3RIBA

Human lysine methyltransferase smyd2 in complex with adohcy
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
430
structure length
430
Chain Sequence
b'GGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESHLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human lysine methyltransferase Smyd2 reveals insights into the substrate divergence in Smyd proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 139
structure length 430
sequence length 430
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ribA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ribA01
5TH7A 2VQ2A 2VYIA 3FFLA 4ABNA 2R3AA 3MA5A 4I17A 3LY9A 4Y6WA 4YPEA 3Q15A 4YVOA 3VV0A 3Q47B 4U0ZA 3ZGQA 3UPVA 4IN3B 3OS5A 5AYWD 4CDRA 3RKVA 4N2SA 5FJYA 1B89A 4I2ZA 2KCKA 4BTAA 4GA1A 1ZBPA 4J0UA 4HORA 2L6JA 4UQXA 3SF4A 3GW4A 5DIZA 2XGSA 3OXFA 5DBKA 1Y8MA 3CKCA 3QDNA 3U4TA 3M5AA 1N3JA 3KMAA 2LSUA 4HOUA 5FZQA 2UY1B 3TGOA 2F69A 3VUZA 3Q49B 4GZ5A 3JYSA 2KATA 4IJDA 3PE3A 4GCNA 5BW8C 3URZA 3NF1A 3R9AB 1NA3A 3E4BA 5JJ7A 4G24A 2PZIA 3UUXA 1MT6A 3ASFA 3LYAA 2HR2A 4WNDA 4YVQC 5HI7A 3ZPJA 4QEOA 3KAEA 2PQRA 4KYOB 1ZU2A 5LSXA 2JLBA 4FMUA 3F9WA 4N3CA 3ULQA 3N71A 4G2VA 3RAYA 2KCLA 3K9IA 3F9XA 5T0MA 4N5CA 4LDGA 3MO5A 1IYGA 2E2EA 3S7BA 2VGXB 1WAO1 2Y4UA 5D0OD 3KD7A 2UY1A 4NJ5A 1QQEA 2RFIA 3IEGA 5BNWA 4UQZA 2V5FA 2C2LA 3M54A 2LSVA 5G04J 3CK7A 5JIYA 4GYOA 2C0MA 4GZ6A 5EG2A 3AS5A 4GYWA 3MV3B 3M58A 3QWWA 2FF4A 2WQHA 2KC7A 4N3AA 3RJVA 3CBMA 1ZKKA 3CBPA 4C1QA 4I9CA 3VTYA 1YA0A 5JINA 3ESKA 4AY6A 4QEPA 4JA7A 4LEUA 4I9EA 5JHNA 4YPUA 3CV0A 2PL2A 4N2QA 5F6KC 2R5SA 5LCWJ 3RQ4A 5ARFA 3FPDA 3GZ2A 1FCHA 2IF4A 1W3BA 2XCCA 3SZ7A 4BWRA 1OUVA 4G23A 4JL0A 3M59A 4IJ8A 4N3BA 2VGXA 5G04C 3F9YA 3EP0A 5F5EA 3SWCA 5A7DB 2YHCA 3ASGA 4UI9J 4U0UA 3WXXA 2NC9A 5CHEE 5CCMA 2FEZA 1KLXA 3OXGA 4CGWA 4J8EA 2Q7FA 5ARGA 3CKBA 1HH8A 3IHXA 4UI9K 5EX0A 4BT8A 1KT0A 5FZRA 3FP3A 1ELRA 4G1TA 4H7YA 1MVHA 5TTFA 3MO2A 4XIFA 3MV2B 4KBQA 5TEGA 4HOQA 5KJMA 4QENA 3OOIA 4GPKA 5LCWC 5CCLA 5T5GA 1O9SA 4G25A 3QWPA 4J7FA 5M72A 4U07A 4EQFA 1XQHA 4J8OA 3EDTB 4AIFA 2MHKA 3PE4A 4XI0A 2IFUA 1ML9A 4MI5A 5A6CA 2XCBA 4UI9C 2VSYA 2VGYA 4AU7A 4F3VA 1E96B 3LCAA 4U0SA 3U3WA 3HNAA 1A17A 1XNFA 4AM9A 3CVQA 3Q5MA 2I6HA 5CPRB 2ONDA 3TG5A 1QZ2A 2QPWA 3GZ1A 1HXIA 3Q4AB 4JDSA 3SW9A 4YNMA 3CVLA 4NQ0A 5F59A 1MVXA 3HYMB 1HZ4A 2OOEA 1H3IA 4HOSA 3LKUA 2JV0A 1WM5A 4E47A 4XI9A 4BT9A 1P5QA 5HQ8A 5KJLA 3QKYA 3LPZA 4B94A 5LSZA 3S7DA 3KMJA 4W9RA 3OPEA 5KJNA 4CGVA 4NRHB 4AY5A 2IGQA 4UQYA 4J7IA 3CK9A 4H12A 3AS4A 4U04A 3M56A 4WNGA 3RJWA 3ZN3A 3LY8A 3QOUA 1MUFA 5FT9A 5KJKA 2BUGA 4I2WA 4NVQA 3CK8A 2FI7A 2GW1A 4GYYA 3RO3A 4MI0A 3TAXA 3UQ3A 4YNPA 3KMTA 1KT1A 4WUYA 2AVPA 1NA0A 3ZHEB 2J9QA 4G26A 3O48A 3CEQA 2FBNA 5T0KA 3S8PA 4YPAA 3CVPA 1PC2A 3ASDA 4J8DA 2PQNA 3AS8A 4I51A 5G05J 2XPIA 3TG4A 5BT1A 4Z4PA 4O6FA 1TJCA 4JLGA 3DB5A 2UWJG 4A1SA 3VTXA 4H7XA 4RG6A 4J83A 3S7JA 2XEVA 4GZ3A 4GCOA 3BO5A 2C0LA 1N6AA 4BUPA 4JHRA 3BEEA 1ELWA 4KXKB 2G46A 3MKRA 3RIBA 2KCVA 4YNDA 3M55A 3FWVA 3ZFWA 4J8FA 2BQZA 2DBAA 2XGMA 1NZNA 4Y6CA 3DALA 3M53A 5JJTA 2WPVA 2VSNA 4I1AA 3CVNA 2W5ZA 5EX3A 3PDNA 4RG9A 3ZHEA 2YQ8A 3ASHA 5D0QD 4HOTA 1PEGA 3CBOA 3MO0A 4BTBA 5G05C 1N6CA 5F6LA 3KS2A 4ME2A 3M57A 3QWVA 2HO1A 2W5YA 4APOA 3GYZA 4RZ0A 5JJ6A 1IHGA 3K5KA 5FTPA 5FZSA 2XGOA 3F9ZA 3RO2A 3RU0A 2Y4TA 3OXLA 3S7FA 4GA0A 4O30A 2LNIA 3LY7A 2QFCA 5JJ0A 2P58C 4N39A 4GA2A 5C1DA 2FO7A 5AYFA 4JA9A 5EKQD 3MEKA 2O8JA 4WNFA 4WNEA 2HYZA
chains in the Genus database with same CATH superfamily
3BUAA 3UKRG 2VQ2A 4DX2A 3C3QA 3IV0A 2R3AA 4PS7A 3LY9A 4DI3A 3CIAA 3UT8A 3Q47B 4YDWA 1FVFA 4U0ZA 1AWCB 3RKVA 4N2SA 5FJYA 3PEVB 4GTOA 3HXFA 1N0QA 2AXVA 3BG0B 4GA1A 1ZBPA 3LVRE 3EHMA 4J0UA 4HORA 4ACKA 3APCA 2M63A 1Y8MA 1JUQA 2R03A 2YHEA 3CVVA 4JXTA 3SNXA 4CEMA 1VDYA 3Q49B 3SQVA 4AXHA 4GZ5A 3AG2E 3JYSA 4IJDA 2X3MA 3PE3A 3URZA 3AG4E 3LDZA 3E4BA 3GZSA 1MT6A 4C9BB 2ZIRA 4ANVA 4DX6D 4PS8A 1N0RA 2AXUA 4YVQC 1G3NB 4QEOA 1MX4A 4KYOB 1ZU2A 3FUDA 3FU5A 4ACLA 3HVEB 3RK6A 4YDOA 5CECB 4G2VA 1AP7A 1UJJA 2Y0BG 4A1GA 4DK5A 1IYGA 4F1SA 3G2SA 3L17A 1O1SA 1OY3D 1FVHA 1TR4A 5A23A 2VGXB 1WAO1 4U8VD 5D0OD 1HO8A 3FH5A 4URKA 1N4RA 3MZLB 1ZB1A 3CSFA 2LSVA 1RZ4A 3V2XA 4GZ6A 2XRYA 5EG2A 3AS5A 1HU3A 2P9SG 1OCOE 2FF4A 2WQHA 4U95D 2KC7A 4FLBA 4C48B 4C1QA 1TN6A 4I9CA 4QEPA 3QJZA 3U64A 1HF8A 4HRNA 5ENPD 3NZSA 5JHNA 2WQ7A 4OAVB 4N2QA 4UWKA 3SO8A 3D9KA 1SVXA 1U3CA 5ARFA 3GZ2A 2GRLA 2XCCA 3SZ7A 4EHMA 2VTBB 4Q69A 5G04C 1NFIE 3SWCA 1EF1C 3ASOE 3OTNA 1FT2A 4U0UA 4GZCA 4CGWA 2Q7FA 3DPYA 3CKBA 5T8IA 2J08A 2R05A 1MVHA 3MO2A 4GTRA 3MV2B 1OWLA 1KPSB 4GPKA 4KVMA 5T5GA 1O9SA 3EHQA 4G8LA 4J7FA 3SBTB 1DCEA 1IQRA 4QQIA 3TL5A 2VGEA 2MYOA 2X38A 4MRUA 5JHAA 5AJLA 4UI9C 4F3VA 1Z3YA 2P9PG 4F6RD 4U0SA 3HNAA 1A17A 2J4DA 2DCPA 5ENOD 5CPRB 2ONDA 3PZ2A 1QZ2A 3AJIA 5EILA 4UUCA 1DC2A 1TYQG 2H6GA 3B7RL 4DI4A 3SW9A 4L7TA 3ASNE 1Z5SC 5AN8A 3ULYA 1TEZA 2XPYA 3APFA 3QNKA 2OOEA 4P29A 3DSUA 4UWFA 4E47A 3G2WA 3D9MA 3ZEFA 1EPUA 1MX2A 2KBXA 3SI5A 4PUCA 3S7DA 4Q94A 3EHRA 5J90A 4W9RA 3HXDA 1JCRA 3OPEA 2AJAA 4CGVA 3EIQC 3T8KA 4J8SA 4BY6A 5HRYA 4H12A 4WNGA 3QOUA 1WG0A 2HE0A 2H6IA 2LAIA 3QARA 5AQ7A 4ANXA 2CHXA 4TXRA 4DX7D 2J4BA 2GW1A 1IXVA 3ONKA 3UQ3A 4HRMB 4YNPA 1KT1A 4AVXA 1NA0A 3C72A 3D3MA 2CHZA 2J49A 3CHPA 5AQBA 3AS8A 4C0EA 1H2UA 4I51A 4WWPA 2J8SD 4GTSA 4OVUA 4O6FA 4CYMD 1TJCA 4DUIA 4AJWA 4HLEA 1XGWA 2UWJG 1NI1A 2BTDA 2C0LA 1N6AA 1K8KG 3SD5A 4JC8A 5AARA 3RIBA 4GPMA 4O60A 4YNDA 2BQZA 2A5UA 5JA4D 2L9BA 2Y3AA 2E0IA 3ZYMA 3QK0A 3M53A 4R7LA 5JJTA 3PNLB 4I1AA 1Z6TA 2W5ZA 1RW2A 4JD2G 4JZYA 4ATGA 1PEGA 3CBOA 2IOLA 1N6CA 3CHQA 1X5BA 3QWVA 2PM7A 4RZ0A 1N95A 4LRZA 4I6GA 3HHMA 4TUUA 2XGOA 1OWMA 3SFZA 2PM6A 3OXLA 3SFXA 4JHKA 3V30A 3HRAA 5ANLA 3FUMA 4K0RA 2LXLA 3HXCA 4GMLA 4K5CA 2LO6A 2IY0C 3FTXA 4AP2A 3I4GA 2FO7A 3Q73A 5AYFA 4JA9A 1TNUA 3MEKA 1Z3XA 5FQ8A 1OXJA 3W9FA 2NXPA 2HYZA 1OWNA 2VYIA 3T5XA 3C3OA 2JEKA 4ABNA 2F0YA 4I17A 4K5AB 5ENRD 4RLYA 2J07A 1O1TA 3Q15A 1H6KA 4DLQA 4IN3B 3OS5A 3T8MA 4L23A 1B89A 1L5JA 2KCKA 3L54A 1PY1A 4I6JA 5LFAA 3GW4A 3IBEA 5DIZA 3OXFA 4YDEA 2Y69E 5DBKA 5CERB 4JW1A 3M5AA 4FHKA 2YINA 2DZOA 3KMAA 4ILGA 5FZQA 4IYPA 3I4RB 3DXKG 1TN7A 3TGOA 2DWZA 4IRUA 2KATA 4V3IA 4A63B 1NA3A 3MGBA 2PZIA 2WXIA 3UUXA 4ANUA 2HR2A 1K1AA 3DSTA 1YCSB 3MJWA 2P2CP 4QFVA 2PQRA 4L2LA 3DSWA 5JHBA 4FMUA 2P9UG 5KWDA 2WXFA 4DX5D 3CLJA 4JPSA 2EIME 4XE0A 3ULQA 3RAYA 1MX6A 5T0MA 4LERA 4LDGA 5KNHD 1OWOA 3FH7A 5FQ6A 2IOSA 3UKUG 2E2EA 4U63A 3PZ4A 4EPZA 2RD0A 4NACA 2Y4UA 5ENTD 3ULEG 1YYHA 3I5PA 3E30A 5BNWA 4UQZA 3ZRHA 1A5EA 3M54A 3CK7A 4RSYA 2J09A 2C0MA 3L16A 4GTMA 3MV3B 3M58A 2H6FA 3ESLA 3CBMA 1ZKKA 3CBPA 4AEZC 2QYJA 3FTWA 4C0MA 4JA7A 3CHOA 3CVUA 5ANRA 4A3TA 3FTUA 5LCWJ 3QB2A 3NAWA 4BWRA 2I2OA 4G23A 4JL0A 3FTZA 4IJ8A 1HS6A 3IKOB 1TNBA 1BI8B 3ZU7B 5A7DB 3KSLA 3ASGA 4B8AA 1OCRE 2BKGA 3RAUA 3WXXA 2WQ6A 4J8EA 5BV0A 4GTTA 1HH8A 2ZISA 4MKTA 2H6HA 1H19A 3KSQA 1E8XA 1MJ0A 2KXPC 4B93B 1KZOA 3JXIA 3QWPA 3HIZA 4TXPA 2EINE 1LTXA 3D9NA 4UWGA 3EDTB 3UX4A 2MHKA 3PE4A 4J6IA 4XI0A 4NIKA 5AAOA 4I1OB 5T4YA 1N4SA 4BEPA 2VSYA 4G11A 4BSXA 1E96B 3NOGD 5JMND 3C5RA 2NYJA 3PRZA 2Y1LE 3IHYA 4AM9A 2XQ0A 3UINC 3TG5A 2WXGA 5AENA 4HI8A 1LD8A 5EYLA 2QPWA 2OCCE 3GZ1A 1HXIA 4JEHA 1D8EA 2KZTA 1U2VG 5F59A 2ZGGA 3MCXA 3U66A 5B3SE 1E90A 3LXUX 1H3IA 1Y6IA 4HOSA 2JV0A 3Q79A 1TNYA 3BQOA 4XI9A 1S70B 2P9LG 4B94A 1SW6A 3FUFA 4N5QA 3CGHA 2WXQA 4NRHB 1JCSA 3FY4A 3CK9A 2OVBA 2GRPB 3AS4A 3ZN3A 3LY8A 4LNBA 1MUFA 2BUGA 3SGHA 5AQAA 3FTYA 2FI7A 4J8YA 4EECA 3P2BA 1OCZE 3KMTA 4WUYA 2AVPA 2J9QA 4EZKA 3IXEA 4G26A 1MZCA 5T0KA 3S8PA 4YPAA 3DBSA 3ASDA 2JABA 2WXPA 5G05J 2IQCA 2QC9A 4J7WA 4Z4PA 5T3RA 4JLGA 3AAAC 3FUJA 5LOZA 4GZ3A 2CG2A 1SA5A 3BEEA 1V55E 1ELWA 4KXKB 3TWQA 2IJGX 2X6FA 1OCCE 3MKRA 4CCAA 3ZFWA 3BG1B 2IU1A 2DBAA 4GU5A 3EIJA 4MBGA 4ANWA 1UJKA 4TUMA 4ILHB 4IULA 1SA4A 4RG9A 3ZHEA 2YQ8A 3ASHA 5D0QD 4HOTA 2DYRE 4BX9A 4K5BA 4GTPA 5BXOA 3JUIA 1UG3A 2YNQA 3SBSA 5CBOA 2AW6A 3GYZA 4FA6A 4HNAD 5IY5E 5J08A 3EU5A 5EIDA 3ISMC 5FTPA 1UN9A 2IEJA 5FZSA 1JPLA 5CRVA 3F9ZA 1YMPA 2X6HA 2XPZA 2P9IG 2RKKA 1TNZA 1FT1A 4K03A 3D9OA 4NURA 5CRUA 2LNIA 3DWLG 4GTQA 4Z68A 1SQMA 5JJ0A 2P9NG 3CHRA 4N39A 5C1DA 5FWQA 3S2AA 2L0TB 4EBAG 5ENSD 2O8JA 4WNFA 3ZW3A 2I6HA 1E7UA 3MX3A 3PEUB 5EDSA 1JCQA 3APDA 5CMYA 3FFLA 4DLOA 3MKQA 3MA5A 4Y6WA 4YPEA 3CVYA 4DRXE 4YVOA 3VV0A 2WXNA 1BI7B 3UPVA 1DCQA 4CDRA 3R7RA 1BU9A 3TWRA 2WB2A 2PNNA 2R2LA 3X2QE 3SHFA 4UQXA 1H0AA 3LJNA 2XGSA 3FHEA 2B6CA 2ETCA 5B1BE 3AU5A 4GZDA 3QDNA 3U4TA 2EIKE 3ML8A 1DVPA 1N3JA 3DEPA 2LSUA 4XEIG 4FJZA 4HOUA 5BW8C 3PH0C 5JJ7A 4G24A 3ZKJA 2OVFA 2EIJE 3PVLA 3ZXSA 2F8YA 3V79K 4JEUA 2V0PA 1WDYA 2RG8A 3TWTA 1IQUA 3ZPJA 2R17C 4XX5A 5BUZA 2HM8A 4N3CA 3N71A 2KCLA 3K9IA 4HVBA 3F9XA 3UXGA 2OEWA 3HXEA 4N5CA 2L6BA 3I3NA 4E6HA 4FLHA 1D9SA 4FULA 3S7BA 3KD7A 3FU0A 2UY1A 4NJ5A 1UN8A 1QQEA 5FIOA 3EUVA 2V5FA 2C2LA 5G04J 1E8ZA 2MRIA 3DRAA 4GYOA 4D10C 3RSEG 3LEWA 4GYWA 4AOFA 1N52A 2V5QC 4CT4A 1SZAA 1INZA 2DVWA 4N3AA 5BPPA 5EIBE 3VTYA 1UOHA 4U7EB 3VLFA 5BV1A 3ESKA 4M3OA 4OYSA 3FEXA 4LEUA 2XS8A 1HG2A 4L9PA 4YPUA 1PAQA 3PZ1A 4WWNA 4HRLA 4F7AA 5F6KC 2R5SA 3RQ4A 1HG5A 3OAWA 2WXLA 5AQ9A 4FC8A 3UM0A 2IO3C 4PDXA 2WXMA 3M59A 1N9AA 3DSSA 3EP0A 3TWUA 1FPPA 2XRZA 2NSZA 4OAUC 3SFYA 4LUNU 2I9CA 3PZDA 4UI9J 3T9KA 1IKND 3TWXA 2R59A 5CHEE 2FEZA 1KLXA 5FINA 5G55A 3OXGA 3FUIA 3Q7AA 3ML9A 4WWOA 4UI9K 3VLEA 2ZXWE 4GB9A 1KT0A 3ZVVA 4AV7A 1ELRA 5KBAA 4G1TA 4H7YA 4X8QA 5TTFA 4KBQA 5TEGA 4HOQA 2ZU6B 3MYVA 4TXQA 3OOIA 4LNUD 3CQCB 3LVQE 2KZTB 2WXOA 4WAFA 3TWVA 3HDXA 4HLLA 3TXMA 4EQFA 1XQHA 5AIJA 1E7VA 3NZUA 3L9TA 4LSZE 1ML9A 4MI5A 5A6CA 1N11A 5E76A 4AU7A 3LCAA 4TRQA 5HKPA 3ZYQA 5HS0A 3CVQA 5CEAA 2X6IA 4CZ2D 3L6AA 4A3VA 4ATZD 3FUNA 3Q4AB 3DSVA 3E34A 3KEZA 4FJYA 2GRNB 1HFAA 3L22A 4LG6A 1MYOA 1HZ4A 3B7UX 3QC1A 1WM5A 5D66A 4U8HA 3KEAA 4HQDA 3ZUVB 5KJLA 3QKYA 4ZHBA 3LPZA 5LSZA 3CHMA 2WXHA 3C3RA 5ITZF 3KMJA 4DJAA 3TWWA 2IGQA 5KNGA 3PUJA 4J7IA 1LF8A 3J5PA 4EZJA 3JCKC 3WG7E 4U04A 2FO1E 1E8WA 4KT6B 1N4PA 4I2WA 4RQIA 3CK8A 4BSZB 4GYYA 3DPDA 3RO3A 2XZTG 2ETAA 2F37A 3ZHEB 1BD8A 1TJFA 3O48A 3CEQA 2FBNA 2CFUA 2BKKB 3CVPA 5KCMA 1WY6A 4J8DA 1QNFA 3UT7A 3UM2A 2XPIA 3TG4A 4JB8P 3D9PA 5BT1A 2V8SE 3LS8A 3DB5A 4A1SA 3VTXA 4H7XA 4RG6A 2XENA 2I1JA 1UW4B 4GCOA 4BX8A 4BETA 3CQGB 4CT0A 2G46A 2WMOA 1S63A 2A4ZA 2KCVA 3AG3E 2FULA 4J8FA 1MHQA 3C98A 1X81A 2XGMA 1NZNA 3DALA 2VSNA 1EYHA 2F8XK 3PDNA 3E33A 3RRMB 3FEYA 3ABLE 5E75A 4GAAA 3RRNB 4XKBA 3B13A 3B95A 2DIWA 2WVIA 3KS2A 4HXIA 3M57A 3MKQB 2W5YA 5D2MC 4CDNA 4APOA 3ZYLA 3BU8A 3ABME 4FADA 3SY2A 2AXZA 4OVVA 5CEDB 3EU9A 1H6PA 3RO2A 1U3DA 4FHJA 3RU0A 4GA0A 3CVWA 4O1OA 5ENNA 4KZ0A 5ENQD 3PNTB 3DEOA 3P1UA 3LY7A 2QFCA 2LAHA 2P58C 2CFZA 4GMJA 4GA2A 3W9GA 3FTVA 5EKQD 1K1BA 2BF0X 3NB2A 5TH7A 3T5VA 2ETBA 2VSOE 1QBQA 3NOCD 1GW6A 3RRUA 5G2NA 2EQXA 3ZGQA 3JQ1A 5AYWD 3Q9NC 4I2ZA 4ZFHA 4FU3A 4L2YA 4BTAA 2KM4A 3FUEA 3PS6A 2L6JA 2CG3A 2VSXE 3SF4A 2XEEA 2EILE 2ZGDA 3CKCA 1S0PA 2XHEA 3E32A 3ZXPA 2UY1B 2F69A 2WXKA 3VUZA 3D9JA 4GCNA 2OV8A 3NF1A 3R9AB 2MOWA 3AG1E 3AU4A 4JVSA 3ASFA 3LYAA 4I6EA 4WNDA 5HI7A 4G8KA 3LJ3A 3KAEA 5LSXA 2JLBA 3L13A 4HS2A 4LNGA 4HI9A 2OEVA 3F9WA 2A5EA 2XZDG 5CMWA 1S64A 3Q75A 2XS1A 3MO5A 5H7PA 1OWPA 2V4HC 3QAQA 3HG0D 3NBNB 3F6QA 4DX1A 2CHWA 4MLPA 2RFIA 3IEGA 5LP0A 3ABKE 3JXJA 4RVBA 5JIYA 4M7CA 5FQ7A 4I43A 3FUKA 1SZ9A 3QWWA 1NL4A 3FU3A 1QYMA 4U8YD 3RJVA 4U96D 3FUHA 2AWIA 1YA0A 4PH4B 5JINA 4AY6A 2GROB 4ILIA 3HVEA 4I9EA 3EHNA 3CV0A 1O1RA 4TV3A 3G2TA 2PL2A 2XEHA 1JWFA 3TXNA 3FPDA 4F1PA 4BESA 3D9LA 1FCHA 2IF4A 1W3BA 3ONLA 3D9HA 4KMOA 1OUVA 5CBNA 4N3BA 2VGXA 3F9YA 1EDUA 4HFGA 3TWSA 3UM1A 5F5EA 3B7TA 2YHCA 1BPOA 3D9IA 1H2TC 4GMRA 2NC9A 5CCMA 4GTVA 4F53A 5ARGA 2IO2C 3IHXA 5EX0A 4BT8A 5FZRA 3FP3A 3CR3A 3CHSA 4Q96A 5EN5D 3EJNA 4XIFA 1IHBA 4A55A 5KJMA 4QENA 2DZNA 4BFRA 5LCWC 5CCLA 4JHJA 1JWGA 4B89A 4G25A 2QY7A 2QYUA 5M72A 1D8DA 4U07A 2ILRA 3JUEA 3CSTA 4J8OA 4APFA 2BEDA 4KZCA 1TN8A 4AIFA 5LX8A 2VTBA 2IFUA 2XCBA 2P9KG 4HBDA 2VGYA 2WM9A 3G2VA 3U3WA 1N94A 1XNFA 3ZIMA 4B8CB 1E8YA 4YDYA 3Q5MA 4XZ4A 2I1KA 5EYPF 1DNPA 4JDSA 3V2OA 4YNMA 3CVLA 4CDMA 2B0OE 4NQ0A 1KZPA 1MVXA 3NQPA 3HYMB 3V31A 2WMNA 3LKUA 4EZLA 1MQSA 3Q7FA 2GRRB 4BT9A 1P5QA 4I1MA 5HQ8A 3UMVA 4FP7A 3TJPA 1HE8A 2WXRA 4B0ZA 3CVXA 5KJNA 4AY5A 1N4QA 4UQYA 3DXMG 3UIOC 4E85A 3M56A 3RJWA 3UIPC 1H6OA 5FT9A 5KJKA 4DPRA 4NVQA 1V54E 3FTSA 3FULA 1Q2ZA 3ZNGA 3E37A 4MI0A 3TAXA 3UM3A 2L0IA 5FQ4A 3B7BA 2X6JA 4MS6A 2R02A 4O1PA 1PC2A 2X6KA 2PQNA 3B7SA 4UWLA 1NP7A 3O4ZA 2LXMA 1TNOA 3R7QA 3ENEA 4BERA 1BLXB 4J83A 3S7JA 2V4LA 2XEVA 3BO5A 3UT4A 4BUPA 3FDHA 2VJ8A 3PUKA 1HX8A 4JHRA 4LCTA 3HXBA 3DSXA 2IONA 2RFMA 1K3ZD 3M55A 1ELKA 3FWVA 2GGFA 2DYSE 5BXUA 3IHVA 4Y6CA 2WPVA 1OT8A 5B1AE 3R9MA 3CVNA 5EX3A 3G2UA 3FU6A 3MO0A 3J5QB 4BTBA 4XKCA 5G05C 5F6LA 4ME2A 4L1BA 2HO1A 5AJDA 2GRMA 5C2YA 3UI2A 4UWHA 3Q78A 2RFAA 5JJ6A 1IHGA 3K5KA 3PREA 2WXJA 1H2VC 3JQ0A 3U9WA 3UTMA 3FH8A 1O5MA 2Y4TA 3L08A 3S7FA 2LUHA 3Q9UC 4EBAA 4O30A 2GRQB 3L82A 2QZAA 4KVOA 3ZYKA 3VLDA 4CRWA 4PS3A 4HB5A 4WNEA 1LD7A 3PZ3A 1N54A
chains in the Genus database with same CATH topology
3MX3A 3PEUB 5TH7A 2VQ2A 5EDSA 1OWNA 3APDA 3IV0A 5CMYA 2VYIA 3FFLA 3T5XA 3T5VA 4ABNA 2JEKA 2R3AA 2VSOE 4DLOA 4PS7A 3MKQA 3MA5A 4I17A 3LY9A 4Y6WA 4YPEA 2J07A 1GW6A 3Q15A 3CVYA 3RRUA 4YVOA 4DI3A 3VV0A 3CIAA 2WXNA 5G2NA 3UT8A 2EQXA 3Q47B 1FVFA 4U0ZA 3ZGQA 1H6KA 3UPVA 4DLQA 4IN3B 3JQ1A 5AYWD 3OS5A 4CDRA 3R7RA 3RKVA 4N2SA 3T8MA 5FJYA 3PEVB 4L23A 1B89A 4I2ZA 1L5JA 2KCKA 3L54A 1PY1A 4I6JA 2WB2A 2AXVA 4FU3A 4L2YA 4BTAA 3BG0B 4GA1A 2KM4A 1ZBPA 3FUEA 3EHMA 3LVRE 2L6JA 3PS6A 4J0UA 3SHFA 2CG3A 5LFAA 4HORA 4UQXA 2VSXE 3SF4A 1H0AA 3GW4A 3IBEA 5DIZA 2XGSA 3OXFA 3FHEA 4ACKA 3APCA 5DBKA 2M63A 1Y8MA 3AU5A 3CKCA 1JUQA 4GZDA 3QDNA 3U4TA 2YHEA 4JW1A 3ML8A 3CVVA 3M5AA 1DVPA 1S0PA 2YINA 4FHKA 1N3JA 4JXTA 3KMAA 2LSUA 2XHEA 4ILGA 4FJZA 4HOUA 5FZQA 4IYPA 3I4RB 3SNXA 2UY1B 4CEMA 3TGOA 2F69A 2WXKA 3VUZA 1VDYA 3Q49B 4IRUA 4AXHA 4GZ5A 3JYSA 2KATA 3D9JA 4IJDA 2X3MA 3PE3A 4GCNA 5BW8C 2OV8A 3NF1A 4V3IA 3URZA 3R9AB 3PH0C 1NA3A 3LDZA 3E4BA 2MOWA 5JJ7A 3GZSA 4G24A 2OVFA 3MGBA 3PVLA 2PZIA 2WXIA 3AU4A 3UUXA 1MT6A 4ANUA 4JVSA 4C9BB 3ZXSA 3ASFA 3LYAA 4JEUA 4ANVA 2HR2A 4PS8A 2V0PA 4I6EA 2AXUA 2RG8A 3MJWA 4WNDA 4YVQC 1IQUA 5HI7A 3ZPJA 4QEOA 3LJ3A 3KAEA 2PQRA 4L2LA 4QFVA 2R17C 4KYOB 1ZU2A 3FUDA 5JHBA 5LSXA 4XX5A 2JLBA 3L13A 4HS2A 4FMUA 3FU5A 2WXFA 4ACLA 5BUZA 3CLJA 3HVEB 4JPSA 3F9WA 3RK6A 2HM8A 4N3CA 4XE0A 5CMWA 3ULQA 3N71A 4G2VA 3RAYA 2KCLA 3K9IA 4HVBA 3F9XA 5T0MA 4LERA 4N5CA 1UJJA 4LDGA 4A1GA 3MO5A 4DK5A 3I3NA 1OWPA 1OWOA 4E6HA 1IYGA 4F1SA 3QAQA 4FLHA 3FH7A 3G2SA 3L17A 5FQ6A 2IOSA 2E2EA 4U63A 4FULA 3S7BA 1FVHA 4EPZA 5A23A 2VGXB 2RD0A 1WAO1 2Y4UA 4NACA 5D0OD 1HO8A 3KD7A 3FU0A 2CHWA 3FH5A 2UY1A 4MLPA 1UN8A 1QQEA 3I5PA 4URKA 4NJ5A 2RFIA 3IEGA 5BNWA 3MZLB 5LP0A 4UQZA 3ZRHA 3CSFA 2V5FA 2C2LA 3M54A 4RVBA 2LSVA 5G04J 1E8ZA 2MRIA 3CK7A 5JIYA 4RSYA 2J09A 4GYOA 2C0MA 4GZ6A 4I43A 5FQ7A 4D10C 2XRYA 3L16A 3LEWA 5EG2A 3AS5A 3FUKA 4GYWA 4AOFA 1HU3A 3MV3B 3M58A 1SZ9A 3QWWA 1N52A 3FU3A 3ESLA 4CT4A 2FF4A 1SZAA 1INZA 2WQHA 2KC7A 4N3AA 3RJVA 4FLBA 3FUHA 1ZKKA 3CBMA 4AEZC 5BPPA 2AWIA 3CBPA 4C1QA 4I9CA 3VTYA 1YA0A 3VLFA 4PH4B 5BV1A 5JINA 3ESKA 3FTWA 4AY6A 4C0MA 4M3OA 4QEPA 4OYSA 3FEXA 3QJZA 4ILIA 4JA7A 4LEUA 3CHOA 1HG2A 3HVEA 1HF8A 4I9EA 3U64A 3NZSA 5JHNA 3EHNA 4YPUA 3CV0A 3CVUA 4TV3A 1PAQA 3G2TA 4WWNA 2WQ7A 2PL2A 5ANRA 4F7AA 4N2QA 4UWKA 5F6KC 1JWFA 2R5SA 4A3TA 3FTUA 3D9KA 5LCWJ 3RQ4A 5ARFA 1U3CA 3TXNA 3FPDA 3GZ2A 2GRLA 3QB2A 3D9LA 1HG5A 1FCHA 2IF4A 1W3BA 2WXLA 3ONLA 3OAWA 2XCCA 3SZ7A 2I2OA 4BWRA 4FC8A 4KMOA 1OUVA 4G23A 4JL0A 2VTBB 3FTZA 2WXMA 1HS6A 4PDXA 4Q69A 3M59A 4IJ8A 3IKOB 4N3BA 2VGXA 5G04C 3F9YA 1EDUA 4HFGA 3EP0A 2XRZA 5F5EA 2NSZA 3SWCA 1EF1C 5A7DB 3B7TA 2YHCA 1BPOA 2I9CA 4LUNU 3ASGA 3PZDA 3OTNA 4UI9J 4U0UA 3D9IA 4B8AA 1H2TC 4GZCA 2NC9A 2R59A 5CHEE 3WXXA 2FEZA 5CCMA 1KLXA 5G55A 2WQ6A 3OXGA 4CGWA 4J8EA 2Q7FA 3FUIA 5BV0A 4F53A 3ML9A 4WWOA 5ARGA 3CKBA 1HH8A 3IHXA 4UI9K 3VLEA 4GB9A 5EX0A 4BT8A 1KT0A 3ZVVA 5T8IA 5FZRA 4MKTA 2J08A 3FP3A 1H19A 4AV7A 1ELRA 3CHSA 3CR3A 4G1TA 4Q96A 1E8XA 4H7YA 1MVHA 3EJNA 5TTFA 3MO2A 4XIFA 3MV2B 4KBQA 5TEGA 4HOQA 4A55A 1OWLA 2ZU6B 5KJMA 3MYVA 3OOIA 4QENA 4GPKA 5LCWC 4BFRA 3CQCB 4KVMA 5CCLA 5T5GA 3LVQE 2KZTB 2WXOA 4JHJA 1JWGA 4B89A 1O9SA 4G25A 4WAFA 2QY7A 3QWPA 3HDXA 3HIZA 4J7FA 5M72A 3TXMA 3SBTB 4U07A 4EQFA 2ILRA 1IQRA 1XQHA 3CSTA 3D9NA 4J8OA 3TL5A 4APFA 5AIJA 4UWGA 3EDTB 4KZCA 1E7VA 4AIFA 3UX4A 5LX8A 2MHKA 2X38A 3PE4A 4J6IA 4XI0A 3NZUA 2VTBA 2IFUA 4I1OB 4MRUA 5T4YA 2XCBA 5A6CA 5AJLA 5JHAA 1ML9A 4UI9C 4MI5A 2VSYA 4G11A 4BSXA 2VGYA 2WM9A 5E76A 4AU7A 3G2VA 1Z3YA 4F3VA 1E96B 3LCAA 4U0SA 3U3WA 3HNAA 4TRQA 1A17A 1XNFA 2J4DA 3PRZA 3ZIMA 2DCPA 4B8CB 1E8YA 3IHYA 3ZYQA 4AM9A 3CVQA 2I6HA 3Q5MA 5CPRB 2ONDA 2XQ0A 2X6IA 3TG5A 4XZ4A 2WXGA 1QZ2A 2I1KA 5AENA 3L6AA 4A3VA 2QPWA 3GZ1A 1HXIA 3FUNA 1DNPA 3Q4AB 4JEHA 4JDSA 3KEZA 3B7RL 4FJYA 4DI4A 3SW9A 4L7TA 4YNMA 1HFAA 2KZTA 3CVLA 3L22A 4CDMA 1TEZA 4NQ0A 2XPYA 3APFA 5F59A 3MCXA 1MVXA 3NQPA 3HYMB 3U66A 3QNKA 1HZ4A 1E90A 2WMNA 2OOEA 3LXUX 3B7UX 1H3IA 1Y6IA 4P29A 4HOSA 3QC1A 3LKUA 2JV0A 1WM5A 4EZLA 4UWFA 4E47A 3G2WA 3D9MA 1MQSA 4XI9A 3ZEFA 4U8HA 1EPUA 4BT9A 1P5QA 4I1MA 5HQ8A 3QKYA 3UMVA 5KJLA 3LPZA 3SI5A 4PUCA 4B94A 3S7DA 5LSZA 4FP7A 4Q94A 3TJPA 3CHMA 2WXHA 5J90A 4W9RA 3FUFA 3KMJA 1HE8A 2WXRA 3CGHA 3OPEA 4B0ZA 4DJAA 2WXQA 3CVXA 5KJNA 4CGVA 4NRHB 4AY5A 2IGQA 4UQYA 3EIQC 3FY4A 3PUJA 4J8SA 4J7IA 4BY6A 1LF8A 3CK9A 2OVBA 4E85A 4EZJA 3JCKC 4H12A 3AS4A 4U04A 3M56A 4WNGA 3RJWA 3ZN3A 1E8WA 4KT6B 3LY8A 3QOUA 1MUFA 5FT9A 5KJKA 2BUGA 4I2WA 2LAIA 3QARA 3SGHA 3FTYA 4DPRA 4NVQA 3CK8A 2FI7A 4ANXA 2CHXA 3FTSA 2J4BA 2GW1A 3FULA 4GYYA 3DPDA 4EECA 3RO3A 3P2BA 4MI0A 3ONKA 3TAXA 3UQ3A 4YNPA 3KMTA 1KT1A 2L0IA 4AVXA 4WUYA 2AVPA 1NA0A 3ZHEB 2J9QA 4EZKA 4G26A 5FQ4A 3D3MA 1TJFA 2X6JA 2CHZA 3O48A 4MS6A 3CEQA 2FBNA 2CFUA 2J49A 3CHPA 5T0KA 3S8PA 4YPAA 3CVPA 5KCMA 3DBSA 1WY6A 1PC2A 3ASDA 4J8DA 2X6KA 1QNFA 2PQNA 3B7SA 2WXPA 3AS8A 3UT7A 4C0EA 1H2UA 4UWLA 4I51A 4WWPA 5G05J 1NP7A 3O4ZA 2XPIA 3TG4A 2IQCA 4OVUA 3D9PA 3R7QA 5BT1A 4Z4PA 2V8SE 4O6FA 3LS8A 1TJCA 3ENEA 5T3RA 4JLGA 4HLEA 4AJWA 1XGWA 3DB5A 2UWJG 4A1SA 3VTXA 3FUJA 4H7XA 4RG6A 5LOZA 3S7JA 4J83A 2V4LA 2I1JA 2XEVA 2BTDA 1UW4B 4GCOA 4GZ3A 3BO5A 2CG2A 4BX8A 3UT4A 2C0LA 1N6AA 4BUPA 3FDHA 2VJ8A 3PUKA 1HX8A 4JHRA 4LCTA 3BEEA 3SD5A 1ELWA 3CQGB 4JC8A 4KXKB 2IJGX 2X6FA 2IONA 4CT0A 2G46A 3MKRA 3RIBA 2WMOA 2A4ZA 2KCVA 4YNDA 1ELKA 4CCAA 2FULA 3FWVA 3M55A 3ZFWA 3BG1B 4J8FA 1MHQA 2GGFA 3C98A 2BQZA 2IU1A 2A5UA 2DBAA 4GU5A 2L9BA 3EIJA 2Y3AA 2XGMA 2E0IA 4ANWA 1NZNA 3IHVA 4Y6CA 3ZYMA 3DALA 1UJKA 3QK0A 4R7LA 2WPVA 5JJTA 3M53A 2VSNA 3PNLB 4I1AA 1Z6TA 3CVNA 4ILHB 2W5ZA 4IULA 1EYHA 5EX3A 3PDNA 4RG9A 3G2UA 3ZHEA 2YQ8A 3ASHA 3RRMB 5D0QD 3FEYA 3FU6A 4JZYA 4ATGA 4HOTA 1PEGA 3CBOA 5E75A 4GAAA 3MO0A 4BX9A 4BTBA 2IOLA 4XKCA 5G05C 3RRNB 1N6CA 4XKBA 3CHQA 3JUIA 1UG3A 3B13A 5F6LA 1X5BA 2DIWA 2WVIA 3KS2A 4HXIA 4ME2A 3M57A 4L1BA 2HYZA 3MKQB 3QWVA 2HO1A 2PM7A 5AJDA 2W5YA 2YNQA 2GRMA 3SBSA 4CDNA 5C2YA 4APOA 2AW6A 3GYZA 4UWHA 4FA6A 4RZ0A 5JJ6A 1IHGA 5J08A 3ZYLA 4LRZA 3K5KA 3PREA 2WXJA 1H2VC 4FADA 3JQ0A 4I6GA 5FTPA 1UN9A 3HHMA 2AXZA 4TUUA 4OVVA 5FZSA 3U9WA 1JPLA 2XGOA 3F9ZA 3RO2A 1OWMA 1U3DA 4FHJA 2X6HA 2XPZA 2PM6A 3FH8A 3RU0A 3SFZA 3L08A 2Y4TA 3OXLA 3S7FA 4GA0A 4EBAA 3CVWA 4O30A 5ENNA 4KZ0A 4JHKA 3PNTB 4K03A 5ANLA 3D9OA 3FUMA 4K0RA 4NURA 2LNIA 3P1UA 3LY7A 2QFCA 5JJ0A 1SQMA 2LAHA 2P58C 4GMLA 4KVOA 3ZYKA 2CFZA 3CHRA 4GMJA 3VLDA 4CRWA 2LO6A 4N39A 3FTXA 4AP2A 3I4GA 4GA2A 4PS3A 5C1DA 2FO7A 3FTVA 5FWQA 4JA9A 3S2AA 2L0TB 5AYFA 5EKQD 3MEKA 4EBAG 1Z3XA 2O8JA 5FQ8A 4WNFA 4WNEA 3ZW3A 2BF0X 2NXPA 1N54A 1E7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TH7 A;  2VQ2 A;  2VYI A;  3FFL A;  4ABN A;  2R3A A;  3MA5 A;  4I17 A;  3LY9 A;  4Y6W A;  4YPE A;  3Q15 A;  4YVO A;  3VV0 A;  3Q47 B;  4U0Z A;  3ZGQ A;  3UPV A;  4IN3 B;  3OS5 A;  5AYW D;  4CDR A;  3RKV A;  4N2S A;  5FJY A;  1B89 A;  4I2Z A;  2KCK A;  4BTA A;  4GA1 A;  1ZBP A;  4J0U A;  4HOR A;  2L6J A;  4UQX A;  3SF4 A;  3GW4 A;  5DIZ A;  2XGS A;  3OXF A;  5DBK A;  1Y8M A;  3CKC A;  3QDN A;  3U4T A;  3M5A A;  1N3J A;  3KMA A;  2LSU A;  4HOU A;  5FZQ A;  2UY1 B;  3TGO A;  2F69 A;  3VUZ A;  3Q49 B;  4GZ5 A;  3JYS A;  2KAT A;  4IJD A;  3PE3 A;  4GCN A;  5BW8 C;  3URZ A;  3NF1 A;  3R9A B;  1NA3 A;  3E4B A;  5JJ7 A;  4G24 A;  2PZI A;  3UUX A;  1MT6 A;  3ASF A;  3LYA A;  2HR2 A;  4WND A;  4YVQ C;  5HI7 A;  3ZPJ A;  4QEO A;  3KAE A;  2PQR A;  4KYO B;  1ZU2 A;  5LSX A;  2JLB A;  4FMU A;  3F9W A;  4N3C A;  3ULQ A;  3N71 A;  4G2V A;  3RAY A;  2KCL A;  3K9I A;  3F9X A;  5T0M A;  4N5C A;  4LDG A;  3MO5 A;  1IYG A;  2E2E A;  3S7B A;  2VGX B;  1WAO 1;  2Y4U A;  5D0O D;  3KD7 A;  2UY1 A;  4NJ5 A;  1QQE A;  2RFI A;  3IEG A;  5BNW A;  4UQZ A;  2V5F A;  2C2L A;  3M54 A;  2LSV A;  5G04 J;  3CK7 A;  5JIY A;  4GYO A;  2C0M A;  4GZ6 A;  5EG2 A;  3AS5 A;  4GYW A;  3MV3 B;  3M58 A;  3QWW A;  2FF4 A;  2WQH A;  2KC7 A;  4N3A A;  3RJV A;  3CBM A;  1ZKK A;  3CBP A;  4C1Q A;  4I9C A;  3VTY A;  1YA0 A;  5JIN A;  3ESK A;  4AY6 A;  4QEP A;  4JA7 A;  4LEU A;  4I9E A;  5JHN A;  4YPU A;  3CV0 A;  2PL2 A;  4N2Q A;  5F6K C;  2R5S A;  5LCW J;  3RQ4 A;  5ARF A;  3FPD A;  3GZ2 A;  1FCH A;  2IF4 A;  1W3B A;  2XCC A;  3SZ7 A;  4BWR A;  1OUV A;  4G23 A;  4JL0 A;  3M59 A;  4IJ8 A;  4N3B A;  2VGX A;  5G04 C;  3F9Y A;  3EP0 A;  5F5E A;  3SWC A;  5A7D B;  2YHC A;  3ASG A;  4UI9 J;  4U0U A;  3WXX A;  2NC9 A;  5CHE E;  5CCM A;  2FEZ A;  1KLX A;  3OXG A;  4CGW A;  4J8E A;  2Q7F A;  5ARG A;  3CKB A;  1HH8 A;  3IHX A;  4UI9 K;  5EX0 A;  4BT8 A;  1KT0 A;  5FZR A;  3FP3 A;  1ELR A;  4G1T A;  4H7Y A;  1MVH A;  5TTF A;  3MO2 A;  4XIF A;  3MV2 B;  4KBQ A;  5TEG A;  4HOQ A;  5KJM A;  4QEN A;  3OOI A;  4GPK A;  5LCW C;  5CCL A;  5T5G A;  1O9S A;  4G25 A;  3QWP A;  4J7F A;  5M72 A;  4U07 A;  4EQF A;  1XQH A;  4J8O A;  3EDT B;  4AIF A;  2MHK A;  3PE4 A;  4XI0 A;  2IFU A;  1ML9 A;  4MI5 A;  5A6C A;  2XCB A;  4UI9 C;  2VSY A;  2VGY A;  4AU7 A;  4F3V A;  1E96 B;  3LCA A;  4U0S A;  3U3W A;  3HNA A;  1A17 A;  1XNF A;  4AM9 A;  3CVQ A;  3Q5M A;  2I6H A;  5CPR B;  2OND A;  3TG5 A;  1QZ2 A;  2QPW A;  3GZ1 A;  1HXI A;  3Q4A B;  4JDS A;  3SW9 A;  4YNM A;  3CVL A;  4NQ0 A;  5F59 A;  1MVX A;  3HYM B;  1HZ4 A;  2OOE A;  1H3I A;  4HOS A;  3LKU A;  2JV0 A;  1WM5 A;  4E47 A;  4XI9 A;  4BT9 A;  1P5Q A;  5HQ8 A;  5KJL A;  3QKY A;  3LPZ A;  4B94 A;  5LSZ A;  3S7D A;  3KMJ A;  4W9R A;  3OPE A;  5KJN A;  4CGV A;  4NRH B;  4AY5 A;  2IGQ A;  4UQY A;  4J7I A;  3CK9 A;  4H12 A;  3AS4 A;  4U04 A;  3M56 A;  4WNG A;  3RJW A;  3ZN3 A;  3LY8 A;  3QOU A;  1MUF A;  5FT9 A;  5KJK A;  2BUG A;  4I2W A;  4NVQ A;  3CK8 A;  2FI7 A;  2GW1 A;  4GYY A;  3RO3 A;  4MI0 A;  3TAX A;  3UQ3 A;  4YNP A;  3KMT A;  1KT1 A;  4WUY A;  2AVP A;  1NA0 A;  3ZHE B;  2J9Q A;  4G26 A;  3O48 A;  3CEQ A;  2FBN A;  5T0K A;  3S8P A;  4YPA A;  3CVP A;  1PC2 A;  3ASD A;  4J8D A;  2PQN A;  3AS8 A;  4I51 A;  5G05 J;  2XPI A;  3TG4 A;  5BT1 A;  4Z4P A;  4O6F A;  1TJC A;  4JLG A;  3DB5 A;  2UWJ G;  4A1S A;  3VTX A;  4H7X A;  4RG6 A;  4J83 A;  3S7J A;  2XEV A;  4GZ3 A;  4GCO A;  3BO5 A;  2C0L A;  1N6A A;  4BUP A;  4JHR A;  3BEE A;  1ELW A;  4KXK B;  2G46 A;  3MKR A;  3RIB A;  2KCV A;  4YND A;  3M55 A;  3FWV A;  3ZFW A;  4J8F A;  2BQZ A;  2DBA A;  2XGM A;  1NZN A;  4Y6C A;  3DAL A;  3M53 A;  5JJT A;  2WPV A;  2VSN A;  4I1A A;  3CVN A;  2W5Z A;  5EX3 A;  3PDN A;  4RG9 A;  3ZHE A;  2YQ8 A;  3ASH A;  5D0Q D;  4HOT A;  1PEG A;  3CBO A;  3MO0 A;  4BTB A;  5G05 C;  1N6C A;  5F6L A;  3KS2 A;  4ME2 A;  3M57 A;  3QWV A;  2HO1 A;  2W5Y A;  4APO A;  3GYZ A;  4RZ0 A;  5JJ6 A;  1IHG A;  3K5K A;  5FTP A;  5FZS A;  2XGO A;  3F9Z A;  3RO2 A;  3RU0 A;  2Y4T A;  3OXL A;  3S7F A;  4GA0 A;  4O30 A;  2LNI A;  3LY7 A;  2QFC A;  5JJ0 A;  2P58 C;  4N39 A;  4GA2 A;  5C1D A;  2FO7 A;  5AYF A;  4JA9 A;  5EKQ D;  3MEK A;  2O8J A;  4WNF A;  4WNE A;  2HYZ A; 
#chains in the Genus database with same CATH topology
 3BUA A;  3UKR G;  2VQ2 A;  4DX2 A;  3C3Q A;  3IV0 A;  2R3A A;  4PS7 A;  3LY9 A;  4DI3 A;  3CIA A;  3UT8 A;  3Q47 B;  4YDW A;  1FVF A;  4U0Z A;  1AWC B;  3RKV A;  4N2S A;  5FJY A;  3PEV B;  4GTO A;  3HXF A;  1N0Q A;  2AXV A;  3BG0 B;  4GA1 A;  1ZBP A;  3LVR E;  3EHM A;  4J0U A;  4HOR A;  4ACK A;  3APC A;  2M63 A;  1Y8M A;  1JUQ A;  2R03 A;  2YHE A;  3CVV A;  4JXT A;  3SNX A;  4CEM A;  1VDY A;  3Q49 B;  3SQV A;  4AXH A;  4GZ5 A;  3AG2 E;  3JYS A;  4IJD A;  2X3M A;  3PE3 A;  3URZ A;  3AG4 E;  3LDZ A;  3E4B A;  3GZS A;  1MT6 A;  4C9B B;  2ZIR A;  4ANV A;  4DX6 D;  4PS8 A;  1N0R A;  2AXU A;  4YVQ C;  1G3N B;  4QEO A;  1MX4 A;  4KYO B;  1ZU2 A;  3FUD A;  3FU5 A;  4ACL A;  3HVE B;  3RK6 A;  4YDO A;  5CEC B;  4G2V A;  1AP7 A;  1UJJ A;  2Y0B G;  4A1G A;  4DK5 A;  1IYG A;  4F1S A;  3G2S A;  3L17 A;  1O1S A;  1OY3 D;  1FVH A;  1TR4 A;  5A23 A;  2VGX B;  1WAO 1;  4U8V D;  5D0O D;  1HO8 A;  3FH5 A;  4URK A;  1N4R A;  3MZL B;  1ZB1 A;  3CSF A;  2LSV A;  1RZ4 A;  3V2X A;  4GZ6 A;  2XRY A;  5EG2 A;  3AS5 A;  1HU3 A;  2P9S G;  1OCO E;  2FF4 A;  2WQH A;  4U95 D;  2KC7 A;  4FLB A;  4C48 B;  4C1Q A;  1TN6 A;  4I9C A;  4QEP A;  3QJZ A;  3U64 A;  1HF8 A;  4HRN A;  5ENP D;  3NZS A;  5JHN A;  2WQ7 A;  4OAV B;  4N2Q A;  4UWK A;  3SO8 A;  3D9K A;  1SVX A;  1U3C A;  5ARF A;  3GZ2 A;  2GRL A;  2XCC A;  3SZ7 A;  4EHM A;  2VTB B;  4Q69 A;  5G04 C;  1NFI E;  3SWC A;  1EF1 C;  3ASO E;  3OTN A;  1FT2 A;  4U0U A;  4GZC A;  4CGW A;  2Q7F A;  3DPY A;  3CKB A;  5T8I A;  2J08 A;  2R05 A;  1MVH A;  3MO2 A;  4GTR A;  3MV2 B;  1OWL A;  1KPS B;  4GPK A;  4KVM A;  5T5G A;  1O9S A;  3EHQ A;  4G8L A;  4J7F A;  3SBT B;  1DCE A;  1IQR A;  4QQI A;  3TL5 A;  2VGE A;  2MYO A;  2X38 A;  4MRU A;  5JHA A;  5AJL A;  4UI9 C;  4F3V A;  1Z3Y A;  2P9P G;  4F6R D;  4U0S A;  3HNA A;  1A17 A;  2J4D A;  2DCP A;  5ENO D;  5CPR B;  2OND A;  3PZ2 A;  1QZ2 A;  3AJI A;  5EIL A;  4UUC A;  1DC2 A;  1TYQ G;  2H6G A;  3B7R L;  4DI4 A;  3SW9 A;  4L7T A;  3ASN E;  1Z5S C;  5AN8 A;  3ULY A;  1TEZ A;  2XPY A;  3APF A;  3QNK A;  2OOE A;  4P29 A;  3DSU A;  4UWF A;  4E47 A;  3G2W A;  3D9M A;  3ZEF A;  1EPU A;  1MX2 A;  2KBX A;  3SI5 A;  4PUC A;  3S7D A;  4Q94 A;  3EHR A;  5J90 A;  4W9R A;  3HXD A;  1JCR A;  3OPE A;  2AJA A;  4CGV A;  3EIQ C;  3T8K A;  4J8S A;  4BY6 A;  5HRY A;  4H12 A;  4WNG A;  3QOU A;  1WG0 A;  2HE0 A;  2H6I A;  2LAI A;  3QAR A;  5AQ7 A;  4ANX A;  2CHX A;  4TXR A;  4DX7 D;  2J4B A;  2GW1 A;  1IXV A;  3ONK A;  3UQ3 A;  4HRM B;  4YNP A;  1KT1 A;  4AVX A;  1NA0 A;  3C72 A;  3D3M A;  2CHZ A;  2J49 A;  3CHP A;  5AQB A;  3AS8 A;  4C0E A;  1H2U A;  4I51 A;  4WWP A;  2J8S D;  4GTS A;  4OVU A;  4O6F A;  4CYM D;  1TJC A;  4DUI A;  4AJW A;  4HLE A;  1XGW A;  2UWJ G;  1NI1 A;  2BTD A;  2C0L A;  1N6A A;  1K8K G;  3SD5 A;  4JC8 A;  5AAR A;  3RIB A;  4GPM A;  4O60 A;  4YND A;  2BQZ A;  2A5U A;  5JA4 D;  2L9B A;  2Y3A A;  2E0I A;  3ZYM A;  3QK0 A;  3M53 A;  4R7L A;  5JJT A;  3PNL B;  4I1A A;  1Z6T A;  2W5Z A;  1RW2 A;  4JD2 G;  4JZY A;  4ATG A;  1PEG A;  3CBO A;  2IOL A;  1N6C A;  3CHQ A;  1X5B A;  3QWV A;  2PM7 A;  4RZ0 A;  1N95 A;  4LRZ A;  4I6G A;  3HHM A;  4TUU A;  2XGO A;  1OWM A;  3SFZ A;  2PM6 A;  3OXL A;  3SFX A;  4JHK A;  3V30 A;  3HRA A;  5ANL A;  3FUM A;  4K0R A;  2LXL A;  3HXC A;  4GML A;  4K5C A;  2LO6 A;  2IY0 C;  3FTX A;  4AP2 A;  3I4G A;  2FO7 A;  3Q73 A;  5AYF A;  4JA9 A;  1TNU A;  3MEK A;  1Z3X A;  5FQ8 A;  1OXJ A;  3W9F A;  2NXP A;  2HYZ A;  1OWN A;  2VYI A;  3T5X A;  3C3O A;  2JEK A;  4ABN A;  2F0Y A;  4I17 A;  4K5A B;  5ENR D;  4RLY A;  2J07 A;  1O1T A;  3Q15 A;  1H6K A;  4DLQ A;  4IN3 B;  3OS5 A;  3T8M A;  4L23 A;  1B89 A;  1L5J A;  2KCK A;  3L54 A;  1PY1 A;  4I6J A;  5LFA A;  3GW4 A;  3IBE A;  5DIZ A;  3OXF A;  4YDE A;  2Y69 E;  5DBK A;  5CER B;  4JW1 A;  3M5A A;  4FHK A;  2YIN A;  2DZO A;  3KMA A;  4ILG A;  5FZQ A;  4IYP A;  3I4R B;  3DXK G;  1TN7 A;  3TGO A;  2DWZ A;  4IRU A;  2KAT A;  4V3I A;  4A63 B;  1NA3 A;  3MGB A;  2PZI A;  2WXI A;  3UUX A;  4ANU A;  2HR2 A;  1K1A A;  3DST A;  1YCS B;  3MJW A;  2P2C P;  4QFV A;  2PQR A;  4L2L A;  3DSW A;  5JHB A;  4FMU A;  2P9U G;  5KWD A;  2WXF A;  4DX5 D;  3CLJ A;  4JPS A;  2EIM E;  4XE0 A;  3ULQ A;  3RAY A;  1MX6 A;  5T0M A;  4LER A;  4LDG A;  5KNH D;  1OWO A;  3FH7 A;  5FQ6 A;  2IOS A;  3UKU G;  2E2E A;  4U63 A;  3PZ4 A;  4EPZ A;  2RD0 A;  4NAC A;  2Y4U A;  5ENT D;  3ULE G;  1YYH A;  3I5P A;  3E30 A;  5BNW A;  4UQZ A;  3ZRH A;  1A5E A;  3M54 A;  3CK7 A;  4RSY A;  2J09 A;  2C0M A;  3L16 A;  4GTM A;  3MV3 B;  3M58 A;  2H6F A;  3ESL A;  3CBM A;  1ZKK A;  3CBP A;  4AEZ C;  2QYJ A;  3FTW A;  4C0M A;  4JA7 A;  3CHO A;  3CVU A;  5ANR A;  4A3T A;  3FTU A;  5LCW J;  3QB2 A;  3NAW A;  4BWR A;  2I2O A;  4G23 A;  4JL0 A;  3FTZ A;  4IJ8 A;  1HS6 A;  3IKO B;  1TNB A;  1BI8 B;  3ZU7 B;  5A7D B;  3KSL A;  3ASG A;  4B8A A;  1OCR E;  2BKG A;  3RAU A;  3WXX A;  2WQ6 A;  4J8E A;  5BV0 A;  4GTT A;  1HH8 A;  2ZIS A;  4MKT A;  2H6H A;  1H19 A;  3KSQ A;  1E8X A;  1MJ0 A;  2KXP C;  4B93 B;  1KZO A;  3JXI A;  3QWP A;  3HIZ A;  4TXP A;  2EIN E;  1LTX A;  3D9N A;  4UWG A;  3EDT B;  3UX4 A;  2MHK A;  3PE4 A;  4J6I A;  4XI0 A;  4NIK A;  5AAO A;  4I1O B;  5T4Y A;  1N4S A;  4BEP A;  2VSY A;  4G11 A;  4BSX A;  1E96 B;  3NOG D;  5JMN D;  3C5R A;  2NYJ A;  3PRZ A;  2Y1L E;  3IHY A;  4AM9 A;  2XQ0 A;  3UIN C;  3TG5 A;  2WXG A;  5AEN A;  4HI8 A;  1LD8 A;  5EYL A;  2QPW A;  2OCC E;  3GZ1 A;  1HXI A;  4JEH A;  1D8E A;  2KZT A;  1U2V G;  5F59 A;  2ZGG A;  3MCX A;  3U66 A;  5B3S E;  1E90 A;  3LXU X;  1H3I A;  1Y6I A;  4HOS A;  2JV0 A;  3Q79 A;  1TNY A;  3BQO A;  4XI9 A;  1S70 B;  2P9L G;  4B94 A;  1SW6 A;  3FUF A;  4N5Q A;  3CGH A;  2WXQ A;  4NRH B;  1JCS A;  3FY4 A;  3CK9 A;  2OVB A;  2GRP B;  3AS4 A;  3ZN3 A;  3LY8 A;  4LNB A;  1MUF A;  2BUG A;  3SGH A;  5AQA A;  3FTY A;  2FI7 A;  4J8Y A;  4EEC A;  3P2B A;  1OCZ E;  3KMT A;  4WUY A;  2AVP A;  2J9Q A;  4EZK A;  3IXE A;  4G26 A;  1MZC A;  5T0K A;  3S8P A;  4YPA A;  3DBS A;  3ASD A;  2JAB A;  2WXP A;  5G05 J;  2IQC A;  2QC9 A;  4J7W A;  4Z4P A;  5T3R A;  4JLG A;  3AAA C;  3FUJ A;  5LOZ A;  4GZ3 A;  2CG2 A;  1SA5 A;  3BEE A;  1V55 E;  1ELW A;  4KXK B;  3TWQ A;  2IJG X;  2X6F A;  1OCC E;  3MKR A;  4CCA A;  3ZFW A;  3BG1 B;  2IU1 A;  2DBA A;  4GU5 A;  3EIJ A;  4MBG A;  4ANW A;  1UJK A;  4TUM A;  4ILH B;  4IUL A;  1SA4 A;  4RG9 A;  3ZHE A;  2YQ8 A;  3ASH A;  5D0Q D;  4HOT A;  2DYR E;  4BX9 A;  4K5B A;  4GTP A;  5BXO A;  3JUI A;  1UG3 A;  2YNQ A;  3SBS A;  5CBO A;  2AW6 A;  3GYZ A;  4FA6 A;  4HNA D;  5IY5 E;  5J08 A;  3EU5 A;  5EID A;  3ISM C;  5FTP A;  1UN9 A;  2IEJ A;  5FZS A;  1JPL A;  5CRV A;  3F9Z A;  1YMP A;  2X6H A;  2XPZ A;  2P9I G;  2RKK A;  1TNZ A;  1FT1 A;  4K03 A;  3D9O A;  4NUR A;  5CRU A;  2LNI A;  3DWL G;  4GTQ A;  4Z68 A;  1SQM A;  5JJ0 A;  2P9N G;  3CHR A;  4N39 A;  5C1D A;  5FWQ A;  3S2A A;  2L0T B;  4EBA G;  5ENS D;  2O8J A;  4WNF A;  3ZW3 A;  2I6H A;  1E7U A;  3MX3 A;  3PEU B;  5EDS A;  1JCQ A;  3APD A;  5CMY A;  3FFL A;  4DLO A;  3MKQ A;  3MA5 A;  4Y6W A;  4YPE A;  3CVY A;  4DRX E;  4YVO A;  3VV0 A;  2WXN A;  1BI7 B;  3UPV A;  1DCQ A;  4CDR A;  3R7R A;  1BU9 A;  3TWR A;  2WB2 A;  2PNN A;  2R2L A;  3X2Q E;  3SHF A;  4UQX A;  1H0A A;  3LJN A;  2XGS A;  3FHE A;  2B6C A;  2ETC A;  5B1B E;  3AU5 A;  4GZD A;  3QDN A;  3U4T A;  2EIK E;  3ML8 A;  1DVP A;  1N3J A;  3DEP A;  2LSU A;  4XEI G;  4FJZ A;  4HOU A;  5BW8 C;  3PH0 C;  5JJ7 A;  4G24 A;  3ZKJ A;  2OVF A;  2EIJ E;  3PVL A;  3ZXS A;  2F8Y A;  3V79 K;  4JEU A;  2V0P A;  1WDY A;  2RG8 A;  3TWT A;  1IQU A;  3ZPJ A;  2R17 C;  4XX5 A;  5BUZ A;  2HM8 A;  4N3C A;  3N71 A;  2KCL A;  3K9I A;  4HVB A;  3F9X A;  3UXG A;  2OEW A;  3HXE A;  4N5C A;  2L6B A;  3I3N A;  4E6H A;  4FLH A;  1D9S A;  4FUL A;  3S7B A;  3KD7 A;  3FU0 A;  2UY1 A;  4NJ5 A;  1UN8 A;  1QQE A;  5FIO A;  3EUV A;  2V5F A;  2C2L A;  5G04 J;  1E8Z A;  2MRI A;  3DRA A;  4GYO A;  4D10 C;  3RSE G;  3LEW A;  4GYW A;  4AOF A;  1N52 A;  2V5Q C;  4CT4 A;  1SZA A;  1INZ A;  2DVW A;  4N3A A;  5BPP A;  5EIB E;  3VTY A;  1UOH A;  4U7E B;  3VLF A;  5BV1 A;  3ESK A;  4M3O A;  4OYS A;  3FEX A;  4LEU A;  2XS8 A;  1HG2 A;  4L9P A;  4YPU A;  1PAQ A;  3PZ1 A;  4WWN A;  4HRL A;  4F7A A;  5F6K C;  2R5S A;  3RQ4 A;  1HG5 A;  3OAW A;  2WXL A;  5AQ9 A;  4FC8 A;  3UM0 A;  2IO3 C;  4PDX A;  2WXM A;  3M59 A;  1N9A A;  3DSS A;  3EP0 A;  3TWU A;  1FPP A;  2XRZ A;  2NSZ A;  4OAU C;  3SFY A;  4LUN U;  2I9C A;  3PZD A;  4UI9 J;  3T9K A;  1IKN D;  3TWX A;  2R59 A;  5CHE E;  2FEZ A;  1KLX A;  5FIN A;  5G55 A;  3OXG A;  3FUI A;  3Q7A A;  3ML9 A;  4WWO A;  4UI9 K;  3VLE A;  2ZXW E;  4GB9 A;  1KT0 A;  3ZVV A;  4AV7 A;  1ELR A;  5KBA A;  4G1T A;  4H7Y A;  4X8Q A;  5TTF A;  4KBQ A;  5TEG A;  4HOQ A;  2ZU6 B;  3MYV A;  4TXQ A;  3OOI A;  4LNU D;  3CQC B;  3LVQ E;  2KZT B;  2WXO A;  4WAF A;  3TWV A;  3HDX A;  4HLL A;  3TXM A;  4EQF A;  1XQH A;  5AIJ A;  1E7V A;  3NZU A;  3L9T A;  4LSZ E;  1ML9 A;  4MI5 A;  5A6C A;  1N11 A;  5E76 A;  4AU7 A;  3LCA A;  4TRQ A;  5HKP A;  3ZYQ A;  5HS0 A;  3CVQ A;  5CEA A;  2X6I A;  4CZ2 D;  3L6A A;  4A3V A;  4ATZ D;  3FUN A;  3Q4A B;  3DSV A;  3E34 A;  3KEZ A;  4FJY A;  2GRN B;  1HFA A;  3L22 A;  4LG6 A;  1MYO A;  1HZ4 A;  3B7U X;  3QC1 A;  1WM5 A;  5D66 A;  4U8H A;  3KEA A;  4HQD A;  3ZUV B;  5KJL A;  3QKY A;  4ZHB A;  3LPZ A;  5LSZ A;  3CHM A;  2WXH A;  3C3R A;  5ITZ F;  3KMJ A;  4DJA A;  3TWW A;  2IGQ A;  5KNG A;  3PUJ A;  4J7I A;  1LF8 A;  3J5P A;  4EZJ A;  3JCK C;  3WG7 E;  4U04 A;  2FO1 E;  1E8W A;  4KT6 B;  1N4P A;  4I2W A;  4RQI A;  3CK8 A;  4BSZ B;  4GYY A;  3DPD A;  3RO3 A;  2XZT G;  2ETA A;  2F37 A;  3ZHE B;  1BD8 A;  1TJF A;  3O48 A;  3CEQ A;  2FBN A;  2CFU A;  2BKK B;  3CVP A;  5KCM A;  1WY6 A;  4J8D A;  1QNF A;  3UT7 A;  3UM2 A;  2XPI A;  3TG4 A;  4JB8 P;  3D9P A;  5BT1 A;  2V8S E;  3LS8 A;  3DB5 A;  4A1S A;  3VTX A;  4H7X A;  4RG6 A;  2XEN A;  2I1J A;  1UW4 B;  4GCO A;  4BX8 A;  4BET A;  3CQG B;  4CT0 A;  2G46 A;  2WMO A;  1S63 A;  2A4Z A;  2KCV A;  3AG3 E;  2FUL A;  4J8F A;  1MHQ A;  3C98 A;  1X81 A;  2XGM A;  1NZN A;  3DAL A;  2VSN A;  1EYH A;  2F8X K;  3PDN A;  3E33 A;  3RRM B;  3FEY A;  3ABL E;  5E75 A;  4GAA A;  3RRN B;  4XKB A;  3B13 A;  3B95 A;  2DIW A;  2WVI A;  3KS2 A;  4HXI A;  3M57 A;  3MKQ B;  2W5Y A;  5D2M C;  4CDN A;  4APO A;  3ZYL A;  3BU8 A;  3ABM E;  4FAD A;  3SY2 A;  2AXZ A;  4OVV A;  5CED B;  3EU9 A;  1H6P A;  3RO2 A;  1U3D A;  4FHJ A;  3RU0 A;  4GA0 A;  3CVW A;  4O1O A;  5ENN A;  4KZ0 A;  5ENQ D;  3PNT B;  3DEO A;  3P1U A;  3LY7 A;  2QFC A;  2LAH A;  2P58 C;  2CFZ A;  4GMJ A;  4GA2 A;  3W9G A;  3FTV A;  5EKQ D;  1K1B A;  2BF0 X;  3NB2 A;  5TH7 A;  3T5V A;  2ETB A;  2VSO E;  1QBQ A;  3NOC D;  1GW6 A;  3RRU A;  5G2N A;  2EQX A;  3ZGQ A;  3JQ1 A;  5AYW D;  3Q9N C;  4I2Z A;  4ZFH A;  4FU3 A;  4L2Y A;  4BTA A;  2KM4 A;  3FUE A;  3PS6 A;  2L6J A;  2CG3 A;  2VSX E;  3SF4 A;  2XEE A;  2EIL E;  2ZGD A;  3CKC A;  1S0P A;  2XHE A;  3E32 A;  3ZXP A;  2UY1 B;  2F69 A;  2WXK A;  3VUZ A;  3D9J A;  4GCN A;  2OV8 A;  3NF1 A;  3R9A B;  2MOW A;  3AG1 E;  3AU4 A;  4JVS A;  3ASF A;  3LYA A;  4I6E A;  4WND A;  5HI7 A;  4G8K A;  3LJ3 A;  3KAE A;  5LSX A;  2JLB A;  3L13 A;  4HS2 A;  4LNG A;  4HI9 A;  2OEV A;  3F9W A;  2A5E A;  2XZD G;  5CMW A;  1S64 A;  3Q75 A;  2XS1 A;  3MO5 A;  5H7P A;  1OWP A;  2V4H C;  3QAQ A;  3HG0 D;  3NBN B;  3F6Q A;  4DX1 A;  2CHW A;  4MLP A;  2RFI A;  3IEG A;  5LP0 A;  3ABK E;  3JXJ A;  4RVB A;  5JIY A;  4M7C A;  5FQ7 A;  4I43 A;  3FUK A;  1SZ9 A;  3QWW A;  1NL4 A;  3FU3 A;  1QYM A;  4U8Y D;  3RJV A;  4U96 D;  3FUH A;  2AWI A;  1YA0 A;  4PH4 B;  5JIN A;  4AY6 A;  2GRO B;  4ILI A;  3HVE A;  4I9E A;  3EHN A;  3CV0 A;  1O1R A;  4TV3 A;  3G2T A;  2PL2 A;  2XEH A;  1JWF A;  3TXN A;  3FPD A;  4F1P A;  4BES A;  3D9L A;  1FCH A;  2IF4 A;  1W3B A;  3ONL A;  3D9H A;  4KMO A;  1OUV A;  5CBN A;  4N3B A;  2VGX A;  3F9Y A;  1EDU A;  4HFG A;  3TWS A;  3UM1 A;  5F5E A;  3B7T A;  2YHC A;  1BPO A;  3D9I A;  1H2T C;  4GMR A;  2NC9 A;  5CCM A;  4GTV A;  4F53 A;  5ARG A;  2IO2 C;  3IHX A;  5EX0 A;  4BT8 A;  5FZR A;  3FP3 A;  3CR3 A;  3CHS A;  4Q96 A;  5EN5 D;  3EJN A;  4XIF A;  1IHB A;  4A55 A;  5KJM A;  4QEN A;  2DZN A;  4BFR A;  5LCW C;  5CCL A;  4JHJ A;  1JWG A;  4B89 A;  4G25 A;  2QY7 A;  2QYU A;  5M72 A;  1D8D A;  4U07 A;  2ILR A;  3JUE A;  3CST A;  4J8O A;  4APF A;  2BED A;  4KZC A;  1TN8 A;  4AIF A;  5LX8 A;  2VTB A;  2IFU A;  2XCB A;  2P9K G;  4HBD A;  2VGY A;  2WM9 A;  3G2V A;  3U3W A;  1N94 A;  1XNF A;  3ZIM A;  4B8C B;  1E8Y A;  4YDY A;  3Q5M A;  4XZ4 A;  2I1K A;  5EYP F;  1DNP A;  4JDS A;  3V2O A;  4YNM A;  3CVL A;  4CDM A;  2B0O E;  4NQ0 A;  1KZP A;  1MVX A;  3NQP A;  3HYM B;  3V31 A;  2WMN A;  3LKU A;  4EZL A;  1MQS A;  3Q7F A;  2GRR B;  4BT9 A;  1P5Q A;  4I1M A;  5HQ8 A;  3UMV A;  4FP7 A;  3TJP A;  1HE8 A;  2WXR A;  4B0Z A;  3CVX A;  5KJN A;  4AY5 A;  1N4Q A;  4UQY A;  3DXM G;  3UIO C;  4E85 A;  3M56 A;  3RJW A;  3UIP C;  1H6O A;  5FT9 A;  5KJK A;  4DPR A;  4NVQ A;  1V54 E;  3FTS A;  3FUL A;  1Q2Z A;  3ZNG A;  3E37 A;  4MI0 A;  3TAX A;  3UM3 A;  2L0I A;  5FQ4 A;  3B7B A;  2X6J A;  4MS6 A;  2R02 A;  4O1P A;  1PC2 A;  2X6K A;  2PQN A;  3B7S A;  4UWL A;  1NP7 A;  3O4Z A;  2LXM A;  1TNO A;  3R7Q A;  3ENE A;  4BER A;  1BLX B;  4J83 A;  3S7J A;  2V4L A;  2XEV A;  3BO5 A;  3UT4 A;  4BUP A;  3FDH A;  2VJ8 A;  3PUK A;  1HX8 A;  4JHR A;  4LCT A;  3HXB A;  3DSX A;  2ION A;  2RFM A;  1K3Z D;  3M55 A;  1ELK A;  3FWV A;  2GGF A;  2DYS E;  5BXU A;  3IHV A;  4Y6C A;  2WPV A;  1OT8 A;  5B1A E;  3R9M A;  3CVN A;  5EX3 A;  3G2U A;  3FU6 A;  3MO0 A;  3J5Q B;  4BTB A;  4XKC A;  5G05 C;  5F6L A;  4ME2 A;  4L1B A;  2HO1 A;  5AJD A;  2GRM A;  5C2Y A;  3UI2 A;  4UWH A;  3Q78 A;  2RFA A;  5JJ6 A;  1IHG A;  3K5K A;  3PRE A;  2WXJ A;  1H2V C;  3JQ0 A;  3U9W A;  3UTM A;  3FH8 A;  1O5M A;  2Y4T A;  3L08 A;  3S7F A;  2LUH A;  3Q9U C;  4EBA A;  4O30 A;  2GRQ B;  3L82 A;  2QZA A;  4KVO A;  3ZYK A;  3VLD A;  4CRW A;  4PS3 A;  4HB5 A;  4WNE A;  1LD7 A;  3PZ3 A;  1N54 A; 
#chains in the Genus database with same CATH homology
 3MX3 A;  3PEU B;  5TH7 A;  2VQ2 A;  5EDS A;  1OWN A;  3APD A;  3IV0 A;  5CMY A;  2VYI A;  3FFL A;  3T5X A;  3T5V A;  4ABN A;  2JEK A;  2R3A A;  2VSO E;  4DLO A;  4PS7 A;  3MKQ A;  3MA5 A;  4I17 A;  3LY9 A;  4Y6W A;  4YPE A;  2J07 A;  1GW6 A;  3Q15 A;  3CVY A;  3RRU A;  4YVO A;  4DI3 A;  3VV0 A;  3CIA A;  2WXN A;  5G2N A;  3UT8 A;  2EQX A;  3Q47 B;  1FVF A;  4U0Z A;  3ZGQ A;  1H6K A;  3UPV A;  4DLQ A;  4IN3 B;  3JQ1 A;  5AYW D;  3OS5 A;  4CDR A;  3R7R A;  3RKV A;  4N2S A;  3T8M A;  5FJY A;  3PEV B;  4L23 A;  1B89 A;  4I2Z A;  1L5J A;  2KCK A;  3L54 A;  1PY1 A;  4I6J A;  2WB2 A;  2AXV A;  4FU3 A;  4L2Y A;  4BTA A;  3BG0 B;  4GA1 A;  2KM4 A;  1ZBP A;  3FUE A;  3EHM A;  3LVR E;  2L6J A;  3PS6 A;  4J0U A;  3SHF A;  2CG3 A;  5LFA A;  4HOR A;  4UQX A;  2VSX E;  3SF4 A;  1H0A A;  3GW4 A;  3IBE A;  5DIZ A;  2XGS A;  3OXF A;  3FHE A;  4ACK A;  3APC A;  5DBK A;  2M63 A;  1Y8M A;  3AU5 A;  3CKC A;  1JUQ A;  4GZD A;  3QDN A;  3U4T A;  2YHE A;  4JW1 A;  3ML8 A;  3CVV A;  3M5A A;  1DVP A;  1S0P A;  2YIN A;  4FHK A;  1N3J A;  4JXT A;  3KMA A;  2LSU A;  2XHE A;  4ILG A;  4FJZ A;  4HOU A;  5FZQ A;  4IYP A;  3I4R B;  3SNX A;  2UY1 B;  4CEM A;  3TGO A;  2F69 A;  2WXK A;  3VUZ A;  1VDY A;  3Q49 B;  4IRU A;  4AXH A;  4GZ5 A;  3JYS A;  2KAT A;  3D9J A;  4IJD A;  2X3M A;  3PE3 A;  4GCN A;  5BW8 C;  2OV8 A;  3NF1 A;  4V3I A;  3URZ A;  3R9A B;  3PH0 C;  1NA3 A;  3LDZ A;  3E4B A;  2MOW A;  5JJ7 A;  3GZS A;  4G24 A;  2OVF A;  3MGB A;  3PVL A;  2PZI A;  2WXI A;  3AU4 A;  3UUX A;  1MT6 A;  4ANU A;  4JVS A;  4C9B B;  3ZXS A;  3ASF A;  3LYA A;  4JEU A;  4ANV A;  2HR2 A;  4PS8 A;  2V0P A;  4I6E A;  2AXU A;  2RG8 A;  3MJW A;  4WND A;  4YVQ C;  1IQU A;  5HI7 A;  3ZPJ A;  4QEO A;  3LJ3 A;  3KAE A;  2PQR A;  4L2L A;  4QFV A;  2R17 C;  4KYO B;  1ZU2 A;  3FUD A;  5JHB A;  5LSX A;  4XX5 A;  2JLB A;  3L13 A;  4HS2 A;  4FMU A;  3FU5 A;  2WXF A;  4ACL A;  5BUZ A;  3CLJ A;  3HVE B;  4JPS A;  3F9W A;  3RK6 A;  2HM8 A;  4N3C A;  4XE0 A;  5CMW A;  3ULQ A;  3N71 A;  4G2V A;  3RAY A;  2KCL A;  3K9I A;  4HVB A;  3F9X A;  5T0M A;  4LER A;  4N5C A;  1UJJ A;  4LDG A;  4A1G A;  3MO5 A;  4DK5 A;  3I3N A;  1OWP A;  1OWO A;  4E6H A;  1IYG A;  4F1S A;  3QAQ A;  4FLH A;  3FH7 A;  3G2S A;  3L17 A;  5FQ6 A;  2IOS A;  2E2E A;  4U63 A;  4FUL A;  3S7B A;  1FVH A;  4EPZ A;  5A23 A;  2VGX B;  2RD0 A;  1WAO 1;  2Y4U A;  4NAC A;  5D0O D;  1HO8 A;  3KD7 A;  3FU0 A;  2CHW A;  3FH5 A;  2UY1 A;  4MLP A;  1UN8 A;  1QQE A;  3I5P A;  4URK A;  4NJ5 A;  2RFI A;  3IEG A;  5BNW A;  3MZL B;  5LP0 A;  4UQZ A;  3ZRH A;  3CSF A;  2V5F A;  2C2L A;  3M54 A;  4RVB A;  2LSV A;  5G04 J;  1E8Z A;  2MRI A;  3CK7 A;  5JIY A;  4RSY A;  2J09 A;  4GYO A;  2C0M A;  4GZ6 A;  4I43 A;  5FQ7 A;  4D10 C;  2XRY A;  3L16 A;  3LEW A;  5EG2 A;  3AS5 A;  3FUK A;  4GYW A;  4AOF A;  1HU3 A;  3MV3 B;  3M58 A;  1SZ9 A;  3QWW A;  1N52 A;  3FU3 A;  3ESL A;  4CT4 A;  2FF4 A;  1SZA A;  1INZ A;  2WQH A;  2KC7 A;  4N3A A;  3RJV A;  4FLB A;  3FUH A;  1ZKK A;  3CBM A;  4AEZ C;  5BPP A;  2AWI A;  3CBP A;  4C1Q A;  4I9C A;  3VTY A;  1YA0 A;  3VLF A;  4PH4 B;  5BV1 A;  5JIN A;  3ESK A;  3FTW A;  4AY6 A;  4C0M A;  4M3O A;  4QEP A;  4OYS A;  3FEX A;  3QJZ A;  4ILI A;  4JA7 A;  4LEU A;  3CHO A;  1HG2 A;  3HVE A;  1HF8 A;  4I9E A;  3U64 A;  3NZS A;  5JHN A;  3EHN A;  4YPU A;  3CV0 A;  3CVU A;  4TV3 A;  1PAQ A;  3G2T A;  4WWN A;  2WQ7 A;  2PL2 A;  5ANR A;  4F7A A;  4N2Q A;  4UWK A;  5F6K C;  1JWF A;  2R5S A;  4A3T A;  3FTU A;  3D9K A;  5LCW J;  3RQ4 A;  5ARF A;  1U3C A;  3TXN A;  3FPD A;  3GZ2 A;  2GRL A;  3QB2 A;  3D9L A;  1HG5 A;  1FCH A;  2IF4 A;  1W3B A;  2WXL A;  3ONL A;  3OAW A;  2XCC A;  3SZ7 A;  2I2O A;  4BWR A;  4FC8 A;  4KMO A;  1OUV A;  4G23 A;  4JL0 A;  2VTB B;  3FTZ A;  2WXM A;  1HS6 A;  4PDX A;  4Q69 A;  3M59 A;  4IJ8 A;  3IKO B;  4N3B A;  2VGX A;  5G04 C;  3F9Y A;  1EDU A;  4HFG A;  3EP0 A;  2XRZ A;  5F5E A;  2NSZ A;  3SWC A;  1EF1 C;  5A7D B;  3B7T A;  2YHC A;  1BPO A;  2I9C A;  4LUN U;  3ASG A;  3PZD A;  3OTN A;  4UI9 J;  4U0U A;  3D9I A;  4B8A A;  1H2T C;  4GZC A;  2NC9 A;  2R59 A;  5CHE E;  3WXX A;  2FEZ A;  5CCM A;  1KLX A;  5G55 A;  2WQ6 A;  3OXG A;  4CGW A;  4J8E A;  2Q7F A;  3FUI A;  5BV0 A;  4F53 A;  3ML9 A;  4WWO A;  5ARG A;  3CKB A;  1HH8 A;  3IHX A;  4UI9 K;  3VLE A;  4GB9 A;  5EX0 A;  4BT8 A;  1KT0 A;  3ZVV A;  5T8I A;  5FZR A;  4MKT A;  2J08 A;  3FP3 A;  1H19 A;  4AV7 A;  1ELR A;  3CHS A;  3CR3 A;  4G1T A;  4Q96 A;  1E8X A;  4H7Y A;  1MVH A;  3EJN A;  5TTF A;  3MO2 A;  4XIF A;  3MV2 B;  4KBQ A;  5TEG A;  4HOQ A;  4A55 A;  1OWL A;  2ZU6 B;  5KJM A;  3MYV A;  3OOI A;  4QEN A;  4GPK A;  5LCW C;  4BFR A;  3CQC B;  4KVM A;  5CCL A;  5T5G A;  3LVQ E;  2KZT B;  2WXO A;  4JHJ A;  1JWG A;  4B89 A;  1O9S A;  4G25 A;  4WAF A;  2QY7 A;  3QWP A;  3HDX A;  3HIZ A;  4J7F A;  5M72 A;  3TXM A;  3SBT B;  4U07 A;  4EQF A;  2ILR A;  1IQR A;  1XQH A;  3CST A;  3D9N A;  4J8O A;  3TL5 A;  4APF A;  5AIJ A;  4UWG A;  3EDT B;  4KZC A;  1E7V A;  4AIF A;  3UX4 A;  5LX8 A;  2MHK A;  2X38 A;  3PE4 A;  4J6I A;  4XI0 A;  3NZU A;  2VTB A;  2IFU A;  4I1O B;  4MRU A;  5T4Y A;  2XCB A;  5A6C A;  5AJL A;  5JHA A;  1ML9 A;  4UI9 C;  4MI5 A;  2VSY A;  4G11 A;  4BSX A;  2VGY A;  2WM9 A;  5E76 A;  4AU7 A;  3G2V A;  1Z3Y A;  4F3V A;  1E96 B;  3LCA A;  4U0S A;  3U3W A;  3HNA A;  4TRQ A;  1A17 A;  1XNF A;  2J4D A;  3PRZ A;  3ZIM A;  2DCP A;  4B8C B;  1E8Y A;  3IHY A;  3ZYQ A;  4AM9 A;  3CVQ A;  2I6H A;  3Q5M A;  5CPR B;  2OND A;  2XQ0 A;  2X6I A;  3TG5 A;  4XZ4 A;  2WXG A;  1QZ2 A;  2I1K A;  5AEN A;  3L6A A;  4A3V A;  2QPW A;  3GZ1 A;  1HXI A;  3FUN A;  1DNP A;  3Q4A B;  4JEH A;  4JDS A;  3KEZ A;  3B7R L;  4FJY A;  4DI4 A;  3SW9 A;  4L7T A;  4YNM A;  1HFA A;  2KZT A;  3CVL A;  3L22 A;  4CDM A;  1TEZ A;  4NQ0 A;  2XPY A;  3APF A;  5F59 A;  3MCX A;  1MVX A;  3NQP A;  3HYM B;  3U66 A;  3QNK A;  1HZ4 A;  1E90 A;  2WMN A;  2OOE A;  3LXU X;  3B7U X;  1H3I A;  1Y6I A;  4P29 A;  4HOS A;  3QC1 A;  3LKU A;  2JV0 A;  1WM5 A;  4EZL A;  4UWF A;  4E47 A;  3G2W A;  3D9M A;  1MQS A;  4XI9 A;  3ZEF A;  4U8H A;  1EPU A;  4BT9 A;  1P5Q A;  4I1M A;  5HQ8 A;  3QKY A;  3UMV A;  5KJL A;  3LPZ A;  3SI5 A;  4PUC A;  4B94 A;  3S7D A;  5LSZ A;  4FP7 A;  4Q94 A;  3TJP A;  3CHM A;  2WXH A;  5J90 A;  4W9R A;  3FUF A;  3KMJ A;  1HE8 A;  2WXR A;  3CGH A;  3OPE A;  4B0Z A;  4DJA A;  2WXQ A;  3CVX A;  5KJN A;  4CGV A;  4NRH B;  4AY5 A;  2IGQ A;  4UQY A;  3EIQ C;  3FY4 A;  3PUJ A;  4J8S A;  4J7I A;  4BY6 A;  1LF8 A;  3CK9 A;  2OVB A;  4E85 A;  4EZJ A;  3JCK C;  4H12 A;  3AS4 A;  4U04 A;  3M56 A;  4WNG A;  3RJW A;  3ZN3 A;  1E8W A;  4KT6 B;  3LY8 A;  3QOU A;  1MUF A;  5FT9 A;  5KJK A;  2BUG A;  4I2W A;  2LAI A;  3QAR A;  3SGH A;  3FTY A;  4DPR A;  4NVQ A;  3CK8 A;  2FI7 A;  4ANX A;  2CHX A;  3FTS A;  2J4B A;  2GW1 A;  3FUL A;  4GYY A;  3DPD A;  4EEC A;  3RO3 A;  3P2B A;  4MI0 A;  3ONK A;  3TAX A;  3UQ3 A;  4YNP A;  3KMT A;  1KT1 A;  2L0I A;  4AVX A;  4WUY A;  2AVP A;  1NA0 A;  3ZHE B;  2J9Q A;  4EZK A;  4G26 A;  5FQ4 A;  3D3M A;  1TJF A;  2X6J A;  2CHZ A;  3O48 A;  4MS6 A;  3CEQ A;  2FBN A;  2CFU A;  2J49 A;  3CHP A;  5T0K A;  3S8P A;  4YPA A;  3CVP A;  5KCM A;  3DBS A;  1WY6 A;  1PC2 A;  3ASD A;  4J8D A;  2X6K A;  1QNF A;  2PQN A;  3B7S A;  2WXP A;  3AS8 A;  3UT7 A;  4C0E A;  1H2U A;  4UWL A;  4I51 A;  4WWP A;  5G05 J;  1NP7 A;  3O4Z A;  2XPI A;  3TG4 A;  2IQC A;  4OVU A;  3D9P A;  3R7Q A;  5BT1 A;  4Z4P A;  2V8S E;  4O6F A;  3LS8 A;  1TJC A;  3ENE A;  5T3R A;  4JLG A;  4HLE A;  4AJW A;  1XGW A;  3DB5 A;  2UWJ G;  4A1S A;  3VTX A;  3FUJ A;  4H7X A;  4RG6 A;  5LOZ A;  3S7J A;  4J83 A;  2V4L A;  2I1J A;  2XEV A;  2BTD A;  1UW4 B;  4GCO A;  4GZ3 A;  3BO5 A;  2CG2 A;  4BX8 A;  3UT4 A;  2C0L A;  1N6A A;  4BUP A;  3FDH A;  2VJ8 A;  3PUK A;  1HX8 A;  4JHR A;  4LCT A;  3BEE A;  3SD5 A;  1ELW A;  3CQG B;  4JC8 A;  4KXK B;  2IJG X;  2X6F A;  2ION A;  4CT0 A;  2G46 A;  3MKR A;  3RIB A;  2WMO A;  2A4Z A;  2KCV A;  4YND A;  1ELK A;  4CCA A;  2FUL A;  3FWV A;  3M55 A;  3ZFW A;  3BG1 B;  4J8F A;  1MHQ A;  2GGF A;  3C98 A;  2BQZ A;  2IU1 A;  2A5U A;  2DBA A;  4GU5 A;  2L9B A;  3EIJ A;  2Y3A A;  2XGM A;  2E0I A;  4ANW A;  1NZN A;  3IHV A;  4Y6C A;  3ZYM A;  3DAL A;  1UJK A;  3QK0 A;  4R7L A;  2WPV A;  5JJT A;  3M53 A;  2VSN A;  3PNL B;  4I1A A;  1Z6T A;  3CVN A;  4ILH B;  2W5Z A;  4IUL A;  1EYH A;  5EX3 A;  3PDN A;  4RG9 A;  3G2U A;  3ZHE A;  2YQ8 A;  3ASH A;  3RRM B;  5D0Q D;  3FEY A;  3FU6 A;  4JZY A;  4ATG A;  4HOT A;  1PEG A;  3CBO A;  5E75 A;  4GAA A;  3MO0 A;  4BX9 A;  4BTB A;  2IOL A;  4XKC A;  5G05 C;  3RRN B;  1N6C A;  4XKB A;  3CHQ A;  3JUI A;  1UG3 A;  3B13 A;  5F6L A;  1X5B A;  2DIW A;  2WVI A;  3KS2 A;  4HXI A;  4ME2 A;  3M57 A;  4L1B A;  2HYZ A;  3MKQ B;  3QWV A;  2HO1 A;  2PM7 A;  5AJD A;  2W5Y A;  2YNQ A;  2GRM A;  3SBS A;  4CDN A;  5C2Y A;  4APO A;  2AW6 A;  3GYZ A;  4UWH A;  4FA6 A;  4RZ0 A;  5JJ6 A;  1IHG A;  5J08 A;  3ZYL A;  4LRZ A;  3K5K A;  3PRE A;  2WXJ A;  1H2V C;  4FAD A;  3JQ0 A;  4I6G A;  5FTP A;  1UN9 A;  3HHM A;  2AXZ A;  4TUU A;  4OVV A;  5FZS A;  3U9W A;  1JPL A;  2XGO A;  3F9Z A;  3RO2 A;  1OWM A;  1U3D A;  4FHJ A;  2X6H A;  2XPZ A;  2PM6 A;  3FH8 A;  3RU0 A;  3SFZ A;  3L08 A;  2Y4T A;  3OXL A;  3S7F A;  4GA0 A;  4EBA A;  3CVW A;  4O30 A;  5ENN A;  4KZ0 A;  4JHK A;  3PNT B;  4K03 A;  5ANL A;  3D9O A;  3FUM A;  4K0R A;  4NUR A;  2LNI A;  3P1U A;  3LY7 A;  2QFC A;  5JJ0 A;  1SQM A;  2LAH A;  2P58 C;  4GML A;  4KVO A;  3ZYK A;  2CFZ A;  3CHR A;  4GMJ A;  3VLD A;  4CRW A;  2LO6 A;  4N39 A;  3FTX A;  4AP2 A;  3I4G A;  4GA2 A;  4PS3 A;  5C1D A;  2FO7 A;  3FTV A;  5FWQ A;  4JA9 A;  3S2A A;  2L0T B;  5AYF A;  5EKQ D;  3MEK A;  4EBA G;  1Z3X A;  2O8J A;  5FQ8 A;  4WNF A;  4WNE A;  3ZW3 A;  2BF0 X;  2NXP A;  1N54 A;  1E7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...