A;  4GPK A;  4XIF A;  4QEN A;  3S7D A;  5JJ7 A;  5FTP A;  4J7F A;  4N3C A;  3O48 A;  4EQF A;  3U4T A;  3LKU A;  3MA5 A;  3CKC A;  4O6F A;  4Y6C A;  4HOS A;  4J83 A;  1WAO 1;  2VSN A;  4YPU A;  2FI7 A;  4LEU A;  4A1S A;  4GCO A;  5EKQ D;  2VYI A;  4JDS A;  3PE3 A;  5BW8 C;  2JLB A;  4HOR A;  2F69 A;  3TG5 A;  4CGV A;  4N3B A;  4IJD A;  4UQY A;  3IHX A;  1NZN A;  4GA0 A;  5AYF A;  4O30 A;  4YPA A;  1ZKK A;  2VQ2 A;  2KC7 A;  1MT6 A;  3U3W A;  1ZU2 A;  3MV3 B;  2KAT A;  4AY5 A;  5A6C A;  5TTF A;  2KCV A;  1ELR A;  1FCH A;  1KT1 A;  3LY9 A;  1ML9 A;  3RU0 A;  3F9W A;  3OXL A;  1H3I A;  4AY6 A;  4FMU A;  4UI9 C;  2HO1 A;  4RG9 A;  2RFI A;  1PEG A;  5M72 A;  3MO0 A;  4N3A A;  4QEP A;  3CBO A;  4U0U A;  3KS2 A;  4I2W A;  2W5Z A;  3OOI A;  5JIN A;  1N3J A;  2P58 C;  2VGX B;  1A17 A;  3EDT B;  2PQN A;  3LCA A;  3CBP A;  3SWC A;  3ASF A;  2BUG A;  2O8J A;  4G25 A;  3CVP A;  4B94 A;  5CCM A;  3CVL A;  4UI9 J;  2NC9 A;  4RG6 A;  2WPV A;  4J8D A;  3RAY A;  3M58 A;  4J0U A;  3ZHE A;  3ZGQ A;  4GA1 A;  3RIB A;  2JV0 A;  4IN3 B;  4N2S A;  3M56 A;  3OXG A;  1KT0 A;  4BTB A;  3AS4 A;  2V5F A;  4F3V A;  3N71 A;  5LSX A;  3VTX A;  3HNA A;  1E96 B;  4WNF A;  3WXX A;  1TJC A;  4J8F A;  5D0O D;  3S8P A;  3EP0 A;  3ESK A;  4LDG A;  2PQR A;  4I2Z A;  3CK7 A;  3Q47 B;  2WQH A;  4JA9 A;  4UI9 K;  1MVX A;  3SW9 A;  3ZHE B;  4ME2 A;  4UQZ A;  1B89 A;  5D0Q D;  5G04 C;  4HOQ A;  4J8O A;  4YVO A;  4BUP A;  5T0M A;  4YND A;  3KMJ A;  1OUV A;  4GZ3 A;  4GYY A;  3BEE A;  4YNM A;  4YPE A;  1YA0 A;  3GYZ A;  2UWJ G;  5ARF A;  3CVN A;  2HR2 A;  4G26 A;  5EG2 A;  2W5Y A;  3Q5M A;  3URZ A;  4NVQ A;  4BTA A;  2C2L A;  5T5G A;  1QQE A;  4GYW A;  5G04 J;  4I9E A;  3SZ7 A;  2IF4 A;  3QWV A;  4H12 A;  4N39 A;  4W9R A;  5JJ6 A;  4U07 A;  3M59 A;  1IYG A;  5LSZ A;  4WNG A;  5FZS A;  4MI5 A;  3LYA A;  2IGQ A;  5BNW A;  2VGX A;  3TAX A;  5DBK A;  5KJM A;  2XGM A;  3TGO A;  4G24 A;  5JHN A;  1QZ2 A;  3CKB A;  5KJK A;  4G2V A;  3S7B A;  3RJV A;  1N6C A;  3Q4A B;  4JLG A;  4WUY A;  3ZN3 A;  2PZI A;  2Y4T A;  2FEZ A;  4ABN A;  5JIY A;  2HYZ A;  4WND A;  2R3A A;  3F9Y A;  2UY1 A;  2FO7 A;  5HI7 A;  4I1A A;  5FT9 A;  4BT9 A;  3ASG A;  3QWW A;  2QFC A;  3QDN A;  3ASH A;  2LSV A;  3UPV A;  3RKV A;  2XGO A;  4KYO B;  3ZPJ A;  1KLX A;  5FZR A;  5TH7 A;  2FBN A;  2KCL A;  4RZ0 A;  2AVP A;  2PL2 A;  4U0Z A;  3QOU A;  3UQ3 A;  2UY1 B;  3LPZ A;  3RJW A;  2XPI A;  3PDN A;  4AIF A;  5FJY A;  2G46 A;  5G05 J;  2LSU A;  3OXF A;  4UQX A;  3LY8 A;  5AYW D;  3RO3 A;  1PC2 A;  3S7J A;  3DAL A;  3Q49 B;  5C1D A;  3QWP A;  3M55 A;  5CPR B;  3TG4 A;  3F9X A;  1O9S A;  3Q15 A;  3KMA A;  3GZ2 A;  5BT1 A;  1MVH A;  4BWR A;  2YHC A;  4I9C A;  5LCW C;  3CBM A;  5DIZ A;  2E2E A;  1WM5 A;  4C1Q A;  3F9Z A;  4G1T A;  5JJ0 A;  4HOU A;  2L6J A;  3MO2 A;  3S7F A;  3E4B A;  5CCL A;  2R5S A;  4GCN A;  4CDR A;  3M57 A;  1NA0 A;  5LCW J;  2OOE A;  4I51 A;  3VTY A;  2IFU A;  4GZ5 A;  4GYO A;  4U0S A;  3MO5 A;  2C0M A;  3CK9 A;  4JL0 A;  1W3B A;  5ARG A;  3DB5 A;  1NA3 A;  5KJN A;  1HH8 A;  2Y4U A;  3KD7 A;  4HOT A;  1Y8M A;  5JJT A;  5F5E A;  3MKR A;  3ULQ A;  4J7I A;  4YVQ C;  2XGS A;  1MUF A;  2XEV A;  2MHK A;  4QEO A;  3K9I A;  4APO A;  3FP3 A;  3OS5 A;  5F6K C;  5F6L A;  4XI9 A;  3VUZ A;  4Y6W A;  2QPW A;  1XQH A;  5EX3 A;  1HXI A;  3NF1 A;  5CHE E;  1XNF A;  5FZQ A;  2BQZ A;  4XI0 A;  3CV0 A;  3GZ1 A;  3KAE A;  4N5C A;  3M54 A;  4AU7 A;  2I6H A;  3LY7 A;  5KJL A;  2FF4 A;  4AM9 A;  1P5Q A;  3VV0 A;  2XCB A;  3ASD A;  4U04 A;  5G05 C;  2DBA A;  3M53 A;  4J8E A;  4JA7 A;  5HQ8 A;  2LNI A;  2VGY A;  3BO5 A;  4IJ8 A;  4N2Q A;  4NJ5 A;  5T0K A;  3IEG A;  3FFL A;  3UUX A;  5TEG A;  1IHG A;  2Q7F A;  4Z4P A;  4GZ6 A;  3FWV A;  3K5K A;  4MI0 A;  5F59 A;  3RQ4 A;  3SF4 A;  4E47 A;  4BT8 A;  3RO2 A;  4H7X A;  3R9A B;  3FPD A;  2J9Q A;  3OPE A;  4KBQ A;  3KMT A;  4KXK B;  2C0L A; 
#chains in the Genus database with same CATH topology
 4EHM A;  3I4R B;  4B8C B;  3CLJ A;  3DSU A;  2KZT B;  3AS5 A;  3GW4 A;  3UX4 A;  3CEQ A;  4H7Y A;  2ION A;  4YNP A;  4U8H A;  2B6C A;  1TN8 A;  4FLB A;  1A5E A;  3MV2 B;  4DX7 D;  5CBN A;  3MEK A;  4O60 A;  3MGB A;  4NRH B;  4ATZ D;  5AQ9 A;  3ZEF A;  2WQ7 A;  2X6H A;  4OYS A;  1EPU A;  5FTP A;  2A5U A;  2L0T B;  4QQI A;  4I6G A;  4CDM A;  5D2M C;  3MA5 A;  1N52 A;  3CKC A;  4J83 A;  1WAO 1;  4YPU A;  4U63 A;  2FI7 A;  3CHS A;  3T8K A;  2V5Q C;  4A1S A;  4OVV A;  3SFX A;  2CG2 A;  5EKQ D;  4JDS A;  1TJF A;  2JLB A;  4IUL A;  2F69 A;  2V4L A;  3T5V A;  4CGV A;  4J8S A;  4UQY A;  5BV1 A;  1NZN A;  5AYF A;  3ULY A;  3QJZ A;  4HLL A;  1N4Q A;  1WDY A;  3MV3 B;  1VDY A;  4AY5 A;  4HFG A;  3DEO A;  4I6J A;  3HDX A;  1BPO A;  1KT1 A;  3LY9 A;  1ML9 A;  1MYO A;  3CHQ A;  3RU0 A;  3L17 A;  4AY6 A;  4FMU A;  5M72 A;  4F1S A;  3KS2 A;  2W5Z A;  4K5B A;  2WXR A;  4IYP A;  3FTW A;  4GMJ A;  5BPP A;  3ZYM A;  2PQN A;  3LCA A;  3SWC A;  3ASF A;  2BUG A;  2HM8 A;  1D9S A;  2O8J A;  4B94 A;  5CCM A;  3FUJ A;  2F0Y A;  4M3O A;  5CBO A;  3FU3 A;  3NZS A;  3ZGQ A;  4GA1 A;  3FTY A;  4B8A A;  4IN3 B;  4N5Q A;  4B89 A;  2WVI A;  2WXP A;  3M56 A;  1Z3Y A;  1BD8 A;  3C3O A;  3Q9N C;  3LXU X;  1SZ9 A;  4LNG A;  4XEI G;  4TXP A;  2ZGG A;  3E37 A;  1MX6 A;  1N9A A;  1TJC A;  1QNF A;  1OWM A;  4I2Z A;  3HRA A;  3Q47 B;  2WQH A;  1TNO A;  4URK A;  2CFZ A;  3O4Z A;  4HOQ A;  5T0M A;  4YND A;  2P9I G;  1MZC A;  1OUV A;  4HB5 A;  3DEP A;  1XGW A;  1YA0 A;  3MYV A;  1H6O A;  2HR2 A;  4G26 A;  3TWU A;  4MKT A;  1L5J A;  4HBD A;  3Q5M A;  2XPY A;  4JPS A;  2C2L A;  2BTD A;  3AAA C;  5T5G A;  2V4H C;  3SZ7 A;  4H12 A;  1KZP A;  2ZXW E;  1U3C A;  5LSZ A;  3V2O A;  4RQI A;  3DSS A;  2IGQ A;  4G24 A;  2I1J A;  5JHN A;  1QZ2 A;  4CDN A;  3MCX A;  2LXL A;  3ML9 A;  3RJV A;  3Q4A B;  5LOZ A;  4JLG A;  5LFA A;  3FTU A;  4DI4 A;  2FEZ A;  4FHK A;  2UY1 A;  4ATG A;  4HVB A;  3UIN C;  3PUJ A;  5LX8 A;  3HXE A;  5HI7 A;  1HF8 A;  2OVB A;  1H2T C;  4BT9 A;  2X6F A;  2GGF A;  2R59 A;  4GTM A;  2QFC A;  2R02 A;  2BF0 X;  3ASH A;  2LSV A;  3RAU A;  3ZU7 B;  4Z68 A;  3RKV A;  1S64 A;  1HE8 A;  2P9S G;  1KPS B;  3E30 A;  5FIN A;  2KCL A;  3JQ0 A;  2AVP A;  1OCR E;  4U0Z A;  3J5Q B;  2EIL E;  2JEK A;  3UT8 A;  2IY0 C;  2NYJ A;  4NAC A;  4BET A;  4TV3 A;  2AXZ A;  3T5X A;  2IEJ A;  4UQX A;  3B13 A;  4DRX E;  4EBA G;  5AYW D;  1PC2 A;  3S7J A;  3Q49 B;  3D9H A;  1E8Z A;  2RD0 A;  1O9S A;  3Q15 A;  3KMA A;  1OCZ E;  1MVH A;  3ZW3 A;  3MZL B;  4GTV A;  1WM5 A;  2OEW A;  3CVW A;  1TN7 A;  4HXI A;  3RRU A;  2YIN A;  4CRW A;  4HOU A;  5BV0 A;  3S7F A;  3OAW A;  2GRQ B;  1UN9 A;  2IJG X;  2DVW A;  4HQD A;  3CQC B;  5EIB E;  2WXG A;  4GCN A;  2CHX A;  4LER A;  4L2Y A;  4GMR A;  4Q94 A;  3MO5 A;  4J6I A;  3QAR A;  2OVF A;  4JL0 A;  2A4Z A;  3CHR A;  1W3B A;  3L13 A;  5ARG A;  4L23 A;  3APD A;  3NB2 A;  1NA3 A;  1WG0 A;  2Y4U A;  5JJT A;  1OWO A;  4ACK A;  3ULQ A;  4J7I A;  1Z5S C;  1DCE A;  1LD8 A;  2WXK A;  1DVP A;  3HVE B;  3TXN A;  1SA5 A;  3LEW A;  2QPW A;  1N54 A;  4BSZ B;  3FTV A;  2ETA A;  4F1P A;  3DRA A;  4UWF A;  4GTO A;  2J4B A;  5FQ6 A;  3FUN A;  3G2U A;  1E7U A;  3HXD A;  4F53 A;  3LY7 A;  4EZK A;  1HG2 A;  3ML8 A;  4UWL A;  3VV0 A;  2DBA A;  3M53 A;  2V0P A;  3PVL A;  5HQ8 A;  1UJK A;  2XHE A;  4EBA A;  4BY6 A;  5FIO A;  5T0K A;  3IEG A;  2B0O E;  3FFL A;  1BI7 B;  2F37 A;  2WM9 A;  4A63 B;  4GZ6 A;  3FWV A;  2WMO A;  3K5K A;  4U8Y D;  5F59 A;  3RQ4 A;  3L08 A;  3D9I A;  3PZ3 A;  4OAV B;  3UIO C;  1Z3X A;  3DXK G;  3FPD A;  2J9Q A;  3OPE A;  4KXK B;  2WXN A;  4WWN A;  2J8S D;  4NQ0 A;  3JYS A;  2KM4 A;  4CYM D;  2GW1 A;  3DSV A;  3ZYQ A;  2VJ8 A;  2VSY A;  3AS8 A;  2RFM A;  4I6E A;  2OND A;  1HO8 A;  1V54 E;  5JMN D;  3M5A A;  3PRE A;  5A7D B;  1DNP A;  5T3R A;  2PNN A;  3IHV A;  1ZB1 A;  1ZBP A;  2AWI A;  4LSZ E;  3SFZ A;  4JHJ A;  4E6H A;  2X38 A;  4EEC A;  3HG0 D;  2YQ8 A;  1BI8 B;  2OV8 A;  2XCC A;  4XIF A;  4BES A;  1IXV A;  4N3C A;  3TWV A;  4EQF A;  4HLE A;  5LP0 A;  1NI1 A;  3LKU A;  1O1T A;  3ASO E;  4XKB A;  3UT7 A;  3FUL A;  2YHE A;  3KEA A;  4LEU A;  3RRN B;  2X3M A;  2NSZ A;  2I2O A;  3BUA A;  4PH4 B;  1QBQ A;  2Y0B G;  1FT2 A;  1U2V G;  2E0I A;  4O30 A;  2GRP B;  4JXT A;  2QYJ A;  2YNQ A;  4L2L A;  3FUF A;  2KC7 A;  2H6G A;  3C98 A;  1ZU2 A;  3RSE G;  4DJA A;  2RFA A;  5A6C A;  4KVO A;  4U7E B;  3OXL A;  2CHW A;  1H3I A;  2MRI A;  3ESL A;  2RFI A;  1PEG A;  4QEP A;  3R7R A;  3LS8 A;  1LD7 A;  4O1P A;  2VGX B;  5KWD A;  3EDT B;  5IY5 E;  5T8I A;  1E7V A;  3Q7A A;  3CVY A;  1H6K A;  3CVL A;  4DX5 D;  4RLY A;  4J8D A;  2QY7 A;  3UI2 A;  5ANL A;  4B93 B;  4J0U A;  5ENS D;  3TWX A;  3L6A A;  4GTQ A;  4GTR A;  2LXM A;  2Y3A A;  4AV7 A;  1KT0 A;  4BTB A;  2V5F A;  3EJN A;  3C5R A;  2R17 C;  4F3V A;  4G8L A;  3CSF A;  3VTX A;  1H2U A;  1HU3 A;  3HNA A;  1E96 B;  4WNF A;  5FWQ A;  4UUC A;  2IO3 C;  2WB2 A;  3EP0 A;  2VGE A;  4F7A A;  3V79 K;  2EIN E;  2QC9 A;  2ZIR A;  5AQB A;  2CG3 A;  3AG4 E;  4YVO A;  2FO1 E;  3KMJ A;  3CQG B;  3V31 A;  4GYY A;  4YDW A;  3BEE A;  3NBN B;  4YNM A;  3ZNG A;  4DLO A;  3URZ A;  3G2V A;  5EN5 D;  3SFY A;  3FEX A;  3AJI A;  2WMN A;  2LAH A;  4BER A;  4I9E A;  5CMW A;  4N39 A;  5JJ6 A;  3U64 A;  1K1A A;  3DXM G;  4KVM A;  3GZS A;  3LYA A;  2VGX A;  4ANU A;  3TGO A;  2AXU A;  3F6Q A;  3QAQ A;  3IXE A;  3CKB A;  4PDX A;  1N4R A;  3S7B A;  2MYO A;  1N6C A;  2OCC E;  2WXL A;  3W9G A;  2PM7 A;  3ZN3 A;  2HYZ A;  4WND A;  5KCM A;  5AJD A;  3ABM E;  3G2S A;  3DST A;  3ZVV A;  4CT4 A;  3T9K A;  3QDN A;  5AEN A;  4EZJ A;  4QFV A;  3UPV A;  1OCO E;  5B1B E;  5J90 A;  2Y69 E;  1KLX A;  4J7W A;  4YDE A;  1EYH A;  5TH7 A;  1RW2 A;  5KNG A;  2PL2 A;  3UQ3 A;  1IHB A;  2UY1 B;  1BU9 A;  1WY6 A;  3JUE A;  5ENQ D;  3JCK C;  3PH0 C;  3PEU B;  2XPI A;  4AIF A;  3TJP A;  2EIJ E;  2LSU A;  3UT4 A;  3RO3 A;  5A23 A;  3UKR G;  3SY2 A;  3QWP A;  5BXO A;  3KEZ A;  1S0P A;  3FU6 A;  3GZ2 A;  5BT1 A;  2V8S E;  3R9M A;  4BX8 A;  4I9C A;  3MJW A;  4ILG A;  5DIZ A;  2XS8 A;  4TUM A;  5AAR A;  3F9Z A;  3TWW A;  2L6J A;  3DBS A;  3PUK A;  2WXM A;  5AQ7 A;  1D8D A;  2XZT G;  3D9N A;  4JVS A;  4Q69 A;  4I51 A;  2IFU A;  3FY4 A;  1FVH A;  3ABK E;  5ITZ F;  2L0I A;  3NOC D;  3I5P A;  3E32 A;  2H6I A;  5CER B;  4HI9 A;  4GTS A;  5KJN A;  4P29 A;  4U96 D;  3KD7 A;  1Y8M A;  5ENN A;  1JUQ A;  2LO6 A;  5F5E A;  2WXH A;  1SVX A;  2XGS A;  2MHK A;  3K9I A;  4FHJ A;  3OS5 A;  3FP3 A;  5F6K C;  3I3N A;  3OTN A;  2IOS A;  5AJL A;  4FUL A;  3MX3 A;  4XI9 A;  3VUZ A;  3CVX A;  3B7T A;  3NZU A;  1XQH A;  2J08 A;  3FUK A;  5EX3 A;  3LDZ A;  5HS0 A;  1HXI A;  4LNU D;  2RKK A;  5CEA A;  1IQR A;  1JCR A;  4LUN U;  3CST A;  4FA6 A;  2FF4 A;  2XCB A;  3Q7F A;  3ASD A;  4U04 A;  1INZ A;  5ENO D;  1TNU A;  4JA7 A;  3BO5 A;  4N2Q A;  3W9F A;  4ANV A;  2RG8 A;  3HXC A;  5G2N A;  1BLX B;  4K5A B;  3ONL A;  5TEG A;  4Z4P A;  1MJ0 A;  4BT8 A;  3E34 A;  4NUR A;  3RO2 A;  3TWQ A;  3ZYK A;  2XQ0 A;  4PS8 A;  3FEY A;  4L1B A;  4APF A;  4GAA A;  1TNZ A;  5J08 A;  2GRR B;  4G23 A;  1N6A A;  2DYS E;  1ELW A;  4JHK A;  3WG7 E;  4B0Z A;  4DLQ A;  2EIK E;  3PE4 A;  2GRL A;  3QKY A;  2Y1L E;  4GA2 A;  4JHR A;  3PRZ A;  1DCQ A;  4I17 A;  3UKU G;  3ZFW A;  3CVQ A;  4ACL A;  2KCK A;  2R05 A;  1SZA A;  1MHQ A;  5EID A;  3BG0 B;  4MBG A;  5EX0 A;  3ONK A;  3U9W A;  3HYM B;  5JA4 D;  1HZ4 A;  4GPK A;  4JD2 G;  4LNB A;  4O1O A;  3S7D A;  5JJ7 A;  4J7F A;  3O48 A;  3L54 A;  3U4T A;  3CGH A;  4Y6C A;  3LJ3 A;  2VSN A;  4EPZ A;  5BUZ A;  3LJN A;  4GCO A;  5EYP F;  2VYI A;  2AW6 A;  3AG3 E;  5D66 A;  2WXO A;  2KBX A;  4IRU A;  3PE3 A;  5BW8 C;  1TYQ G;  1FPP A;  4N3B A;  2ZU6 B;  3IHX A;  4ILH B;  3ZXS A;  4TXQ A;  3U3W A;  4UWK A;  4C9B B;  1X81 A;  5TTF A;  1AWC B;  1ELR A;  1FCH A;  1U3D A;  3FDH A;  3NQP A;  3F9W A;  3ZYL A;  5FQ7 A;  4UI9 C;  2HO1 A;  1N4P A;  4N3A A;  3R7Q A;  4U0U A;  4UWG A;  5B3S E;  5JIN A;  1N3J A;  4HI8 A;  3AG2 E;  3APF A;  1A17 A;  3B95 A;  1UOH A;  3CBP A;  3SGH A;  1NL4 A;  4G25 A;  3CVP A;  4KT6 B;  2CHZ A;  4UI9 J;  3HIZ A;  4XKC A;  3RAY A;  5EYL A;  3ZHE A;  1Z6T A;  2ZGD A;  3FTS A;  2EIM E;  3J5P A;  3SD5 A;  4C0M A;  1DC2 A;  1N4S A;  3OXG A;  4BFR A;  3KSL A;  4KZC A;  1ELK A;  3N71 A;  4BEP A;  3B7R L;  4MRU A;  3L22 A;  3WXX A;  3S8P A;  4AVX A;  3ESK A;  4LDG A;  2PQR A;  3CK7 A;  3RK6 A;  3TWR A;  4ZFH A;  2VTB A;  1MVX A;  1D8E A;  3QB2 A;  4ME2 A;  4UQZ A;  1B89 A;  5D0Q D;  4J8O A;  4BUP A;  1AP7 A;  3BG1 B;  4GZ3 A;  4MS6 A;  4YPE A;  1K3Z D;  3GYZ A;  2UWJ G;  5ARF A;  3CVN A;  3L9T A;  2W5Y A;  4DUI A;  3IHY A;  4BTA A;  3EHQ A;  2DIW A;  1H0A A;  1UG3 A;  1TEZ A;  1E90 A;  2VSO E;  3Q78 A;  2IF4 A;  1SQM A;  3QWV A;  4W9R A;  1UW4 B;  4U07 A;  2R2L A;  3M59 A;  3IV0 A;  2L6B A;  2ETB A;  4JC8 A;  4WNG A;  5FZS A;  3PNL B;  3PZD A;  5EDS A;  4A1G A;  5BNW A;  3TAX A;  5DBK A;  2XGM A;  4K5C A;  3HXB A;  4XZ4 A;  3QNK A;  4HS2 A;  1TN6 A;  2PZI A;  2QYU A;  2Y4T A;  2R3A A;  3F9Y A;  4TXR A;  4FAD A;  4AEZ C;  4AXH A;  1JCS A;  4RSY A;  2XEN A;  3ZXP A;  1EDU A;  2J07 A;  3ISM C;  4ILI A;  2XZD G;  4GPM A;  5FT9 A;  4DX2 A;  4ZHB A;  2WXF A;  3JUI A;  1PAQ A;  4DK5 A;  3DPY A;  4A55 A;  3ZPJ A;  4AJW A;  4FP7 A;  3LVR E;  5FZR A;  2FBN A;  2P9L G;  3FU0 A;  4DI3 A;  3QOU A;  1IQU A;  1SA4 A;  4FU3 A;  1K8K G;  4GML A;  4CEM A;  3EIJ A;  4X8Q A;  3ZKJ A;  2G46 A;  3UM3 A;  5G05 J;  2H6H A;  5CEC B;  1H2V C;  1H19 A;  3DAL A;  1N94 A;  5ANR A;  4TUU A;  5CPR B;  3VLF A;  3NOG D;  4AP2 A;  3MKQ A;  3U66 A;  4FC8 A;  2BKK B;  3G2W A;  1UJJ A;  4U8V D;  2P9N G;  5LCW C;  4L9P A;  1LF8 A;  3TWS A;  3UXG A;  4C1Q A;  1Q2Z A;  4WWP A;  1V55 E;  4G1T A;  5JJ0 A;  4HNA D;  4C0E A;  3MO2 A;  3D9P A;  1HFA A;  2R5S A;  3B7S A;  3M57 A;  2LUH A;  1NA0 A;  5LCW J;  2OOE A;  3EU9 A;  3VTY A;  3UM1 A;  4GZ5 A;  4E85 A;  4U0S A;  3UM2 A;  3ENE A;  3CK9 A;  3SO8 A;  3EHR A;  1S63 A;  3BQO A;  1TNY A;  2WXQ A;  2AXV A;  3MKR A;  4GB9 A;  2P9K G;  4FJZ A;  2I1K A;  4FJY A;  1MQS A;  4APO A;  4XX5 A;  1MX2 A;  3UMV A;  5AIJ A;  5F6L A;  3KSQ A;  4Y6W A;  2WQ6 A;  3EHM A;  1O1R A;  3NF1 A;  2H6F A;  1N11 A;  5FQ4 A;  5CHE E;  1XNF A;  5FZQ A;  2J09 A;  3FUD A;  3V2X A;  4M7C A;  3AG1 E;  3CV0 A;  3KAE A;  4N5C A;  3LVQ E;  3M54 A;  4AU7 A;  2I6H A;  1E8X A;  3AU4 A;  1OWN A;  4U95 D;  1O5M A;  4V3I A;  2WXJ A;  3EU5 A;  3IBE A;  4AM9 A;  3L16 A;  2XS1 A;  3FH8 A;  1P5Q A;  4EZL A;  3ABL E;  1OWL A;  2LNI A;  2VGY A;  4IJ8 A;  3SBS A;  3BU8 A;  4NJ5 A;  2EQX A;  4LCT A;  2KZT A;  1HG5 A;  4A3V A;  3UTM A;  4MI0 A;  3CVV A;  4E47 A;  5G55 A;  3EIQ C;  1H6P A;  4R7L A;  3PEV B;  1JCQ A;  4KBQ A;  3KMT A;  5JHB A;  1IKN D;  4AOF A;  3QC1 A;  2DZO A;  1HX8 A;  3CK8 A;  3D9J A;  5CRU A;  3C3Q A;  3P2B A;  1FVF A;  1E8W A;  3FUE A;  2J49 A;  3UIP C;  3QK0 A;  4OVU A;  1OT8 A;  3JXI A;  1X5B A;  4GTT A;  3G2T A;  5ENP D;  4JZY A;  1TR4 A;  4CGW A;  4DX1 A;  4ANW A;  1O1S A;  2JAB A;  4I43 A;  5E76 A;  1UN8 A;  2A5E A;  4WNE A;  4QEN A;  1FT1 A;  4LRZ A;  2XPZ A;  1N95 A;  4BX9 A;  4GU5 A;  2BKG A;  4K03 A;  4O6F A;  4HOS A;  3FH7 A;  4LG6 A;  3SQV A;  2IOL A;  3EUV A;  3TXM A;  2PM6 A;  3TWT A;  4FLH A;  4HOR A;  3CVU A;  3TG5 A;  5CED B;  3NAW A;  5H7P A;  4BSX A;  4IJD A;  4GA0 A;  4ANX A;  4YPA A;  1ZKK A;  2IQC A;  2VQ2 A;  2F8X K;  4JEU A;  1MT6 A;  3B7U X;  5KNH D;  3IKO B;  2KAT A;  2L9B A;  3FUM A;  2KCV A;  4JEH A;  1S70 B;  5CRV A;  5E75 A;  3D9M A;  2QZA A;  1JWF A;  1E8Y A;  3D9L A;  4D10 C;  3HHM A;  4RG9 A;  2IO2 C;  4G11 A;  3MO0 A;  3CBO A;  4I2W A;  3OOI A;  4WAF A;  2P58 C;  4WWO A;  2XRY A;  3ULE G;  4HRN A;  3S2A A;  2NC9 A;  4RG6 A;  2WPV A;  2CFU A;  5AQA A;  3TL5 A;  1OXJ A;  5AN8 A;  3M58 A;  1GW6 A;  2FUL A;  3RIB A;  4GTP A;  2JV0 A;  4N2S A;  3PZ2 A;  4Q96 A;  4HRL A;  1MX4 A;  3AS4 A;  4C48 B;  5LSX A;  2M63 A;  1G3N B;  3I4G A;  2DWZ A;  4DX6 D;  4J8F A;  2XEE A;  5D0O D;  2DYR E;  1RZ4 A;  3FTZ A;  2J4D A;  4I1M A;  3VLE A;  4JA9 A;  4UI9 K;  3SW9 A;  3ZHE B;  5G04 C;  3CHM A;  4GZD A;  4KZ0 A;  1OWP A;  3ZIM A;  3UM0 A;  5EG2 A;  3CHO A;  1Y6I A;  4NVQ A;  1QQE A;  4GYW A;  2GRO B;  3D9O A;  1K1B A;  5G04 J;  3C3R A;  4PS3 A;  1IYG A;  2VTB B;  4MI5 A;  2ETC A;  3X2Q E;  5KJM A;  3APC A;  2HE0 A;  2P9U G;  5C2Y A;  2X6J A;  3DWL G;  5KJK A;  4G2V A;  3C72 A;  4WUY A;  2MOW A;  4ABN A;  5JIY A;  2BED A;  3PNT B;  3Q73 A;  3SBT B;  4XE0 A;  2FO7 A;  1JWG A;  1EF1 C;  2P9P G;  4GZC A;  2R03 A;  1N0Q A;  4I1A A;  3ASG A;  4NIK A;  3QWW A;  5AAO A;  3D9K A;  2XGO A;  4KYO B;  2DCP A;  2F8Y A;  1OY3 D;  2P2C P;  3SHF A;  3ZUV B;  4RZ0 A;  3ASN E;  3FU5 A;  5FQ8 A;  3LPZ A;  1NFI E;  1YMP A;  1YYH A;  3RJW A;  3PZ1 A;  3VLD A;  2KXP C;  3DSX A;  4CT0 A;  3PDN A;  4PUC A;  5FJY A;  4DPR A;  4I1O B;  3SI5 A;  3OXF A;  3LY8 A;  5KBA A;  2ILR A;  4CZ2 D;  5ENR D;  5C1D A;  2NXP A;  3M55 A;  3PZ4 A;  3TG4 A;  3F9X A;  4TRQ A;  5CMY A;  2X6I A;  1PY1 A;  4BWR A;  2YHC A;  3V30 A;  1N0R A;  4PS7 A;  3CBM A;  4OAU C;  2E2E A;  3Q9U C;  2AJA A;  1OCC E;  5BXU A;  3E33 A;  3E4B A;  2X6K A;  5CCL A;  1JPL A;  5EIL A;  4CDR A;  1NP7 A;  3HVE A;  4L7T A;  3L82 A;  4GYO A;  3JXJ A;  2C0M A;  3MKQ B;  3T8M A;  5HRY A;  4KMO A;  3DB5 A;  3D3M A;  5HKP A;  3JQ1 A;  3CIA A;  1HH8 A;  2GRM A;  3Q79 A;  4HOT A;  4K0R A;  4RVB A;  1SW6 A;  5T4Y A;  4YVQ C;  5JHA A;  2IU1 A;  1MUF A;  2XEV A;  1QYM A;  4QEO A;  2OEV A;  3DPD A;  3CR3 A;  2XRZ A;  1HS6 A;  2XEH A;  2LAI A;  3B7B A;  5ENT D;  3P1U A;  2WXI A;  2BQZ A;  4XI0 A;  4MLP A;  3GZ1 A;  1TNB A;  2VSX E;  4YDY A;  3RRM B;  1KZO A;  1YCS B;  5KJL A;  2GRN B;  4UWH A;  2I9C A;  4JB8 P;  3ZRH A;  5G05 C;  4A3T A;  4J8E A;  3SNX A;  3CHP A;  1LTX A;  3EHN A;  3FUH A;  5B1A E;  4J8Y A;  2DZN A;  3AU5 A;  4JW1 A;  2ZIS A;  3FUI A;  3UUX A;  1IHG A;  2Q7F A;  3DSW A;  3FHE A;  4F6R D;  3SF4 A;  4G8K A;  3FTX A;  3HXF A;  4YDO A;  4H7X A;  3R9A B;  4HRM B;  3Q75 A;  3PS6 A;  3FH5 A;  4CCA A;  2C0L A; 
#chains in the Genus database with same CATH homology
 4WWN A;  3CK8 A;  3D9J A;  4NQ0 A;  4G23 A;  3JYS A;  1N6A A;  2KM4 A;  3P2B A;  2GW1 A;  3ZYQ A;  1ELW A;  3I4R B;  1FVF A;  2VJ8 A;  4B8C B;  4JHK A;  3CLJ A;  1E8W A;  3FUE A;  2J49 A;  4B0Z A;  4DLQ A;  2VSY A;  3AS8 A;  3QK0 A;  3PE4 A;  2KZT B;  2GRL A;  3AS5 A;  4OVU A;  3QKY A;  4I6E A;  3GW4 A;  4GA2 A;  3UX4 A;  4JHR A;  2OND A;  3CEQ A;  1X5B A;  3PRZ A;  4H7Y A;  4I17 A;  1HO8 A;  3G2T A;  2ION A;  3ZFW A;  3CVQ A;  4JZY A;  4U8H A;  4ACL A;  2KCK A;  4YNP A;  3M5A A;  3PRE A;  5A7D B;  4FLB A;  1SZA A;  1DNP A;  5T3R A;  4CGW A;  1MHQ A;  3IHV A;  4ANW A;  3MV2 B;  4I43 A;  1ZBP A;  2AWI A;  3SFZ A;  4JHJ A;  3BG0 B;  3MEK A;  5EX0 A;  3ONK A;  2X38 A;  4E6H A;  3MGB A;  1UN8 A;  5E76 A;  4NRH B;  3U9W A;  4EEC A;  2YQ8 A;  4WNE A;  3HYM B;  3ZEF A;  2WQ7 A;  2OV8 A;  1HZ4 A;  2XCC A;  4GPK A;  2X6H A;  4OYS A;  4XIF A;  4QEN A;  1EPU A;  3S7D A;  5JJ7 A;  4LRZ A;  5FTP A;  2XPZ A;  4N3C A;  4J7F A;  3O48 A;  4EQF A;  4HLE A;  2A5U A;  2L0T B;  3L54 A;  5LP0 A;  3U4T A;  4BX9 A;  3LKU A;  4I6G A;  4CDM A;  3MA5 A;  1N52 A;  3CGH A;  4GU5 A;  4K03 A;  3CKC A;  4O6F A;  4Y6C A;  4HOS A;  3FH7 A;  4J83 A;  3LJ3 A;  1WAO 1;  2VSN A;  3FUL A;  4XKB A;  3UT7 A;  2YHE A;  2FI7 A;  3CHS A;  4U63 A;  4YPU A;  4LEU A;  4A1S A;  4OVV A;  4EPZ A;  5BUZ A;  2CG2 A;  3RRN B;  2IOL A;  4GCO A;  2X3M A;  5EKQ D;  3TXM A;  2VYI A;  2NSZ A;  2PM6 A;  2I2O A;  2AW6 A;  4FLH A;  2WXO A;  4IRU A;  4JDS A;  1TJF A;  3PE3 A;  2JLB A;  5BW8 C;  4HOR A;  4PH4 B;  4IUL A;  2F69 A;  3CVU A;  3TG5 A;  2V4L A;  3T5V A;  4CGV A;  4BSX A;  4N3B A;  4J8S A;  4IJD A;  2ZU6 B;  4UQY A;  1NZN A;  2E0I A;  4GA0 A;  4ILH B;  3ZXS A;  5BV1 A;  4ANX A;  3IHX A;  1ZKK A;  4O30 A;  4YPA A;  5AYF A;  4JXT A;  2YNQ A;  4L2L A;  2IQC A;  2VQ2 A;  3QJZ A;  3FUF A;  2KC7 A;  4JEU A;  1MT6 A;  3C98 A;  3U3W A;  1ZU2 A;  3B7U X;  3MV3 B;  4UWK A;  1VDY A;  2KAT A;  3IKO B;  4AY5 A;  4HFG A;  4C9B B;  2L9B A;  4DJA A;  3FUM A;  5A6C A;  5TTF A;  4I6J A;  2KCV A;  3HDX A;  4KVO A;  1ELR A;  1BPO A;  1FCH A;  1U3D A;  3FDH A;  1KT1 A;  3NQP A;  4JEH A;  3LY9 A;  1ML9 A;  3RU0 A;  3CHQ A;  3F9W A;  3OXL A;  3D9M A;  5E75 A;  2CHW A;  1JWF A;  3ZYL A;  1H3I A;  3L17 A;  1E8Y A;  3D9L A;  5FQ7 A;  4AY6 A;  2MRI A;  4FMU A;  4UI9 C;  4D10 C;  2HO1 A;  3ESL A;  3HHM A;  4RG9 A;  2RFI A;  1PEG A;  4G11 A;  5M72 A;  3MO0 A;  4N3A A;  4F1S A;  3R7Q A;  3R7R A;  3CBO A;  3LS8 A;  3KS2 A;  4I2W A;  4U0U A;  4UWG A;  2W5Z A;  3OOI A;  5JIN A;  2WXR A;  1N3J A;  4IYP A;  3FTW A;  4GMJ A;  4WAF A;  5BPP A;  3ZYM A;  2P58 C;  2VGX B;  1A17 A;  3APF A;  3EDT B;  2PQN A;  4WWO A;  3LCA A;  5T8I A;  2XRY A;  3CBP A;  1E7V A;  3SWC A;  3ASF A;  2BUG A;  2HM8 A;  3SGH A;  3CVY A;  1H6K A;  2O8J A;  4G25 A;  3CVP A;  4KT6 B;  3S2A A;  4B94 A;  5CCM A;  2CHZ A;  3CVL A;  4UI9 J;  3FUJ A;  2NC9 A;  4M3O A;  4RG6 A;  2WPV A;  2CFU A;  3FU3 A;  3NZS A;  4J8D A;  3TL5 A;  3HIZ A;  2QY7 A;  4XKC A;  3RAY A;  5ANL A;  3M58 A;  1GW6 A;  4J0U A;  3ZHE A;  3ZGQ A;  2FUL A;  4GA1 A;  4QEP A;  1Z6T A;  3RIB A;  2JV0 A;  3FTS A;  3FTY A;  4B8A A;  3L6A A;  4IN3 B;  4N2S A;  4B89 A;  2WVI A;  2WXP A;  3SD5 A;  3M56 A;  2Y3A A;  4Q96 A;  4AV7 A;  1Z3Y A;  4C0M A;  3OXG A;  1KT0 A;  4BTB A;  3AS4 A;  4BFR A;  2V5F A;  3EJN A;  2R17 C;  4KZC A;  4F3V A;  1ELK A;  3N71 A;  5LSX A;  3CSF A;  3LXU X;  1SZ9 A;  3VTX A;  2M63 A;  3B7R L;  1H2U A;  1HU3 A;  3HNA A;  1E96 B;  4WNF A;  4MRU A;  5FWQ A;  3I4G A;  3L22 A;  3WXX A;  1TJC A;  4J8F A;  2WB2 A;  1QNF A;  5D0O D;  3S8P A;  4AVX A;  3EP0 A;  3ESK A;  4LDG A;  2PQR A;  4F7A A;  1OWM A;  3FTZ A;  2J4D A;  4I2Z A;  3CK7 A;  4I1M A;  3Q47 B;  3RK6 A;  2WQH A;  3VLE A;  2VTB A;  4JA9 A;  4UI9 K;  4URK A;  1MVX A;  3ZHE B;  3QB2 A;  2CFZ A;  2CG3 A;  4ME2 A;  3SW9 A;  4UQZ A;  3O4Z A;  1B89 A;  5D0Q D;  5G04 C;  4HOQ A;  4J8O A;  4YVO A;  4BUP A;  5T0M A;  4YND A;  3KMJ A;  3BG1 B;  3CHM A;  1OUV A;  3CQG B;  4GZ3 A;  4GYY A;  4GZD A;  3BEE A;  4MS6 A;  4YNM A;  1XGW A;  4KZ0 A;  1YA0 A;  4YPE A;  1OWP A;  3MYV A;  3GYZ A;  2UWJ G;  3ZIM A;  5ARF A;  3CVN A;  2HR2 A;  4G26 A;  5EG2 A;  2W5Y A;  4MKT A;  1L5J A;  3Q5M A;  2XPY A;  4DLO A;  3CHO A;  1Y6I A;  3URZ A;  3G2V A;  3IHY A;  4JPS A;  4NVQ A;  4BTA A;  2C2L A;  2BTD A;  2DIW A;  5T5G A;  1H0A A;  1UG3 A;  1TEZ A;  1E90 A;  1QQE A;  3FEX A;  4GYW A;  3D9O A;  2WMN A;  2LAH A;  2VSO E;  5G04 J;  4I9E A;  3SZ7 A;  2IF4 A;  1SQM A;  3QWV A;  5CMW A;  4H12 A;  4N39 A;  4W9R A;  5JJ6 A;  1UW4 B;  4U07 A;  3U64 A;  1U3C A;  4PS3 A;  3IV0 A;  3M59 A;  1IYG A;  5LSZ A;  4WNG A;  4JC8 A;  2VTB B;  5FZS A;  4KVM A;  3GZS A;  3PNL B;  3LYA A;  4MI5 A;  3PZD A;  5EDS A;  4A1G A;  2IGQ A;  5BNW A;  2VGX A;  3TAX A;  5DBK A;  4ANU A;  5KJM A;  2XGM A;  3APC A;  3TGO A;  2AXU A;  3QAQ A;  4G24 A;  2I1J A;  5JHN A;  1QZ2 A;  4XZ4 A;  3CKB A;  5C2Y A;  3QNK A;  4CDN A;  3MCX A;  2X6J A;  4PDX A;  5KJK A;  4G2V A;  3ML9 A;  4HS2 A;  3RJV A;  3S7B A;  1N6C A;  3Q4A B;  5LOZ A;  4JLG A;  2WXL A;  5LFA A;  3FTU A;  4WUY A;  4DI4 A;  2MOW A;  2PM7 A;  3ZN3 A;  2PZI A;  2Y4T A;  2FEZ A;  4ABN A;  5JIY A;  2HYZ A;  4WND A;  2R3A A;  3PNT B;  5KCM A;  4FHK A;  3F9Y A;  2UY1 A;  4FAD A;  4ATG A;  4HVB A;  5AJD A;  4AEZ C;  3PUJ A;  3SBT B;  4AXH A;  4RSY A;  5LX8 A;  4XE0 A;  2FO7 A;  1JWG A;  1EF1 C;  3G2S A;  1EDU A;  3ZVV A;  4GZC A;  5HI7 A;  4CT4 A;  2J07 A;  1HF8 A;  4ILI A;  2OVB A;  1H2T C;  4I1A A;  5FT9 A;  4BT9 A;  2X6F A;  2GGF A;  3ASG A;  2R59 A;  3QWW A;  2QFC A;  3QDN A;  2BF0 X;  3ASH A;  4EZJ A;  2LSV A;  4QFV A;  5AEN A;  2WXF A;  3UPV A;  3D9K A;  3JUI A;  1PAQ A;  4DK5 A;  5J90 A;  4A55 A;  3RKV A;  2XGO A;  4KYO B;  3ZPJ A;  1KLX A;  4AJW A;  2DCP A;  4FP7 A;  3LVR E;  5FZR A;  3SHF A;  1HE8 A;  1EYH A;  5TH7 A;  2FBN A;  2KCL A;  3JQ0 A;  4RZ0 A;  2AVP A;  2PL2 A;  3FU0 A;  4U0Z A;  4DI3 A;  3QOU A;  3UQ3 A;  1IQU A;  2JEK A;  2UY1 B;  4FU3 A;  1WY6 A;  3FU5 A;  5FQ8 A;  3JCK C;  4GML A;  3PH0 C;  3LPZ A;  3PEU B;  3UT8 A;  4CEM A;  3EIJ A;  3RJW A;  3VLD A;  4NAC A;  2XPI A;  4CT0 A;  3PDN A;  4TV3 A;  4PUC A;  4AIF A;  5FJY A;  2G46 A;  2AXZ A;  5G05 J;  3TJP A;  4DPR A;  3T5X A;  4I1O B;  2LSU A;  3SI5 A;  3OXF A;  4UQX A;  3LY8 A;  3B13 A;  3UT4 A;  2ILR A;  4EBA G;  5AYW D;  1H2V C;  3RO3 A;  1PC2 A;  5A23 A;  3S7J A;  1H19 A;  3DAL A;  3Q49 B;  5ANR A;  4TUU A;  5C1D A;  2NXP A;  3QWP A;  3M55 A;  3VLF A;  5CPR B;  3TG4 A;  1E8Z A;  3F9X A;  3KEZ A;  3MKQ A;  4TRQ A;  4AP2 A;  2RD0 A;  1O9S A;  3Q15 A;  5CMY A;  3U66 A;  4FC8 A;  2X6I A;  3KMA A;  3G2W A;  1UJJ A;  1S0P A;  3FU6 A;  3GZ2 A;  5BT1 A;  1PY1 A;  4BWR A;  1MVH A;  2V8S E;  2YHC A;  3ZW3 A;  4BX8 A;  4I9C A;  3MJW A;  5LCW C;  4PS7 A;  3CBM A;  4ILG A;  5DIZ A;  2E2E A;  3MZL B;  1WM5 A;  1LF8 A;  3CVW A;  4C1Q A;  4WWP A;  3F9Z A;  4G1T A;  4HXI A;  3RRU A;  5JJ0 A;  2YIN A;  4CRW A;  4HOU A;  5BV0 A;  2L6J A;  4C0E A;  3MO2 A;  3S7F A;  3OAW A;  3DBS A;  3D9P A;  1HFA A;  3PUK A;  1UN9 A;  2WXM A;  3E4B A;  2IJG X;  2X6K A;  5CCL A;  2R5S A;  1JPL A;  3CQC B;  2WXG A;  4GCN A;  3B7S A;  2CHX A;  1NP7 A;  3D9N A;  3HVE A;  4LER A;  4JVS A;  4L2Y A;  4L7T A;  4CDR A;  4Q69 A;  1NA0 A;  5LCW J;  2OOE A;  4I51 A;  4Q94 A;  3VTY A;  2IFU A;  4GZ5 A;  4E85 A;  4GYO A;  3FY4 A;  1FVH A;  3ENE A;  4U0S A;  2L0I A;  3MO5 A;  2C0M A;  3MKQ B;  3I5P A;  4J6I A;  3CK9 A;  3QAR A;  2OVF A;  4JL0 A;  2A4Z A;  3CHR A;  1W3B A;  3L13 A;  3T8M A;  5ARG A;  4L23 A;  3M57 A;  4KMO A;  3DB5 A;  3APD A;  1NA3 A;  3D3M A;  5KJN A;  3JQ1 A;  4P29 A;  3CIA A;  1HH8 A;  2Y4U A;  2GRM A;  3KD7 A;  2WXQ A;  1Y8M A;  5ENN A;  5JJT A;  1JUQ A;  2LO6 A;  4HOT A;  4K0R A;  2AXV A;  4RVB A;  5F5E A;  2WXH A;  1OWO A;  4ACK A;  3MKR A;  4GB9 A;  5T4Y A;  3ULQ A;  4J7I A;  4YVQ C;  2XGS A;  4FJZ A;  5JHA A;  2IU1 A;  2I1K A;  1MUF A;  2XEV A;  4FJY A;  2MHK A;  4QEO A;  1MQS A;  3K9I A;  4FHJ A;  4APO A;  3FP3 A;  2WXK A;  4XX5 A;  3UMV A;  1DVP A;  5AIJ A;  3OS5 A;  5F6K C;  3I3N A;  5F6L A;  3DPD A;  3CR3 A;  3HVE B;  3OTN A;  2IOS A;  5AJL A;  4FUL A;  3MX3 A;  3TXN A;  4XI9 A;  3VUZ A;  3CVX A;  3LEW A;  4Y6W A;  2QPW A;  3B7T A;  3NZU A;  1N54 A;  2XRZ A;  1XQH A;  2WQ6 A;  1HS6 A;  2J08 A;  3FUK A;  5EX3 A;  3EHM A;  3LDZ A;  2LAI A;  1HXI A;  3FTV A;  3NF1 A;  5FQ4 A;  5CHE E;  1XNF A;  3P1U A;  1IQR A;  2J09 A;  3FUD A;  2WXI A;  5FZQ A;  4UWF A;  2BQZ A;  4XI0 A;  4MLP A;  3CV0 A;  3GZ1 A;  2J4B A;  3KAE A;  4N5C A;  3LVQ E;  5FQ6 A;  3M54 A;  2VSX E;  4AU7 A;  2I6H A;  1E8X A;  3AU4 A;  3G2U A;  3FUN A;  3RRM B;  1E7U A;  1OWN A;  4F53 A;  3LY7 A;  4LUN U;  4EZK A;  4V3I A;  5KJL A;  2WXJ A;  3CST A;  4FA6 A;  4UWH A;  2FF4 A;  3IBE A;  4AM9 A;  1HG2 A;  2I9C A;  3L16 A;  3FH8 A;  3ML8 A;  4UWL A;  1P5Q A;  3VV0 A;  3ZRH A;  2XCB A;  4EZL A;  3ASD A;  4U04 A;  5G05 C;  4A3T A;  1OWL A;  1INZ A;  2DBA A;  3M53 A;  4J8E A;  2V0P A;  3PVL A;  3SNX A;  4JA7 A;  1UJK A;  2LNI A;  2VGY A;  2XHE A;  4EBA A;  5HQ8 A;  4BY6 A;  3BO5 A;  4IJ8 A;  4N2Q A;  3CHP A;  3SBS A;  4ANV A;  4NJ5 A;  2RG8 A;  3EHN A;  2EQX A;  3FUH A;  5T0K A;  3IEG A;  4LCT A;  5G2N A;  3AU5 A;  4JW1 A;  3FFL A;  3FUI A;  3UUX A;  3ONL A;  5TEG A;  1IHG A;  2KZT A;  2Q7F A;  2WM9 A;  4GZ6 A;  3FWV A;  4Z4P A;  1HG5 A;  4A3V A;  2WMO A;  3FHE A;  3K5K A;  4MI0 A;  5F59 A;  3RQ4 A;  3L08 A;  3SF4 A;  3CVV A;  3D9I A;  4E47 A;  4BT8 A;  5G55 A;  4NUR A;  3FTX A;  3EIQ C;  1Z3X A;  3RO2 A;  4R7L A;  4H7X A;  3PEV B;  3R9A B;  3FPD A;  2J9Q A;  3ZYK A;  3OPE A;  4KBQ A;  2XQ0 A;  4PS8 A;  3PS6 A;  3KMT A;  3FEY A;  4L1B A;  4APF A;  5JHB A;  4AOF A;  3QC1 A;  3FH5 A;  4CCA A;  4KXK B;  2C0L A;  4GAA A;  2WXN A;  1HX8 A;  5J08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...