3RIBA

Human lysine methyltransferase smyd2 in complex with adohcy
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
430
structure length
430
Chain Sequence
GGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESHLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human lysine methyltransferase Smyd2 reveals insights into the substrate divergence in Smyd proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 139
structure length 430
sequence length 430
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ribA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ribA01
2PZIA 3Q47B 4H7YA 1OUVA 2QFCA 4YNMA 1A17A 2HR2A 3ZFWA 4AY6A 4MI0A 2C0MA 2R3AA 5F5EA 3OOIA 4BTAA 2PL2A 5G05J 3HNAA 1ELWA 3PE4A 5LSXA 4APOA 4G25A 4J0UA 5T5GA 2Q7FA 4MI5A 2P58C 5TH7A 3Q5MA 3UUXA 4JA9A 3QKYA 3BO5A 5BNWA 4GZ5A 4I9CA 4AIFA 4Z4PA 4GA1A 1MVXA 4BWRA 2VSYA 5KJKA 1ZU2A 2YHCA 4GZ3A 3LY8A 4RZ0A 3QOUA 2R5SA 3CVPA 5JIYA 3F9ZA 4ABNA 5FTPA 2XGSA 5F59A 3MV2B 3E4BA 3SWCA 1NA3A 4UQXA 4G26A 3F9YA 3S7DA 5EKQD 4U04A 4J7FA 1ZBPA 5A6CA 5LSZA 4QENA 3OPEA 3TAXA 3RIBA 3PE3A 1N3JA 2KCVA 3DALA 3KS2A 4JHRA 4B94A 4GA2A 4UQZA 4N2SA 2VGYA 5CCLA 4RG9A 5D0OD 2KCKA 4N3AA 3ZPJA 1NZNA 3S7JA 1WAO1 4IN3B 1Y8MA 3ULQA 4G1TA 3CK7A 5F6KC 4GCOA 3OXFA 3MO2A 2WQHA 3CBOA 1YA0A 3LKUA 3M56A 3EDTB 3ZHEB 2I6HA 4YVOA 4JLGA 2XGMA 1IHGA 3M55A 3BEEA 5HI7A 3ASHA 4O30A 4AY5A 4C1QA 3MEKA 4G23A 3RJVA 5A7DB 3CKBA 3QWVA 3GZ1A 3OXGA 4KYOB 2AVPA 5DBKA 1E96B 1PC2A 1ZKKA 4IJDA 2BUGA 1PEGA 5ARFA 1ML9A 2WPVA 4CGWA 5EG2A 5M72A 2HO1A 2KATA 5LCWC 3KMJA 1IYGA 3KMTA 4W9RA 3CKCA 3UPVA 3KMAA 5ARGA 3CEQA 4RG6A 3F9XA 3ASFA 3SF4A 5T0MA 1P5QA 3IEGA 3MO5A 3RO2A 1HH8A 5JJ6A 3Q49B 5DIZA 4YNPA 2RFIA 2NC9A 4I2WA 3CBMA 4I51A 2FF4A 4UI9J 2JLBA 3KD7A 3LYAA 3MO0A 4H7XA 3TGOA 3CK8A 2BQZA 2Y4TA 4QEPA 2IF4A 3OXLA 4UI9K 2UY1B 3FP3A 3LPZA 5LCWJ 2IFUA 5TEGA 4N2QA 5EX3A 5JJTA 3M57A 3URZA 2YQ8A 3MKRA 4Y6WA 4A1SA 3GW4A 5FT9A 4ME2A 4YPUA 3EP0A 4LDGA 1XQHA 3GYZA 3ESKA 4BT8A 5FJYA 1B89A 5JHNA 4F3VA 4UI9C 2Y4UA 5G05C 4CDRA 2VQ2A 3OS5A 2F69A 2MHKA 1KLXA 3CBPA 2XCCA 2PQRA 5KJLA 1KT0A 3VTXA 3RO3A 3SZ7A 4I1AA 3CK9A 4FMUA 2XGOA 5G04C 3QWPA 4HOUA 3CV0A 1QQEA 4GZ6A 3ZHEA 3MV3B 4J8DA 3S7BA 2KC7A 4YPEA 3M59A 4N3CA 1N6AA 3LY7A 4LEUA 5G04J 5JINA 4JL0A 3TG4A 5KJMA 3Q15A 4GYWA 4AM9A 4G2VA 3N71A 1XNFA 1MVHA 2V5FA 3U3WA 4NRHB 4J7IA 3S8PA 1W3BA 3LCAA 4GPKA 2W5YA 2L6JA 4I9EA 5BW8C 4WNFA 3FPDA 3ASDA 2JV0A 4QEOA 3M58A 4HOTA 3AS5A 3AS8A 2J9QA 4GYYA 3IHXA 2XPIA 3M54A 3Q4AB 5FZRA 4JDSA 4BTBA 3SW9A 1TJCA 4WUYA 3VV0A 3RU0A 2LSUA 3WXXA 3LY9A 2GW1A 4UQYA 3ZN3A 2FO7A 2KCLA 3O48A 4EQFA 2W5ZA 3U4TA 5JJ0A 2LSVA 4I2ZA 5AYFA 3HYMB 1MUFA 4NJ5A 5C1DA 4H12A 2OOEA 2XCBA 4XI0A 5TTFA 3AS4A 4I17A 4KBQA 4HOQA 4YNDA 4Y6CA 2IGQA 5D0QD 1KT1A 3VTYA 3K5KA 1N6CA 2LNIA 3M53A 4J8EA 4JA7A 2VYIA 4GA0A 3S7FA 4U0SA 5CHEE 3QDNA 4G24A 4BUPA 4J8FA 2E2EA 3KAEA 1WM5A 4GCNA 4J83A 4CGVA 1QZ2A 4O6FA 4J8OA 4YPAA 4IJ8A 2DBAA 4NVQA 1FCHA 4WNEA 4NQ0A 5FZQA 4XIFA 2QPWA 4E47A 3VUZA 1HZ4A 3CVQA 4BT9A 3GZ2A 2HYZA 1ELRA 5KJNA 3TG5A 2G46A 3RKVA 1MT6A 2UWJG 5T0KA 5AYWD 4XI9A 3ASGA 5FZSA 2FI7A 5CCMA 3QWWA 3DB5A 5EX0A 5HQ8A 4U0UA 5F6LA 3CVLA 4HOSA 2VGXA 4N3BA 3CVNA 2VSNA 1H3IA 3RJWA 1O9SA 4HORA 3RQ4A 2VGXB 1NA0A 3UQ3A 4AU7A 5CPRB 3FWVA 2O8JA 5BT1A 2C0LA 4WNGA 1HXIA 3K9IA 2FBNA 2C2LA 4WNDA 3PDNA 2FEZA 2PQNA 2UY1A 2ONDA 2XEVA 4KXKB 3JYSA 3MA5A 3M5AA 3ZGQA 3R9AB 3RAYA 4GYOA 4N5CA 4YVQC 3NF1A 4N39A 4U07A 3F9WA 4U0ZA 5JJ7A 3FFLA
chains in the Genus database with same CATH superfamily
1JWFA 2IQCA 4H7YA 2QFCA 4DJAA 2HR2A 4AY6A 2C0MA 2YHEA 3MX3A 5A23A 5AENA 1TNBA 4APOA 2GRMA 3Q5MA 3CVVA 3JXIA 2IO3C 2H6GA 3SHFA 1BI8B 1H6PA 3HIZA 2GRRB 4AIFA 4GA1A 1MVXA 1DNPA 2XHEA 3I3NA 3ULEG 4BX8A 4UWGA 4LG6A 4MS6A 2XGSA 4I1MA 4BX9A 3E4BA 2WMNA 3F9YA 3PRZA 4U04A 3UT7A 3PZ1A 3SY2A 1ELKA 1PY1A 5EDSA 3D9KA 4QENA 2R02A 3OPEA 3UM1A 1N0RA 1Q2ZA 1N94A 2KM4A 2KCVA 3DALA 4R7LA 4B94A 3DEPA 3EU5A 5CBOA 4UQZA 3TXNA 3ASOE 5D0OD 5CCLA 2KCKA 3S7JA 1WAO1 4BESA 2OVBA 1H6OA 5F6KC 3CK7A 2KXPC 4GCOA 3MO2A 3FTXA 2X6JA 3M56A 2BF0X 3EDTB 3ZHEB 4CRWA 4KVOA 4GPMA 3DSVA 3PH0C 3OTNA 5G2NA 1U3CA 4X8QA 5CBNA 4NACA 4OVUA 3ZVVA 2GRQB 3R9MA 1E7VA 1FVFA 3MYVA 4AY5A 2V4LA 5ENPD 4C1QA 4CYMD 4GZDA 4G23A 4K0RA 3W9GA 3QWVA 3B7SA 3GZSA 2AVPA 3JQ0A 3T9KA 5DBKA 4MBGA 1ZKKA 1MJ0A 4IJDA 2BUGA 1PEGA 5D2MC 1N11A 4B89A 3I4GA 3UXGA 5M72A 3HVEB 1YCSB 3UPVA 4XEIG 3ASFA 3SF4A 1P5QA 1E7UA 3ZIMA 4PDXA 2DZNA 2NC9A 2V5QC 5AARA 1K3ZD 1EPUA 2PM7A 5T8IA 5LOZA 3MO0A 1XGWA 3TGOA 2AJAA 3DSTA 4KZCA 3OXLA 4NURA 4UI9K 3FTUA 1HE8A 1OCOE 1DVPA 4N2QA 3VLEA 3UT8A 2YQ8A 3APCA 3EIJA 4LUNU 3ZNGA 3GW4A 3SD5A 3LJNA 4LDGA 1XQHA 3ZEFA 3ESKA 4BT8A 4XE0A 3ABKE 5JHNA 3ZYMA 4CDRA 3F6QA 4HLLA 3CVYA 3OS5A 2J8SD 3Q9NC 2DWZA 2DVWA 1KPSB 2PQRA 5KJLA 4V3IA 3RO3A 2XGOA 4HOUA 3CV0A 4Q69A 1V55E 4GTSA 5HS0A 5ENOD 3ZHEA 3MV3B 3S7BA 4YPEA 1OT8A 3C3OA 1N6AA 3LY7A 4LEUA 3AU4A 2Y3AA 3D9MA 5JMND 4GYWA 1X81A 1V54E 3DXKG 4NRHB 2WXLA 1MX2A 2W5YA 4GMJA 4BSXA 4I9EA 4F6RD 2LAHA 3ZYLA 1E8WA 2CHWA 2V4HC 4G8KA 3FPDA 3TJPA 3I5PA 3IHXA 4JHJA 2XPIA 5J08A 1FVHA 1FT1A 3C3RA 4WUYA 3RU0A 2LSUA 3DPYA 3LY9A 3NZSA 4UQYA 2WXFA 5HRYA 2CFUA 4JVSA 1N4SA 3MJWA 4K03A 4JD2G 2W5ZA 3L54A 1E8YA 4I2ZA 3UMVA 2A4ZA 4GMRA 2IEJA 4P29A 3MKQA 3APFA 4XI0A 5ENSD 1QBQA 2P9KG 5CEAA 1KT1A 4BSZB 2ZGGA 4WWOA 3M53A 4D10C 3VLDA 2VYIA 2QYUA 1OCCE 4EBAG 4U0SA 3DWLG 3QDNA 4G24A 1KZPA 3PZ4A 1Z3XA 4Q94A 4FADA 3J5QB 4J83A 3CHPA 4K5AB 4JPSA 5JHBA 1H6KA 2AXVA 1BD8A 4YPAA 1FCHA 3AU5A 4WNEA 3PVLA 5FZQA 1N4RA 4F1PA 3E30A 4EECA 3IHYA 1DCEA 2IOLA 4BT9A 3EUVA 2HYZA 3V79K 5KJNA 3TG5A 1GW6A 3RKVA 1D8DA 4FU3A 3FUDA 4ATZD 1UJKA 3MKQB 1MX6A 4U8VD 1OWPA 2A5UA 4I6JA 1EYHA 5CCMA 1OY3D 3KSLA 5FINA 2XS1A 2IONA 1YMPA 4F7AA 4N3BA 2VTBA 3QB2A 1TJFA 2LUHA 3DSWA 4JW1A 1EDUA 2VSNA 1H3IA 1HU3A 4C9BB 1Z3YA 3Q79A 2XENA 4AU7A 2EILE 3Q9UC 3FU6A 1HXIA 4AOFA 4WNDA 4BERA 4DI4A 4F1SA 2FEZA 2PQNA 2UY1A 3L6AA 3VLFA 2WXGA 3MA5A 4XKCA 3G2SA 3Q7FA 3D9JA 1SVXA 2X38A 1LD8A 3B13A 4HXIA 4YVQC 4HRMB 2ZISA 4YDWA 2ZU6B 4U0ZA 1FT2A 3D9HA 2MOWA 4L1BA 4YNMA 2J07A 2IJGX 3ZFWA 4MI0A 3BUAA 1TNUA 3CHRA 2RKKA 4EHMA 3OOIA 2XEHA 3ABLE 5G05J 3HNAA 1ELWA 4GTRA 4OVVA 2XS8A 5TH7A 1SQMA 1WG0A 4JA9A 3QKYA 3BO5A 5BNWA 3BG0B 2F0YA 3FTZA 3UTMA 4BWRA 5KJKA 1ZU2A 3FEYA 3NZUA 3TWVA 3LY8A 4U96D 2XPZA 4IYPA 4TUMA 3CVPA 4DX2A 3FUJA 3UIOC 2CG2A 5JIYA 5BV0A 2WXIA 3QNKA 4GTMA 1MQSA 3EHMA 5F59A 2AXUA 1N4QA 1D9SA 1NA3A 4UQXA 2R17C 4ACKA 3S7DA 2KZTA 3FUFA 5EKQD 1SZAA 5A6CA 2RD0A 3ONKA 4I6EA 1K1AA 1O5MA 5AQAA 3L82A 1N3JA 4URKA 3FTYA 4GA2A 1IHBA 4RG9A 3FEXA 3TXMA 2H6HA 4IN3B 3C5RA 1BU9A 1Y8MA 3CR3A 3ULQA 1TEZA 3OXFA 3PUKA 3ABME 1IXVA 2WQHA 3CBOA 1YA0A 2I9CA 3ZW3A 4HB5A 1OXJA 3DRAA 1OWOA 4FHJA 3QAQA 1IHGA 2WXPA 3FDHA 4M7CA 2FO1E 3KEZA 4XZ4A 3GZ1A 4KYOB 2ZIRA 1E96B 1D8EA 2KBXA 3LJ3A 4CGWA 2P9PG 3EJNA 1N54A 2KATA 1TN6A 5BXUA 1L5JA 3DEOA 2H6FA 3UINC 2DYRE 3CLJA 1TN7A 5LCWC 1IYGA 3KMJA 3UM0A 4W9RA 4U8YD 3CKCA 5ARGA 3CEQA 4RG6A 3F9XA 4MLPA 4CDNA 5T0MA 3IEGA 1TNZA 1HH8A 3FH7A 3Q49B 1H2UA 1JCQA 3CBMA 4I51A 5C2YA 4DX6D 2R05A 4GTVA 2WXRA 3KD7A 3LYAA 4H7XA 5FQ7A 4CZ2D 2QC9A 5CMWA 5BXOA 3FHEA 3B7TA 3FTWA 5FQ8A 5LCWJ 2QZAA 2XRYA 4JEUA 3QJZA 4MRUA 2OVFA 5BPPA 4GTTA 5AQBA 5FT9A 3GYZA 4A3TA 1B89A 1TYQG 1Z6TA 2VQ2A 4HLEA 3PREA 2F69A 2MHKA 1UOHA 5KNGA 3HXEA 4UWFA 1KT0A 3G2UA 3CK9A 5EYLA 2NXPA 3LXUX 4AP2A 1AWCB 4GMLA 3M59A 4B93B 4N3CA 5G04J 4WWPA 4JL0A 2OEWA 4ANUA 2F37A 2ZXWE 3FTSA 3N71A 4FLHA 1XNFA 1MVHA 2V5FA 3ESLA 3U3WA 3D9IA 4GTPA 4GPKA 2VJ8A 2L6JA 5B1BE 4FJYA 1AP7A 2JV0A 4GAAA 3M58A 3S2AA 1H0AA 4GYYA 4JDSA 4BTBA 3SW9A 1TJCA 2KZTB 4KMOA 2GW1A 3HDXA 2FO7A 3ZXPA 2WXJA 5ENQD 4BY6A 3SNXA 5AAOA 4EQFA 3Q7AA 3BU8A 1PAQA 1DC2A 5AYFA 3HYMB 1MUFA 1LTXA 3PNTB 2XCBA 2IO2C 3SFXA 3AS4A 5EIDA 4KBQA 4C48B 4YNDA 5D0QD 3FUKA 2P9NG 2V0PA 1U2VG 4J8YA 1N6CA 2LNIA 2X6HA 3PUJA 3B95A 3S7FA 5ENTD 4DX7D 3JQ1A 4Q96A 4FJZA 1O1SA 3LEWA 2NYJA 3QC1A 1A5EA 4NIKA 2P9LG 2ILRA 4CGVA 3UKRG 3X2QE 1S63A 1JUQA 2DBAA 4NVQA 4NQ0A 4UWHA 4XIFA 4ILIA 3VUZA 1S0PA 3GZ2A 1ELRA 1IQUA 2V8SE 5KWDA 3MCXA 2UWJG 5AYWD 4XI9A 3MZLB 3HXFA 1HG5A 3ASGA 3RRMB 5FZSA 2FI7A 3E34A 2X6FA 3ML8A 1K8KG 2OV8A 5AJDA 3QWWA 2I1JA 4U0UA 3CVLA 4HOSA 4HRLA 1O1RA 4FULA 3IBEA 3UM3A 1MYOA 2X3MA 4LSZE 2WQ6A 2VSXE 1O9SA 2WXKA 1UG3A 3B7RL 2VGXB 1NA0A 2F8XK 1VDYA 3T5VA 3EU9A 5BT1A 2PM6A 2FBNA 3QARA 2C2LA 4RQIA 3G2WA 3ML9A 3DSUA 3AG4E 2MRIA 5B3SE 2ONDA 3JCKC 2J09A 4KXKB 1SA5A 4HRNA 3M5AA 4GYOA 2L6BA 3E32A 4J8SA 3FU3A 5D66A 4U07A 5ENNA 3LVQE 5JHAA 3Q47B 1OUVA 1SZ9A 5FIOA 1A17A 1JCSA 4PH4B 4G11A 4LCTA 3L13A 4BTAA 3QK0A 2MYOA 3PE4A 3PZDA 5ANLA 5LSXA 3LDZA 4J0UA 2Q7FA 2P58C 4HI8A 2GRPB 4HBDA 3UIPC 3UUXA 4GB9A 1UW4B 2VSYA 4RVBA 2YHCA 3DPDA 1UN8A 4QQIA 4RZ0A 1INZA 2J49A 2X6KA 4KVMA 1QYMA 3F9ZA 4CT4A 5FTPA 2WXMA 5J90A 3ASNE 2B0OE 3MV2B 3SWCA 2GRLA 4G26A 1RW2A 4LRZA 4J7FA 5LSZA 3MGBA 2J4DA 3HXDA 3RIBA 4PS7A 5FQ6A 2P2CP 4B8CB 2BKGA 2JEKA 3CSTA 3FUNA 4N2SA 3ZPJA 2QYJA 1NZNA 3HHMA 3IKOB 2RG8A 4XKBA 3CHSA 3FUIA 4BFRA 3LVRE 2P9UG 4K5CA 3TWUA 3SFZA 2I6HA 4YVOA 3O4ZA 1DCQA 5BUZA 1H2VC 1WY6A 4CDMA 3UM2A 3PS6A 1MHQA 1MZCA 1NL4A 2ETCA 1N0QA 4O30A 4I43A 1JWGA 3CQGB 1H19A 3CKBA 2IY0C 2L0IA 1UJJA 3TWXA 2AWIA 4GTQA 5ARFA 4G8LA 4TXPA 2WPVA 1ML9A 5EG2A 2HO1A 1UN9A 1U3DA 4TRQA 3KMTA 2DYSE 4ANVA 4ANXA 3TWSA 3NBNB 3CHOA 4TXQA 3RO2A 1BI7B 5JA4D 4YNPA 2RFIA 4I2WA 3V30A 4ATGA 3L22A 1HS6A 2JLBA 5EIBE 4OAVB 3IV0A 3JUEA 4PS3A 2Y4TA 2BKKB 4QEPA 3HVEA 3G2VA 5E75A 1N52A 3CHQA 4JB8P 2UY1B 1IQRA 3DBSA 3LPZA 2IFUA 4I6GA 4EZKA 5EX3A 3M57A 3FH8A 3MKRA 4LERA 4EZJA 4O60A 3KSQA 2YNQA 2R59A 3TL5A 4ME2A 3EP0A 2GROB 5CMYA 1TR4A 1BLXB 4UI9C 2Y4UA 5G05C 3CVWA 2I2OA 3C98A 1X5BA 1KLXA 3CBPA 5LFAA 2XCCA 4ZHBA 3VTXA 3UI2A 2BTDA 3HRAA 2PNNA 3QWPA 2ETBA 1QQEA 4GZ6A 3DSXA 3Q78A 3OAWA 4ILHB 4J8DA 4MKTA 5ANRA 4L7TA 3FUMA 5JINA 4O1OA 4B0ZA 5KJMA 2J08A 2P9SG 3E37A 3Q15A 2AXZA 2DZOA 4G2VA 3PZ3A 4QFVA 4J7IA 2ETAA 3LCAA 4DK5A 5CRVA 4ILGA 2J4BA 2A5EA 3ASDA 1S70B 4QEOA 1WDYA 3J5PA 5EN5D 4AEZC 4HOTA 3AS5A 1HFAA 3Q4AB 4CCAA 2QY7A 3NQPA 3VV0A 3WXXA 3JUIA 4FP7A 4PUCA 3O48A 3U4TA 5C1DA 4H12A 2OOEA 2CFZA 1G3NB 1Z5SC 5TTFA 2GRNB 4Y6CA 2IGQA 3K5KA 1BPOA 2CHZA 3L16A 3FULA 4I1OB 4J8EA 4JA7A 3ZRHA 3D9LA 2M63A 5CHEE 3DSSA 4BUPA 4DLQA 4FC8A 3IHVA 4HQDA 1QZ2A 4OAUC 5AQ7A 2XZDG 4IJ8A 3I4RB 3WG7E 4YDEA 2QPWA 2XQ0A 5AQ9A 2EINE 1HZ4A 2L0TB 3ZYQA 4L9PA 2Y0BG 2WXHA 5AIJA 3FUEA 3C3QA 1IKND 4UWKA 4AXHA 4JHKA 1RZ4A 3L17A 4J6IA 3CHMA 1OWLA 2WXQA 3D9PA 4WWNA 5EX0A 4AV7A 5F6LA 3FUHA 4A55A 2VGXA 4HS2A 1OWNA 2R2LA 5H7PA 4EPZA 4L2LA 1OWMA 3D3MA 4HORA 3RQ4A 3ZUVB 4IULA 3UQ3A 5CPRB 3FWVA 4GZCA 2O8JA 1E8XA 1SW6A 4WNGA 4ACLA 3JXJA 3P2BA 1MX4A 4UUCA 4GTOA 1HX8A 4C0MA 2B6CA 3PEUB 5CEDB 2NSZA 2XEVA 3T5XA 3JYSA 5CERB 3ZGQA 3RAYA 4L2YA 5KNHD 3ZXSA 4N5CA 3NF1A 2X6IA 2IOSA 4DRXE 3F9WA 3EHNA 3NAWA 3FFLA 4ZFHA 2PZIA 4K5BA 1TNOA 3W9FA 1OCZE 3HG0D 2WM9A 2R3AA 5F5EA 3SFYA 2LXMA 2PL2A 3PEVB 4G25A 5T5GA 4MI5A 2LO6A 3AAAC 5EILA 1EF1C 4U7EB 3NOGD 4KZ0A 5G55A 2HE0A 3BQOA 3B7BA 4WAFA 4GZ5A 4I9CA 4Z4PA 2E0IA 1NP7A 4GZ3A 4BETA 4HFGA 5FWQA 4A63B 4DX5D 3QOUA 3CSFA 2R5SA 4DX1A 3V2OA 3CVUA 3G2TA 4ABNA 3SI5A 4U8HA 2VTBB 3RSEG 1E8ZA 4DI3A 4YDOA 1ZBPA 2EIME 3RRNB 3T8MA 2XZTG 4JC8A 4J7WA 3R7RA 1YYHA 1O1TA 3Q73A 3TAXA 3PE3A 2FULA 3KS2A 3APDA 4JHRA 3PZ2A 5FQ4A 3Q75A 2I1KA 4EBAA 2VGYA 2Y69E 4N3AA 3R7QA 5T4YA 3NOCD 4UWLA 4TUUA 4G1TA 5AJLA 2EIKE 3ZYKA 3UT4A 3D9OA 2R03A 3BG1B 3LKUA 2VSOE 2XEEA 4TXRA 2H6IA 4JLGA 2XGMA 3M55A 3BEEA 1S64A 5HI7A 3ASHA 3RAUA 5IY5E 3T8KA 4E85A 3MEKA 3RJVA 5A7DB 1TNYA 4LNUD 3OXGA 4GU5A 4OYSA 4U63A 3B7UX 1PC2A 2XRZA 1OCRE 1SA4A 4TV3A 3DXMG 3FTVA 2CHXA 3KMAA 3SO8A 3MO5A 5JJ6A 1NI1A 5DIZA 4N5QA 2WB2A 4E6HA 2EQXA 4Z68A 2FF4A 4UI9J 2DIWA 2XPYA 3P1UA 3CK8A 5B1AE 2BQZA 3LS8A 1K1BA 3UX4A 2GGFA 3NB2A 2IF4A 5LX8A 1N9AA 5KCMA 3FP3A 4RLYA 2AW6A 4IRUA 5TEGA 1NFIE 5JJTA 5CECB 2RFMA 3URZA 4Y6WA 4A3VA 2WQ7A 2Y1LE 4A1SA 4RSYA 4YPUA 4FHKA 5FJYA 5AN8A 3SBTB 4F3VA 3D9NA 2OCCE 3U66A 2CG3A 4YDYA 4JEHA 2RFAA 4APFA 3TWWA 2VGEA 4O1PA 4DLOA 3SZ7A 3CVXA 4I1AA 3ISMC 2LAIA 4FMUA 5G04C 4XX5A 4KT6B 3HXBA 2BEDA 2KC7A 5E76A 3FU5A 3U64A 1LF8A 1E90A 3HXCA 3FH5A 3TWRA 5ENRD 2IU1A 3TG4A 5KBAA 3ZU7B 4JXTA 3AG1E 5ITZF 4AM9A 2WMOA 3EHQA 1HO8A 4BEPA 3S8PA 1W3BA 1H2TC 4LNGA 5BW8C 4WNFA 1TN8A 3AG2E 3SGHA 3AS8A 2L9BA 2J9QA 3M54A 5FZRA 2JABA 3IXEA 2F8YA 2ZGDA 3ZN3A 3KEAA 3ULYA 2KCLA 3FU0A 1N4PA 3UKUG 5JJ0A 2YINA 2LSVA 3ENEA 3U9WA 4NJ5A 1KZOA 4ANWA 4I17A 1JPLA 4HOQA 3C72A 4HVBA 1N95A 3VTYA 4CT0A 4GA0A 4DUIA 4AVXA 4J8FA 4B8AA 2E2EA 4EZLA 4JZYA 3RRUA 2HM8A 3KAEA 1WM5A 2DCPA 4GCNA 4HI9A 3TWQA 4PS8A 3PNLB 1FPPA 4AJWA 4O6FA 4J8OA 3FY4A 2WXNA 3EHRA 3AJIA 5HKPA 4E47A 3CVQA 2G46A 1LD7A 3ONLA 1MT6A 3EIQC 3CIAA 5T0KA 4C0EA 4HNAD 4FA6A 2OEVA 3CQCB 2EIJE 2LXLA 4F53A 1HG2A 4L23A 1JCRA 3DB5A 5HQ8A 4DPRA 3CGHA 5CRUA 4LNBA 1Y6IA 4A1GA 3CVNA 3RJWA 3SQVA 3L9TA 5BV1A 2P9IG 4U95D 3E33A 2C0LA 3K9IA 3ZKJA 3TWTA 3PDNA 4CEMA 3AG3E 3L08A 4M3OA 5EYPF 2WVIA 1ZB1A 3R9AB 4FLBA 2WXOA 5T3RA 1QNFA 4N39A 3V2XA 5LP0A 3SBSA 1HF8A 5JJ7A 3RK6A 3V31A
chains in the Genus database with same CATH topology
1JWFA 2MOWA 5JHAA 2PZIA 2IQCA 3Q47B 1OUVA 4H7YA 1SZ9A 2QFCA 4L1BA 4YNMA 2J07A 1A17A 4DJAA 2IJGX 2HR2A 3ZFWA 4AY6A 4MI0A 4PH4B 2C0MA 4G11A 2WM9A 3CHRA 2YHEA 2R3AA 5F5EA 4LCTA 3MX3A 3OOIA 5A23A 3L13A 4BTAA 3QK0A 2PL2A 5G05J 5AENA 3HNAA 1ELWA 3PE4A 3PZDA 5ANLA 5LSXA 4APOA 3LDZA 3PEVB 4G25A 4J0UA 5T5GA 2Q7FA 4MI5A 2LO6A 4OVVA 2GRMA 2P58C 5TH7A 3Q5MA 3CVVA 1EF1C 4KZ0A 1SQMA 5G55A 3SHFA 3UUXA 4JA9A 3QKYA 3HIZA 4WAFA 3BO5A 5BNWA 3BG0B 3FTZA 4GZ5A 4I9CA 4AIFA 4GB9A 4Z4PA 4GA1A 1MVXA 1UW4B 2VSYA 4RVBA 4BWRA 2E0IA 1ZU2A 2YHCA 5KJKA 1NP7A 4GZ3A 1DNPA 2XHEA 3FEYA 3NZUA 3DPDA 1UN8A 3I3NA 3LY8A 4RZ0A 4HFGA 5FWQA 2XPZA 3QOUA 4IYPA 1INZA 3CSFA 3CVPA 2R5SA 4BX8A 2J49A 2X6KA 4UWGA 3FUJA 4MS6A 4KVMA 3CVUA 2CG2A 5JIYA 3F9ZA 5BV0A 2WXIA 3G2TA 4ABNA 4CT4A 3QNKA 5FTPA 2WXMA 5J90A 1MQSA 3EHMA 2XGSA 4I1MA 3SI5A 4U8HA 4BX9A 3MV2B 2VTBB 5F59A 2AXUA 3E4BA 3SWCA 1NA3A 2GRLA 2WMNA 1E8ZA 4UQXA 2R17C 4ACKA 4G26A 4LRZA 3F9YA 3PRZA 3S7DA 4DI3A 2KZTA 3FUFA 4U04A 5EKQD 4J7FA 1SZAA 3UT7A 1ZBPA 5A6CA 3RRNB 2RD0A 3ONKA 3T8MA 4I6EA 4JC8A 1ELKA 3R7RA 5LSZA 3MGBA 2J4DA 1PY1A 5EDSA 3D9KA 4QENA 3OPEA 3TAXA 3RIBA 3PE3A 4PS7A 1N3JA 5FQ6A 2FULA 2KM4A 4URKA 2KCVA 3DALA 3KS2A 3APDA 3FTYA 4JHRA 4R7LA 4B94A 5FQ4A 4B8CB 2JEKA 3FUNA 3CSTA 4GA2A 4UQZA 2I1KA 3TXNA 4EBAA 4N2SA 2VGYA 4RG9A 5D0OD 5CCLA 2KCKA 4N3AA 3FEXA 1NZNA 3HHMA 3IKOB 3R7QA 3S7JA 3TXMA 3ZPJA 1WAO1 4IN3B 5T4YA 4UWLA 2OVBA 2RG8A 4TUUA 1Y8MA 3CR3A 4XKBA 4G1TA 3CHSA 3CK7A 3FUIA 5AJLA 3ULQA 4BFRA 1TEZA 4GCOA 5F6KC 3OXFA 3LVRE 3MO2A 3PUKA 2WQHA 3UT4A 3D9OA 3BG1B 3ZYKA 3FTXA 1YA0A 3CBOA 2I9CA 3LKUA 2X6JA 2VSOE 3M56A 3ZW3A 2BF0X 3EDTB 3ZHEB 4CRWA 4KVOA 3SFZA 2I6HA 3PH0C 3OTNA 3O4ZA 4YVOA 1OWOA 5BUZA 5G2NA 1H2VC 1U3CA 1WY6A 4FHJA 4CDMA 4JLGA 3QAQA 4NACA 2XGMA 1IHGA 3PS6A 1MHQA 4OVUA 3BEEA 3ZVVA 1E7VA 2WXPA 5HI7A 3M55A 3ASHA 4O30A 1FVFA 3MYVA 4AY5A 3FDHA 4E85A 2V4LA 4C1QA 4I43A 1JWGA 3MEKA 4GZDA 3CQGB 4G23A 3RJVA 3KEZA 5A7DB 1H19A 3CKBA 4K0RA 3QWVA 3B7SA 4XZ4A 3GZ1A 3GZSA 3OXGA 4KYOB 2AVPA 4GU5A 4OYSA 2L0IA 3JQ0A 5DBKA 4U63A 3B7UX 1E96B 1PC2A 1UJJA 1ZKKA 2XRZA 3LJ3A 2AWIA 4TV3A 2BUGA 1PEGA 5ARFA 4IJDA 4B89A 1ML9A 2WPVA 3FTVA 4CGWA 3EJNA 3I4GA 5M72A 1N54A 2HO1A 5EG2A 2KATA 1L5JA 1UN9A 1U3DA 3HVEB 3CLJA 2CHXA 4TRQA 5LCWC 1IYGA 3KMJA 3KMTA 4W9RA 3CKCA 3UPVA 4ANVA 3KMAA 5ARGA 4ANXA 3CEQA 4RG6A 3F9XA 3ASFA 4MLPA 4CDNA 3SF4A 5T0MA 3CHOA 1P5QA 1E7UA 3IEGA 3MO5A 3RO2A 3ZIMA 1HH8A 3FH7A 4PDXA 5JJ6A 3Q49B 5DIZA 4YNPA 2RFIA 2NC9A 1H2UA 4I2WA 4ATGA 1EPUA 2WB2A 4E6HA 3CBMA 4I51A 2EQXA 2PM7A 5C2YA 2FF4A 3L22A 5T8IA 4UI9J 1HS6A 2JLBA 2WXRA 5LOZA 2DIWA 3KD7A 2XPYA 3IV0A 3P1UA 3LYAA 3MO0A 1XGWA 4H7XA 5FQ7A 4PS3A 3CK8A 3TGOA 2BQZA 3LS8A 2Y4TA 3UX4A 2GGFA 4QEPA 3HVEA 3G2VA 5E75A 2IF4A 4KZCA 5LX8A 5CMWA 3FHEA 3OXLA 4NURA 1N52A 3B7TA 3CHQA 4UI9K 2UY1B 1IQRA 3DBSA 3FTUA 3FTWA 5KCMA 3FP3A 5FQ8A 2AW6A 1HE8A 3LPZA 4IRUA 2IFUA 5LCWJ 5TEGA 1DVPA 4N2QA 2XRYA 4I6GA 3VLEA 4EZKA 5EX3A 5JJTA 3M57A 4JEUA 3QJZA 3URZA 3UT8A 2YQ8A 4MRUA 3FH8A 3MKRA 4LERA 4Y6WA 4EZJA 4A3VA 3APCA 2WQ7A 3EIJA 2YNQA 2OVFA 5BPPA 4A1SA 4LUNU 4RSYA 3GW4A 2R59A 3SD5A 5FT9A 4ME2A 3TL5A 4YPUA 3EP0A 4FHKA 4LDGA 1XQHA 3GYZA 5CMYA 3ZEFA 4A3TA 3ESKA 4BT8A 5FJYA 4XE0A 1B89A 3SBTB 5JHNA 4F3VA 4UI9C 2Y4UA 3D9NA 5G05C 3ZYMA 3CVWA 3U66A 4CDRA 1Z6TA 2I2OA 3CVYA 2VQ2A 2CG3A 3C98A 3OS5A 4HLEA 3PREA 2F69A 4JEHA 2MHKA 1X5BA 1KLXA 3CBPA 5LFAA 2XCCA 4APFA 2PQRA 4UWFA 5KJLA 4DLOA 1KT0A 3VTXA 4V3IA 2BTDA 3G2UA 3RO3A 3SZ7A 3CVXA 4I1AA 3CK9A 2LAIA 2NXPA 4FMUA 2XGOA 5G04C 3QWPA 4HOUA 4XX5A 3CV0A 1QQEA 4Q69A 4GZ6A 3LXUX 4KT6B 3OAWA 4AP2A 3ZHEA 3MV3B 4ILHB 4J8DA 4MKTA 3S7BA 2KC7A 4GMLA 4YPEA 5E76A 3FU5A 3U64A 3M59A 1LF8A 4N3CA 5ANRA 1N6AA 4L7TA 1E90A 3FUMA 3LY7A 4LEUA 5G04J 5JINA 3FH5A 4WWPA 3AU4A 4JL0A 2IU1A 3TG4A 2Y3AA 4B0ZA 4JXTA 3D9MA 4ANUA 5KJMA 2J08A 3Q15A 4GYWA 2AXZA 4AM9A 4G2VA 2WMOA 3N71A 3FTSA 4FLHA 1XNFA 1MVHA 2V5FA 3ESLA 4QFVA 4NRHB 3D9IA 3U3WA 1HO8A 4J7IA 2WXLA 3S8PA 1W3BA 1H2TC 3LCAA 4DK5A 4GPKA 2W5YA 2VJ8A 2L6JA 4GMJA 4BSXA 4I9EA 4FJYA 5BW8C 4WNFA 4ILGA 2J4BA 2LAHA 3ZYLA 1E8WA 2CHWA 3FPDA 3ASDA 2JV0A 4QEOA 3TJPA 4GAAA 3M58A 3I5PA 4AEZC 4HOTA 3AS5A 3SGHA 3S2AA 1HFAA 3AS8A 1H0AA 2L9BA 2J9QA 4GYYA 4JHJA 2XPIA 3IHXA 3M54A 3Q4AB 5FZRA 4CCAA 5J08A 4BTBA 4JDSA 1FVHA 2QY7A 3SW9A 3NQPA 1TJCA 4WUYA 3VV0A 2KZTB 3RU0A 2LSUA 4KMOA 3WXXA 3LY9A 2GW1A 3HDXA 2WXFA 3NZSA 4UQYA 3JUIA 2FO7A 3ZN3A 2CFUA 2KCLA 4JVSA 4FP7A 3MJWA 2WXJA 4PUCA 3FU0A 4K03A 4BY6A 3SNXA 3O48A 4EQFA 3L54A 3U4TA 2W5ZA 5JJ0A 1E8YA 2YINA 2LSVA 3ENEA 3U9WA 4I2ZA 1PAQA 5AYFA 3HYMB 3UMVA 1MUFA 4NJ5A 5C1DA 4H12A 2A4ZA 2OOEA 3PNTB 2CFZA 4ANWA 2XCBA 4P29A 3MKQA 3APFA 4XI0A 5TTFA 3AS4A 4I17A 4KBQA 1JPLA 4HOQA 4YNDA 4Y6CA 4HVBA 2IGQA 5D0QD 3FUKA 1KT1A 3VTYA 3K5KA 1BPOA 2V0PA 4WWOA 2CHZA 1N6CA 3L16A 4CT0A 3FULA 2LNIA 2X6HA 3M53A 4D10C 3PUJA 4I1OB 4J8EA 2VYIA 4GA0A 4JA7A 3S7FA 3VLDA 3D9LA 3ZRHA 4AVXA 4EBAG 2M63A 4U0SA 3JQ1A 5CHEE 3QDNA 4Q96A 4G24A 4BUPA 4DLQA 4J8FA 4FJZA 4B8AA 2E2EA 1Z3XA 3LEWA 3IHVA 4FC8A 4JZYA 4EZLA 3QC1A 4Q94A 3RRUA 4FADA 2HM8A 3KAEA 1WM5A 2DCPA 2ILRA 3CHPA 4GCNA 4CGVA 1QZ2A 4PS8A 4J83A 3PNLB 4JPSA 4AJWA 5JHBA 1H6KA 2AXVA 4O6FA 4J8OA 1JUQA 4YPAA 4IJ8A 3FY4A 2DBAA 3I4RB 2WXNA 4NVQA 1FCHA 3AU5A 4WNEA 3PVLA 4NQ0A 5FZQA 4UWHA 4XIFA 2QPWA 4ILIA 2XQ0A 4E47A 3VUZA 1HZ4A 2L0TB 3ZYQA 4EECA 3IHYA 3CVQA 1S0PA 2IOLA 4BT9A 3GZ2A 2HYZA 1ELRA 2WXHA 1IQUA 2V8SE 3TG5A 1GW6A 5AIJA 5KJNA 2G46A 3ONLA 3RKVA 1MT6A 3MCXA 3EIQC 4FU3A 3CIAA 3FUEA 3FUDA 2UWJG 5T0KA 5AYWD 4C0EA 4UWKA 4AXHA 4XI9A 3MZLB 1UJKA 4FA6A 4JHKA 1HG5A 3CQCB 3MKQB 3ASGA 3RRMB 5FZSA 2FI7A 1OWPA 2X6FA 3ML8A 2A5UA 3L17A 4I6JA 4J6IA 1EYHA 1HG2A 4L23A 4F53A 5CCMA 3CHMA 1OWLA 2OV8A 2WXQA 3D9PA 3QWWA 4WWNA 5AJDA 5EX0A 4AV7A 5HQ8A 2I1JA 4U0UA 3DB5A 5F6LA 3CGHA 2IONA 3CVLA 3FUHA 4DPRA 4A55A 4HOSA 2VGXA 4HS2A 1OWNA 4F7AA 4N3BA 2VTBA 3QB2A 1TJFA 4FULA 3IBEA 4EPZA 4L2LA 1Y6IA 2X3MA 1EDUA 4JW1A 4A1GA 3CVNA 2WQ6A 1OWMA 2VSNA 2VSXE 1H3IA 3RJWA 1HU3A 1O9SA 4C9BB 1Z3YA 3D3MA 4HORA 3RQ4A 2WXKA 1UG3A 4IULA 3B7RL 2VGXB 1NA0A 3UQ3A 1VDYA 4AU7A 3T5VA 5CPRB 3FWVA 4GZCA 5BV1A 2O8JA 1E8XA 3FU6A 5BT1A 2PM6A 2C0LA 4WNGA 4ACLA 1HXIA 3K9IA 2FBNA 3QARA 2C2LA 4AOFA 3P2BA 4WNDA 4DI4A 4F1SA 3G2WA 3PDNA 2FEZA 2PQNA 3ML9A 4CEMA 2UY1A 2MRIA 1HX8A 2ONDA 4C0MA 3L08A 3JCKC 3L6AA 4M3OA 3VLFA 3PEUB 2XEVA 2J09A 2NSZA 4KXKB 2WXGA 2WVIA 3JYSA 3MA5A 4XKCA 3T5XA 3G2SA 3M5AA 3ZGQA 3D9JA 3R9AB 4GYOA 3RAYA 4L2YA 4FLBA 3ZXSA 2WXOA 5T3RA 2X38A 4N5CA 3B13A 4HXIA 4YVQC 1QNFA 3NF1A 2X6IA 4J8SA 4N39A 2IOSA 3FU3A 4U07A 5LP0A 3F9WA 3SBSA 1HF8A 2ZU6B 4U0ZA 5ENNA 5JJ7A 3RK6A 3LVQE 3FFLA 3EHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZI A;  3Q47 B;  4H7Y A;  1OUV A;  2QFC A;  4YNM A;  1A17 A;  2HR2 A;  3ZFW A;  4AY6 A;  4MI0 A;  2C0M A;  2R3A A;  5F5E A;  3OOI A;  4BTA A;  2PL2 A;  5G05 J;  3HNA A;  1ELW A;  3PE4 A;  5LSX A;  4APO A;  4G25 A;  4J0U A;  5T5G A;  2Q7F A;  4MI5 A;  2P58 C;  5TH7 A;  3Q5M A;  3UUX A;  4JA9 A;  3QKY A;  3BO5 A;  5BNW A;  4GZ5 A;  4I9C A;  4AIF A;  4Z4P A;  4GA1 A;  1MVX A;  4BWR A;  2VSY A;  5KJK A;  1ZU2 A;  2YHC A;  4GZ3 A;  3LY8 A;  4RZ0 A;  3QOU A;  2R5S A;  3CVP A;  5JIY A;  3F9Z A;  4ABN A;  5FTP A;  2XGS A;  5F59 A;  3MV2 B;  3E4B A;  3SWC A;  1NA3 A;  4UQX A;  4G26 A;  3F9Y A;  3S7D A;  5EKQ D;  4U04 A;  4J7F A;  1ZBP A;  5A6C A;  5LSZ A;  4QEN A;  3OPE A;  3TAX A;  3RIB A;  3PE3 A;  1N3J A;  2KCV A;  3DAL A;  3KS2 A;  4JHR A;  4B94 A;  4GA2 A;  4UQZ A;  4N2S A;  2VGY A;  5CCL A;  4RG9 A;  5D0O D;  2KCK A;  4N3A A;  3ZPJ A;  1NZN A;  3S7J A;  1WAO 1;  4IN3 B;  1Y8M A;  3ULQ A;  4G1T A;  3CK7 A;  5F6K C;  4GCO A;  3OXF A;  3MO2 A;  2WQH A;  3CBO A;  1YA0 A;  3LKU A;  3M56 A;  3EDT B;  3ZHE B;  2I6H A;  4YVO A;  4JLG A;  2XGM A;  1IHG A;  3M55 A;  3BEE A;  5HI7 A;  3ASH A;  4O30 A;  4AY5 A;  4C1Q A;  3MEK A;  4G23 A;  3RJV A;  5A7D B;  3CKB A;  3QWV A;  3GZ1 A;  3OXG A;  4KYO B;  2AVP A;  5DBK A;  1E96 B;  1PC2 A;  1ZKK A;  4IJD A;  2BUG A;  1PEG A;  5ARF A;  1ML9 A;  2WPV A;  4CGW A;  5EG2 A;  5M72 A;  2HO1 A;  2KAT A;  5LCW C;  3KMJ A;  1IYG A;  3KMT A;  4W9R A;  3CKC A;  3UPV A;  3KMA A;  5ARG A;  3CEQ A;  4RG6 A;  3F9X A;  3ASF A;  3SF4 A;  5T0M A;  1P5Q A;  3IEG A;  3MO5 A;  3RO2 A;  1HH8 A;  5JJ6 A;  3Q49 B;  5DIZ A;  4YNP A;  2RFI A;  2NC9 A;  4I2W A;  3CBM A;  4I51 A;  2FF4 A;  4UI9 J;  2JLB A;  3KD7 A;  3LYA A;  3MO0 A;  4H7X A;  3TGO A;  3CK8 A;  2BQZ A;  2Y4T A;  4QEP A;  2IF4 A;  3OXL A;  4UI9 K;  2UY1 B;  3FP3 A;  3LPZ A;  5LCW J;  2IFU A;  5TEG A;  4N2Q A;  5EX3 A;  5JJT A;  3M57 A;  3URZ A;  2YQ8 A;  3MKR A;  4Y6W A;  4A1S A;  3GW4 A;  5FT9 A;  4ME2 A;  4YPU A;  3EP0 A;  4LDG A;  1XQH A;  3GYZ A;  3ESK A;  4BT8 A;  5FJY A;  1B89 A;  5JHN A;  4F3V A;  4UI9 C;  2Y4U A;  5G05 C;  4CDR A;  2VQ2 A;  3OS5 A;  2F69 A;  2MHK A;  1KLX A;  3CBP A;  2XCC A;  2PQR A;  5KJL A;  1KT0 A;  3VTX A;  3RO3 A;  3SZ7 A;  4I1A A;  3CK9 A;  4FMU A;  2XGO A;  5G04 C;  3QWP A;  4HOU A;  3CV0 A;  1QQE A;  4GZ6 A;  3ZHE A;  3MV3 B;  4J8D A;  3S7B A;  2KC7 A;  4YPE A;  3M59 A;  4N3C A;  1N6A A;  3LY7 A;  4LEU A;  5G04 J;  5JIN A;  4JL0 A;  3TG4 A;  5KJM A;  3Q15 A;  4GYW A;  4AM9 A;  4G2V A;  3N71 A;  1XNF A;  1MVH A;  2V5F A;  3U3W A;  4NRH B;  4J7I A;  3S8P A;  1W3B A;  3LCA A;  4GPK A;  2W5Y A;  2L6J A;  4I9E A;  5BW8 C;  4WNF A;  3FPD A;  3ASD A;  2JV0 A;  4QEO A;  3M58 A;  4HOT A;  3AS5 A;  3AS8 A;  2J9Q A;  4GYY A;  3IHX A;  2XPI A;  3M54 A;  3Q4A B;  5FZR A;  4JDS A;  4BTB A;  3SW9 A;  1TJC A;  4WUY A;  3VV0 A;  3RU0 A;  2LSU A;  3WXX A;  3LY9 A;  2GW1 A;  4UQY A;  3ZN3 A;  2FO7 A;  2KCL A;  3O48 A;  4EQF A;  2W5Z A;  3U4T A;  5JJ0 A;  2LSV A;  4I2Z A;  5AYF A;  3HYM B;  1MUF A;  4NJ5 A;  5C1D A;  4H12 A;  2OOE A;  2XCB A;  4XI0 A;  5TTF A;  3AS4 A;  4I17 A;  4KBQ A;  4HOQ A;  4YND A;  4Y6C A;  2IGQ A;  5D0Q D;  1KT1 A;  3VTY A;  3K5K A;  1N6C A;  2LNI A;  3M53 A;  4J8E A;  4JA7 A;  2VYI A;  4GA0 A;  3S7F A;  4U0S A;  5CHE E;  3QDN A;  4G24 A;  4BUP A;  4J8F A;  2E2E A;  3KAE A;  1WM5 A;  4GCN A;  4J83 A;  4CGV A;  1QZ2 A;  4O6F A;  4J8O A;  4YPA A;  4IJ8 A;  2DBA A;  4NVQ A;  1FCH A;  4WNE A;  4NQ0 A;  5FZQ A;  4XIF A;  2QPW A;  4E47 A;  3VUZ A;  1HZ4 A;  3CVQ A;  4BT9 A;  3GZ2 A;  2HYZ A;  1ELR A;  5KJN A;  3TG5 A;  2G46 A;  3RKV A;  1MT6 A;  2UWJ G;  5T0K A;  5AYW D;  4XI9 A;  3ASG A;  5FZS A;  2FI7 A;  5CCM A;  3QWW A;  3DB5 A;  5EX0 A;  5HQ8 A;  4U0U A;  5F6L A;  3CVL A;  4HOS A;  2VGX A;  4N3B A;  3CVN A;  2VSN A;  1H3I A;  3RJW A;  1O9S A;  4HOR A;  3RQ4 A;  2VGX B;  1NA0 A;  3UQ3 A;  4AU7 A;  5CPR B;  3FWV A;  2O8J A;  5BT1 A;  2C0L A;  4WNG A;  1HXI A;  3K9I A;  2FBN A;  2C2L A;  4WND A;  3PDN A;  2FEZ A;  2PQN A;  2UY1 A;  2OND A;  2XEV A;  4KXK B;  3JYS A;  3MA5 A;  3M5A A;  3ZGQ A;  3R9A B;  3RAY A;  4GYO A;  4N5C A;  4YVQ C;  3NF1 A;  4N39 A;  4U07 A;  3F9W A;  4U0Z A;  5JJ7 A;  3FFL A; 
#chains in the Genus database with same CATH topology
 1JWF A;  2IQC A;  4H7Y A;  2QFC A;  4DJA A;  2HR2 A;  4AY6 A;  2C0M A;  2YHE A;  3MX3 A;  5A23 A;  5AEN A;  1TNB A;  4APO A;  2GRM A;  3Q5M A;  3CVV A;  3JXI A;  2IO3 C;  2H6G A;  3SHF A;  1BI8 B;  1H6P A;  3HIZ A;  2GRR B;  4AIF A;  4GA1 A;  1MVX A;  1DNP A;  2XHE A;  3I3N A;  3ULE G;  4BX8 A;  4UWG A;  4LG6 A;  4MS6 A;  2XGS A;  4I1M A;  4BX9 A;  3E4B A;  2WMN A;  3F9Y A;  3PRZ A;  4U04 A;  3UT7 A;  3PZ1 A;  3SY2 A;  1ELK A;  1PY1 A;  5EDS A;  3D9K A;  4QEN A;  2R02 A;  3OPE A;  3UM1 A;  1N0R A;  1Q2Z A;  1N94 A;  2KM4 A;  2KCV A;  3DAL A;  4R7L A;  4B94 A;  3DEP A;  3EU5 A;  5CBO A;  4UQZ A;  3TXN A;  3ASO E;  5D0O D;  5CCL A;  2KCK A;  3S7J A;  1WAO 1;  4BES A;  2OVB A;  1H6O A;  5F6K C;  3CK7 A;  2KXP C;  4GCO A;  3MO2 A;  3FTX A;  2X6J A;  3M56 A;  2BF0 X;  3EDT B;  3ZHE B;  4CRW A;  4KVO A;  4GPM A;  3DSV A;  3PH0 C;  3OTN A;  5G2N A;  1U3C A;  4X8Q A;  5CBN A;  4NAC A;  4OVU A;  3ZVV A;  2GRQ B;  3R9M A;  1E7V A;  1FVF A;  3MYV A;  4AY5 A;  2V4L A;  5ENP D;  4C1Q A;  4CYM D;  4GZD A;  4G23 A;  4K0R A;  3W9G A;  3QWV A;  3B7S A;  3GZS A;  2AVP A;  3JQ0 A;  3T9K A;  5DBK A;  4MBG A;  1ZKK A;  1MJ0 A;  4IJD A;  2BUG A;  1PEG A;  5D2M C;  1N11 A;  4B89 A;  3I4G A;  3UXG A;  5M72 A;  3HVE B;  1YCS B;  3UPV A;  4XEI G;  3ASF A;  3SF4 A;  1P5Q A;  1E7U A;  3ZIM A;  4PDX A;  2DZN A;  2NC9 A;  2V5Q C;  5AAR A;  1K3Z D;  1EPU A;  2PM7 A;  5T8I A;  5LOZ A;  3MO0 A;  1XGW A;  3TGO A;  2AJA A;  3DST A;  4KZC A;  3OXL A;  4NUR A;  4UI9 K;  3FTU A;  1HE8 A;  1OCO E;  1DVP A;  4N2Q A;  3VLE A;  3UT8 A;  2YQ8 A;  3APC A;  3EIJ A;  4LUN U;  3ZNG A;  3GW4 A;  3SD5 A;  3LJN A;  4LDG A;  1XQH A;  3ZEF A;  3ESK A;  4BT8 A;  4XE0 A;  3ABK E;  5JHN A;  3ZYM A;  4CDR A;  3F6Q A;  4HLL A;  3CVY A;  3OS5 A;  2J8S D;  3Q9N C;  2DWZ A;  2DVW A;  1KPS B;  2PQR A;  5KJL A;  4V3I A;  3RO3 A;  2XGO A;  4HOU A;  3CV0 A;  4Q69 A;  1V55 E;  4GTS A;  5HS0 A;  5ENO D;  3ZHE A;  3MV3 B;  3S7B A;  4YPE A;  1OT8 A;  3C3O A;  1N6A A;  3LY7 A;  4LEU A;  3AU4 A;  2Y3A A;  3D9M A;  5JMN D;  4GYW A;  1X81 A;  1V54 E;  3DXK G;  4NRH B;  2WXL A;  1MX2 A;  2W5Y A;  4GMJ A;  4BSX A;  4I9E A;  4F6R D;  2LAH A;  3ZYL A;  1E8W A;  2CHW A;  2V4H C;  4G8K A;  3FPD A;  3TJP A;  3I5P A;  3IHX A;  4JHJ A;  2XPI A;  5J08 A;  1FVH A;  1FT1 A;  3C3R A;  4WUY A;  3RU0 A;  2LSU A;  3DPY A;  3LY9 A;  3NZS A;  4UQY A;  2WXF A;  5HRY A;  2CFU A;  4JVS A;  1N4S A;  3MJW A;  4K03 A;  4JD2 G;  2W5Z A;  3L54 A;  1E8Y A;  4I2Z A;  3UMV A;  2A4Z A;  4GMR A;  2IEJ A;  4P29 A;  3MKQ A;  3APF A;  4XI0 A;  5ENS D;  1QBQ A;  2P9K G;  5CEA A;  1KT1 A;  4BSZ B;  2ZGG A;  4WWO A;  3M53 A;  4D10 C;  3VLD A;  2VYI A;  2QYU A;  1OCC E;  4EBA G;  4U0S A;  3DWL G;  3QDN A;  4G24 A;  1KZP A;  3PZ4 A;  1Z3X A;  4Q94 A;  4FAD A;  3J5Q B;  4J83 A;  3CHP A;  4K5A B;  4JPS A;  5JHB A;  1H6K A;  2AXV A;  1BD8 A;  4YPA A;  1FCH A;  3AU5 A;  4WNE A;  3PVL A;  5FZQ A;  1N4R A;  4F1P A;  3E30 A;  4EEC A;  3IHY A;  1DCE A;  2IOL A;  4BT9 A;  3EUV A;  2HYZ A;  3V79 K;  5KJN A;  3TG5 A;  1GW6 A;  3RKV A;  1D8D A;  4FU3 A;  3FUD A;  4ATZ D;  1UJK A;  3MKQ B;  1MX6 A;  4U8V D;  1OWP A;  2A5U A;  4I6J A;  1EYH A;  5CCM A;  1OY3 D;  3KSL A;  5FIN A;  2XS1 A;  2ION A;  1YMP A;  4F7A A;  4N3B A;  2VTB A;  3QB2 A;  1TJF A;  2LUH A;  3DSW A;  4JW1 A;  1EDU A;  2VSN A;  1H3I A;  1HU3 A;  4C9B B;  1Z3Y A;  3Q79 A;  2XEN A;  4AU7 A;  2EIL E;  3Q9U C;  3FU6 A;  1HXI A;  4AOF A;  4WND A;  4BER A;  4DI4 A;  4F1S A;  2FEZ A;  2PQN A;  2UY1 A;  3L6A A;  3VLF A;  2WXG A;  3MA5 A;  4XKC A;  3G2S A;  3Q7F A;  3D9J A;  1SVX A;  2X38 A;  1LD8 A;  3B13 A;  4HXI A;  4YVQ C;  4HRM B;  2ZIS A;  4YDW A;  2ZU6 B;  4U0Z A;  1FT2 A;  3D9H A;  2MOW A;  4L1B A;  4YNM A;  2J07 A;  2IJG X;  3ZFW A;  4MI0 A;  3BUA A;  1TNU A;  3CHR A;  2RKK A;  4EHM A;  3OOI A;  2XEH A;  3ABL E;  5G05 J;  3HNA A;  1ELW A;  4GTR A;  4OVV A;  2XS8 A;  5TH7 A;  1SQM A;  1WG0 A;  4JA9 A;  3QKY A;  3BO5 A;  5BNW A;  3BG0 B;  2F0Y A;  3FTZ A;  3UTM A;  4BWR A;  5KJK A;  1ZU2 A;  3FEY A;  3NZU A;  3TWV A;  3LY8 A;  4U96 D;  2XPZ A;  4IYP A;  4TUM A;  3CVP A;  4DX2 A;  3FUJ A;  3UIO C;  2CG2 A;  5JIY A;  5BV0 A;  2WXI A;  3QNK A;  4GTM A;  1MQS A;  3EHM A;  5F59 A;  2AXU A;  1N4Q A;  1D9S A;  1NA3 A;  4UQX A;  2R17 C;  4ACK A;  3S7D A;  2KZT A;  3FUF A;  5EKQ D;  1SZA A;  5A6C A;  2RD0 A;  3ONK A;  4I6E A;  1K1A A;  1O5M A;  5AQA A;  3L82 A;  1N3J A;  4URK A;  3FTY A;  4GA2 A;  1IHB A;  4RG9 A;  3FEX A;  3TXM A;  2H6H A;  4IN3 B;  3C5R A;  1BU9 A;  1Y8M A;  3CR3 A;  3ULQ A;  1TEZ A;  3OXF A;  3PUK A;  3ABM E;  1IXV A;  2WQH A;  3CBO A;  1YA0 A;  2I9C A;  3ZW3 A;  4HB5 A;  1OXJ A;  3DRA A;  1OWO A;  4FHJ A;  3QAQ A;  1IHG A;  2WXP A;  3FDH A;  4M7C A;  2FO1 E;  3KEZ A;  4XZ4 A;  3GZ1 A;  4KYO B;  2ZIR A;  1E96 B;  1D8E A;  2KBX A;  3LJ3 A;  4CGW A;  2P9P G;  3EJN A;  1N54 A;  2KAT A;  1TN6 A;  5BXU A;  1L5J A;  3DEO A;  2H6F A;  3UIN C;  2DYR E;  3CLJ A;  1TN7 A;  5LCW C;  1IYG A;  3KMJ A;  3UM0 A;  4W9R A;  4U8Y D;  3CKC A;  5ARG A;  3CEQ A;  4RG6 A;  3F9X A;  4MLP A;  4CDN A;  5T0M A;  3IEG A;  1TNZ A;  1HH8 A;  3FH7 A;  3Q49 B;  1H2U A;  1JCQ A;  3CBM A;  4I51 A;  5C2Y A;  4DX6 D;  2R05 A;  4GTV A;  2WXR A;  3KD7 A;  3LYA A;  4H7X A;  5FQ7 A;  4CZ2 D;  2QC9 A;  5CMW A;  5BXO A;  3FHE A;  3B7T A;  3FTW A;  5FQ8 A;  5LCW J;  2QZA A;  2XRY A;  4JEU A;  3QJZ A;  4MRU A;  2OVF A;  5BPP A;  4GTT A;  5AQB A;  5FT9 A;  3GYZ A;  4A3T A;  1B89 A;  1TYQ G;  1Z6T A;  2VQ2 A;  4HLE A;  3PRE A;  2F69 A;  2MHK A;  1UOH A;  5KNG A;  3HXE A;  4UWF A;  1KT0 A;  3G2U A;  3CK9 A;  5EYL A;  2NXP A;  3LXU X;  4AP2 A;  1AWC B;  4GML A;  3M59 A;  4B93 B;  4N3C A;  5G04 J;  4WWP A;  4JL0 A;  2OEW A;  4ANU A;  2F37 A;  2ZXW E;  3FTS A;  3N71 A;  4FLH A;  1XNF A;  1MVH A;  2V5F A;  3ESL A;  3U3W A;  3D9I A;  4GTP A;  4GPK A;  2VJ8 A;  2L6J A;  5B1B E;  4FJY A;  1AP7 A;  2JV0 A;  4GAA A;  3M58 A;  3S2A A;  1H0A A;  4GYY A;  4JDS A;  4BTB A;  3SW9 A;  1TJC A;  2KZT B;  4KMO A;  2GW1 A;  3HDX A;  2FO7 A;  3ZXP A;  2WXJ A;  5ENQ D;  4BY6 A;  3SNX A;  5AAO A;  4EQF A;  3Q7A A;  3BU8 A;  1PAQ A;  1DC2 A;  5AYF A;  3HYM B;  1MUF A;  1LTX A;  3PNT B;  2XCB A;  2IO2 C;  3SFX A;  3AS4 A;  5EID A;  4KBQ A;  4C48 B;  4YND A;  5D0Q D;  3FUK A;  2P9N G;  2V0P A;  1U2V G;  4J8Y A;  1N6C A;  2LNI A;  2X6H A;  3PUJ A;  3B95 A;  3S7F A;  5ENT D;  4DX7 D;  3JQ1 A;  4Q96 A;  4FJZ A;  1O1S A;  3LEW A;  2NYJ A;  3QC1 A;  1A5E A;  4NIK A;  2P9L G;  2ILR A;  4CGV A;  3UKR G;  3X2Q E;  1S63 A;  1JUQ A;  2DBA A;  4NVQ A;  4NQ0 A;  4UWH A;  4XIF A;  4ILI A;  3VUZ A;  1S0P A;  3GZ2 A;  1ELR A;  1IQU A;  2V8S E;  5KWD A;  3MCX A;  2UWJ G;  5AYW D;  4XI9 A;  3MZL B;  3HXF A;  1HG5 A;  3ASG A;  3RRM B;  5FZS A;  2FI7 A;  3E34 A;  2X6F A;  3ML8 A;  1K8K G;  2OV8 A;  5AJD A;  3QWW A;  2I1J A;  4U0U A;  3CVL A;  4HOS A;  4HRL A;  1O1R A;  4FUL A;  3IBE A;  3UM3 A;  1MYO A;  2X3M A;  4LSZ E;  2WQ6 A;  2VSX E;  1O9S A;  2WXK A;  1UG3 A;  3B7R L;  2VGX B;  1NA0 A;  2F8X K;  1VDY A;  3T5V A;  3EU9 A;  5BT1 A;  2PM6 A;  2FBN A;  3QAR A;  2C2L A;  4RQI A;  3G2W A;  3ML9 A;  3DSU A;  3AG4 E;  2MRI A;  5B3S E;  2OND A;  3JCK C;  2J09 A;  4KXK B;  1SA5 A;  4HRN A;  3M5A A;  4GYO A;  2L6B A;  3E32 A;  4J8S A;  3FU3 A;  5D66 A;  4U07 A;  5ENN A;  3LVQ E;  5JHA A;  3Q47 B;  1OUV A;  1SZ9 A;  5FIO A;  1A17 A;  1JCS A;  4PH4 B;  4G11 A;  4LCT A;  3L13 A;  4BTA A;  3QK0 A;  2MYO A;  3PE4 A;  3PZD A;  5ANL A;  5LSX A;  3LDZ A;  4J0U A;  2Q7F A;  2P58 C;  4HI8 A;  2GRP B;  4HBD A;  3UIP C;  3UUX A;  4GB9 A;  1UW4 B;  2VSY A;  4RVB A;  2YHC A;  3DPD A;  1UN8 A;  4QQI A;  4RZ0 A;  1INZ A;  2J49 A;  2X6K A;  4KVM A;  1QYM A;  3F9Z A;  4CT4 A;  5FTP A;  2WXM A;  5J90 A;  3ASN E;  2B0O E;  3MV2 B;  3SWC A;  2GRL A;  4G26 A;  1RW2 A;  4LRZ A;  4J7F A;  5LSZ A;  3MGB A;  2J4D A;  3HXD A;  3RIB A;  4PS7 A;  5FQ6 A;  2P2C P;  4B8C B;  2BKG A;  2JEK A;  3CST A;  3FUN A;  4N2S A;  3ZPJ A;  2QYJ A;  1NZN A;  3HHM A;  3IKO B;  2RG8 A;  4XKB A;  3CHS A;  3FUI A;  4BFR A;  3LVR E;  2P9U G;  4K5C A;  3TWU A;  3SFZ A;  2I6H A;  4YVO A;  3O4Z A;  1DCQ A;  5BUZ A;  1H2V C;  1WY6 A;  4CDM A;  3UM2 A;  3PS6 A;  1MHQ A;  1MZC A;  1NL4 A;  2ETC A;  1N0Q A;  4O30 A;  4I43 A;  1JWG A;  3CQG B;  1H19 A;  3CKB A;  2IY0 C;  2L0I A;  1UJJ A;  3TWX A;  2AWI A;  4GTQ A;  5ARF A;  4G8L A;  4TXP A;  2WPV A;  1ML9 A;  5EG2 A;  2HO1 A;  1UN9 A;  1U3D A;  4TRQ A;  3KMT A;  2DYS E;  4ANV A;  4ANX A;  3TWS A;  3NBN B;  3CHO A;  4TXQ A;  3RO2 A;  1BI7 B;  5JA4 D;  4YNP A;  2RFI A;  4I2W A;  3V30 A;  4ATG A;  3L22 A;  1HS6 A;  2JLB A;  5EIB E;  4OAV B;  3IV0 A;  3JUE A;  4PS3 A;  2Y4T A;  2BKK B;  4QEP A;  3HVE A;  3G2V A;  5E75 A;  1N52 A;  3CHQ A;  4JB8 P;  2UY1 B;  1IQR A;  3DBS A;  3LPZ A;  2IFU A;  4I6G A;  4EZK A;  5EX3 A;  3M57 A;  3FH8 A;  3MKR A;  4LER A;  4EZJ A;  4O60 A;  3KSQ A;  2YNQ A;  2R59 A;  3TL5 A;  4ME2 A;  3EP0 A;  2GRO B;  5CMY A;  1TR4 A;  1BLX B;  4UI9 C;  2Y4U A;  5G05 C;  3CVW A;  2I2O A;  3C98 A;  1X5B A;  1KLX A;  3CBP A;  5LFA A;  2XCC A;  4ZHB A;  3VTX A;  3UI2 A;  2BTD A;  3HRA A;  2PNN A;  3QWP A;  2ETB A;  1QQE A;  4GZ6 A;  3DSX A;  3Q78 A;  3OAW A;  4ILH B;  4J8D A;  4MKT A;  5ANR A;  4L7T A;  3FUM A;  5JIN A;  4O1O A;  4B0Z A;  5KJM A;  2J08 A;  2P9S G;  3E37 A;  3Q15 A;  2AXZ A;  2DZO A;  4G2V A;  3PZ3 A;  4QFV A;  4J7I A;  2ETA A;  3LCA A;  4DK5 A;  5CRV A;  4ILG A;  2J4B A;  2A5E A;  3ASD A;  1S70 B;  4QEO A;  1WDY A;  3J5P A;  5EN5 D;  4AEZ C;  4HOT A;  3AS5 A;  1HFA A;  3Q4A B;  4CCA A;  2QY7 A;  3NQP A;  3VV0 A;  3WXX A;  3JUI A;  4FP7 A;  4PUC A;  3O48 A;  3U4T A;  5C1D A;  4H12 A;  2OOE A;  2CFZ A;  1G3N B;  1Z5S C;  5TTF A;  2GRN B;  4Y6C A;  2IGQ A;  3K5K A;  1BPO A;  2CHZ A;  3L16 A;  3FUL A;  4I1O B;  4J8E A;  4JA7 A;  3ZRH A;  3D9L A;  2M63 A;  5CHE E;  3DSS A;  4BUP A;  4DLQ A;  4FC8 A;  3IHV A;  4HQD A;  1QZ2 A;  4OAU C;  5AQ7 A;  2XZD G;  4IJ8 A;  3I4R B;  3WG7 E;  4YDE A;  2QPW A;  2XQ0 A;  5AQ9 A;  2EIN E;  1HZ4 A;  2L0T B;  3ZYQ A;  4L9P A;  2Y0B G;  2WXH A;  5AIJ A;  3FUE A;  3C3Q A;  1IKN D;  4UWK A;  4AXH A;  4JHK A;  1RZ4 A;  3L17 A;  4J6I A;  3CHM A;  1OWL A;  2WXQ A;  3D9P A;  4WWN A;  5EX0 A;  4AV7 A;  5F6L A;  3FUH A;  4A55 A;  2VGX A;  4HS2 A;  1OWN A;  2R2L A;  5H7P A;  4EPZ A;  4L2L A;  1OWM A;  3D3M A;  4HOR A;  3RQ4 A;  3ZUV B;  4IUL A;  3UQ3 A;  5CPR B;  3FWV A;  4GZC A;  2O8J A;  1E8X A;  1SW6 A;  4WNG A;  4ACL A;  3JXJ A;  3P2B A;  1MX4 A;  4UUC A;  4GTO A;  1HX8 A;  4C0M A;  2B6C A;  3PEU B;  5CED B;  2NSZ A;  2XEV A;  3T5X A;  3JYS A;  5CER B;  3ZGQ A;  3RAY A;  4L2Y A;  5KNH D;  3ZXS A;  4N5C A;  3NF1 A;  2X6I A;  2IOS A;  4DRX E;  3F9W A;  3EHN A;  3NAW A;  3FFL A;  4ZFH A;  2PZI A;  4K5B A;  1TNO A;  3W9F A;  1OCZ E;  3HG0 D;  2WM9 A;  2R3A A;  5F5E A;  3SFY A;  2LXM A;  2PL2 A;  3PEV B;  4G25 A;  5T5G A;  4MI5 A;  2LO6 A;  3AAA C;  5EIL A;  1EF1 C;  4U7E B;  3NOG D;  4KZ0 A;  5G55 A;  2HE0 A;  3BQO A;  3B7B A;  4WAF A;  4GZ5 A;  4I9C A;  4Z4P A;  2E0I A;  1NP7 A;  4GZ3 A;  4BET A;  4HFG A;  5FWQ A;  4A63 B;  4DX5 D;  3QOU A;  3CSF A;  2R5S A;  4DX1 A;  3V2O A;  3CVU A;  3G2T A;  4ABN A;  3SI5 A;  4U8H A;  2VTB B;  3RSE G;  1E8Z A;  4DI3 A;  4YDO A;  1ZBP A;  2EIM E;  3RRN B;  3T8M A;  2XZT G;  4JC8 A;  4J7W A;  3R7R A;  1YYH A;  1O1T A;  3Q73 A;  3TAX A;  3PE3 A;  2FUL A;  3KS2 A;  3APD A;  4JHR A;  3PZ2 A;  5FQ4 A;  3Q75 A;  2I1K A;  4EBA A;  2VGY A;  2Y69 E;  4N3A A;  3R7Q A;  5T4Y A;  3NOC D;  4UWL A;  4TUU A;  4G1T A;  5AJL A;  2EIK E;  3ZYK A;  3UT4 A;  3D9O A;  2R03 A;  3BG1 B;  3LKU A;  2VSO E;  2XEE A;  4TXR A;  2H6I A;  4JLG A;  2XGM A;  3M55 A;  3BEE A;  1S64 A;  5HI7 A;  3ASH A;  3RAU A;  5IY5 E;  3T8K A;  4E85 A;  3MEK A;  3RJV A;  5A7D B;  1TNY A;  4LNU D;  3OXG A;  4GU5 A;  4OYS A;  4U63 A;  3B7U X;  1PC2 A;  2XRZ A;  1OCR E;  1SA4 A;  4TV3 A;  3DXM G;  3FTV A;  2CHX A;  3KMA A;  3SO8 A;  3MO5 A;  5JJ6 A;  1NI1 A;  5DIZ A;  4N5Q A;  2WB2 A;  4E6H A;  2EQX A;  4Z68 A;  2FF4 A;  4UI9 J;  2DIW A;  2XPY A;  3P1U A;  3CK8 A;  5B1A E;  2BQZ A;  3LS8 A;  1K1B A;  3UX4 A;  2GGF A;  3NB2 A;  2IF4 A;  5LX8 A;  1N9A A;  5KCM A;  3FP3 A;  4RLY A;  2AW6 A;  4IRU A;  5TEG A;  1NFI E;  5JJT A;  5CEC B;  2RFM A;  3URZ A;  4Y6W A;  4A3V A;  2WQ7 A;  2Y1L E;  4A1S A;  4RSY A;  4YPU A;  4FHK A;  5FJY A;  5AN8 A;  3SBT B;  4F3V A;  3D9N A;  2OCC E;  3U66 A;  2CG3 A;  4YDY A;  4JEH A;  2RFA A;  4APF A;  3TWW A;  2VGE A;  4O1P A;  4DLO A;  3SZ7 A;  3CVX A;  4I1A A;  3ISM C;  2LAI A;  4FMU A;  5G04 C;  4XX5 A;  4KT6 B;  3HXB A;  2BED A;  2KC7 A;  5E76 A;  3FU5 A;  3U64 A;  1LF8 A;  1E90 A;  3HXC A;  3FH5 A;  3TWR A;  5ENR D;  2IU1 A;  3TG4 A;  5KBA A;  3ZU7 B;  4JXT A;  3AG1 E;  5ITZ F;  4AM9 A;  2WMO A;  3EHQ A;  1HO8 A;  4BEP A;  3S8P A;  1W3B A;  1H2T C;  4LNG A;  5BW8 C;  4WNF A;  1TN8 A;  3AG2 E;  3SGH A;  3AS8 A;  2L9B A;  2J9Q A;  3M54 A;  5FZR A;  2JAB A;  3IXE A;  2F8Y A;  2ZGD A;  3ZN3 A;  3KEA A;  3ULY A;  2KCL A;  3FU0 A;  1N4P A;  3UKU G;  5JJ0 A;  2YIN A;  2LSV A;  3ENE A;  3U9W A;  4NJ5 A;  1KZO A;  4ANW A;  4I17 A;  1JPL A;  4HOQ A;  3C72 A;  4HVB A;  1N95 A;  3VTY A;  4CT0 A;  4GA0 A;  4DUI A;  4AVX A;  4J8F A;  4B8A A;  2E2E A;  4EZL A;  4JZY A;  3RRU A;  2HM8 A;  3KAE A;  1WM5 A;  2DCP A;  4GCN A;  4HI9 A;  3TWQ A;  4PS8 A;  3PNL B;  1FPP A;  4AJW A;  4O6F A;  4J8O A;  3FY4 A;  2WXN A;  3EHR A;  3AJI A;  5HKP A;  4E47 A;  3CVQ A;  2G46 A;  1LD7 A;  3ONL A;  1MT6 A;  3EIQ C;  3CIA A;  5T0K A;  4C0E A;  4HNA D;  4FA6 A;  2OEV A;  3CQC B;  2EIJ E;  2LXL A;  4F53 A;  1HG2 A;  4L23 A;  1JCR A;  3DB5 A;  5HQ8 A;  4DPR A;  3CGH A;  5CRU A;  4LNB A;  1Y6I A;  4A1G A;  3CVN A;  3RJW A;  3SQV A;  3L9T A;  5BV1 A;  2P9I G;  4U95 D;  3E33 A;  2C0L A;  3K9I A;  3ZKJ A;  3TWT A;  3PDN A;  4CEM A;  3AG3 E;  3L08 A;  4M3O A;  5EYP F;  2WVI A;  1ZB1 A;  3R9A B;  4FLB A;  2WXO A;  5T3R A;  1QNF A;  4N39 A;  3V2X A;  5LP0 A;  3SBS A;  1HF8 A;  5JJ7 A;  3RK6 A;  3V31 A; 
#chains in the Genus database with same CATH homology
 1JWF A;  2MOW A;  5JHA A;  2PZI A;  2IQC A;  3Q47 B;  1OUV A;  4H7Y A;  1SZ9 A;  2QFC A;  4L1B A;  4YNM A;  2J07 A;  1A17 A;  4DJA A;  2IJG X;  2HR2 A;  3ZFW A;  4AY6 A;  4MI0 A;  4PH4 B;  2C0M A;  4G11 A;  2WM9 A;  3CHR A;  2YHE A;  2R3A A;  5F5E A;  4LCT A;  3MX3 A;  3OOI A;  5A23 A;  3L13 A;  4BTA A;  3QK0 A;  2PL2 A;  5G05 J;  5AEN A;  3HNA A;  1ELW A;  3PE4 A;  3PZD A;  5ANL A;  5LSX A;  4APO A;  3LDZ A;  3PEV B;  4G25 A;  4J0U A;  5T5G A;  2Q7F A;  4MI5 A;  2LO6 A;  4OVV A;  2GRM A;  2P58 C;  5TH7 A;  3Q5M A;  3CVV A;  1EF1 C;  4KZ0 A;  1SQM A;  5G55 A;  3SHF A;  3UUX A;  4JA9 A;  3QKY A;  3HIZ A;  4WAF A;  3BO5 A;  5BNW A;  3BG0 B;  3FTZ A;  4GZ5 A;  4I9C A;  4AIF A;  4GB9 A;  4Z4P A;  4GA1 A;  1MVX A;  1UW4 B;  2VSY A;  4RVB A;  4BWR A;  2E0I A;  1ZU2 A;  2YHC A;  5KJK A;  1NP7 A;  4GZ3 A;  1DNP A;  2XHE A;  3FEY A;  3NZU A;  3DPD A;  1UN8 A;  3I3N A;  3LY8 A;  4RZ0 A;  4HFG A;  5FWQ A;  2XPZ A;  3QOU A;  4IYP A;  1INZ A;  3CSF A;  3CVP A;  2R5S A;  4BX8 A;  2J49 A;  2X6K A;  4UWG A;  3FUJ A;  4MS6 A;  4KVM A;  3CVU A;  2CG2 A;  5JIY A;  3F9Z A;  5BV0 A;  2WXI A;  3G2T A;  4ABN A;  4CT4 A;  3QNK A;  5FTP A;  2WXM A;  5J90 A;  1MQS A;  3EHM A;  2XGS A;  4I1M A;  3SI5 A;  4U8H A;  4BX9 A;  3MV2 B;  2VTB B;  5F59 A;  2AXU A;  3E4B A;  3SWC A;  1NA3 A;  2GRL A;  2WMN A;  1E8Z A;  4UQX A;  2R17 C;  4ACK A;  4G26 A;  4LRZ A;  3F9Y A;  3PRZ A;  3S7D A;  4DI3 A;  2KZT A;  3FUF A;  4U04 A;  5EKQ D;  4J7F A;  1SZA A;  3UT7 A;  1ZBP A;  5A6C A;  3RRN B;  2RD0 A;  3ONK A;  3T8M A;  4I6E A;  4JC8 A;  1ELK A;  3R7R A;  5LSZ A;  3MGB A;  2J4D A;  1PY1 A;  5EDS A;  3D9K A;  4QEN A;  3OPE A;  3TAX A;  3RIB A;  3PE3 A;  4PS7 A;  1N3J A;  5FQ6 A;  2FUL A;  2KM4 A;  4URK A;  2KCV A;  3DAL A;  3KS2 A;  3APD A;  3FTY A;  4JHR A;  4R7L A;  4B94 A;  5FQ4 A;  4B8C B;  2JEK A;  3FUN A;  3CST A;  4GA2 A;  4UQZ A;  2I1K A;  3TXN A;  4EBA A;  4N2S A;  2VGY A;  4RG9 A;  5D0O D;  5CCL A;  2KCK A;  4N3A A;  3FEX A;  1NZN A;  3HHM A;  3IKO B;  3R7Q A;  3S7J A;  3TXM A;  3ZPJ A;  1WAO 1;  4IN3 B;  5T4Y A;  4UWL A;  2OVB A;  2RG8 A;  4TUU A;  1Y8M A;  3CR3 A;  4XKB A;  4G1T A;  3CHS A;  3CK7 A;  3FUI A;  5AJL A;  3ULQ A;  4BFR A;  1TEZ A;  4GCO A;  5F6K C;  3OXF A;  3LVR E;  3MO2 A;  3PUK A;  2WQH A;  3UT4 A;  3D9O A;  3BG1 B;  3ZYK A;  3FTX A;  1YA0 A;  3CBO A;  2I9C A;  3LKU A;  2X6J A;  2VSO E;  3M56 A;  3ZW3 A;  2BF0 X;  3EDT B;  3ZHE B;  4CRW A;  4KVO A;  3SFZ A;  2I6H A;  3PH0 C;  3OTN A;  3O4Z A;  4YVO A;  1OWO A;  5BUZ A;  5G2N A;  1H2V C;  1U3C A;  1WY6 A;  4FHJ A;  4CDM A;  4JLG A;  3QAQ A;  4NAC A;  2XGM A;  1IHG A;  3PS6 A;  1MHQ A;  4OVU A;  3BEE A;  3ZVV A;  1E7V A;  2WXP A;  5HI7 A;  3M55 A;  3ASH A;  4O30 A;  1FVF A;  3MYV A;  4AY5 A;  3FDH A;  4E85 A;  2V4L A;  4C1Q A;  4I43 A;  1JWG A;  3MEK A;  4GZD A;  3CQG B;  4G23 A;  3RJV A;  3KEZ A;  5A7D B;  1H19 A;  3CKB A;  4K0R A;  3QWV A;  3B7S A;  4XZ4 A;  3GZ1 A;  3GZS A;  3OXG A;  4KYO B;  2AVP A;  4GU5 A;  4OYS A;  2L0I A;  3JQ0 A;  5DBK A;  4U63 A;  3B7U X;  1E96 B;  1PC2 A;  1UJJ A;  1ZKK A;  2XRZ A;  3LJ3 A;  2AWI A;  4TV3 A;  2BUG A;  1PEG A;  5ARF A;  4IJD A;  4B89 A;  1ML9 A;  2WPV A;  3FTV A;  4CGW A;  3EJN A;  3I4G A;  5M72 A;  1N54 A;  2HO1 A;  5EG2 A;  2KAT A;  1L5J A;  1UN9 A;  1U3D A;  3HVE B;  3CLJ A;  2CHX A;  4TRQ A;  5LCW C;  1IYG A;  3KMJ A;  3KMT A;  4W9R A;  3CKC A;  3UPV A;  4ANV A;  3KMA A;  5ARG A;  4ANX A;  3CEQ A;  4RG6 A;  3F9X A;  3ASF A;  4MLP A;  4CDN A;  3SF4 A;  5T0M A;  3CHO A;  1P5Q A;  1E7U A;  3IEG A;  3MO5 A;  3RO2 A;  3ZIM A;  1HH8 A;  3FH7 A;  4PDX A;  5JJ6 A;  3Q49 B;  5DIZ A;  4YNP A;  2RFI A;  2NC9 A;  1H2U A;  4I2W A;  4ATG A;  1EPU A;  2WB2 A;  4E6H A;  3CBM A;  4I51 A;  2EQX A;  2PM7 A;  5C2Y A;  2FF4 A;  3L22 A;  5T8I A;  4UI9 J;  1HS6 A;  2JLB A;  2WXR A;  5LOZ A;  2DIW A;  3KD7 A;  2XPY A;  3IV0 A;  3P1U A;  3LYA A;  3MO0 A;  1XGW A;  4H7X A;  5FQ7 A;  4PS3 A;  3CK8 A;  3TGO A;  2BQZ A;  3LS8 A;  2Y4T A;  3UX4 A;  2GGF A;  4QEP A;  3HVE A;  3G2V A;  5E75 A;  2IF4 A;  4KZC A;  5LX8 A;  5CMW A;  3FHE A;  3OXL A;  4NUR A;  1N52 A;  3B7T A;  3CHQ A;  4UI9 K;  2UY1 B;  1IQR A;  3DBS A;  3FTU A;  3FTW A;  5KCM A;  3FP3 A;  5FQ8 A;  2AW6 A;  1HE8 A;  3LPZ A;  4IRU A;  2IFU A;  5LCW J;  5TEG A;  1DVP A;  4N2Q A;  2XRY A;  4I6G A;  3VLE A;  4EZK A;  5EX3 A;  5JJT A;  3M57 A;  4JEU A;  3QJZ A;  3URZ A;  3UT8 A;  2YQ8 A;  4MRU A;  3FH8 A;  3MKR A;  4LER A;  4Y6W A;  4EZJ A;  4A3V A;  3APC A;  2WQ7 A;  3EIJ A;  2YNQ A;  2OVF A;  5BPP A;  4A1S A;  4LUN U;  4RSY A;  3GW4 A;  2R59 A;  3SD5 A;  5FT9 A;  4ME2 A;  3TL5 A;  4YPU A;  3EP0 A;  4FHK A;  4LDG A;  1XQH A;  3GYZ A;  5CMY A;  3ZEF A;  4A3T A;  3ESK A;  4BT8 A;  5FJY A;  4XE0 A;  1B89 A;  3SBT B;  5JHN A;  4F3V A;  4UI9 C;  2Y4U A;  3D9N A;  5G05 C;  3ZYM A;  3CVW A;  3U66 A;  4CDR A;  1Z6T A;  2I2O A;  3CVY A;  2VQ2 A;  2CG3 A;  3C98 A;  3OS5 A;  4HLE A;  3PRE A;  2F69 A;  4JEH A;  2MHK A;  1X5B A;  1KLX A;  3CBP A;  5LFA A;  2XCC A;  4APF A;  2PQR A;  4UWF A;  5KJL A;  4DLO A;  1KT0 A;  3VTX A;  4V3I A;  2BTD A;  3G2U A;  3RO3 A;  3SZ7 A;  3CVX A;  4I1A A;  3CK9 A;  2LAI A;  2NXP A;  4FMU A;  2XGO A;  5G04 C;  3QWP A;  4HOU A;  4XX5 A;  3CV0 A;  1QQE A;  4Q69 A;  4GZ6 A;  3LXU X;  4KT6 B;  3OAW A;  4AP2 A;  3ZHE A;  3MV3 B;  4ILH B;  4J8D A;  4MKT A;  3S7B A;  2KC7 A;  4GML A;  4YPE A;  5E76 A;  3FU5 A;  3U64 A;  3M59 A;  1LF8 A;  4N3C A;  5ANR A;  1N6A A;  4L7T A;  1E90 A;  3FUM A;  3LY7 A;  4LEU A;  5G04 J;  5JIN A;  3FH5 A;  4WWP A;  3AU4 A;  4JL0 A;  2IU1 A;  3TG4 A;  2Y3A A;  4B0Z A;  4JXT A;  3D9M A;  4ANU A;  5KJM A;  2J08 A;  3Q15 A;  4GYW A;  2AXZ A;  4AM9 A;  4G2V A;  2WMO A;  3N71 A;  3FTS A;  4FLH A;  1XNF A;  1MVH A;  2V5F A;  3ESL A;  4QFV A;  4NRH B;  3D9I A;  3U3W A;  1HO8 A;  4J7I A;  2WXL A;  3S8P A;  1W3B A;  1H2T C;  3LCA A;  4DK5 A;  4GPK A;  2W5Y A;  2VJ8 A;  2L6J A;  4GMJ A;  4BSX A;  4I9E A;  4FJY A;  5BW8 C;  4WNF A;  4ILG A;  2J4B A;  2LAH A;  3ZYL A;  1E8W A;  2CHW A;  3FPD A;  3ASD A;  2JV0 A;  4QEO A;  3TJP A;  4GAA A;  3M58 A;  3I5P A;  4AEZ C;  4HOT A;  3AS5 A;  3SGH A;  3S2A A;  1HFA A;  3AS8 A;  1H0A A;  2L9B A;  2J9Q A;  4GYY A;  4JHJ A;  2XPI A;  3IHX A;  3M54 A;  3Q4A B;  5FZR A;  4CCA A;  5J08 A;  4BTB A;  4JDS A;  1FVH A;  2QY7 A;  3SW9 A;  3NQP A;  1TJC A;  4WUY A;  3VV0 A;  2KZT B;  3RU0 A;  2LSU A;  4KMO A;  3WXX A;  3LY9 A;  2GW1 A;  3HDX A;  2WXF A;  3NZS A;  4UQY A;  3JUI A;  2FO7 A;  3ZN3 A;  2CFU A;  2KCL A;  4JVS A;  4FP7 A;  3MJW A;  2WXJ A;  4PUC A;  3FU0 A;  4K03 A;  4BY6 A;  3SNX A;  3O48 A;  4EQF A;  3L54 A;  3U4T A;  2W5Z A;  5JJ0 A;  1E8Y A;  2YIN A;  2LSV A;  3ENE A;  3U9W A;  4I2Z A;  1PAQ A;  5AYF A;  3HYM B;  3UMV A;  1MUF A;  4NJ5 A;  5C1D A;  4H12 A;  2A4Z A;  2OOE A;  3PNT B;  2CFZ A;  4ANW A;  2XCB A;  4P29 A;  3MKQ A;  3APF A;  4XI0 A;  5TTF A;  3AS4 A;  4I17 A;  4KBQ A;  1JPL A;  4HOQ A;  4YND A;  4Y6C A;  4HVB A;  2IGQ A;  5D0Q D;  3FUK A;  1KT1 A;  3VTY A;  3K5K A;  1BPO A;  2V0P A;  4WWO A;  2CHZ A;  1N6C A;  3L16 A;  4CT0 A;  3FUL A;  2LNI A;  2X6H A;  3M53 A;  4D10 C;  3PUJ A;  4I1O B;  4J8E A;  2VYI A;  4GA0 A;  4JA7 A;  3S7F A;  3VLD A;  3D9L A;  3ZRH A;  4AVX A;  4EBA G;  2M63 A;  4U0S A;  3JQ1 A;  5CHE E;  3QDN A;  4Q96 A;  4G24 A;  4BUP A;  4DLQ A;  4J8F A;  4FJZ A;  4B8A A;  2E2E A;  1Z3X A;  3LEW A;  3IHV A;  4FC8 A;  4JZY A;  4EZL A;  3QC1 A;  4Q94 A;  3RRU A;  4FAD A;  2HM8 A;  3KAE A;  1WM5 A;  2DCP A;  2ILR A;  3CHP A;  4GCN A;  4CGV A;  1QZ2 A;  4PS8 A;  4J83 A;  3PNL B;  4JPS A;  4AJW A;  5JHB A;  1H6K A;  2AXV A;  4O6F A;  4J8O A;  1JUQ A;  4YPA A;  4IJ8 A;  3FY4 A;  2DBA A;  3I4R B;  2WXN A;  4NVQ A;  1FCH A;  3AU5 A;  4WNE A;  3PVL A;  4NQ0 A;  5FZQ A;  4UWH A;  4XIF A;  2QPW A;  4ILI A;  2XQ0 A;  4E47 A;  3VUZ A;  1HZ4 A;  2L0T B;  3ZYQ A;  4EEC A;  3IHY A;  3CVQ A;  1S0P A;  2IOL A;  4BT9 A;  3GZ2 A;  2HYZ A;  1ELR A;  2WXH A;  1IQU A;  2V8S E;  3TG5 A;  1GW6 A;  5AIJ A;  5KJN A;  2G46 A;  3ONL A;  3RKV A;  1MT6 A;  3MCX A;  3EIQ C;  4FU3 A;  3CIA A;  3FUE A;  3FUD A;  2UWJ G;  5T0K A;  5AYW D;  4C0E A;  4UWK A;  4AXH A;  4XI9 A;  3MZL B;  1UJK A;  4FA6 A;  4JHK A;  1HG5 A;  3CQC B;  3MKQ B;  3ASG A;  3RRM B;  5FZS A;  2FI7 A;  1OWP A;  2X6F A;  3ML8 A;  2A5U A;  3L17 A;  4I6J A;  4J6I A;  1EYH A;  1HG2 A;  4L23 A;  4F53 A;  5CCM A;  3CHM A;  1OWL A;  2OV8 A;  2WXQ A;  3D9P A;  3QWW A;  4WWN A;  5AJD A;  5EX0 A;  4AV7 A;  5HQ8 A;  2I1J A;  4U0U A;  3DB5 A;  5F6L A;  3CGH A;  2ION A;  3CVL A;  3FUH A;  4DPR A;  4A55 A;  4HOS A;  2VGX A;  4HS2 A;  1OWN A;  4F7A A;  4N3B A;  2VTB A;  3QB2 A;  1TJF A;  4FUL A;  3IBE A;  4EPZ A;  4L2L A;  1Y6I A;  2X3M A;  1EDU A;  4JW1 A;  4A1G A;  3CVN A;  2WQ6 A;  1OWM A;  2VSN A;  2VSX E;  1H3I A;  3RJW A;  1HU3 A;  1O9S A;  4C9B B;  1Z3Y A;  3D3M A;  4HOR A;  3RQ4 A;  2WXK A;  1UG3 A;  4IUL A;  3B7R L;  2VGX B;  1NA0 A;  3UQ3 A;  1VDY A;  4AU7 A;  3T5V A;  5CPR B;  3FWV A;  4GZC A;  5BV1 A;  2O8J A;  1E8X A;  3FU6 A;  5BT1 A;  2PM6 A;  2C0L A;  4WNG A;  4ACL A;  1HXI A;  3K9I A;  2FBN A;  3QAR A;  2C2L A;  4AOF A;  3P2B A;  4WND A;  4DI4 A;  4F1S A;  3G2W A;  3PDN A;  2FEZ A;  2PQN A;  3ML9 A;  4CEM A;  2UY1 A;  2MRI A;  1HX8 A;  2OND A;  4C0M A;  3L08 A;  3JCK C;  3L6A A;  4M3O A;  3VLF A;  3PEU B;  2XEV A;  2J09 A;  2NSZ A;  4KXK B;  2WXG A;  2WVI A;  3JYS A;  3MA5 A;  4XKC A;  3T5X A;  3G2S A;  3M5A A;  3ZGQ A;  3D9J A;  3R9A B;  4GYO A;  3RAY A;  4L2Y A;  4FLB A;  3ZXS A;  2WXO A;  5T3R A;  2X38 A;  4N5C A;  3B13 A;  4HXI A;  4YVQ C;  1QNF A;  3NF1 A;  2X6I A;  4J8S A;  4N39 A;  2IOS A;  3FU3 A;  4U07 A;  5LP0 A;  3F9W A;  3SBS A;  1HF8 A;  2ZU6 B;  4U0Z A;  5ENN A;  5JJ7 A;  3RK6 A;  3LVQ E;  3FFL A;  3EHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...