3RIBA

Human lysine methyltransferase smyd2 in complex with adohcy
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
430
structure length
430
Chain Sequence
GGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESHLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human lysine methyltransferase Smyd2 reveals insights into the substrate divergence in Smyd proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 139
structure length 430
sequence length 430
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ribA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ribA01
3EP0A 1IHGA 3DALA 3F9WA 3KS2A 1PC2A 4GZ5A 1B89A 4HOQA 3CK7A 4U0SA 3SZ7A 4B94A 3LYAA 4J7IA 4BT9A 4YPAA 4UQXA 3CVQA 3JYSA 5FT9A 4H7XA 4RZ0A 1OUVA 5CCMA 3M56A 3MO2A 3PE4A 2XGSA 5F6LA 1HXIA 4GYOA 3MO0A 4GCNA 4BTBA 3TGOA 3CEQA 3MA5A 3ULQA 4J0UA 3S8PA 3M59A 1HH8A 3RO2A 2C0LA 1NA3A 4UI9K 3AS5A 2DBAA 4UQYA 4BTAA 4Y6CA 4BUPA 2HR2A 4O30A 4BT8A 4APOA 3KMJA 3F9ZA 4ME2A 3LY8A 3PDNA 5KJMA 4J83A 3CK9A 1NA0A 5JINA 2UY1B 4WNEA 3AS4A 3CVNA 4AM9A 3UQ3A 4U0UA 3R9AB 4H12A 2OOEA 3RKVA 3O48A 3QDNA 3QWWA 2P58C 3KAEA 4YNPA 1KLXA 4IN3B 4I9EA 1WAO1 2G46A 5JJ6A 5JHNA 2FF4A 1HZ4A 3OXLA 2FO7A 4YPUA 5FZRA 2XGOA 2E2EA 4N39A 4H7YA 4AIFA 4I51A 3CKCA 4CGVA 5EX3A 1N3JA 2F69A 3RU0A 1QQEA 3ASGA 3M53A 5CPRB 3M58A 3S7BA 5FZSA 3UUXA 2FI7A 4GZ6A 4O6FA 3ASFA 1TJCA 4J8OA 1ZKKA 3LY7A 3M54A 3FFLA 3LKUA 3VTYA 4XI9A 4HOUA 3CBOA 3RQ4A 3FPDA 4YPEA 3ESKA 3ASDA 5CHEE 3N71A 3Q49B 4GYYA 4AU7A 3CVLA 3MEKA 3QOUA 3WXXA 4CDRA 4RG9A 4MI0A 4HOTA 3ZGQA 3CVPA 1E96B 3RJWA 4HORA 1N6AA 5TH7A 4C1QA 2WQHA 3ZFWA 4I1AA 1FCHA 3CK8A 5T0MA 4FMUA 3RAYA 3ASHA 5T0KA 4JDSA 2XCBA 2IF4A 1WM5A 1YA0A 1XNFA 4WNGA 2Y4TA 5TEGA 2Y4UA 2MHKA 4Y6WA 5DIZA 4UI9J 3ZN3A 2VSNA 3RO3A 3TAXA 4A1SA 2KATA 4U07A 5TTFA 5A6CA 3ZPJA 3IHXA 2JLBA 3PE3A 3MV3B 5T5GA 3BEEA 3EDTB 5F59A 3E4BA 4G26A 2ONDA 1NZNA 4QEOA 4XIFA 3OOIA 2AVPA 5A7DB 1KT1A 4NJ5A 3VUZA 5F5EA 4UQZA 2VGYA 3TG5A 2KCKA 2VQ2A 5EKQD 2JV0A 1QZ2A 3KMAA 4Z4PA 2YHCA 2KC7A 3RIBA 4I17A 4UI9C 2LNIA 5ARFA 3F9YA 2PQNA 4ABNA 1KT0A 5LSZA 2NC9A 5BT1A 4MI5A 2FEZA 3QWVA 2VYIA 2RFIA 3BO5A 1ML9A 4WNDA 4F3VA 5G04C 2L6JA 5C1DA 4YNDA 4WNFA 3KD7A 2V5FA 4I2WA 3MO5A 1MVXA 5LCWJ 4YVQC 5KJLA 2VGXA 2VSYA 4KBQA 1XQHA 4QEPA 2KCLA 3MKRA 5KJNA 3URZA 2XEVA 4WUYA 4U04A 2WPVA 4JL0A 4AY5A 3OPEA 2XPIA 5JJ0A 2LSUA 4N5CA 1IYGA 5FTPA 3M57A 3MV2B 4LEUA 3FWVA 4I9CA 2LSVA 4G24A 5JJTA 4J8DA 4G25A 3AS8A 3M55A 2C0MA 3CBPA 3LY9A 3DB5A 4QENA 5D0QD 4KXKB 5LCWC 2IFUA 3S7DA 5HI7A 1MUFA 2R3AA 5BNWA 2VGXB 5JJ7A 2YQ8A 2HO1A 1O9SA 2QFCA 3QWPA 4NQ0A 3Q47B 1ZBPA 3TG4A 3SWCA 2R5SA 3SF4A 4J8FA 4JLGA 2XGMA 1MVHA 2W5ZA 2GW1A 4LDGA 4E47A 4KYOB 3Q5MA 3U3WA 2IGQA 3GYZA 2PZIA 4GA2A 4BWRA 2UY1A 4AY6A 4NVQA 4G23A 4W9RA 3CV0A 2PL2A 4XI0A 5EX0A 4J8EA 3OXGA 1N6CA 4JA7A 4GCOA 4GYWA 4HOSA 3LCAA 3QKYA 3CKBA 3S7JA 2KCVA 2QPWA 3VTXA 4EQFA 4GZ3A 5DBKA 5G04J 3SW9A 3GZ1A 4N2SA 5KJKA 5JIYA 1A17A 5FJYA 3UPVA 4N3BA 3RJVA 3GW4A 3K9IA 4GA1A 4CGWA 2XCCA 2UWJG 3OXFA 5FZQA 1PEGA 4IJDA 5M72A 5G05J 3HNAA 4RG6A 3M5AA 4G2VA 3F9XA 3NF1A 4N3AA 1Y8MA 3ZHEA 2O8JA 3K5KA 3IEGA 5D0OD 3KMTA 4IJ8A 4JA9A 2W5YA 3Q4AB 2J9QA 4N2QA 1W3BA 1H3IA 1ZU2A 5EG2A 3OS5A 4NRHB 3HYMB 1MT6A 2BQZA 2I6HA 1P5QA 3GZ2A 5AYWD 3LPZA 4J7FA 5LSXA 5CCLA 3S7FA 1ELRA 3Q15A 5AYFA 4I2ZA 5G05C 4G1TA 4YNMA 2C2LA 4N3CA 2PQRA 2Q7FA 1ELWA 4JHRA 3CBMA 3VV0A 3ZHEB 5F6KC 4GPKA 3U4TA 2BUGA 4YVOA 4GA0A 5BW8C 4U0ZA 2HYZA 2FBNA 5HQ8A 5ARGA 3FP3A
chains in the Genus database with same CATH superfamily
3RRMB 3EP0A 4O1OA 3ZKJA 2P9SG 1PC2A 4EECA 4DX1A 4F53A 4U0SA 3SZ7A 1QYMA 3LYAA 2LXLA 4A55A 4WWOA 3PS6A 4BT9A 4YPAA 2EIJE 4H7XA 3AU5A 1OWMA 3V31A 4U8HA 4U95D 5F6LA 3MO0A 1KZPA 2OEWA 2YHEA 3MA5A 4A3VA 3ULQA 1IHBA 1E90A 3B95A 4F6RD 1N4SA 3Q75A 3RO2A 4YDEA 1NA3A 4FC8A 2DBAA 4I1MA 3BQOA 2IEJA 4FJZA 4F1PA 3Q79A 4K5BA 3FTYA 2HR2A 4ZFHA 4ME2A 3LY8A 3J5PA 3PDNA 2JEKA 1X5BA 4J83A 3CR3A 1MYOA 2KZTA 5AQ9A 1OXJA 3R9AB 4H12A 2OOEA 3RKVA 5ANLA 3QAQA 3QWWA 3KAEA 5AJDA 5ENRD 1E7VA 4DX5D 4IN3B 4BY6A 1WAO1 3BG0B 5JJ6A 2FF4A 4PDXA 3Q73A 4GTRA 5T4YA 4BSXA 3CHMA 4LUNU 4HNAD 3L13A 1LD7A 2I1KA 1E8ZA 4CGVA 5EX3A 1N3JA 3FH8A 3M58A 3S7BA 5LP0A 3UUXA 2V4HC 1TJCA 3M54A 1H6PA 3VTYA 4HOUA 3IV0A 4U63A 4K5CA 2H6GA 3ESKA 1MJ0A 4CDNA 3Q49B 2OV8A 5ENTD 4AU7A 3ABLE 3CVLA 3MEKA 4PH4B 4GTMA 3CSTA 3ULEG 4HB5A 2KM4A 3D9NA 3UM3A 2WXQA 3TWTA 2P9UG 3PRZA 3ASHA 3FTVA 3D9LA 4JDSA 5C2YA 3ZYMA 1WM5A 3I4RB 4JW1A 4LCTA 5TEGA 5DIZA 3C3OA 3HDXA 1L5JA 3ZXSA 2WXKA 5TTFA 5A6CA 3ZPJA 1H6OA 2QY7A 3IHVA 3FEXA 2M63A 3PE3A 5T5GA 1TNZA 3BEEA 3U9WA 5D66A 4I6EA 4GMLA 4DUIA 2ONDA 2XENA 4LSZE 4CDMA 1E8XA 3ZYLA 3JQ1A 4NJ5A 3VUZA 2R59A 4UQZA 3R7QA 2VQ2A 3CVYA 5AQ7A 4ACKA 3D9OA 3TWRA 2XPZA 4I17A 3ASOE 2EQXA 3FTUA 3FTWA 3SBTB 3DSSA 2B0OE 2PQNA 3QC1A 2KXPC 3FHEA 1N9AA 3CVVA 2H6FA 3G2SA 3QWVA 4QQIA 3BO5A 3CHQA 1H2VC 3CIAA 4BSZB 2KZTB 4WNFA 4CYMD 4APFA 3SBSA 5LCWJ 5CRUA 2NXPA 2VGXA 4FJYA 4KBQA 1XQHA 3E32A 1SZ9A 3UX4A 4XE0A 4MS6A 5ENQD 2WPVA 4AY5A 4GTSA 5JJ0A 3V2OA 2OVBA 3ML9A 2X6FA 2ZIRA 3V30A 3MV2B 3FUEA 2LSVA 3T8KA 5E76A 3M55A 3HRAA 4KXKB 2MOWA 3DPYA 4Q94A 3JXIA 4XKCA 2QFCA 3IBEA 1ZBPA 2R5SA 1JCRA 3ZRHA 3L9TA 3DSUA 4KYOB 2BF0X 4A1GA 2IGQA 5CMWA 4DRXE 2UY1A 4AY6A 3CSFA 4J8EA 5AN8A 1K1BA 1N6CA 3PNLB 4GCOA 3I5PA 3D9KA 2LAIA 3QKYA 3PUKA 1TNBA 3VLFA 1GW6A 3CHSA 3PH0C 5FJYA 1BI7B 3K9IA 4CGWA 2DZNA 3B7BA 2GRPB 5G05J 3M5AA 4BX8A 1MHQA 3ENEA 3F9XA 3NF1A 2XHEA 3ISMC 3RRNB 4N3AA 3ZHEA 3CVUA 5D0OD 1N4QA 2R05A 5EN5D 2W5YA 2J9QA 5BUZA 5H7PA 4NIKA 1H3IA 1ZU2A 4KMOA 5EG2A 4NRHB 4RSYA 3HYMB 4J8YA 2J49A 4KVOA 5AYWD 4J7FA 3S7FA 3W9FA 4FHJA 3BU8A 1Q2ZA 4BX9A 3PNTB 3AU4A 3DXMG 4YNMA 3CQCB 4TXRA 1DVPA 1NFIE 3VLDA 3SI5A 2F8YA 3AAAC 2FBNA 2WMOA 5B1AE 1OCCE 3IXEA 1IHGA 3DALA 3F9WA 3R7RA 5AQBA 4L7TA 4DX2A 3CK7A 2ILRA 3SNXA 5AENA 1FPPA 4TRQA 2WMNA 3HXDA 3CVQA 3JYSA 5ENPD 3HG0D 3SQVA 3HXCA 3SY2A 4RZ0A 4FA6A 5JHBA 4JC8A 1XGWA 4ZHBA 3APCA 3E37A 1K1AA 2XGSA 3AG2E 4ANWA 1HXIA 1S64A 4GTPA 3JUIA 1EPUA 4TXQA 2QYJA 3CEQA 3HHMA 4J0UA 2AWIA 1HE8A 1ZB1A 3M59A 2WXLA 4UUCA 4UI9K 3AS5A 4GTVA 3MYVA 4UQYA 4GB9A 1S70B 3FU6A 5EIBE 3UIOC 2GROB 5KWDA 2Y69E 3KMJA 3TXMA 4JEUA 1NA0A 3FDHA 5JINA 2QYUA 2ZGDA 2F8XK 2UY1B 1N0RA 1HS6A 5D2MC 2MRIA 1TEZA 2GGFA 2P58C 1O1RA 4I9EA 2GRQB 2KBXA 1UN9A 4GPMA 3U66A 2YNQA 2FO7A 1DC2A 4YPUA 2IO2C 3DSWA 5FZRA 2XGOA 3UM2A 2IJGX 3OAWA 2E2EA 3G2VA 4N39A 5FQ8A 2NYJA 3CKCA 3B7RL 4PUCA 2F69A 2L0IA 1QQEA 3AJIA 3ASGA 3M53A 2DYSE 1H2UA 2V8SE 2RD0A 1DCQA 3P1UA 5JMND 3J5QB 3LY7A 3LKUA 2WVIA 3CBOA 3RQ4A 4V3IA 3E33A 5CHEE 2X6KA 3WXXA 3UKUG 4NACA 1U2VG 2IU1A 4CZ2D 4MI0A 1JWGA 3MKQA 4PS7A 1S0PA 4J7WA 3RJWA 3TL5A 4HORA 3AG1E 2VGEA 5TH7A 4GTQA 3FUFA 4I1AA 3APDA 3CK8A 4ATGA 4K0RA 4U96D 2CHZA 4FMUA 1FT1A 3LJ3A 3ZW3A 2AXZA 4J6IA 3NZUA 2XCBA 1N4RA 3R9MA 2IF4A 4NURA 4IRUA 2WXNA 4Q69A 1Z5SC 1SVXA 3TWXA 2IOSA 2VSNA 3ZN3A 4HVBA 5KCMA 4O60A 3CVXA 3T8MA 2EILE 4BESA 4DK5A 4TUUA 5HKPA 3AG3E 3FTZA 1TYQG 3FU5A 3MV3B 3EDTB 4OVVA 1RW2A 2X3MA 2P2CP 4CT0A 4QEOA 5HRYA 4FHKA 4C48B 4RQIA 2AVPA 5AARA 2AXUA 2I2OA 3HXFA 3TG5A 4E6HA 3KMAA 3JQ0A 4EBAG 2X6JA 4UI9C 4JD2G 2LNIA 1EYHA 4LNUD 3BG1B 3F9YA 4F1SA 1OWOA 4DLOA 3MJWA 4JHJA 3WG7E 4LNBA 5LSZA 5EYLA 1NL4A 2BTDA 5LFAA 1OWNA 1Z6TA 1ML9A 3CQGB 4KZCA 5G04C 5C1DA 2BKKB 4YNDA 4CCAA 5KJLA 3T9KA 3TJPA 2KCLA 4PS8A 5KJNA 4L2YA 3URZA 4EZKA 3O4ZA 4Q96A 4WUYA 4U04A 3ONLA 3OPEA 1LTXA 2IY0C 4MKTA 3NAWA 1OT8A 5LOZA 4C9BB 4N5CA 3E34A 5FTPA 3M57A 3B7UX 5BPPA 3FWVA 4JXTA 1MX4A 1O1TA 3AS8A 5ENSD 4HFGA 2VSXE 1PAQA 3LY9A 2VJ8A 5D0QD 1D8EA 5FQ4A 1N94A 3LXUX 2IFUA 3FEYA 3S7DA 5HI7A 3SO8A 1MUFA 2R3AA 3DSVA 3FTXA 4NQ0A 4IULA 3APFA 3SF4A 5CECB 3UT4A 4ANUA 2V4LA 2W5ZA 3Q5MA 3U3WA 1MX2A 5G55A 4BWRA 5A23A 4G23A 4CRWA 4JEHA 3CV0A 2PL2A 4OAVB 3OXGA 4JA7A 3CLJA 4HOSA 3MKQB 1YMPA 3PEUB 2J4BA 2VSOE 5BXOA 2QPWA 2Y3AA 3SW9A 3MX3A 3GZ1A 5AQAA 5KJKA 5JIYA 4HRNA 4XZ4A 3RJVA 3GW4A 2XCCA 5FZQA 4DJAA 1PEGA 4IJDA 4XEIG 3L6AA 1OY3D 3C5RA 4C0EA 1OWPA 1DCEA 3KSLA 1Y8MA 4GMJA 4BERA 2O8JA 1O5MA 3LDZA 3FH5A 4JA9A 4AEZC 1MT6A 4AP2A 1P5QA 2XEHA 3C72A 1JPLA 3DEPA 4HLEA 3LPZA 2ETCA 3Q15A 4EBAA 3Q7AA 3T5VA 4MBGA 3EHMA 2WM9A 4JZYA 2PQRA 4ILHB 1MQSA 3ZXPA 4CEMA 3FUDA 4YVOA 4GA0A 4K5AB 5BW8C 3G2WA 5T3RA 3ZEFA 4UWGA 2CFZA 3FP3A 4LG6A 3QARA 3PZDA 4AVXA 3KS2A 1SW6A 4GZ5A 4EHMA 1UJJA 2XQ0A 4HOQA 2B6CA 3MGBA 5EDSA 3UT8A 5KBAA 2R2LA 2RFAA 3DEOA 4MLPA 2GRRB 2BEDA 3FUNA 4JHKA 2L6BA 3UIPC 5CCMA 2R02A 3M56A 3MO2A 5B3SE 2DYRE 2RFMA 4GYOA 4LNGA 1WG0A 4GCNA 2RKKA 4B8AA 2P9IG 2WXMA 4UWKA 2ZU6B 4D10C 4UWFA 2C0LA 3HVEB 3KSQA 1KZOA 1H19A 2FO1E 2XS8A 4WWPA 4Y6CA 4BUPA 3G2TA 4O30A 2X6HA 4BT8A 5B1BE 1EDUA 3FUKA 1H6KA 3FUHA 5BV0A 3PZ3A 3CK9A 4JB8P 4J8SA 4WNEA 3SFXA 1JWFA 3CVNA 4AM9A 3UQ3A 4K03A 4KZ0A 2Y0BG 4WWNA 1E8WA 4YNPA 1OCRE 1DNPA 4RVBA 4AJWA 2G46A 1E7UA 2CFUA 1UG3A 5JHNA 3C98A 4R7LA 2LUHA 1HZ4A 3OXLA 5LX8A 2F37A 2E0IA 2P9PG 3RAUA 3CHOA 4M3OA 4AIFA 1Y6IA 2WXJA 4BEPA 3TWVA 3RK6A 1YCSB 4PS3A 2GRLA 2FI7A 4GZ6A 3VLEA 4P29A 3FFLA 2J08A 4DLQA 3FPDA 4YPEA 3ASDA 3N71A 2RG8A 2XEEA 3L17A 2LXMA 4I1OB 1UJKA 2DVWA 4CDRA 1TN6A 4RG9A 3CVPA 1E96B 3D3MA 4C1QA 3ZFWA 1SA4A 3SD5A 4HBDA 5CEDB 3RAYA 5CBNA 5KNHD 1IQUA 1N52A 2F0YA 5FIOA 2Y4TA 1X81A 2MHKA 4Y6WA 1V55E 4UI9J 3UKRG 1IQRA 3RO3A 3TAXA 4A1SA 4U07A 3ZYQA 3UXGA 3IHXA 4RLYA 4HXIA 2JLBA 4L2LA 4EPZA 5J90A 1VDYA 5F59A 4G26A 4O1PA 3AG4E 4B0ZA 1NZNA 2WQ6A 4N5QA 4KVMA 4B8CB 2H6IA 5FWQA 1QNFA 5CMYA 1KT1A 4G11A 5F5EA 1AWCB 2VGYA 2CG2A 1N54A 5EKQD 2JV0A 3SHFA 4Z4PA 3D9IA 2YHCA 2KC7A 3L16A 3SFZA 4GAAA 5ARFA 2ETAA 4G8LA 3QNKA 4AOFA 4AXHA 5ANRA 1KT0A 1Z3YA 5BT1A 3CHRA 4MI5A 3NZSA 2IONA 4HRLA 1H2TC 2WB2A 3C3QA 4B93B 4F3VA 2HM8A 3KD7A 2V5FA 3MO5A 1MVXA 2QC9A 3JXJA 2CG3A 2WXGA 3MKRA 2X6IA 2AXVA 4B89A 2H6HA 4WAFA 4ANVA 1FT2A 4OYSA 1HO8A 2XEVA 4YDOA 1Z3XA 2JABA 2XPIA 2LSUA 5ENOD 1SQMA 1IYGA 4GTOA 4LEUA 2C0MA 3CBPA 3DB5A 3ZYKA 3PVLA 1OCZE 2EIME 3BUAA 5BNWA 1LD8A 3UI2A 2YQ8A 1O9SA 2BKGA 3NQPA 1S63A 2OCCE 1HFAA 3FU3A 1MVHA 4TUMA 3F6QA 2GRNB 2IOLA 1BU9A 3GYZA 4GZDA 3NBNB 3V79K 2ETBA 2PZIA 4GA2A 4NVQA 4W9RA 5EX0A 3EHRA 4GYWA 3ZIMA 5AIJA 2L9BA 2A5EA 2VTBA 5DBKA 5HS0A 1BLXB 2PM7A 4FLBA 1A17A 3UPVA 4I43A 4GA1A 3OXFA 5AAOA 1SZAA 4ILIA 1JUQA 3FY4A 3DXKG 3HNAA 1N11A 4G2VA 4XX5A 3ESLA 3EJNA 5CBOA 5ITZF 3K5KA 3IEGA 4YDWA 1H0AA 3KMTA 2V5QC 4N2QA 4KT6B 3GZ2A 3Q7FA 3T5XA 3DPDA 2ZGGA 5AYFA 2DWZA 5CEAA 3B13A 1TN7A 3B7TA 3I3NA 5FINA 2Q7FA 4JHRA 3I4GA 3CGHA 4GPKA 3U4TA 3UTMA 3PZ4A 2DZOA 1UOHA 3DBSA 3L08A 5HQ8A 1K8KG 3ULYA 5J08A 4G8KA 2ZISA 4M7CA 1NI1A 1N95A 3HVEA 4L23A 1B89A 3DWLG 3ZU7B 2IO3C 4B94A 2EINE 4J7IA 3HIZA 4UQXA 5FT9A 3G2UA 1OUVA 1MZCA 1K3ZD 2XZTG 5E75A 3PZ2A 3PE4A 3L22A 4ANXA 1U3DA 5G2NA 3SGHA 2ZXWE 1RZ4A 4BTBA 3TGOA 5CERB 3UM1A 1UW4B 3S8PA 3FH7A 1HH8A 4GU5A 2V0PA 5CRVA 5EIDA 1NP7A 3ABME 1IXVA 4HI9A 4CT4A 4BTAA 3TWQA 4DPRA 4HS2A 3DSXA 3FUJA 4APOA 1TNYA 1O1SA 1HX8A 3F9ZA 1OWLA 5KJMA 2P9LG 1HG2A 2P9KG 1SA5A 3V2XA 3AS4A 2AW6A 4E85A 2WQ7A 3MCXA 4U0UA 1FVHA 1V54E 3O48A 1AP7A 4L1BA 3QDNA 2VTBB 3FUIA 1D9SA 4ILGA 3UMVA 1KLXA 3P2BA 1D8DA 4ATZD 3U64A 2DIWA 3DSTA 1WDYA 3EHNA 4MRUA 5FQ7A 3ZNGA 2XS1A 4H7YA 4I51A 1TN8A 3NOCD 5ENNA 2A5UA 3RU0A 3LJNA 3ZUVB 5BXUA 3UM0A 2X38A 4L9PA 4C0MA 5CPRB 5FZSA 4FADA 4DX7D 4O6FA 3ASFA 4J8OA 1ZKKA 4U7EB 3D9JA 1TNOA 4XI9A 4EZLA 2NSZA 4GYYA 4OVUA 3EU9A 3HXEA 4LRZA 3QOUA 3GZSA 2DCPA 1BPOA 4HOTA 3ZGQA 2Y1LE 3PEVB 4JVSA 4EZJA 2GRMA 2HE0A 1N6AA 2WQHA 3Q9UC 1FCHA 1N4PA 4FULA 4ACLA 5T0MA 3PUJA 2WXHA 5BV1A 2XPYA 1PY1A 1YYHA 5T0KA 3UT7A 4TV3A 1BD8A 1IKND 3EIJA 3DRAA 4GMRA 1YA0A 1XNFA 4WNGA 3ASNE 5AJLA 3HXBA 2Y4UA 3Q78A 3FU0A 4Z68A 3EUVA 2KATA 1EF1C 2CHWA 3KEZA 1JCSA 3KEAA 3OTNA 2PM6A 2WXOA 3E4BA 5EYPF 4XIFA 3OOIA 4I6GA 3FTSA 5A7DB 3TWSA 5IY5E 1UN8A 2KCKA 5EILA 1QZ2A 3MZLB 5JA4D 3RIBA 4GZCA 2WXRA 4ABNA 1FVFA 2NC9A 3L54A 1OCOE 2FEZA 4HQDA 2VYIA 4HLLA 2RFIA 3UINC 1E8YA 5FQ6A 2WXIA 2XZDG 4WNDA 2QZAA 3EU5A 3Q9NC 4UWLA 2L6JA 3D9HA 2WXPA 1KPSB 2R03A 4I2WA 3S2AA 4YVQC 3FUMA 2R17C 3CHPA 2VSYA 3TWUA 4QEPA 3ML8A 4AV7A 3IHYA 3LEWA 4FP7A 4JL0A 4DX6D 3PZ1A 3QJZA 3RRUA 2WXFA 2PNNA 5T8IA 3D9PA 2I1JA 4BFRA 1QBQA 4I9CA 1G3NB 4G24A 2EIKE 5JJTA 4J8DA 4G25A 1HU3A 4GTTA 4QENA 4XKBA 5LCWC 4A63B 2J09A 3EHQA 2J07A 2CHXA 2OEVA 2VGXB 5JJ7A 2HO1A 3QWPA 3Q47B 3ONKA 3TG4A 3SWCA 4J8FA 4HI8A 2XGMA 4JLGA 3B7SA 5KNGA 2GW1A 4LDGA 3IKOB 4E47A 3D9MA 3NOGD 1TR4A 4FU3A 4LERA 3L82A 1HF8A 1U3CA 3ABKE 4XI0A 4I6JA 3NB2A 2YINA 4U8YD 3LS8A 3LCAA 2LO6A 3CKBA 3S7JA 4QFVA 3EIQC 4F7AA 2KCVA 1A5EA 1LF8A 3VTXA 4EQFA 4OAUC 3W9GA 2LAHA 2IQCA 1N0QA 2A4ZA 4GZ3A 5G04J 3E30A 1BI8B 4JPSA 4N2SA 2MYOA 4N3BA 3JCKC 2UWJG 1INZA 4DI4A 5M72A 3TXNA 4RG6A 3SFYA 2XRYA 2J4DA 3QK0A 3FULA 3ZVVA 3QB2A 3LVQE 4UWHA 4IJ8A 3Q4AB 1W3BA 4A3TA 4FLHA 3OS5A 4YDYA 2BQZA 2I6HA 1TJFA 2AJAA 3TWWA 3LVRE 1MX6A 5LSXA 5CCLA 4TXPA 1JCQA 1ELRA 4BETA 3RSEG 3X2QE 4I2ZA 5G05C 4G1TA 2P9NG 3PREA 2J8SD 2L0TB 2C2LA 4N3CA 1ELWA 4IYPA 4U8VD 3JUEA 1WY6A 2XRZA 3CBMA 2FULA 3VV0A 1HG5A 3ZHEB 5F6KC 2BUGA 4HRMB 4X8QA 1ELKA 4U0ZA 3CVWA 2HYZA 2OVFA 4DI3A 4URKA 2I9CA 1TNUA 3C3RA 5ARGA 5JHAA
chains in the Genus database with same CATH topology
5J08A 3RRMB 3QARA 1IHGA 3DALA 3EP0A 3F9WA 3PZDA 3R7RA 4AVXA 3KS2A 1PC2A 4L7TA 4EECA 3HVEA 4GZ5A 4L23A 1B89A 1UJJA 2XQ0A 4HOQA 3CK7A 2ILRA 3MGBA 4U0SA 4F53A 5EDSA 3UT8A 3SNXA 3SZ7A 5AENA 4B94A 4TRQA 3LYAA 4A55A 4J7IA 2WMNA 4WWOA 3PS6A 4BT9A 3HIZA 4YPAA 4UQXA 3CVQA 3JYSA 4MLPA 5FT9A 4H7XA 3FUNA 3AU5A 4JHKA 3G2UA 4RZ0A 1OUVA 4FA6A 5JHBA 4JC8A 1XGWA 5CCMA 5E75A 1OWMA 3APCA 3M56A 3MO2A 4U8HA 3PE4A 2XGSA 3L22A 4ANXA 4ANWA 1U3DA 5G2NA 5F6LA 3SGHA 1HXIA 4GYOA 3MO0A 4GCNA 3JUIA 1EPUA 2YHEA 4BTBA 4B8AA 3TGOA 3CEQA 3HHMA 3MA5A 4A3VA 3ULQA 4J0UA 1E90A 2WXMA 2AWIA 1HE8A 1UW4B 3S8PA 4UWKA 3M59A 3FH7A 1HH8A 2ZU6B 4GU5A 4D10C 2V0PA 4UWFA 3RO2A 2C0LA 2WXLA 1NA3A 4FC8A 3HVEB 3AS5A 2DBAA 4UI9K 4I1MA 1NP7A 4FJZA 1H19A 3MYVA 4UQYA 4GB9A 4CT4A 4WWPA 4BTAA 3FU6A 4Y6CA 4DPRA 4BUPA 3FTYA 2HR2A 4HS2A 3G2TA 4O30A 2X6HA 4BT8A 3FUJA 4APOA 3KMJA 1HX8A 3F9ZA 4ME2A 1EDUA 3FUKA 3LY8A 1OWLA 1H6KA 3PDNA 3FUHA 5BV0A 5KJMA 3TXMA 2JEKA 4JEUA 1X5BA 4J83A 3CK9A 1NA0A 3CR3A 3FDHA 1HG2A 5JINA 4J8SA 2KZTA 2UY1B 4WNEA 3AS4A 2AW6A 4E85A 2WQ7A 1JWFA 3CVNA 3MCXA 1HS6A 4AM9A 2MRIA 4K03A 1FVHA 4U0UA 3UQ3A 3R9AB 4KZ0A 1TEZA 4H12A 2OOEA 3RKVA 3O48A 4WWNA 4L1BA 5ANLA 1E8WA 2GGFA 3QDNA 3QAQA 3QWWA 2P58C 3KAEA 2VTBB 3FUIA 4YNPA 5AJDA 4ILGA 1E7VA 1DNPA 1KLXA 4IN3B 4I9EA 3UMVA 4RVBA 4BY6A 1WAO1 3BG0B 4AJWA 2G46A 1E7UA 5JJ6A 3P2BA 2CFUA 1UG3A 1UN9A 5JHNA 3C98A 2FF4A 4R7LA 3U66A 4PDXA 1HZ4A 3U64A 2DIWA 2YNQA 3OXLA 5LX8A 2FO7A 4YPUA 2E0IA 3EHNA 4MRUA 5T4YA 5FZRA 4BSXA 2XGOA 2IJGX 3CHMA 3OAWA 4LUNU 2E2EA 3G2VA 4N39A 3CHOA 4M3OA 5FQ7A 5FQ8A 4H7YA 4AIFA 1Y6IA 4I51A 3L13A 2I1KA 1E8ZA 3CKCA 4CGVA 3B7RL 5EX3A 4PUCA 1N3JA 5ENNA 2A5UA 2F69A 2WXJA 3RU0A 2L0IA 1QQEA 3FH8A 3ASGA 3M53A 2X38A 4C0MA 5CPRB 3RK6A 3M58A 3S7BA 1H2UA 2V8SE 5FZSA 4FADA 2RD0A 3UUXA 5LP0A 4PS3A 2GRLA 2FI7A 4GZ6A 4O6FA 3ASFA 1TJCA 3P1UA 4J8OA 3VLEA 1ZKKA 3LY7A 3M54A 4P29A 3FFLA 2J08A 3D9JA 3LKUA 2WVIA 3VTYA 4DLQA 4XI9A 4HOUA 3IV0A 4EZLA 3CBOA 3RQ4A 4U63A 3FPDA 4YPEA 4V3IA 3ESKA 3ASDA 4CDNA 2NSZA 3N71A 3Q49B 4GYYA 2OV8A 2RG8A 3L17A 4OVUA 5CHEE 2X6KA 4LRZA 4I1OB 3CVLA 3MEKA 4PH4B 4AU7A 3QOUA 1UJKA 3WXXA 4CDRA 3GZSA 3CSTA 2DCPA 4NACA 1BPOA 2IU1A 4RG9A 4MI0A 4HOTA 1JWGA 3MKQA 4PS7A 3ZGQA 1S0PA 3PEVB 2KM4A 4JVSA 3CVPA 2GRMA 4EZJA 1E96B 3RJWA 3TL5A 4HORA 1N6AA 3D9NA 5TH7A 3D3MA 4C1QA 2WQHA 3FUFA 3ZFWA 4I1AA 3SD5A 1FCHA 3APDA 3CK8A 4ATGA 4K0RA 4FULA 2WXQA 4ACLA 2CHZA 5T0MA 3PUJA 4FMUA 2WXHA 3LJ3A 5BV1A 3ZW3A 2XPYA 1PY1A 2AXZA 3RAYA 3PRZA 3NZUA 4J6IA 3ASHA 3FTVA 3UT7A 5T0KA 4TV3A 1IQUA 2XCBA 3D9LA 5C2YA 4JDSA 3EIJA 2IF4A 1WM5A 3ZYMA 1YA0A 1N52A 4NURA 1XNFA 3I4RB 4IRUA 4JW1A 2WXNA 4WNGA 2Y4TA 4Q69A 4LCTA 5TEGA 5AJLA 2Y4UA 2MHKA 4Y6WA 3FU0A 5DIZA 4UI9J 3HDXA 2IOSA 2VSNA 3ZN3A 1L5JA 4HVBA 1IQRA 3RO3A 3TAXA 4A1SA 3ZXSA 2WXKA 2KATA 5KCMA 4U07A 3ZYQA 5TTFA 1EF1C 2CHWA 3KEZA 3CVXA 5A6CA 3T8MA 3ZPJA 4DK5A 4TUUA 3IHXA 2QY7A 3IHVA 4HXIA 3FEXA 2JLBA 2M63A 3FTZA 4L2LA 3PE3A 3OTNA 2PM6A 3FU5A 3MV3B 5T5GA 4EPZA 5J90A 1VDYA 2WXOA 3BEEA 3EDTB 5F59A 3E4BA 4OVVA 3U9WA 4I6EA 4G26A 2X3MA 4GMLA 4B0ZA 2ONDA 1NZNA 4CT0A 2WQ6A 4QEOA 4CDMA 4KVMA 4B8CB 5FWQA 4FHKA 4XIFA 3OOIA 1QNFA 1E8XA 4I6GA 5CMYA 3FTSA 3ZYLA 2AVPA 5A7DB 3JQ1A 1KT1A 4G11A 4NJ5A 3VUZA 2AXUA 2I2OA 2R59A 5F5EA 4UQZA 2VGYA 1UN8A 2CG2A 3TG5A 2KCKA 3R7QA 4E6HA 1N54A 2VQ2A 5EKQD 1QZ2A 3SHFA 3CVYA 4ACKA 2JV0A 3KMAA 4Z4PA 3D9IA 2YHCA 2KC7A 3MZLB 3RIBA 3D9OA 3JQ0A 3L16A 4EBAG 2XPZA 4I17A 2X6JA 3SFZA 4UI9C 2EQXA 2LNIA 4GZCA 3FTUA 4GAAA 1EYHA 5ARFA 2WXRA 3BG1B 3FTWA 3SBTB 3F9YA 4F1SA 1OWOA 4DLOA 3MJWA 2PQNA 3QNKA 4AOFA 4JHJA 4AXHA 3QC1A 5ANRA 4ABNA 1FVFA 1KT0A 5LSZA 3FHEA 2NC9A 1Z3YA 3L54A 5BT1A 3CVVA 3CHRA 4MI5A 3NZSA 2IONA 3G2SA 2FEZA 2BTDA 3QWVA 2VYIA 1H2TC 5LFAA 1OWNA 1Z6TA 2RFIA 2WB2A 3BO5A 1E8YA 3CHQA 1ML9A 1H2VC 5FQ6A 2WXIA 3CQGB 4WNDA 4F3VA 3CIAA 4KZCA 5G04C 4UWLA 2L6JA 5C1DA 2HM8A 2WXPA 2KZTB 4WNFA 4YNDA 3KD7A 2V5FA 4I2WA 3S2AA 4APFA 3SBSA 3MO5A 1MVXA 5LCWJ 4YVQC 3FUMA 4CCAA 5KJLA 2NXPA 2VGXA 2R17C 2CG3A 3CHPA 2WXGA 2VSYA 4FJYA 4KBQA 1XQHA 4QEPA 3ML8A 3TJPA 2KCLA 3MKRA 4PS8A 5KJNA 4L2YA 4AV7A 2X6IA 1SZ9A 2AXVA 4WAFA 4ANVA 4B89A 3IHYA 4OYSA 3UX4A 4XE0A 3URZA 1HO8A 2XEVA 3LEWA 4MS6A 4EZKA 3O4ZA 4Q96A 4WUYA 4FP7A 4U04A 2WPVA 4JL0A 4AY5A 3ONLA 3OPEA 1Z3XA 2XPIA 5JJ0A 2LSUA 4MKTA 3QJZA 3RRUA 2WXFA 5LOZA 1SQMA 2OVBA 3ML9A 4N5CA 5T8IA 2X6FA 4C9BB 1IYGA 5FTPA 3D9PA 3M57A 2I1JA 3MV2B 3B7UX 5BPPA 4LEUA 4BFRA 3FWVA 3FUEA 4I9CA 2LSVA 4JXTA 4G24A 5JJTA 4J8DA 4G25A 1HU3A 3AS8A 5E76A 3M55A 2C0MA 4HFGA 2VSXE 3CBPA 1PAQA 3LY9A 2VJ8A 3DB5A 4QENA 5D0QD 3ZYKA 3PVLA 4KXKB 4XKBA 5LCWC 2MOWA 5FQ4A 3LXUX 2J09A 2IFUA 3FEYA 3S7DA 2J07A 2CHXA 5HI7A 1MUFA 2R3AA 5BNWA 2VGXB 5JJ7A 2YQ8A 2HO1A 4Q94A 1O9SA 4XKCA 2QFCA 3FTXA 3QWPA 4IULA 3IBEA 3APFA 1ZBPA 3ONKA 3Q47B 4NQ0A 3NQPA 3TG4A 3SWCA 1HFAA 2R5SA 3FU3A 3SF4A 4J8FA 3UT4A 2XGMA 1MVHA 4JLGA 3ZRHA 4ANUA 3B7SA 2V4LA 2W5ZA 2GW1A 4LDGA 3IKOB 4E47A 4KYOB 2BF0X 3Q5MA 3U3WA 3D9MA 4A1GA 2IGQA 2IOLA 3GYZA 4GZDA 4FU3A 5CMWA 5G55A 4LERA 2PZIA 4GA2A 4BWRA 2UY1A 5A23A 4AY6A 4NVQA 4G23A 4CRWA 1HF8A 1U3CA 4JEHA 4W9RA 3CV0A 2PL2A 3CSFA 4XI0A 4I6JA 5EX0A 4J8EA 3OXGA 1N6CA 3PNLB 4JA7A 2YINA 4GCOA 3I5PA 3CLJA 4GYWA 3ZIMA 4HOSA 3D9KA 3LS8A 3LCAA 3MKQB 2LO6A 5AIJA 2LAIA 2L9BA 3PEUB 3QKYA 3CKBA 3S7JA 4QFVA 2J4BA 2VSOE 3EIQC 3PUKA 4F7AA 2KCVA 2VTBA 2QPWA 1LF8A 3VTXA 4EQFA 2LAHA 2IQCA 2A4ZA 2Y3AA 4GZ3A 5DBKA 5G04J 3SW9A 3MX3A 3VLFA 1GW6A 3CHSA 4JPSA 3GZ1A 2PM7A 3PH0C 5KJKA 4N2SA 4FLBA 5JIYA 1A17A 5FJYA 3UPVA 4I43A 4N3BA 4XZ4A 3RJVA 3GW4A 3K9IA 4GA1A 4CGWA 2XCCA 3JCKC 2UWJG 3OXFA 1INZA 5FZQA 4DJAA 1SZAA 4ILIA 1PEGA 4IJDA 1JUQA 3L6AA 4DI4A 5M72A 3TXNA 3FY4A 5G05J 4C0EA 3HNAA 4RG6A 3M5AA 4G2VA 4BX8A 1MHQA 3ENEA 3F9XA 1OWPA 2XRYA 3NF1A 4XX5A 2XHEA 3ESLA 2J4DA 3QK0A 3FULA 3RRNB 4N3AA 1Y8MA 4GMJA 3QB2A 3ZVVA 3EJNA 3ZHEA 3CVUA 2O8JA 3K5KA 3IEGA 3LVQE 4UWHA 1H0AA 3LDZA 5D0OD 3KMTA 3FH5A 4IJ8A 4JA9A 2W5YA 3Q4AB 2J9QA 4N2QA 5BUZA 1W3BA 4A3TA 1H3IA 1ZU2A 4FLHA 4KMOA 5EG2A 4AEZC 4NRHB 4KT6B 3OS5A 4RSYA 3HYMB 1MT6A 2BQZA 2I6HA 4AP2A 2J49A 1P5QA 1TJFA 3GZ2A 4KVOA 5AYWD 1JPLA 3LVRE 4HLEA 3LPZA 4J7FA 5LSXA 5CCLA 3T5XA 3S7FA 1ELRA 3Q15A 4EBAA 4FHJA 3DPDA 3T5VA 3EHMA 5AYFA 4BX9A 4I2ZA 2WM9A 4JZYA 5G05C 3PNTB 3AU4A 3B13A 4G1TA 3B7TA 3I3NA 3PREA 4YNMA 2L0TB 2C2LA 2Q7FA 2PQRA 4ILHB 4N3CA 1ELWA 4IYPA 3CQCB 1MQSA 4JHRA 3I4GA 1WY6A 4CEMA 2XRZA 3FUDA 2FULA 3CBMA 3VV0A 1DVPA 1HG5A 3ZHEB 3CGHA 5F6KC 3VLDA 2BUGA 3U4TA 4YVOA 4GA0A 4GPKA 5BW8C 1ELKA 4U0ZA 3G2WA 5T3RA 3SI5A 3CVWA 3ZEFA 4UWGA 2HYZA 2OVFA 2FBNA 2WMOA 2I9CA 2CFZA 3DBSA 4DI3A 3L08A 4URKA 5HQ8A 5ARGA 3FP3A 5JHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EP0 A;  1IHG A;  3DAL A;  3F9W A;  3KS2 A;  1PC2 A;  4GZ5 A;  1B89 A;  4HOQ A;  3CK7 A;  4U0S A;  3SZ7 A;  4B94 A;  3LYA A;  4J7I A;  4BT9 A;  4YPA A;  4UQX A;  3CVQ A;  3JYS A;  5FT9 A;  4H7X A;  4RZ0 A;  1OUV A;  5CCM A;  3M56 A;  3MO2 A;  3PE4 A;  2XGS A;  5F6L A;  1HXI A;  4GYO A;  3MO0 A;  4GCN A;  4BTB A;  3TGO A;  3CEQ A;  3MA5 A;  3ULQ A;  4J0U A;  3S8P A;  3M59 A;  1HH8 A;  3RO2 A;  2C0L A;  1NA3 A;  4UI9 K;  3AS5 A;  2DBA A;  4UQY A;  4BTA A;  4Y6C A;  4BUP A;  2HR2 A;  4O30 A;  4BT8 A;  4APO A;  3KMJ A;  3F9Z A;  4ME2 A;  3LY8 A;  3PDN A;  5KJM A;  4J83 A;  3CK9 A;  1NA0 A;  5JIN A;  2UY1 B;  4WNE A;  3AS4 A;  3CVN A;  4AM9 A;  3UQ3 A;  4U0U A;  3R9A B;  4H12 A;  2OOE A;  3RKV A;  3O48 A;  3QDN A;  3QWW A;  2P58 C;  3KAE A;  4YNP A;  1KLX A;  4IN3 B;  4I9E A;  1WAO 1;  2G46 A;  5JJ6 A;  5JHN A;  2FF4 A;  1HZ4 A;  3OXL A;  2FO7 A;  4YPU A;  5FZR A;  2XGO A;  2E2E A;  4N39 A;  4H7Y A;  4AIF A;  4I51 A;  3CKC A;  4CGV A;  5EX3 A;  1N3J A;  2F69 A;  3RU0 A;  1QQE A;  3ASG A;  3M53 A;  5CPR B;  3M58 A;  3S7B A;  5FZS A;  3UUX A;  2FI7 A;  4GZ6 A;  4O6F A;  3ASF A;  1TJC A;  4J8O A;  1ZKK A;  3LY7 A;  3M54 A;  3FFL A;  3LKU A;  3VTY A;  4XI9 A;  4HOU A;  3CBO A;  3RQ4 A;  3FPD A;  4YPE A;  3ESK A;  3ASD A;  5CHE E;  3N71 A;  3Q49 B;  4GYY A;  4AU7 A;  3CVL A;  3MEK A;  3QOU A;  3WXX A;  4CDR A;  4RG9 A;  4MI0 A;  4HOT A;  3ZGQ A;  3CVP A;  1E96 B;  3RJW A;  4HOR A;  1N6A A;  5TH7 A;  4C1Q A;  2WQH A;  3ZFW A;  4I1A A;  1FCH A;  3CK8 A;  5T0M A;  4FMU A;  3RAY A;  3ASH A;  5T0K A;  4JDS A;  2XCB A;  2IF4 A;  1WM5 A;  1YA0 A;  1XNF A;  4WNG A;  2Y4T A;  5TEG A;  2Y4U A;  2MHK A;  4Y6W A;  5DIZ A;  4UI9 J;  3ZN3 A;  2VSN A;  3RO3 A;  3TAX A;  4A1S A;  2KAT A;  4U07 A;  5TTF A;  5A6C A;  3ZPJ A;  3IHX A;  2JLB A;  3PE3 A;  3MV3 B;  5T5G A;  3BEE A;  3EDT B;  5F59 A;  3E4B A;  4G26 A;  2OND A;  1NZN A;  4QEO A;  4XIF A;  3OOI A;  2AVP A;  5A7D B;  1KT1 A;  4NJ5 A;  3VUZ A;  5F5E A;  4UQZ A;  2VGY A;  3TG5 A;  2KCK A;  2VQ2 A;  5EKQ D;  2JV0 A;  1QZ2 A;  3KMA A;  4Z4P A;  2YHC A;  2KC7 A;  3RIB A;  4I17 A;  4UI9 C;  2LNI A;  5ARF A;  3F9Y A;  2PQN A;  4ABN A;  1KT0 A;  5LSZ A;  2NC9 A;  5BT1 A;  4MI5 A;  2FEZ A;  3QWV A;  2VYI A;  2RFI A;  3BO5 A;  1ML9 A;  4WND A;  4F3V A;  5G04 C;  2L6J A;  5C1D A;  4YND A;  4WNF A;  3KD7 A;  2V5F A;  4I2W A;  3MO5 A;  1MVX A;  5LCW J;  4YVQ C;  5KJL A;  2VGX A;  2VSY A;  4KBQ A;  1XQH A;  4QEP A;  2KCL A;  3MKR A;  5KJN A;  3URZ A;  2XEV A;  4WUY A;  4U04 A;  2WPV A;  4JL0 A;  4AY5 A;  3OPE A;  2XPI A;  5JJ0 A;  2LSU A;  4N5C A;  1IYG A;  5FTP A;  3M57 A;  3MV2 B;  4LEU A;  3FWV A;  4I9C A;  2LSV A;  4G24 A;  5JJT A;  4J8D A;  4G25 A;  3AS8 A;  3M55 A;  2C0M A;  3CBP A;  3LY9 A;  3DB5 A;  4QEN A;  5D0Q D;  4KXK B;  5LCW C;  2IFU A;  3S7D A;  5HI7 A;  1MUF A;  2R3A A;  5BNW A;  2VGX B;  5JJ7 A;  2YQ8 A;  2HO1 A;  1O9S A;  2QFC A;  3QWP A;  4NQ0 A;  3Q47 B;  1ZBP A;  3TG4 A;  3SWC A;  2R5S A;  3SF4 A;  4J8F A;  4JLG A;  2XGM A;  1MVH A;  2W5Z A;  2GW1 A;  4LDG A;  4E47 A;  4KYO B;  3Q5M A;  3U3W A;  2IGQ A;  3GYZ A;  2PZI A;  4GA2 A;  4BWR A;  2UY1 A;  4AY6 A;  4NVQ A;  4G23 A;  4W9R A;  3CV0 A;  2PL2 A;  4XI0 A;  5EX0 A;  4J8E A;  3OXG A;  1N6C A;  4JA7 A;  4GCO A;  4GYW A;  4HOS A;  3LCA A;  3QKY A;  3CKB A;  3S7J A;  2KCV A;  2QPW A;  3VTX A;  4EQF A;  4GZ3 A;  5DBK A;  5G04 J;  3SW9 A;  3GZ1 A;  4N2S A;  5KJK A;  5JIY A;  1A17 A;  5FJY A;  3UPV A;  4N3B A;  3RJV A;  3GW4 A;  3K9I A;  4GA1 A;  4CGW A;  2XCC A;  2UWJ G;  3OXF A;  5FZQ A;  1PEG A;  4IJD A;  5M72 A;  5G05 J;  3HNA A;  4RG6 A;  3M5A A;  4G2V A;  3F9X A;  3NF1 A;  4N3A A;  1Y8M A;  3ZHE A;  2O8J A;  3K5K A;  3IEG A;  5D0O D;  3KMT A;  4IJ8 A;  4JA9 A;  2W5Y A;  3Q4A B;  2J9Q A;  4N2Q A;  1W3B A;  1H3I A;  1ZU2 A;  5EG2 A;  3OS5 A;  4NRH B;  3HYM B;  1MT6 A;  2BQZ A;  2I6H A;  1P5Q A;  3GZ2 A;  5AYW D;  3LPZ A;  4J7F A;  5LSX A;  5CCL A;  3S7F A;  1ELR A;  3Q15 A;  5AYF A;  4I2Z A;  5G05 C;  4G1T A;  4YNM A;  2C2L A;  4N3C A;  2PQR A;  2Q7F A;  1ELW A;  4JHR A;  3CBM A;  3VV0 A;  3ZHE B;  5F6K C;  4GPK A;  3U4T A;  2BUG A;  4YVO A;  4GA0 A;  5BW8 C;  4U0Z A;  2HYZ A;  2FBN A;  5HQ8 A;  5ARG A;  3FP3 A; 
#chains in the Genus database with same CATH topology
 3RRM B;  3EP0 A;  4O1O A;  3ZKJ A;  2P9S G;  1PC2 A;  4EEC A;  4DX1 A;  4F53 A;  4U0S A;  3SZ7 A;  1QYM A;  3LYA A;  2LXL A;  4A55 A;  4WWO A;  3PS6 A;  4BT9 A;  4YPA A;  2EIJ E;  4H7X A;  3AU5 A;  1OWM A;  3V31 A;  4U8H A;  4U95 D;  5F6L A;  3MO0 A;  1KZP A;  2OEW A;  2YHE A;  3MA5 A;  4A3V A;  3ULQ A;  1IHB A;  1E90 A;  3B95 A;  4F6R D;  1N4S A;  3Q75 A;  3RO2 A;  4YDE A;  1NA3 A;  4FC8 A;  2DBA A;  4I1M A;  3BQO A;  2IEJ A;  4FJZ A;  4F1P A;  3Q79 A;  4K5B A;  3FTY A;  2HR2 A;  4ZFH A;  4ME2 A;  3LY8 A;  3J5P A;  3PDN A;  2JEK A;  1X5B A;  4J83 A;  3CR3 A;  1MYO A;  2KZT A;  5AQ9 A;  1OXJ A;  3R9A B;  4H12 A;  2OOE A;  3RKV A;  5ANL A;  3QAQ A;  3QWW A;  3KAE A;  5AJD A;  5ENR D;  1E7V A;  4DX5 D;  4IN3 B;  4BY6 A;  1WAO 1;  3BG0 B;  5JJ6 A;  2FF4 A;  4PDX A;  3Q73 A;  4GTR A;  5T4Y A;  4BSX A;  3CHM A;  4LUN U;  4HNA D;  3L13 A;  1LD7 A;  2I1K A;  1E8Z A;  4CGV A;  5EX3 A;  1N3J A;  3FH8 A;  3M58 A;  3S7B A;  5LP0 A;  3UUX A;  2V4H C;  1TJC A;  3M54 A;  1H6P A;  3VTY A;  4HOU A;  3IV0 A;  4U63 A;  4K5C A;  2H6G A;  3ESK A;  1MJ0 A;  4CDN A;  3Q49 B;  2OV8 A;  5ENT D;  4AU7 A;  3ABL E;  3CVL A;  3MEK A;  4PH4 B;  4GTM A;  3CST A;  3ULE G;  4HB5 A;  2KM4 A;  3D9N A;  3UM3 A;  2WXQ A;  3TWT A;  2P9U G;  3PRZ A;  3ASH A;  3FTV A;  3D9L A;  4JDS A;  5C2Y A;  3ZYM A;  1WM5 A;  3I4R B;  4JW1 A;  4LCT A;  5TEG A;  5DIZ A;  3C3O A;  3HDX A;  1L5J A;  3ZXS A;  2WXK A;  5TTF A;  5A6C A;  3ZPJ A;  1H6O A;  2QY7 A;  3IHV A;  3FEX A;  2M63 A;  3PE3 A;  5T5G A;  1TNZ A;  3BEE A;  3U9W A;  5D66 A;  4I6E A;  4GML A;  4DUI A;  2OND A;  2XEN A;  4LSZ E;  4CDM A;  1E8X A;  3ZYL A;  3JQ1 A;  4NJ5 A;  3VUZ A;  2R59 A;  4UQZ A;  3R7Q A;  2VQ2 A;  3CVY A;  5AQ7 A;  4ACK A;  3D9O A;  3TWR A;  2XPZ A;  4I17 A;  3ASO E;  2EQX A;  3FTU A;  3FTW A;  3SBT B;  3DSS A;  2B0O E;  2PQN A;  3QC1 A;  2KXP C;  3FHE A;  1N9A A;  3CVV A;  2H6F A;  3G2S A;  3QWV A;  4QQI A;  3BO5 A;  3CHQ A;  1H2V C;  3CIA A;  4BSZ B;  2KZT B;  4WNF A;  4CYM D;  4APF A;  3SBS A;  5LCW J;  5CRU A;  2NXP A;  2VGX A;  4FJY A;  4KBQ A;  1XQH A;  3E32 A;  1SZ9 A;  3UX4 A;  4XE0 A;  4MS6 A;  5ENQ D;  2WPV A;  4AY5 A;  4GTS A;  5JJ0 A;  3V2O A;  2OVB A;  3ML9 A;  2X6F A;  2ZIR A;  3V30 A;  3MV2 B;  3FUE A;  2LSV A;  3T8K A;  5E76 A;  3M55 A;  3HRA A;  4KXK B;  2MOW A;  3DPY A;  4Q94 A;  3JXI A;  4XKC A;  2QFC A;  3IBE A;  1ZBP A;  2R5S A;  1JCR A;  3ZRH A;  3L9T A;  3DSU A;  4KYO B;  2BF0 X;  4A1G A;  2IGQ A;  5CMW A;  4DRX E;  2UY1 A;  4AY6 A;  3CSF A;  4J8E A;  5AN8 A;  1K1B A;  1N6C A;  3PNL B;  4GCO A;  3I5P A;  3D9K A;  2LAI A;  3QKY A;  3PUK A;  1TNB A;  3VLF A;  1GW6 A;  3CHS A;  3PH0 C;  5FJY A;  1BI7 B;  3K9I A;  4CGW A;  2DZN A;  3B7B A;  2GRP B;  5G05 J;  3M5A A;  4BX8 A;  1MHQ A;  3ENE A;  3F9X A;  3NF1 A;  2XHE A;  3ISM C;  3RRN B;  4N3A A;  3ZHE A;  3CVU A;  5D0O D;  1N4Q A;  2R05 A;  5EN5 D;  2W5Y A;  2J9Q A;  5BUZ A;  5H7P A;  4NIK A;  1H3I A;  1ZU2 A;  4KMO A;  5EG2 A;  4NRH B;  4RSY A;  3HYM B;  4J8Y A;  2J49 A;  4KVO A;  5AYW D;  4J7F A;  3S7F A;  3W9F A;  4FHJ A;  3BU8 A;  1Q2Z A;  4BX9 A;  3PNT B;  3AU4 A;  3DXM G;  4YNM A;  3CQC B;  4TXR A;  1DVP A;  1NFI E;  3VLD A;  3SI5 A;  2F8Y A;  3AAA C;  2FBN A;  2WMO A;  5B1A E;  1OCC E;  3IXE A;  1IHG A;  3DAL A;  3F9W A;  3R7R A;  5AQB A;  4L7T A;  4DX2 A;  3CK7 A;  2ILR A;  3SNX A;  5AEN A;  1FPP A;  4TRQ A;  2WMN A;  3HXD A;  3CVQ A;  3JYS A;  5ENP D;  3HG0 D;  3SQV A;  3HXC A;  3SY2 A;  4RZ0 A;  4FA6 A;  5JHB A;  4JC8 A;  1XGW A;  4ZHB A;  3APC A;  3E37 A;  1K1A A;  2XGS A;  3AG2 E;  4ANW A;  1HXI A;  1S64 A;  4GTP A;  3JUI A;  1EPU A;  4TXQ A;  2QYJ A;  3CEQ A;  3HHM A;  4J0U A;  2AWI A;  1HE8 A;  1ZB1 A;  3M59 A;  2WXL A;  4UUC A;  4UI9 K;  3AS5 A;  4GTV A;  3MYV A;  4UQY A;  4GB9 A;  1S70 B;  3FU6 A;  5EIB E;  3UIO C;  2GRO B;  5KWD A;  2Y69 E;  3KMJ A;  3TXM A;  4JEU A;  1NA0 A;  3FDH A;  5JIN A;  2QYU A;  2ZGD A;  2F8X K;  2UY1 B;  1N0R A;  1HS6 A;  5D2M C;  2MRI A;  1TEZ A;  2GGF A;  2P58 C;  1O1R A;  4I9E A;  2GRQ B;  2KBX A;  1UN9 A;  4GPM A;  3U66 A;  2YNQ A;  2FO7 A;  1DC2 A;  4YPU A;  2IO2 C;  3DSW A;  5FZR A;  2XGO A;  3UM2 A;  2IJG X;  3OAW A;  2E2E A;  3G2V A;  4N39 A;  5FQ8 A;  2NYJ A;  3CKC A;  3B7R L;  4PUC A;  2F69 A;  2L0I A;  1QQE A;  3AJI A;  3ASG A;  3M53 A;  2DYS E;  1H2U A;  2V8S E;  2RD0 A;  1DCQ A;  3P1U A;  5JMN D;  3J5Q B;  3LY7 A;  3LKU A;  2WVI A;  3CBO A;  3RQ4 A;  4V3I A;  3E33 A;  5CHE E;  2X6K A;  3WXX A;  3UKU G;  4NAC A;  1U2V G;  2IU1 A;  4CZ2 D;  4MI0 A;  1JWG A;  3MKQ A;  4PS7 A;  1S0P A;  4J7W A;  3RJW A;  3TL5 A;  4HOR A;  3AG1 E;  2VGE A;  5TH7 A;  4GTQ A;  3FUF A;  4I1A A;  3APD A;  3CK8 A;  4ATG A;  4K0R A;  4U96 D;  2CHZ A;  4FMU A;  1FT1 A;  3LJ3 A;  3ZW3 A;  2AXZ A;  4J6I A;  3NZU A;  2XCB A;  1N4R A;  3R9M A;  2IF4 A;  4NUR A;  4IRU A;  2WXN A;  4Q69 A;  1Z5S C;  1SVX A;  3TWX A;  2IOS A;  2VSN A;  3ZN3 A;  4HVB A;  5KCM A;  4O60 A;  3CVX A;  3T8M A;  2EIL E;  4BES A;  4DK5 A;  4TUU A;  5HKP A;  3AG3 E;  3FTZ A;  1TYQ G;  3FU5 A;  3MV3 B;  3EDT B;  4OVV A;  1RW2 A;  2X3M A;  2P2C P;  4CT0 A;  4QEO A;  5HRY A;  4FHK A;  4C48 B;  4RQI A;  2AVP A;  5AAR A;  2AXU A;  2I2O A;  3HXF A;  3TG5 A;  4E6H A;  3KMA A;  3JQ0 A;  4EBA G;  2X6J A;  4UI9 C;  4JD2 G;  2LNI A;  1EYH A;  4LNU D;  3BG1 B;  3F9Y A;  4F1S A;  1OWO A;  4DLO A;  3MJW A;  4JHJ A;  3WG7 E;  4LNB A;  5LSZ A;  5EYL A;  1NL4 A;  2BTD A;  5LFA A;  1OWN A;  1Z6T A;  1ML9 A;  3CQG B;  4KZC A;  5G04 C;  5C1D A;  2BKK B;  4YND A;  4CCA A;  5KJL A;  3T9K A;  3TJP A;  2KCL A;  4PS8 A;  5KJN A;  4L2Y A;  3URZ A;  4EZK A;  3O4Z A;  4Q96 A;  4WUY A;  4U04 A;  3ONL A;  3OPE A;  1LTX A;  2IY0 C;  4MKT A;  3NAW A;  1OT8 A;  5LOZ A;  4C9B B;  4N5C A;  3E34 A;  5FTP A;  3M57 A;  3B7U X;  5BPP A;  3FWV A;  4JXT A;  1MX4 A;  1O1T A;  3AS8 A;  5ENS D;  4HFG A;  2VSX E;  1PAQ A;  3LY9 A;  2VJ8 A;  5D0Q D;  1D8E A;  5FQ4 A;  1N94 A;  3LXU X;  2IFU A;  3FEY A;  3S7D A;  5HI7 A;  3SO8 A;  1MUF A;  2R3A A;  3DSV A;  3FTX A;  4NQ0 A;  4IUL A;  3APF A;  3SF4 A;  5CEC B;  3UT4 A;  4ANU A;  2V4L A;  2W5Z A;  3Q5M A;  3U3W A;  1MX2 A;  5G55 A;  4BWR A;  5A23 A;  4G23 A;  4CRW A;  4JEH A;  3CV0 A;  2PL2 A;  4OAV B;  3OXG A;  4JA7 A;  3CLJ A;  4HOS A;  3MKQ B;  1YMP A;  3PEU B;  2J4B A;  2VSO E;  5BXO A;  2QPW A;  2Y3A A;  3SW9 A;  3MX3 A;  3GZ1 A;  5AQA A;  5KJK A;  5JIY A;  4HRN A;  4XZ4 A;  3RJV A;  3GW4 A;  2XCC A;  5FZQ A;  4DJA A;  1PEG A;  4IJD A;  4XEI G;  3L6A A;  1OY3 D;  3C5R A;  4C0E A;  1OWP A;  1DCE A;  3KSL A;  1Y8M A;  4GMJ A;  4BER A;  2O8J A;  1O5M A;  3LDZ A;  3FH5 A;  4JA9 A;  4AEZ C;  1MT6 A;  4AP2 A;  1P5Q A;  2XEH A;  3C72 A;  1JPL A;  3DEP A;  4HLE A;  3LPZ A;  2ETC A;  3Q15 A;  4EBA A;  3Q7A A;  3T5V A;  4MBG A;  3EHM A;  2WM9 A;  4JZY A;  2PQR A;  4ILH B;  1MQS A;  3ZXP A;  4CEM A;  3FUD A;  4YVO A;  4GA0 A;  4K5A B;  5BW8 C;  3G2W A;  5T3R A;  3ZEF A;  4UWG A;  2CFZ A;  3FP3 A;  4LG6 A;  3QAR A;  3PZD A;  4AVX A;  3KS2 A;  1SW6 A;  4GZ5 A;  4EHM A;  1UJJ A;  2XQ0 A;  4HOQ A;  2B6C A;  3MGB A;  5EDS A;  3UT8 A;  5KBA A;  2R2L A;  2RFA A;  3DEO A;  4MLP A;  2GRR B;  2BED A;  3FUN A;  4JHK A;  2L6B A;  3UIP C;  5CCM A;  2R02 A;  3M56 A;  3MO2 A;  5B3S E;  2DYR E;  2RFM A;  4GYO A;  4LNG A;  1WG0 A;  4GCN A;  2RKK A;  4B8A A;  2P9I G;  2WXM A;  4UWK A;  2ZU6 B;  4D10 C;  4UWF A;  2C0L A;  3HVE B;  3KSQ A;  1KZO A;  1H19 A;  2FO1 E;  2XS8 A;  4WWP A;  4Y6C A;  4BUP A;  3G2T A;  4O30 A;  2X6H A;  4BT8 A;  5B1B E;  1EDU A;  3FUK A;  1H6K A;  3FUH A;  5BV0 A;  3PZ3 A;  3CK9 A;  4JB8 P;  4J8S A;  4WNE A;  3SFX A;  1JWF A;  3CVN A;  4AM9 A;  3UQ3 A;  4K03 A;  4KZ0 A;  2Y0B G;  4WWN A;  1E8W A;  4YNP A;  1OCR E;  1DNP A;  4RVB A;  4AJW A;  2G46 A;  1E7U A;  2CFU A;  1UG3 A;  5JHN A;  3C98 A;  4R7L A;  2LUH A;  1HZ4 A;  3OXL A;  5LX8 A;  2F37 A;  2E0I A;  2P9P G;  3RAU A;  3CHO A;  4M3O A;  4AIF A;  1Y6I A;  2WXJ A;  4BEP A;  3TWV A;  3RK6 A;  1YCS B;  4PS3 A;  2GRL A;  2FI7 A;  4GZ6 A;  3VLE A;  4P29 A;  3FFL A;  2J08 A;  4DLQ A;  3FPD A;  4YPE A;  3ASD A;  3N71 A;  2RG8 A;  2XEE A;  3L17 A;  2LXM A;  4I1O B;  1UJK A;  2DVW A;  4CDR A;  1TN6 A;  4RG9 A;  3CVP A;  1E96 B;  3D3M A;  4C1Q A;  3ZFW A;  1SA4 A;  3SD5 A;  4HBD A;  5CED B;  3RAY A;  5CBN A;  5KNH D;  1IQU A;  1N52 A;  2F0Y A;  5FIO A;  2Y4T A;  1X81 A;  2MHK A;  4Y6W A;  1V55 E;  4UI9 J;  3UKR G;  1IQR A;  3RO3 A;  3TAX A;  4A1S A;  4U07 A;  3ZYQ A;  3UXG A;  3IHX A;  4RLY A;  4HXI A;  2JLB A;  4L2L A;  4EPZ A;  5J90 A;  1VDY A;  5F59 A;  4G26 A;  4O1P A;  3AG4 E;  4B0Z A;  1NZN A;  2WQ6 A;  4N5Q A;  4KVM A;  4B8C B;  2H6I A;  5FWQ A;  1QNF A;  5CMY A;  1KT1 A;  4G11 A;  5F5E A;  1AWC B;  2VGY A;  2CG2 A;  1N54 A;  5EKQ D;  2JV0 A;  3SHF A;  4Z4P A;  3D9I A;  2YHC A;  2KC7 A;  3L16 A;  3SFZ A;  4GAA A;  5ARF A;  2ETA A;  4G8L A;  3QNK A;  4AOF A;  4AXH A;  5ANR A;  1KT0 A;  1Z3Y A;  5BT1 A;  3CHR A;  4MI5 A;  3NZS A;  2ION A;  4HRL A;  1H2T C;  2WB2 A;  3C3Q A;  4B93 B;  4F3V A;  2HM8 A;  3KD7 A;  2V5F A;  3MO5 A;  1MVX A;  2QC9 A;  3JXJ A;  2CG3 A;  2WXG A;  3MKR A;  2X6I A;  2AXV A;  4B89 A;  2H6H A;  4WAF A;  4ANV A;  1FT2 A;  4OYS A;  1HO8 A;  2XEV A;  4YDO A;  1Z3X A;  2JAB A;  2XPI A;  2LSU A;  5ENO D;  1SQM A;  1IYG A;  4GTO A;  4LEU A;  2C0M A;  3CBP A;  3DB5 A;  3ZYK A;  3PVL A;  1OCZ E;  2EIM E;  3BUA A;  5BNW A;  1LD8 A;  3UI2 A;  2YQ8 A;  1O9S A;  2BKG A;  3NQP A;  1S63 A;  2OCC E;  1HFA A;  3FU3 A;  1MVH A;  4TUM A;  3F6Q A;  2GRN B;  2IOL A;  1BU9 A;  3GYZ A;  4GZD A;  3NBN B;  3V79 K;  2ETB A;  2PZI A;  4GA2 A;  4NVQ A;  4W9R A;  5EX0 A;  3EHR A;  4GYW A;  3ZIM A;  5AIJ A;  2L9B A;  2A5E A;  2VTB A;  5DBK A;  5HS0 A;  1BLX B;  2PM7 A;  4FLB A;  1A17 A;  3UPV A;  4I43 A;  4GA1 A;  3OXF A;  5AAO A;  1SZA A;  4ILI A;  1JUQ A;  3FY4 A;  3DXK G;  3HNA A;  1N11 A;  4G2V A;  4XX5 A;  3ESL A;  3EJN A;  5CBO A;  5ITZ F;  3K5K A;  3IEG A;  4YDW A;  1H0A A;  3KMT A;  2V5Q C;  4N2Q A;  4KT6 B;  3GZ2 A;  3Q7F A;  3T5X A;  3DPD A;  2ZGG A;  5AYF A;  2DWZ A;  5CEA A;  3B13 A;  1TN7 A;  3B7T A;  3I3N A;  5FIN A;  2Q7F A;  4JHR A;  3I4G A;  3CGH A;  4GPK A;  3U4T A;  3UTM A;  3PZ4 A;  2DZO A;  1UOH A;  3DBS A;  3L08 A;  5HQ8 A;  1K8K G;  3ULY A;  5J08 A;  4G8K A;  2ZIS A;  4M7C A;  1NI1 A;  1N95 A;  3HVE A;  4L23 A;  1B89 A;  3DWL G;  3ZU7 B;  2IO3 C;  4B94 A;  2EIN E;  4J7I A;  3HIZ A;  4UQX A;  5FT9 A;  3G2U A;  1OUV A;  1MZC A;  1K3Z D;  2XZT G;  5E75 A;  3PZ2 A;  3PE4 A;  3L22 A;  4ANX A;  1U3D A;  5G2N A;  3SGH A;  2ZXW E;  1RZ4 A;  4BTB A;  3TGO A;  5CER B;  3UM1 A;  1UW4 B;  3S8P A;  3FH7 A;  1HH8 A;  4GU5 A;  2V0P A;  5CRV A;  5EID A;  1NP7 A;  3ABM E;  1IXV A;  4HI9 A;  4CT4 A;  4BTA A;  3TWQ A;  4DPR A;  4HS2 A;  3DSX A;  3FUJ A;  4APO A;  1TNY A;  1O1S A;  1HX8 A;  3F9Z A;  1OWL A;  5KJM A;  2P9L G;  1HG2 A;  2P9K G;  1SA5 A;  3V2X A;  3AS4 A;  2AW6 A;  4E85 A;  2WQ7 A;  3MCX A;  4U0U A;  1FVH A;  1V54 E;  3O48 A;  1AP7 A;  4L1B A;  3QDN A;  2VTB B;  3FUI A;  1D9S A;  4ILG A;  3UMV A;  1KLX A;  3P2B A;  1D8D A;  4ATZ D;  3U64 A;  2DIW A;  3DST A;  1WDY A;  3EHN A;  4MRU A;  5FQ7 A;  3ZNG A;  2XS1 A;  4H7Y A;  4I51 A;  1TN8 A;  3NOC D;  5ENN A;  2A5U A;  3RU0 A;  3LJN A;  3ZUV B;  5BXU A;  3UM0 A;  2X38 A;  4L9P A;  4C0M A;  5CPR B;  5FZS A;  4FAD A;  4DX7 D;  4O6F A;  3ASF A;  4J8O A;  1ZKK A;  4U7E B;  3D9J A;  1TNO A;  4XI9 A;  4EZL A;  2NSZ A;  4GYY A;  4OVU A;  3EU9 A;  3HXE A;  4LRZ A;  3QOU A;  3GZS A;  2DCP A;  1BPO A;  4HOT A;  3ZGQ A;  2Y1L E;  3PEV B;  4JVS A;  4EZJ A;  2GRM A;  2HE0 A;  1N6A A;  2WQH A;  3Q9U C;  1FCH A;  1N4P A;  4FUL A;  4ACL A;  5T0M A;  3PUJ A;  2WXH A;  5BV1 A;  2XPY A;  1PY1 A;  1YYH A;  5T0K A;  3UT7 A;  4TV3 A;  1BD8 A;  1IKN D;  3EIJ A;  3DRA A;  4GMR A;  1YA0 A;  1XNF A;  4WNG A;  3ASN E;  5AJL A;  3HXB A;  2Y4U A;  3Q78 A;  3FU0 A;  4Z68 A;  3EUV A;  2KAT A;  1EF1 C;  2CHW A;  3KEZ A;  1JCS A;  3KEA A;  3OTN A;  2PM6 A;  2WXO A;  3E4B A;  5EYP F;  4XIF A;  3OOI A;  4I6G A;  3FTS A;  5A7D B;  3TWS A;  5IY5 E;  1UN8 A;  2KCK A;  5EIL A;  1QZ2 A;  3MZL B;  5JA4 D;  3RIB A;  4GZC A;  2WXR A;  4ABN A;  1FVF A;  2NC9 A;  3L54 A;  1OCO E;  2FEZ A;  4HQD A;  2VYI A;  4HLL A;  2RFI A;  3UIN C;  1E8Y A;  5FQ6 A;  2WXI A;  2XZD G;  4WND A;  2QZA A;  3EU5 A;  3Q9N C;  4UWL A;  2L6J A;  3D9H A;  2WXP A;  1KPS B;  2R03 A;  4I2W A;  3S2A A;  4YVQ C;  3FUM A;  2R17 C;  3CHP A;  2VSY A;  3TWU A;  4QEP A;  3ML8 A;  4AV7 A;  3IHY A;  3LEW A;  4FP7 A;  4JL0 A;  4DX6 D;  3PZ1 A;  3QJZ A;  3RRU A;  2WXF A;  2PNN A;  5T8I A;  3D9P A;  2I1J A;  4BFR A;  1QBQ A;  4I9C A;  1G3N B;  4G24 A;  2EIK E;  5JJT A;  4J8D A;  4G25 A;  1HU3 A;  4GTT A;  4QEN A;  4XKB A;  5LCW C;  4A63 B;  2J09 A;  3EHQ A;  2J07 A;  2CHX A;  2OEV A;  2VGX B;  5JJ7 A;  2HO1 A;  3QWP A;  3Q47 B;  3ONK A;  3TG4 A;  3SWC A;  4J8F A;  4HI8 A;  2XGM A;  4JLG A;  3B7S A;  5KNG A;  2GW1 A;  4LDG A;  3IKO B;  4E47 A;  3D9M A;  3NOG D;  1TR4 A;  4FU3 A;  4LER A;  3L82 A;  1HF8 A;  1U3C A;  3ABK E;  4XI0 A;  4I6J A;  3NB2 A;  2YIN A;  4U8Y D;  3LS8 A;  3LCA A;  2LO6 A;  3CKB A;  3S7J A;  4QFV A;  3EIQ C;  4F7A A;  2KCV A;  1A5E A;  1LF8 A;  3VTX A;  4EQF A;  4OAU C;  3W9G A;  2LAH A;  2IQC A;  1N0Q A;  2A4Z A;  4GZ3 A;  5G04 J;  3E30 A;  1BI8 B;  4JPS A;  4N2S A;  2MYO A;  4N3B A;  3JCK C;  2UWJ G;  1INZ A;  4DI4 A;  5M72 A;  3TXN A;  4RG6 A;  3SFY A;  2XRY A;  2J4D A;  3QK0 A;  3FUL A;  3ZVV A;  3QB2 A;  3LVQ E;  4UWH A;  4IJ8 A;  3Q4A B;  1W3B A;  4A3T A;  4FLH A;  3OS5 A;  4YDY A;  2BQZ A;  2I6H A;  1TJF A;  2AJA A;  3TWW A;  3LVR E;  1MX6 A;  5LSX A;  5CCL A;  4TXP A;  1JCQ A;  1ELR A;  4BET A;  3RSE G;  3X2Q E;  4I2Z A;  5G05 C;  4G1T A;  2P9N G;  3PRE A;  2J8S D;  2L0T B;  2C2L A;  4N3C A;  1ELW A;  4IYP A;  4U8V D;  3JUE A;  1WY6 A;  2XRZ A;  3CBM A;  2FUL A;  3VV0 A;  1HG5 A;  3ZHE B;  5F6K C;  2BUG A;  4HRM B;  4X8Q A;  1ELK A;  4U0Z A;  3CVW A;  2HYZ A;  2OVF A;  4DI3 A;  4URK A;  2I9C A;  1TNU A;  3C3R A;  5ARG A;  5JHA A; 
#chains in the Genus database with same CATH homology
 5J08 A;  3RRM B;  3QAR A;  1IHG A;  3DAL A;  3EP0 A;  3F9W A;  3PZD A;  3R7R A;  4AVX A;  3KS2 A;  1PC2 A;  4L7T A;  4EEC A;  3HVE A;  4GZ5 A;  4L23 A;  1B89 A;  1UJJ A;  2XQ0 A;  4HOQ A;  3CK7 A;  2ILR A;  3MGB A;  4U0S A;  4F53 A;  5EDS A;  3UT8 A;  3SNX A;  3SZ7 A;  5AEN A;  4B94 A;  4TRQ A;  3LYA A;  4A55 A;  4J7I A;  2WMN A;  4WWO A;  3PS6 A;  4BT9 A;  3HIZ A;  4YPA A;  4UQX A;  3CVQ A;  3JYS A;  4MLP A;  5FT9 A;  4H7X A;  3FUN A;  3AU5 A;  4JHK A;  3G2U A;  4RZ0 A;  1OUV A;  4FA6 A;  5JHB A;  4JC8 A;  1XGW A;  5CCM A;  5E75 A;  1OWM A;  3APC A;  3M56 A;  3MO2 A;  4U8H A;  3PE4 A;  2XGS A;  3L22 A;  4ANX A;  4ANW A;  1U3D A;  5G2N A;  5F6L A;  3SGH A;  1HXI A;  4GYO A;  3MO0 A;  4GCN A;  3JUI A;  1EPU A;  2YHE A;  4BTB A;  4B8A A;  3TGO A;  3CEQ A;  3HHM A;  3MA5 A;  4A3V A;  3ULQ A;  4J0U A;  1E90 A;  2WXM A;  2AWI A;  1HE8 A;  1UW4 B;  3S8P A;  4UWK A;  3M59 A;  3FH7 A;  1HH8 A;  2ZU6 B;  4GU5 A;  4D10 C;  2V0P A;  4UWF A;  3RO2 A;  2C0L A;  2WXL A;  1NA3 A;  4FC8 A;  3HVE B;  3AS5 A;  2DBA A;  4UI9 K;  4I1M A;  1NP7 A;  4FJZ A;  1H19 A;  3MYV A;  4UQY A;  4GB9 A;  4CT4 A;  4WWP A;  4BTA A;  3FU6 A;  4Y6C A;  4DPR A;  4BUP A;  3FTY A;  2HR2 A;  4HS2 A;  3G2T A;  4O30 A;  2X6H A;  4BT8 A;  3FUJ A;  4APO A;  3KMJ A;  1HX8 A;  3F9Z A;  4ME2 A;  1EDU A;  3FUK A;  3LY8 A;  1OWL A;  1H6K A;  3PDN A;  3FUH A;  5BV0 A;  5KJM A;  3TXM A;  2JEK A;  4JEU A;  1X5B A;  4J83 A;  3CK9 A;  1NA0 A;  3CR3 A;  3FDH A;  1HG2 A;  5JIN A;  4J8S A;  2KZT A;  2UY1 B;  4WNE A;  3AS4 A;  2AW6 A;  4E85 A;  2WQ7 A;  1JWF A;  3CVN A;  3MCX A;  1HS6 A;  4AM9 A;  2MRI A;  4K03 A;  1FVH A;  4U0U A;  3UQ3 A;  3R9A B;  4KZ0 A;  1TEZ A;  4H12 A;  2OOE A;  3RKV A;  3O48 A;  4WWN A;  4L1B A;  5ANL A;  1E8W A;  2GGF A;  3QDN A;  3QAQ A;  3QWW A;  2P58 C;  3KAE A;  2VTB B;  3FUI A;  4YNP A;  5AJD A;  4ILG A;  1E7V A;  1DNP A;  1KLX A;  4IN3 B;  4I9E A;  3UMV A;  4RVB A;  4BY6 A;  1WAO 1;  3BG0 B;  4AJW A;  2G46 A;  1E7U A;  5JJ6 A;  3P2B A;  2CFU A;  1UG3 A;  1UN9 A;  5JHN A;  3C98 A;  2FF4 A;  4R7L A;  3U66 A;  4PDX A;  1HZ4 A;  3U64 A;  2DIW A;  2YNQ A;  3OXL A;  5LX8 A;  2FO7 A;  4YPU A;  2E0I A;  3EHN A;  4MRU A;  5T4Y A;  5FZR A;  4BSX A;  2XGO A;  2IJG X;  3CHM A;  3OAW A;  4LUN U;  2E2E A;  3G2V A;  4N39 A;  3CHO A;  4M3O A;  5FQ7 A;  5FQ8 A;  4H7Y A;  4AIF A;  1Y6I A;  4I51 A;  3L13 A;  2I1K A;  1E8Z A;  3CKC A;  4CGV A;  3B7R L;  5EX3 A;  4PUC A;  1N3J A;  5ENN A;  2A5U A;  2F69 A;  2WXJ A;  3RU0 A;  2L0I A;  1QQE A;  3FH8 A;  3ASG A;  3M53 A;  2X38 A;  4C0M A;  5CPR B;  3RK6 A;  3M58 A;  3S7B A;  1H2U A;  2V8S E;  5FZS A;  4FAD A;  2RD0 A;  3UUX A;  5LP0 A;  4PS3 A;  2GRL A;  2FI7 A;  4GZ6 A;  4O6F A;  3ASF A;  1TJC A;  3P1U A;  4J8O A;  3VLE A;  1ZKK A;  3LY7 A;  3M54 A;  4P29 A;  3FFL A;  2J08 A;  3D9J A;  3LKU A;  2WVI A;  3VTY A;  4DLQ A;  4XI9 A;  4HOU A;  3IV0 A;  4EZL A;  3CBO A;  3RQ4 A;  4U63 A;  3FPD A;  4YPE A;  4V3I A;  3ESK A;  3ASD A;  4CDN A;  2NSZ A;  3N71 A;  3Q49 B;  4GYY A;  2OV8 A;  2RG8 A;  3L17 A;  4OVU A;  5CHE E;  2X6K A;  4LRZ A;  4I1O B;  3CVL A;  3MEK A;  4PH4 B;  4AU7 A;  3QOU A;  1UJK A;  3WXX A;  4CDR A;  3GZS A;  3CST A;  2DCP A;  4NAC A;  1BPO A;  2IU1 A;  4RG9 A;  4MI0 A;  4HOT A;  1JWG A;  3MKQ A;  4PS7 A;  3ZGQ A;  1S0P A;  3PEV B;  2KM4 A;  4JVS A;  3CVP A;  2GRM A;  4EZJ A;  1E96 B;  3RJW A;  3TL5 A;  4HOR A;  1N6A A;  3D9N A;  5TH7 A;  3D3M A;  4C1Q A;  2WQH A;  3FUF A;  3ZFW A;  4I1A A;  3SD5 A;  1FCH A;  3APD A;  3CK8 A;  4ATG A;  4K0R A;  4FUL A;  2WXQ A;  4ACL A;  2CHZ A;  5T0M A;  3PUJ A;  4FMU A;  2WXH A;  3LJ3 A;  5BV1 A;  3ZW3 A;  2XPY A;  1PY1 A;  2AXZ A;  3RAY A;  3PRZ A;  3NZU A;  4J6I A;  3ASH A;  3FTV A;  3UT7 A;  5T0K A;  4TV3 A;  1IQU A;  2XCB A;  3D9L A;  5C2Y A;  4JDS A;  3EIJ A;  2IF4 A;  1WM5 A;  3ZYM A;  1YA0 A;  1N52 A;  4NUR A;  1XNF A;  3I4R B;  4IRU A;  4JW1 A;  2WXN A;  4WNG A;  2Y4T A;  4Q69 A;  4LCT A;  5TEG A;  5AJL A;  2Y4U A;  2MHK A;  4Y6W A;  3FU0 A;  5DIZ A;  4UI9 J;  3HDX A;  2IOS A;  2VSN A;  3ZN3 A;  1L5J A;  4HVB A;  1IQR A;  3RO3 A;  3TAX A;  4A1S A;  3ZXS A;  2WXK A;  2KAT A;  5KCM A;  4U07 A;  3ZYQ A;  5TTF A;  1EF1 C;  2CHW A;  3KEZ A;  3CVX A;  5A6C A;  3T8M A;  3ZPJ A;  4DK5 A;  4TUU A;  3IHX A;  2QY7 A;  3IHV A;  4HXI A;  3FEX A;  2JLB A;  2M63 A;  3FTZ A;  4L2L A;  3PE3 A;  3OTN A;  2PM6 A;  3FU5 A;  3MV3 B;  5T5G A;  4EPZ A;  5J90 A;  1VDY A;  2WXO A;  3BEE A;  3EDT B;  5F59 A;  3E4B A;  4OVV A;  3U9W A;  4I6E A;  4G26 A;  2X3M A;  4GML A;  4B0Z A;  2OND A;  1NZN A;  4CT0 A;  2WQ6 A;  4QEO A;  4CDM A;  4KVM A;  4B8C B;  5FWQ A;  4FHK A;  4XIF A;  3OOI A;  1QNF A;  1E8X A;  4I6G A;  5CMY A;  3FTS A;  3ZYL A;  2AVP A;  5A7D B;  3JQ1 A;  1KT1 A;  4G11 A;  4NJ5 A;  3VUZ A;  2AXU A;  2I2O A;  2R59 A;  5F5E A;  4UQZ A;  2VGY A;  1UN8 A;  2CG2 A;  3TG5 A;  2KCK A;  3R7Q A;  4E6H A;  1N54 A;  2VQ2 A;  5EKQ D;  1QZ2 A;  3SHF A;  3CVY A;  4ACK A;  2JV0 A;  3KMA A;  4Z4P A;  3D9I A;  2YHC A;  2KC7 A;  3MZL B;  3RIB A;  3D9O A;  3JQ0 A;  3L16 A;  4EBA G;  2XPZ A;  4I17 A;  2X6J A;  3SFZ A;  4UI9 C;  2EQX A;  2LNI A;  4GZC A;  3FTU A;  4GAA A;  1EYH A;  5ARF A;  2WXR A;  3BG1 B;  3FTW A;  3SBT B;  3F9Y A;  4F1S A;  1OWO A;  4DLO A;  3MJW A;  2PQN A;  3QNK A;  4AOF A;  4JHJ A;  4AXH A;  3QC1 A;  5ANR A;  4ABN A;  1FVF A;  1KT0 A;  5LSZ A;  3FHE A;  2NC9 A;  1Z3Y A;  3L54 A;  5BT1 A;  3CVV A;  3CHR A;  4MI5 A;  3NZS A;  2ION A;  3G2S A;  2FEZ A;  2BTD A;  3QWV A;  2VYI A;  1H2T C;  5LFA A;  1OWN A;  1Z6T A;  2RFI A;  2WB2 A;  3BO5 A;  1E8Y A;  3CHQ A;  1ML9 A;  1H2V C;  5FQ6 A;  2WXI A;  3CQG B;  4WND A;  4F3V A;  3CIA A;  4KZC A;  5G04 C;  4UWL A;  2L6J A;  5C1D A;  2HM8 A;  2WXP A;  2KZT B;  4WNF A;  4YND A;  3KD7 A;  2V5F A;  4I2W A;  3S2A A;  4APF A;  3SBS A;  3MO5 A;  1MVX A;  5LCW J;  4YVQ C;  3FUM A;  4CCA A;  5KJL A;  2NXP A;  2VGX A;  2R17 C;  2CG3 A;  3CHP A;  2WXG A;  2VSY A;  4FJY A;  4KBQ A;  1XQH A;  4QEP A;  3ML8 A;  3TJP A;  2KCL A;  3MKR A;  4PS8 A;  5KJN A;  4L2Y A;  4AV7 A;  2X6I A;  1SZ9 A;  2AXV A;  4WAF A;  4ANV A;  4B89 A;  3IHY A;  4OYS A;  3UX4 A;  4XE0 A;  3URZ A;  1HO8 A;  2XEV A;  3LEW A;  4MS6 A;  4EZK A;  3O4Z A;  4Q96 A;  4WUY A;  4FP7 A;  4U04 A;  2WPV A;  4JL0 A;  4AY5 A;  3ONL A;  3OPE A;  1Z3X A;  2XPI A;  5JJ0 A;  2LSU A;  4MKT A;  3QJZ A;  3RRU A;  2WXF A;  5LOZ A;  1SQM A;  2OVB A;  3ML9 A;  4N5C A;  5T8I A;  2X6F A;  4C9B B;  1IYG A;  5FTP A;  3D9P A;  3M57 A;  2I1J A;  3MV2 B;  3B7U X;  5BPP A;  4LEU A;  4BFR A;  3FWV A;  3FUE A;  4I9C A;  2LSV A;  4JXT A;  4G24 A;  5JJT A;  4J8D A;  4G25 A;  1HU3 A;  3AS8 A;  5E76 A;  3M55 A;  2C0M A;  4HFG A;  2VSX E;  3CBP A;  1PAQ A;  3LY9 A;  2VJ8 A;  3DB5 A;  4QEN A;  5D0Q D;  3ZYK A;  3PVL A;  4KXK B;  4XKB A;  5LCW C;  2MOW A;  5FQ4 A;  3LXU X;  2J09 A;  2IFU A;  3FEY A;  3S7D A;  2J07 A;  2CHX A;  5HI7 A;  1MUF A;  2R3A A;  5BNW A;  2VGX B;  5JJ7 A;  2YQ8 A;  2HO1 A;  4Q94 A;  1O9S A;  4XKC A;  2QFC A;  3FTX A;  3QWP A;  4IUL A;  3IBE A;  3APF A;  1ZBP A;  3ONK A;  3Q47 B;  4NQ0 A;  3NQP A;  3TG4 A;  3SWC A;  1HFA A;  2R5S A;  3FU3 A;  3SF4 A;  4J8F A;  3UT4 A;  2XGM A;  1MVH A;  4JLG A;  3ZRH A;  4ANU A;  3B7S A;  2V4L A;  2W5Z A;  2GW1 A;  4LDG A;  3IKO B;  4E47 A;  4KYO B;  2BF0 X;  3Q5M A;  3U3W A;  3D9M A;  4A1G A;  2IGQ A;  2IOL A;  3GYZ A;  4GZD A;  4FU3 A;  5CMW A;  5G55 A;  4LER A;  2PZI A;  4GA2 A;  4BWR A;  2UY1 A;  5A23 A;  4AY6 A;  4NVQ A;  4G23 A;  4CRW A;  1HF8 A;  1U3C A;  4JEH A;  4W9R A;  3CV0 A;  2PL2 A;  3CSF A;  4XI0 A;  4I6J A;  5EX0 A;  4J8E A;  3OXG A;  1N6C A;  3PNL B;  4JA7 A;  2YIN A;  4GCO A;  3I5P A;  3CLJ A;  4GYW A;  3ZIM A;  4HOS A;  3D9K A;  3LS8 A;  3LCA A;  3MKQ B;  2LO6 A;  5AIJ A;  2LAI A;  2L9B A;  3PEU B;  3QKY A;  3CKB A;  3S7J A;  4QFV A;  2J4B A;  2VSO E;  3EIQ C;  3PUK A;  4F7A A;  2KCV A;  2VTB A;  2QPW A;  1LF8 A;  3VTX A;  4EQF A;  2LAH A;  2IQC A;  2A4Z A;  2Y3A A;  4GZ3 A;  5DBK A;  5G04 J;  3SW9 A;  3MX3 A;  3VLF A;  1GW6 A;  3CHS A;  4JPS A;  3GZ1 A;  2PM7 A;  3PH0 C;  5KJK A;  4N2S A;  4FLB A;  5JIY A;  1A17 A;  5FJY A;  3UPV A;  4I43 A;  4N3B A;  4XZ4 A;  3RJV A;  3GW4 A;  3K9I A;  4GA1 A;  4CGW A;  2XCC A;  3JCK C;  2UWJ G;  3OXF A;  1INZ A;  5FZQ A;  4DJA A;  1SZA A;  4ILI A;  1PEG A;  4IJD A;  1JUQ A;  3L6A A;  4DI4 A;  5M72 A;  3TXN A;  3FY4 A;  5G05 J;  4C0E A;  3HNA A;  4RG6 A;  3M5A A;  4G2V A;  4BX8 A;  1MHQ A;  3ENE A;  3F9X A;  1OWP A;  2XRY A;  3NF1 A;  4XX5 A;  2XHE A;  3ESL A;  2J4D A;  3QK0 A;  3FUL A;  3RRN B;  4N3A A;  1Y8M A;  4GMJ A;  3QB2 A;  3ZVV A;  3EJN A;  3ZHE A;  3CVU A;  2O8J A;  3K5K A;  3IEG A;  3LVQ E;  4UWH A;  1H0A A;  3LDZ A;  5D0O D;  3KMT A;  3FH5 A;  4IJ8 A;  4JA9 A;  2W5Y A;  3Q4A B;  2J9Q A;  4N2Q A;  5BUZ A;  1W3B A;  4A3T A;  1H3I A;  1ZU2 A;  4FLH A;  4KMO A;  5EG2 A;  4AEZ C;  4NRH B;  4KT6 B;  3OS5 A;  4RSY A;  3HYM B;  1MT6 A;  2BQZ A;  2I6H A;  4AP2 A;  2J49 A;  1P5Q A;  1TJF A;  3GZ2 A;  4KVO A;  5AYW D;  1JPL A;  3LVR E;  4HLE A;  3LPZ A;  4J7F A;  5LSX A;  5CCL A;  3T5X A;  3S7F A;  1ELR A;  3Q15 A;  4EBA A;  4FHJ A;  3DPD A;  3T5V A;  3EHM A;  5AYF A;  4BX9 A;  4I2Z A;  2WM9 A;  4JZY A;  5G05 C;  3PNT B;  3AU4 A;  3B13 A;  4G1T A;  3B7T A;  3I3N A;  3PRE A;  4YNM A;  2L0T B;  2C2L A;  2Q7F A;  2PQR A;  4ILH B;  4N3C A;  1ELW A;  4IYP A;  3CQC B;  1MQS A;  4JHR A;  3I4G A;  1WY6 A;  4CEM A;  2XRZ A;  3FUD A;  2FUL A;  3CBM A;  3VV0 A;  1DVP A;  1HG5 A;  3ZHE B;  3CGH A;  5F6K C;  3VLD A;  2BUG A;  3U4T A;  4YVO A;  4GA0 A;  4GPK A;  5BW8 C;  1ELK A;  4U0Z A;  3G2W A;  5T3R A;  3SI5 A;  3CVW A;  3ZEF A;  4UWG A;  2HYZ A;  2OVF A;  2FBN A;  2WMO A;  2I9C A;  2CFZ A;  3DBS A;  4DI3 A;  3L08 A;  4URK A;  5HQ8 A;  5ARG A;  3FP3 A;  5JHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...