3RIBA

Human lysine methyltransferase smyd2 in complex with adohcy
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
430
structure length
430
Chain Sequence
GGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESHLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human lysine methyltransferase Smyd2 reveals insights into the substrate divergence in Smyd proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 139
structure length 430
sequence length 430
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ribA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ribA01
2VQ2A 4AY6A 4BT8A 5FJYA 2JLBA 3CBOA 1KT1A 4AM9A 5BT1A 4HOSA 5LCWJ 2XCBA 3MO5A 1WAO1 3LY9A 2VSNA 3QWPA 3CVLA 2FEZA 4H7YA 3KD7A 3FFLA 4KBQA 1ML9A 4J83A 3CV0A 3DB5A 2C0LA 5DIZA 3ZPJA 3ZN3A 4XI9A 2W5YA 4N3BA 3K5KA 2PQRA 2UWJG 3E4BA 3U4TA 3GYZA 4O6FA 4U0SA 2XEVA 3F9YA 3FP3A 3EDTB 5TEGA 4BUPA 2FBNA 3MA5A 1IHGA 3FPDA 4BT9A 4N2SA 4ABNA 5AYWD 3OXLA 4G26A 4HORA 3DALA 3CK8A 5TH7A 4CDRA 5JJ6A 2XGMA 2KATA 5AYFA 3TG4A 3MKRA 4RG9A 4J8FA 1YA0A 3VTXA 3U3WA 4J7FA 3K9IA 4HOQA 3LPZA 4N39A 4JL0A 5CHEE 5KJKA 3PDNA 5BNWA 2R3AA 4G25A 3PE4A 4RG6A 5D0OD 4I51A 4NQ0A 3ZFWA 5G05J 1P5QA 4YNPA 4YPEA 5F6KC 5ARFA 5KJMA 3AS4A 1NZNA 2QFCA 4UQXA 3SWCA 4A1SA 2J9QA 3MEKA 3CKBA 5TTFA 3M54A 4GYWA 3Q49B 3CVQA 4J8OA 1ZKKA 3S7DA 2XGSA 4U0UA 5HQ8A 3CBMA 3ASFA 5D0QD 5G04J 4FMUA 4J8DA 1ELWA 1XQHA 4GA2A 1IYGA 3N71A 3QWWA 2IGQA 5FTPA 2GW1A 3KS2A 3UQ3A 4IN3B 3ASHA 5FZRA 3TGOA 3FWVA 3OXGA 4YPAA 5A7DB 4BTBA 2RFIA 3UPVA 1W3BA 4BWRA 3RJVA 5JHNA 4J0UA 5CCLA 4YNMA 2WQHA 3AS5A 4CGVA 3RIBA 4U07A 5KJLA 3QDNA 4MI5A 2Y4TA 4G1TA 1PEGA 2IF4A 3OXFA 4QEPA 4I1AA 2MHKA 3M56A 4I2ZA 4B94A 4GYOA 1KLXA 3HNAA 2NC9A 3S8PA 3LY8A 3S7FA 4IJDA 3TAXA 1MUFA 4H7XA 4C1QA 1E96B 3M59A 1ELRA 3RKVA 5KJNA 4UQZA 3ASGA 4Y6CA 5LSXA 5LCWC 2C0MA 3RAYA 3F9ZA 4GZ5A 5F5EA 1Y8MA 5T5GA 3RO3A 3CEQA 3CKCA 1XNFA 1N3JA 3Q15A 2G46A 4Y6WA 4GZ3A 3M53A 5T0MA 5JIYA 4GPKA 4U0ZA 4G23A 4UI9C 3F9WA 3VV0A 1A17A 1H3IA 3MO2A 3CVNA 5FZSA 4HOUA 2XCCA 3LKUA 4W9RA 4KXKB 3CBPA 1ZU2A 5FZQA 4I9CA 3AS8A 2O8JA 3KMAA 2E2EA 4GCOA 3KMJA 3OPEA 5F59A 5ARGA 3M57A 4KYOB 2P58C 1HXIA 4E47A 2XGOA 2OOEA 2KC7A 4MI0A 4WNFA 1MVXA 3RU0A 2LNIA 2HR2A 1QQEA 3MO0A 3QWVA 3S7JA 3Q47B 2WPVA 2BQZA 3KMTA 4O30A 2V5FA 5T0KA 2DBAA 4JA9A 3M5AA 3NF1A 1KT0A 5JJ7A 3RJWA 2Y4UA 4NRHB 5JINA 4GYYA 4YVQC 5G05C 4GA0A 4WNDA 4I2WA 5CPRB 4WUYA 3MV2B 3SZ7A 4WNGA 2PZIA 3ZGQA 4XI0A 1TJCA 5DBKA 2FF4A 3URZA 2QPWA 3SF4A 2KCKA 1MVHA 1O9SA 1PC2A 3CVPA 3OOIA 4G2VA 3M58A 3RQ4A 5EG2A 4ME2A 4AY5A 2C2LA 4YNDA 3Q5MA 2VSYA 1B89A 2PL2A 4F3VA 3CK9A 2YHCA 3Q4AB 5M72A 3EP0A 4J8EA 3SW9A 5BW8C 3ZHEB 4NVQA 5EX0A 1N6AA 4YVOA 3KAEA 3QKYA 3JYSA 4UI9K 3CK7A 4JA7A 4N2QA 2LSUA 5G04C 5HI7A 4H12A 2AVPA 4UQYA 3GW4A 4HOTA 3LYAA 4AU7A 4I17A 2UY1B 4J7IA 2YQ8A 1QZ2A 4XIFA 2VGXB 1HH8A 2HO1A 3S7BA 3ASDA 2IFUA 3GZ2A 5FT9A 4JDSA 3VTYA 4WNEA 1N6CA 4YPUA 2KCLA 3IEGA 2Q7FA 4GCNA 2W5ZA 2HYZA 5C1DA 2PQNA 5EKQD 4LDGA 2VYIA 2FI7A 1FCHA 4GA1A 4QEOA 5JJ0A 3IHXA 3O48A 5EX3A 3ESKA 2FO7A 4JLGA 3LY7A 4G24A 3VUZA 3BO5A 1WM5A 3QOUA 2ONDA 1OUVA 3MV3B 3ZHEA 4LEUA 1MT6A 1HZ4A 4QENA 3RO2A 4N5CA 4BTAA 3LCAA 4U04A 5JJTA 4N3CA 3M55A 4GZ6A 3ULQA 3WXXA 4Z4PA 1NA0A 4N3AA 3R9AB 4IJ8A 3TG5A 4RZ0A 4EQFA 4UI9J 1NA3A 5F6LA 4I9EA 2BUGA 4CGWA 3UUXA 4AIFA 2I6HA 4JHRA 2R5SA 2L6JA 5CCMA 2F69A 3GZ1A 3F9XA 1ZBPA 5A6CA 2XPIA 3OS5A 3HYMB 2VGYA 2JV0A 3BEEA 5LSZA 2KCVA 2VGXA 2UY1A 4APOA 2LSVA 3PE3A 4NJ5A
chains in the Genus database with same CATH superfamily
3G2UA 3SO8A 3ZW3A 1D9SA 4Q96A 1HS6A 4HOSA 1H2UA 1Z6TA 1YMPA 1AWCB 2XCBA 3MO5A 3GZSA 4H7YA 1TN6A 4U95D 3E32A 3ZVVA 4GTRA 2C0LA 5DIZA 3ZPJA 3ZN3A 4EBAA 2PQRA 4BSXA 2DWZA 3SFZA 3ZRHA 3U4TA 3QNKA 4ILHB 4U0SA 1GW6A 4FJZA 4BUPA 3MA5A 5ITZF 4XZ4A 1TJFA 1FT1A 4EBAG 3FEYA 3CK8A 5TH7A 2PM7A 2R03A 4L2YA 4Z68A 4U7EB 1H6PA 4LUNU 4RG9A 1YA0A 4HOQA 1S63A 3FTWA 4KVMA 4RVBA 4N39A 2OCCE 5KJKA 2R3AA 4G25A 5FWQA 2GGFA 3FY4A 4HBDA 5EILA 5G05J 1OWOA 4LNGA 3SQVA 5F6KC 4JVSA 3R9MA 2QFCA 1TNZA 3SWCA 4A1SA 4RLYA 2J49A 3CKBA 3FDHA 3CHRA 1TR4A 3PH0C 3G2WA 1RW2A 4DLOA 4MBGA 5HQ8A 1Z3YA 3C72A 3QK0A 1QYMA 5D0QD 5G04J 3B7BA 4FMUA 1TNOA 3E34A 4UWKA 1IYGA 3AG4E 3QWWA 1HX8A 2YINA 2IGQA 4HLLA 2WXLA 3ASHA 3TGOA 2GRRB 3FWVA 3BG0B 3OXGA 4JZYA 4U8HA 1ELKA 3SNXA 4YPAA 5A7DB 4I43A 3VLEA 5KBAA 3UPVA 3RSEG 2EIME 1WDYA 4FLBA 4GAAA 4J0UA 3CR3A 2WQHA 4K5AB 4CGVA 1OXJA 2X6IA 3ZNGA 1H19A 4TXQA 1PEGA 3OXFA 4I1AA 2MHKA 2F8XK 3TJPA 4B94A 2BF0X 3Q78A 2WM9A 3HNAA 3TAXA 4H7XA 3NOGD 2OVBA 3M59A 3DPYA 3FH5A 1DNPA 4P29A 2XQ0A 5LCWC 3TXMA 5T8IA 5B3SE 3RAYA 4A3VA 5F5EA 1Y8MA 4A55A 5T5GA 1IXVA 3RO3A 3CKCA 1XNFA 3Q15A 2G46A 4Y6WA 1TNYA 2RG8A 3Q9NC 2WXGA 3M53A 1JCSA 4U0ZA 3U64A 3F9WA 3D9PA 3PZ4A 3FTVA 3U66A 3VV0A 3D9LA 1MX4A 3CVNA 4LNBA 2XS8A 4B89A 3APCA 4I9CA 3UT7A 4GCOA 3J5QB 3M57A 4MRUA 3CLJA 4UWGA 5EIBE 4BY6A 3C98A 4CT0A 3ZKJA 1D8EA 2KC7A 3FULA 1KPSB 4HRNA 4I1MA 4PS8A 3RU0A 4HXIA 3X2QE 2CFUA 3UM2A 4O30A 3Q7FA 3FUHA 2IJGX 1JWGA 5T0KA 4PS3A 4QFVA 4JA9A 3UT8A 3HXBA 4CDNA 3ZUVB 5CPRB 2ZU6B 1BD8A 4OVUA 4DLQA 3ZIMA 4EHMA 5DBKA 4HRMB 1G3NB 2ZISA 1HF8A 1OWPA 3SF4A 3PS6A 2KCKA 4O1OA 1FVHA 2WQ6A 1K1BA 2GRPB 4D10C 2P9IG 3Q5MA 3MGBA 1N11A 2J4DA 4HNAD 4MLPA 4DUIA 4ILIA 1INZA 4L2LA 3D9IA 3HXEA 5EX0A 1O1SA 1N6AA 4JHKA 3KAEA 4U96D 3VLFA 5EYLA 2KXPC 1NI1A 5LP0A 2IQCA 2WXKA 4JPSA 2LSUA 2AVPA 2JEKA 3NOCD 3AAAC 1JPLA 3PZ2A 1HO8A 3DXMG 3RRMB 2ETAA 3ZYMA 4I17A 2VGXB 1QNFA 2P9LG 5CEDB 3S7BA 2WXNA 2IFUA 2A5UA 4NIKA 3KSQA 4YDYA 1TNUA 3BG1B 2WXFA 4YPUA 2KCLA 3DSUA 4WWNA 2DVWA 4GCNA 4KVOA 4PH4B 3D9JA 5JJ0A 3O48A 3TWUA 3BO5A 4YDOA 2A4ZA 5E76A 4DI4A 3D3MA 4GTSA 4LEUA 1HZ4A 3HG0D 3HRAA 4BTAA 4C9BB 1LTXA 1JCQA 3WXXA 4Z4PA 5G2NA 4G11A 3PREA 2MYOA 5BV0A 2WVIA 3TG5A 4DX2A 3FU5A 3ONKA 4EQFA 5E75A 3RRUA 5F6LA 1S64A 3EHMA 5CRVA 2L6JA 2F69A 3GZ1A 1IQUA 3F9XA 1ZBPA 5A6CA 5BUZA 1KZPA 4K5BA 1BI7B 3C3OA 1O1TA 3U9WA 3BEEA 4K0RA 4TRQA 5D2MC 2VGXA 3PE3A 3MX3A 2HM8A 1OY3D 3CBOA 2L6BA 1KT1A 1S0PA 4AM9A 3UI2A 2F8YA 5FQ6A 3QWPA 3KD7A 4KBQA 1ML9A 2YHEA 4DX6D 3CV0A 3LEWA 5AIJA 2IU1A 3AG1E 3KEAA 1L5JA 3BQOA 2GRNB 3GYZA 3CHQA 3EU9A 1HG2A 4LCTA 1H0AA 2XEVA 3FP3A 1K1AA 5ANLA 3PUKA 3ZEFA 1IHGA 5FINA 3FPDA 3UT4A 2V4HC 3C5RA 4LNUD 2XZTG 4FU3A 4ABNA 3OXLA 4BEPA 4CDRA 2KATA 5AYFA 3TG4A 4J8FA 1OWMA 1N94A 3ISMC 4EZKA 4BX8A 4I1OB 4DJAA 1MHQA 4RG6A 5D0OD 3V30A 4C0EA 3ZFWA 3CHSA 5CMYA 4BETA 2I1KA 3TXNA 4TXPA 4YNPA 3FH7A 3LXUX 1EYHA 5ARFA 4AEZC 5KJMA 1OCZE 3D9KA 4UQXA 4OVVA 4L9PA 1TYQG 3ZXSA 3JXIA 3QB2A 3M54A 4GPMA 2XRYA 3L54A 4GTMA 4L23A 3NAWA 1ZKKA 5JA4D 3S7DA 3CVUA 3E33A 3I4RB 3Q75A 2PM6A 1SZ9A 4DRXE 1N54A 4YDWA 2V0PA 1ELWA 2KM4A 3PNTB 2RFAA 3RRNB 5AENA 3ZYLA 1N4RA 3KS2A 3FU0A 5FZRA 3QJZA 1YYHA 2CG3A 4JB8P 5ENOD 4QQIA 3FUKA 4HRLA 3IKOB 4BTBA 4GB9A 4WAFA 3C3RA 2GRQB 4YNMA 5HKPA 3RIBA 3RK6A 5LOZA 5A23A 3CSFA 3I3NA 3WG7E 2Y4TA 4G1TA 2P9UG 3M56A 1H2VC 2V4LA 4GYOA 3S8PA 3LY8A 3R7RA 1MUFA 4C1QA 3TWRA 4JW1A 2Y3AA 5KJNA 1OWLA 3ASGA 4ANXA 1E8YA 2EILE 2ZGDA 4AVXA 3FTUA 3L16A 3TWQA 1HFAA 3EHNA 5AQAA 3TWXA 1A17A 5J90A 1H3IA 3MO2A 2GROB 4TV3A 5FZSA 2Y69E 2XCCA 4KXKB 4OYSA 4MS6A 3KMAA 2E2EA 4A63B 3MYVA 4N5QA 1OCCE 4KYOB 3CGHA 4AJWA 4MI0A 1U3CA 4WNFA 2CG2A 2X38A 1MVXA 3IBEA 3HXDA 2EINE 2OEVA 3APFA 1QQEA 1IHBA 3S7JA 3Q47B 3KMTA 2BQZA 3FH8A 2V5FA 4R7LA 3FU3A 3UIPC 2DYRE 3NF1A 3DSWA 4ZHBA 5CBNA 5AAOA 3T8KA 2R05A 4GYYA 2LUHA 3UX4A 3EHQA 2WMOA 3ZGQA 5FIOA 4XI0A 1EPUA 1TJCA 2QYUA 1WG0A 1MYOA 3ZXPA 2AWIA 1O9SA 1PC2A 4PS7A 3CVPA 1HU3A 3OOIA 4G2VA 3NBNB 2P9KG 4ME2A 4X8QA 4KZ0A 3E37A 4F3VA 2LXLA 4J6IA 3PZ1A 5M72A 3ZHEB 3JYSA 1UOHA 3SFYA 4UWHA 4H12A 5AARA 4FA6A 2LXMA 1H6OA 2QYJA 3CIAA 3LVRE 3B95A 3JUIA 4HLEA 4B8AA 2YQ8A 5T4YA 5FQ4A 5C2YA 3LVQE 3ULEG 3LS8A 1RZ4A 3QAQA 3UM3A 3UTMA 3I4GA 4U8VD 1XGWA 4C0MA 3ABME 3UM0A 4GTQA 4HI8A 1MZCA 1N6CA 3RAUA 1WY6A 4TUUA 5CEAA 1E7VA 2OEWA 4JEUA 5EKQD 2VYIA 3FTYA 3SGHA 4IRUA 4FADA 4DX1A 4I6JA 4JLGA 1PY1A 4G24A 5EDSA 1WM5A 2MRIA 2ONDA 4BX9A 3MV3B 3ZHEA 4QENA 4N5CA 3VLDA 1SA5A 4U04A 2WB2A 4N3CA 4F6RD 4GZ6A 3ULQA 2H6FA 3BU8A 3SY2A 3HVEA 3ZYQA 1NA0A 4N3AA 3R9AB 2P9SG 3TWSA 3BUAA 4XEIG 2XEHA 2BEDA 2XPYA 3ENEA 3UUXA 1H6KA 4AIFA 2R5SA 3EHRA 2XPIA 4ATZD 5ENNA 4KZCA 3FTSA 5LSZA 2UY1A 2LSVA 2XS1A 4NJ5A 2VQ2A 1OCOE 4AY6A 4BT8A 4LSZE 3CHPA 2JLBA 2RD0A 3EIQC 1QBQA 3I5PA 1SZAA 3HIZA 3FUEA 4GTPA 4J8YA 5LCWJ 2WXQA 1WAO1 3LY9A 4FHJA 5AJLA 3FFLA 1TEZA 3HVEB 4J83A 3DB5A 2X6FA 1MX6A 3FUJA 2H6IA 4N3BA 3K5KA 4E85A 4CRWA 3JXJA 1BU9A 3FU6A 3SHFA 4DI3A 4A3TA 3L08A 3EDTB 4BSZB 2WXRA 4M3OA 4G8KA 3AG2E 4WWPA 3B7UX 1SQMA 4N2SA 1D8DA 1YCSB 4B93B 4JXTA 3FEXA 5AQ7A 2RKKA 4CDMA 4G8LA 3U3WA 4J7FA 3K9IA 3LPZA 4HQDA 3LDZA 5CHEE 5ENQD 3PDNA 5BNWA 3PE4A 2XEEA 4FLHA 2H6HA 1P5QA 5AQ9A 2LAIA 4PUCA 5B1BE 5T3RA 4YPEA 1BPOA 3D9HA 3AS4A 5B1AE 2XENA 3PZ3A 3DSXA 3ABLE 2J9QA 5JHAA 4JC8A 1O1RA 2LAHA 2EQXA 5TTFA 1U2VG 4GZCA 3PVLA 4GYWA 3Q49B 4JD2G 3CVQA 4J8OA 2DYSE 3HDXA 3CBMA 4FP7A 3JCKC 5BPPA 3FTXA 4EZLA 4F53A 5IY5E 1XQHA 4XE0A 4MKTA 2GW1A 3O4ZA 2GRLA 1IKND 1W3BA 4BWRA 5JHNA 3EU5A 5CCLA 4XX5A 4OAVB 3TWTA 3QDNA 1K3ZD 4I2ZA 1E8ZA 4A1GA 3PEUB 2Y1LE 2NC9A 2OVFA 3S7FA 4IJDA 2J07A 1ELRA 2J4BA 3T5VA 1SVXA 3J5PA 4UQZA 5LSXA 2AXZA 3F9ZA 4GZ5A 3L9TA 1ZB1A 2BTDA 2VJ8A 3CEQA 3T5XA 3JUEA 1N3JA 1BLXB 2XZDG 2P9NG 3ASNE 3PNLB 4CCAA 4J8SA 5ENRD 2RFMA 4GZDA 3SD5A 2P2CP 4UUCA 4G23A 4K5CA 1N4PA 4GTVA 2X6KA 3T9KA 1OWNA 2WQ7A 5ANRA 2X6JA 3TWVA 2IO2C 4HOUA 2AJAA 4W9RA 3ZU7B 5BV1A 3CBPA 1ZU2A 2IEJA 5FZQA 3OPEA 2WXOA 4IULA 2P58C 3PRZA 1HXIA 2I9CA 4E47A 2CHXA 2OOEA 3B7TA 2X3MA 5JMND 3FUNA 2HR2A 4M7CA 3QWVA 4GMRA 2WPVA 3P2BA 3ULYA 5G55A 2DBAA 4LRZA 1KT0A 5JJ7A 3JQ1A 2Y4UA 5CBOA 5JINA 4YVQC 5G05C 4GA0A 1E7UA 3MV2B 4ACKA 1HG5A 4C48B 3R7QA 1S70B 2AW6A 2CHZA 4HVBA 2QPWA 1IQRA 1NL4A 1MVHA 4UWFA 2IO3C 3JQ0A 3FTZA 3Q9UC 4CEMA 3OTNA 3M58A 3RQ4A 4ACLA 5EG2A 4UWLA 3AU5A 4AY5A 2C2LA 4GTOA 4YNDA 4ATGA 4HS2A 2VSYA 1B89A 2PL2A 3CK9A 3PEVB 3L6AA 3Q4AB 1UN8A 1X81A 4J8EA 2WXPA 5AJDA 3SW9A 4OAUC 5BW8C 4NVQA 1K8KG 4URKA 1VDYA 3G2VA 2QY7A 4GMJA 4JA7A 4N2QA 5G04C 5ENTD 4UQYA 4HOTA 2QC9A 4I6EA 4DK5A 3G2TA 1QZ2A 4JEHA 1HH8A 2HO1A 3ASDA 3GZ2A 5FT9A 3NZSA 3VTYA 2V8SE 1UJKA 4WNEA 1PAQA 3DWLG 5CRUA 5CERB 1H2TC 1HE8A 3UIOC 3UM1A 1OT8A 2FULA 2W5ZA 3SBTB 2HYZA 5C1DA 2XPZA 4LDGA 2FI7A 1LD7A 5KNGA 3IHXA 1SA4A 4CYMD 2PNNA 3ESKA 5JHBA 3LJ3A 4NURA 2B0OE 3SI5A 3AJIA 3DXKG 4J7WA 3W9GA 3CVWA 1NP7A 2GRMA 1MT6A 2R59A 3RO2A 2I1JA 1Y6IA 1E90A 5ENPD 5JJTA 3TWWA 1Z5SC 4B8CB 2XRZA 2L9BA 4I6GA 3CSTA 3CVXA 4GTTA 1MX2A 3E30A 1JCRA 3ONLA 1EDUA 5BXOA 3L13A 4RZ0A 3B13A 3MJWA 3FUFA 1UN9A 2ZIRA 4I9EA 4O60A 2BUGA 1UW4B 4DPRA 2BKKB 3PUJA 2I6HA 2ZXWE 5H7PA 1UG3A 4FHKA 2CHWA 5BXUA 2VGYA 4K03A 2ILRA 1AP7A 2JV0A 2KCVA 2AXVA 2DIWA 2F37A 4APOA 2WXMA 1A5EA 5FJYA 1N52A 3CHMA 5BT1A 2VSNA 3CVLA 2FEZA 2Y0BG 1JWFA 4F1PA 3NZUA 4XI9A 2W5YA 2UWJG 4WWOA 3E4BA 4O6FA 4F1SA 4CZ2D 3F9YA 1MJ0A 2M63A 5TEGA 4KMOA 4LERA 2FBNA 2VTBA 2WXJA 3KSLA 4BT9A 3UMVA 1TN7A 3FUMA 2B6CA 5AYWD 4G26A 4HORA 3DALA 5JJ6A 2XGMA 2IONA 2EIJE 3MKRA 1N0RA 3VTXA 3L22A 1N9AA 4JL0A 3IHYA 3Q73A 3B7SA 5ENSD 2R17C 3Q7AA 4I51A 4NQ0A 2DZOA 4CT4A 1FVFA 4GMLA 1NZNA 3UINC 3W9FA 3CVVA 3MEKA 2VSOE 4KT6B 2KBXA 3SFXA 1E8WA 3CQGB 4YDEA 2XGSA 4U0UA 4Q94A 3MKQA 3DSSA 3ASFA 2KZTA 2YNQA 2H6GA 3UKRG 4J8DA 1V54E 3ESLA 4FULA 1EF1C 2E0IA 4GA2A 3N71A 4V3IA 2BKGA 2JABA 1E8XA 5FTPA 3EJNA 3ML9A 3L17A 4PDXA 3UQ3A 4IN3B 5LFAA 1DCEA 3HXCA 5KNHD 2RFIA 3RJVA 1FPPA 3OAWA 5EN5D 3AS5A 1O5MA 4U07A 3UKUG 5CMWA 5KJLA 4MI5A 4TXRA 3CQCB 2IF4A 2F0YA 4QEPA 3CHOA 5D66A 3PZDA 4BESA 1KLXA 1E96B 2DCPA 3RKVA 5EIDA 1FT2A 3APDA 1NFIE 4Y6CA 5HRYA 3FUDA 3DSTA 2C0MA 3EIJA 2VTBB 3SBSA 1JUQA 1N0QA 5J08A 1LF8A 2ETBA 2L0TB 1V55E 2R2LA 4GZ3A 5T0MA 2LO6A 3KEZA 3D9MA 5JIYA 4GPKA 1LD8A 4UI9C 4EZJA 2L0IA 1DC2A 3IHVA 1N4SA 3DPDA 4HFGA 2NXPA 5FQ7A 4ILGA 1SW6A 4U63A 3LKUA 3Q79A 4E6HA 2P9PG 4HI9A 4LG6A 3D9NA 4EECA 3AS8A 2O8JA 2FO1E 3IV0A 3KMJA 3DEPA 5F59A 5ARGA 4ZFHA 5LX8A 1DCQA 5HS0A 3EUVA 4ANUA 4HB5A 2XGOA 2CFZA 3V2OA 3V2XA 4U8YD 4ANVA 1Q2ZA 3AG3E 2LNIA 3MO0A 2DZNA 2WXIA 3DEOA 3DSVA 3UXGA 2IOLA 2WMNA 2KZTB 4DX7D 3MKQB 2VSXE 3M5AA 4RSYA 3NQPA 4EPZA 3RJWA 2I2OA 4NRHB 5EYPF 2VGEA 4WNDA 4I2WA 4WUYA 3SZ7A 1N95A 4WNGA 2PZIA 1X5BA 3QARA 2FF4A 2WXHA 3URZA 2QZAA 3C3QA 3ZYKA 2ZGGA 4O1PA 1MQSA 3G2SA 2AXUA 2ETCA 4TUMA 4AP2A 4IYPA 4AOFA 2YHCA 3DBSA 3AU4A 1OCRE 3EP0A 2V5QC 5KWDA 2NYJA 3T8MA 3DRAA 4YVOA 2OV8A 3HXFA 3QKYA 2R02A 4UI9K 4NACA 3CK7A 4XKCA 1UJJA 1DVPA 2EIKE 5FQ8A 3V31A 3CVYA 5HI7A 3TL5A 5KCMA 4B0ZA 3GW4A 3S2AA 3LYAA 4AU7A 2UY1B 5AN8A 1U3DA 4J7IA 4XIFA 1TNBA 4BERA 1BI8B 2XHEA 4RQIA 4APFA 4XKBA 4BFRA 4JDSA 3L82A 2J09A 2MOWA 3IEGA 4GU5A 1TN8A 2Q7FA 2PQNA 1FCHA 4GA1A 4QEOA 2J8SD 2NSZA 5EX3A 3V79K 3B7RL 2FO7A 3LY7A 3FHEA 5CECB 2A5EA 3VUZA 3QOUA 5AQBA 1KZOA 2IOSA 1OUVA 3MZLB 3ABKE 1N4QA 2IY0C 3ML8A 3LCAA 4Q69A 3M55A 4DX5D 4F7AA 4IJ8A 3FUIA 2HE0A 4AV7A 3NB2A 3D9OA 4L1BA 4L7TA 4UI9J 1NA3A 3QC1A 4CGWA 2X6HA 4FC8A 1Z3XA 3HHMA 4JHRA 4FJYA 3MCXA 5CCMA 3ASOE 3LJNA 3OS5A 4ANWA 3HYMB 3P1UA 3IXEA 4AXHA 3F6QA 2J08A 4JHJA
chains in the Genus database with same CATH topology
2VQ2A 3MX3A 3G2UA 2WXMA 4BT8A 4AY6A 3ZW3A 3CHPA 2HM8A 4Q96A 5FJYA 2JLBA 3CBOA 2RD0A 1N52A 3CHMA 3EIQC 3I5PA 1SZAA 3HIZA 1KT1A 3FUEA 1HS6A 1S0PA 4AM9A 5BT1A 1H2UA 4HOSA 1Z6TA 5LCWJ 2XCBA 2WXQA 1WAO1 3LY9A 4FHJA 3MO5A 5FQ6A 3GZSA 2VSNA 3QWPA 3CVLA 2FEZA 5AJLA 4H7YA 3KD7A 3FFLA 1JWFA 3HVEB 4KBQA 1TEZA 2YHEA 1ML9A 4J83A 3ZVVA 3CV0A 3DB5A 2X6FA 3LEWA 2C0LA 3NZUA 3FUJA 5DIZA 3ZN3A 2IU1A 4XI9A 3ZPJA 4N3BA 5AIJA 2W5YA 3K5KA 4EBAA 2PQRA 2UWJG 4BSXA 4WWOA 4E85A 4CRWA 3SFZA 1L5JA 3E4BA 3ZRHA 3U4TA 3GYZA 3CHQA 4O6FA 3FU6A 3QNKA 1HG2A 4LCTA 1H0AA 4ILHB 4U0SA 2XEVA 3SHFA 4F1SA 4DI3A 1GW6A 3F9YA 3TGOA 2M63A 4A3TA 3FP3A 3L08A 3EDTB 4FJZA 5TEGA 4BUPA 4KMOA 2WXRA 4M3OA 2J08A 5ANLA 4LERA 2FBNA 2VTBA 3MA5A 2WXJA 3PUKA 3ZEFA 1IHGA 3FPDA 4WWPA 4BT9A 3B7UX 1TJFA 4XZ4A 3UT4A 1SQMA 3UMVA 4N2SA 3FUMA 4FU3A 4ABNA 4EBAG 3FEYA 5AYWD 3OXLA 4G26A 4HORA 3DALA 3CK8A 4JXTA 5TH7A 4CDRA 5JJ6A 2XGMA 2IONA 2PM7A 2KATA 3FEXA 4L2YA 5AYFA 3TG4A 4LUNU 3MKRA 4RG9A 4J8FA 4CDMA 1YA0A 3VTXA 3U3WA 1OWMA 4J7FA 3K9IA 3L22A 3LPZA 4HOQA 4EZKA 3FTWA 4KVMA 4RVBA 4N39A 4JL0A 3LDZA 5CHEE 4BX8A 3IHYA 5KJKA 3PDNA 4I1OB 5BNWA 2R3AA 3B7SA 4G25A 5FWQA 3PE4A 1MHQA 4DJAA 4RG6A 2GGFA 2R17C 5D0OD 3FY4A 4C0EA 4FLHA 4I51A 4NQ0A 3CHSA 5CMYA 5G05J 1OWOA 1P5QA 3ZFWA 2I1KA 3TXNA 2LAIA 4PUCA 4YNPA 3FH7A 4CT4A 3LXUX 5T3RA 1FVFA 4GMLA 4YPEA 1BPOA 5F6KC 1EYHA 5ARFA 4AEZC 5KJMA 3AS4A 4JVSA 1NZNA 2QFCA 3D9KA 3CVVA 4UQXA 4OVVA 3SWCA 4A1SA 2J9QA 2J49A 5JHAA 3MEKA 4JC8A 3ZXSA 3CKBA 2VSOE 2LAHA 2EQXA 4KT6B 5TTFA 3FDHA 3QB2A 3M54A 4GZCA 3CHRA 3PVLA 4GYWA 2XRYA 3Q49B 3PH0C 3L54A 3CVQA 3G2WA 1E8WA 3CQGB 4L23A 1ZKKA 3S7DA 3CVUA 2XGSA 4J8OA 4DLOA 4U0UA 3I4RB 4Q94A 5HQ8A 3MKQA 3HDXA 2PM6A 1Z3YA 1SZ9A 3ASFA 2KZTA 3CBMA 1N54A 3QK0A 4FP7A 2YNQA 3JCKC 5D0QD 5BPPA 5G04J 4FMUA 3FTXA 4EZLA 4J8DA 2V0PA 1ELWA 2KM4A 3ESLA 3PNTB 1EF1C 4FULA 4XE0A 2E0IA 4UWKA 3RRNB 4GA2A 4MKTA 3ZYLA 5AENA 1IYGA 3N71A 3QWWA 4V3IA 1HX8A 2YINA 2IGQA 1E8XA 5FTPA 3EJNA 3ML9A 2GW1A 3KS2A 3L17A 3O4ZA 4PDXA 3FU0A 2WXLA 3ASHA 3QJZA 4IN3B 3FWVA 2CG3A 3BG0B 5FZRA 3OXGA 4JZYA 4F53A 5LFAA 3FUKA 4U8HA 3IKOB 1ELKA 3SNXA 2GRLA 4YPAA 5A7DB 4BTBA 2RFIA 4I43A 4GB9A 3VLEA 3UPVA 1W3BA 4BWRA 3RJVA 4WAFA 5JHNA 3OAWA 4FLBA 4GAAA 4J0UA 5CCLA 4YNMA 3CR3A 2WQHA 4J7IA 3AS5A 4CGVA 4XX5A 3RIBA 3RK6A 4U07A 5LOZA 5CMWA 5A23A 3CSFA 5KJLA 3I3NA 2X6IA 3QDNA 4MI5A 2Y4TA 4G1TA 1H19A 3CQCB 1PEGA 2IF4A 3OXFA 4QEPA 4I1AA 2MHKA 3CHOA 3M56A 4I2ZA 3TJPA 1H2VC 2V4LA 1E8ZA 4B94A 2BF0X 3PZDA 3PEUB 4GYOA 4A1GA 2WM9A 1KLXA 3HNAA 2NC9A 3S8PA 3LY8A 2OVFA 3R7RA 3S7FA 3TAXA 1MUFA 4IJDA 4H7XA 4C1QA 1E96B 2DCPA 2OVBA 3M59A 2J07A 1ELRA 2J4BA 3FH5A 3RKVA 3T5VA 3APDA 4JW1A 1DNPA 2Y3AA 5KJNA 4UQZA 1OWLA 3ASGA 4Y6CA 4P29A 2XQ0A 4ANXA 3FUDA 5LSXA 5LCWC 2C0MA 3TXMA 2AXZA 5T8IA 1E8YA 3EIJA 2VTBB 3RAYA 3F9ZA 4A3VA 4GZ5A 3SBSA 5F5EA 1Y8MA 4A55A 5T5GA 2BTDA 2VJ8A 1JUQA 3RO3A 5J08A 1LF8A 3CEQA 3T5XA 3CKCA 4AVXA 3FTUA 2L0TB 3L16A 1XNFA 1N3JA 3Q15A 2G46A 4Y6WA 4GZ3A 2RG8A 2WXGA 3M53A 5T0MA 2LO6A 3KEZA 3D9MA 3PNLB 4CCAA 4J8SA 5JIYA 4GPKA 4GZDA 4U0ZA 3SD5A 1HFAA 3EHNA 3U64A 4G23A 4UI9C 4EZJA 2L0IA 3F9WA 3D9PA 3IHVA 2X6KA 3FTVA 3U66A 3VV0A 3DPDA 4HFGA 1OWNA 2WQ7A 5ANRA 1A17A 2NXPA 3D9LA 4ILGA 5FQ7A 5J90A 1H3IA 3MO2A 2X6JA 3CVNA 4TV3A 5FZSA 4HOUA 2XCCA 3APCA 4U63A 3LKUA 4W9RA 4B89A 4KXKB 4OYSA 5BV1A 4E6HA 3CBPA 1ZU2A 3D9NA 5FZQA 4I9CA 4EECA 3AS8A 3UT7A 2O8JA 4MS6A 3IV0A 2E2EA 4GCOA 3KMAA 3MYVA 3KMJA 5ARGA 3OPEA 5F59A 3M57A 5LX8A 2WXOA 4IULA 3CLJA 4MRUA 4UWGA 4BY6A 4KYOB 2P58C 3C98A 3PRZA 4CT0A 4ANUA 1HXIA 3CGHA 2I9CA 4E47A 4AJWA 2CHXA 2XGOA 2OOEA 2KC7A 3B7TA 4MI0A 2CFZA 2X3MA 3FULA 1U3CA 4WNFA 2CG2A 2X38A 1MVXA 4I1MA 4ANVA 3IBEA 3FUNA 1XQHA 4PS8A 3RU0A 2LNIA 2HR2A 3APFA 1QQEA 3MO0A 3QWVA 3S7JA 4HXIA 2WXIA 3Q47B 2IOLA 2CFUA 2WMNA 2KZTB 2WPVA 3P2BA 2BQZA 3KMTA 4O30A 3FUHA 3MKQB 2VSXE 3FH8A 2IJGX 2V5FA 4R7LA 5G55A 3FU3A 1JWGA 5T0KA 2DBAA 4PS3A 4LRZA 4QFVA 4JA9A 3UT8A 3M5AA 4RSYA 3NF1A 3NQPA 1KT0A 4EPZA 5JJ7A 3RJWA 3JQ1A 4CDNA 2Y4UA 2I2OA 4NRHB 5JINA 4GYYA 4YVQC 5G05C 4GA0A 3UX4A 4WNDA 4I2WA 5CPRB 1E7UA 2ZU6B 4WUYA 3MV2B 3SZ7A 4ACKA 4WNGA 2PZIA 2WMOA 1HG5A 3ZGQA 1X5BA 4OVUA 4XI0A 3R7QA 1EPUA 3QARA 3ZIMA 4DLQA 1TJCA 2AW6A 5DBKA 2CHZA 2FF4A 2WXHA 3URZA 4HVBA 2QPWA 1HF8A 1OWPA 3SF4A 3PS6A 1IQRA 2KCKA 1FVHA 1MVHA 2AWIA 1O9SA 2WQ6A 3ZYKA 4UWFA 1PC2A 4PS7A 3JQ0A 3CVPA 1MQSA 1HU3A 3OOIA 4G2VA 3FTZA 4CEMA 3OTNA 3M58A 3RQ4A 4ACLA 3G2SA 5EG2A 4ME2A 4UWLA 3AU5A 4KZ0A 4AY5A 2AXUA 2C2LA 4D10C 4YNDA 4ATGA 3Q5MA 2VSYA 1B89A 4HS2A 2PL2A 3MGBA 4F3VA 3CK9A 3PEVB 4AP2A 4IYPA 2J4DA 3L6AA 2YHCA 3DBSA 4AOFA 3Q4AB 3AU4A 1UN8A 4J6IA 4MLPA 4ILIA 5M72A 3EP0A 4J8EA 2WXPA 5AJDA 1INZA 3SW9A 4L2LA 4APOA 5BW8C 3D9IA 3ZHEB 3T8MA 4NVQA 5EX0A 1N6AA 4URKA 4JHKA 4YVOA 3KAEA 2OV8A 3VLFA 1VDYA 3QKYA 3JYSA 4UI9K 3G2VA 4NACA 5LP0A 3CK7A 4XKCA 2QY7A 1UJJA 4UWHA 4GMJA 1DVPA 2IQCA 5FQ8A 4JA7A 3CVYA 2WXKA 4JPSA 4N2QA 2LSUA 5G04C 5HI7A 4H12A 2AVPA 2JEKA 4UQYA 4FA6A 3TL5A 5KCMA 4B0ZA 3GW4A 3S2AA 3CIAA 1JPLA 4HOTA 1HO8A 3LYAA 3RRMB 3LVRE 3ZYMA 4AU7A 3JUIA 4I17A 4HLEA 4I6EA 2UY1B 4B8AA 1U3DA 2YQ8A 3G2TA 1QZ2A 4XIFA 2VGXB 5T4YA 4DK5A 4JEHA 5FQ4A 1HH8A 5C2YA 1QNFA 3LVQE 2HO1A 2XHEA 3S7BA 4APFA 3LS8A 2WXNA 4XKBA 3ASDA 2IFUA 4BFRA 3QAQA 3GZ2A 5FT9A 4JDSA 3I4GA 3NZSA 3VTYA 2V8SE 2A5UA 1UJKA 4WNEA 1PAQA 3UQ3A 1XGWA 2J09A 4C0MA 1H2TC 2MOWA 3BG1B 2WXFA 1HE8A 1N6CA 4YPUA 2KCLA 3IEGA 4WWNA 1WY6A 4GU5A 4TUUA 2FULA 2Q7FA 4GCNA 1E7VA 3SBTB 2HYZA 5C1DA 2W5ZA 2PQNA 4KVOA 2XPZA 4JEUA 5EKQD 4PH4B 2VYIA 2FI7A 3FTYA 1FCHA 3D9JA 4GA1A 4IRUA 3SGHA 4LDGA 2NSZA 4QEOA 4FADA 5JJ0A 3IHXA 3O48A 5EX3A 3B7RL 4I6JA 3ESKA 5JHBA 2FO7A 3LJ3A 3LY7A 4JLGA 3FHEA 1PY1A 4NURA 4G24A 3VUZA 5EDSA 3BO5A 3SI5A 1WM5A 3QOUA 2MRIA 2A4ZA 2ONDA 2IOSA 5E76A 4BX9A 1NP7A 3D3MA 1OUVA 4DI4A 3CVWA 3MZLB 3MV3B 3ZHEA 4LEUA 2GRMA 1MT6A 1HZ4A 3ML8A 2R59A 3RO2A 4QENA 4N5CA 3VLDA 2I1JA 4BTAA 1Y6IA 1E90A 4C9BB 3LCAA 4U04A 2WB2A 5JJTA 4N3CA 4Q69A 3M55A 4GZ6A 4B8CB 3ULQA 2L9BA 2XRZA 4I6GA 3WXXA 3CSTA 3HVEA 3ZYQA 3CVXA 4Z4PA 5G2NA 1NA0A 4G11A 3ONLA 4N3AA 3R9AB 4F7AA 3PREA 1EDUA 4IJ8A 5BV0A 2WVIA 3TG5A 3FUIA 3L13A 4RZ0A 4AV7A 3B13A 3D9OA 3MJWA 3FU5A 3FUFA 4L1BA 3ONKA 4L7TA 4EQFA 4UI9J 5E75A 1UN9A 3RRUA 2XPYA 1NA3A 3ENEA 5F6LA 3EHMA 4I9EA 3QC1A 2BUGA 4CGWA 3UUXA 1H6KA 1UW4B 2X6HA 4DPRA 4AIFA 3PUJA 2I6HA 4FC8A 1Z3XA 2R5SA 3HHMA 4JHRA 4FJYA 3MCXA 2L6JA 5CCMA 1UG3A 3GZ1A 4FHKA 2F69A 1IQUA 3F9XA 1ZBPA 2CHWA 2XPIA 5A6CA 3OS5A 4ANWA 5BUZA 3HYMB 3P1UA 2VGYA 4K03A 5ENNA 4KZCA 2ILRA 3FTSA 3U9WA 4AXHA 2JV0A 3BEEA 4K0RA 2KCVA 2AXVA 2DIWA 4TRQA 5LSZA 2VGXA 2UY1A 4JHJA 2LSVA 3PE3A 4NJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQ2 A;  4AY6 A;  4BT8 A;  5FJY A;  2JLB A;  3CBO A;  1KT1 A;  4AM9 A;  5BT1 A;  4HOS A;  5LCW J;  2XCB A;  3MO5 A;  1WAO 1;  3LY9 A;  2VSN A;  3QWP A;  3CVL A;  2FEZ A;  4H7Y A;  3KD7 A;  3FFL A;  4KBQ A;  1ML9 A;  4J83 A;  3CV0 A;  3DB5 A;  2C0L A;  5DIZ A;  3ZPJ A;  3ZN3 A;  4XI9 A;  2W5Y A;  4N3B A;  3K5K A;  2PQR A;  2UWJ G;  3E4B A;  3U4T A;  3GYZ A;  4O6F A;  4U0S A;  2XEV A;  3F9Y A;  3FP3 A;  3EDT B;  5TEG A;  4BUP A;  2FBN A;  3MA5 A;  1IHG A;  3FPD A;  4BT9 A;  4N2S A;  4ABN A;  5AYW D;  3OXL A;  4G26 A;  4HOR A;  3DAL A;  3CK8 A;  5TH7 A;  4CDR A;  5JJ6 A;  2XGM A;  2KAT A;  5AYF A;  3TG4 A;  3MKR A;  4RG9 A;  4J8F A;  1YA0 A;  3VTX A;  3U3W A;  4J7F A;  3K9I A;  4HOQ A;  3LPZ A;  4N39 A;  4JL0 A;  5CHE E;  5KJK A;  3PDN A;  5BNW A;  2R3A A;  4G25 A;  3PE4 A;  4RG6 A;  5D0O D;  4I51 A;  4NQ0 A;  3ZFW A;  5G05 J;  1P5Q A;  4YNP A;  4YPE A;  5F6K C;  5ARF A;  5KJM A;  3AS4 A;  1NZN A;  2QFC A;  4UQX A;  3SWC A;  4A1S A;  2J9Q A;  3MEK A;  3CKB A;  5TTF A;  3M54 A;  4GYW A;  3Q49 B;  3CVQ A;  4J8O A;  1ZKK A;  3S7D A;  2XGS A;  4U0U A;  5HQ8 A;  3CBM A;  3ASF A;  5D0Q D;  5G04 J;  4FMU A;  4J8D A;  1ELW A;  1XQH A;  4GA2 A;  1IYG A;  3N71 A;  3QWW A;  2IGQ A;  5FTP A;  2GW1 A;  3KS2 A;  3UQ3 A;  4IN3 B;  3ASH A;  5FZR A;  3TGO A;  3FWV A;  3OXG A;  4YPA A;  5A7D B;  4BTB A;  2RFI A;  3UPV A;  1W3B A;  4BWR A;  3RJV A;  5JHN A;  4J0U A;  5CCL A;  4YNM A;  2WQH A;  3AS5 A;  4CGV A;  3RIB A;  4U07 A;  5KJL A;  3QDN A;  4MI5 A;  2Y4T A;  4G1T A;  1PEG A;  2IF4 A;  3OXF A;  4QEP A;  4I1A A;  2MHK A;  3M56 A;  4I2Z A;  4B94 A;  4GYO A;  1KLX A;  3HNA A;  2NC9 A;  3S8P A;  3LY8 A;  3S7F A;  4IJD A;  3TAX A;  1MUF A;  4H7X A;  4C1Q A;  1E96 B;  3M59 A;  1ELR A;  3RKV A;  5KJN A;  4UQZ A;  3ASG A;  4Y6C A;  5LSX A;  5LCW C;  2C0M A;  3RAY A;  3F9Z A;  4GZ5 A;  5F5E A;  1Y8M A;  5T5G A;  3RO3 A;  3CEQ A;  3CKC A;  1XNF A;  1N3J A;  3Q15 A;  2G46 A;  4Y6W A;  4GZ3 A;  3M53 A;  5T0M A;  5JIY A;  4GPK A;  4U0Z A;  4G23 A;  4UI9 C;  3F9W A;  3VV0 A;  1A17 A;  1H3I A;  3MO2 A;  3CVN A;  5FZS A;  4HOU A;  2XCC A;  3LKU A;  4W9R A;  4KXK B;  3CBP A;  1ZU2 A;  5FZQ A;  4I9C A;  3AS8 A;  2O8J A;  3KMA A;  2E2E A;  4GCO A;  3KMJ A;  3OPE A;  5F59 A;  5ARG A;  3M57 A;  4KYO B;  2P58 C;  1HXI A;  4E47 A;  2XGO A;  2OOE A;  2KC7 A;  4MI0 A;  4WNF A;  1MVX A;  3RU0 A;  2LNI A;  2HR2 A;  1QQE A;  3MO0 A;  3QWV A;  3S7J A;  3Q47 B;  2WPV A;  2BQZ A;  3KMT A;  4O30 A;  2V5F A;  5T0K A;  2DBA A;  4JA9 A;  3M5A A;  3NF1 A;  1KT0 A;  5JJ7 A;  3RJW A;  2Y4U A;  4NRH B;  5JIN A;  4GYY A;  4YVQ C;  5G05 C;  4GA0 A;  4WND A;  4I2W A;  5CPR B;  4WUY A;  3MV2 B;  3SZ7 A;  4WNG A;  2PZI A;  3ZGQ A;  4XI0 A;  1TJC A;  5DBK A;  2FF4 A;  3URZ A;  2QPW A;  3SF4 A;  2KCK A;  1MVH A;  1O9S A;  1PC2 A;  3CVP A;  3OOI A;  4G2V A;  3M58 A;  3RQ4 A;  5EG2 A;  4ME2 A;  4AY5 A;  2C2L A;  4YND A;  3Q5M A;  2VSY A;  1B89 A;  2PL2 A;  4F3V A;  3CK9 A;  2YHC A;  3Q4A B;  5M72 A;  3EP0 A;  4J8E A;  3SW9 A;  5BW8 C;  3ZHE B;  4NVQ A;  5EX0 A;  1N6A A;  4YVO A;  3KAE A;  3QKY A;  3JYS A;  4UI9 K;  3CK7 A;  4JA7 A;  4N2Q A;  2LSU A;  5G04 C;  5HI7 A;  4H12 A;  2AVP A;  4UQY A;  3GW4 A;  4HOT A;  3LYA A;  4AU7 A;  4I17 A;  2UY1 B;  4J7I A;  2YQ8 A;  1QZ2 A;  4XIF A;  2VGX B;  1HH8 A;  2HO1 A;  3S7B A;  3ASD A;  2IFU A;  3GZ2 A;  5FT9 A;  4JDS A;  3VTY A;  4WNE A;  1N6C A;  4YPU A;  2KCL A;  3IEG A;  2Q7F A;  4GCN A;  2W5Z A;  2HYZ A;  5C1D A;  2PQN A;  5EKQ D;  4LDG A;  2VYI A;  2FI7 A;  1FCH A;  4GA1 A;  4QEO A;  5JJ0 A;  3IHX A;  3O48 A;  5EX3 A;  3ESK A;  2FO7 A;  4JLG A;  3LY7 A;  4G24 A;  3VUZ A;  3BO5 A;  1WM5 A;  3QOU A;  2OND A;  1OUV A;  3MV3 B;  3ZHE A;  4LEU A;  1MT6 A;  1HZ4 A;  4QEN A;  3RO2 A;  4N5C A;  4BTA A;  3LCA A;  4U04 A;  5JJT A;  4N3C A;  3M55 A;  4GZ6 A;  3ULQ A;  3WXX A;  4Z4P A;  1NA0 A;  4N3A A;  3R9A B;  4IJ8 A;  3TG5 A;  4RZ0 A;  4EQF A;  4UI9 J;  1NA3 A;  5F6L A;  4I9E A;  2BUG A;  4CGW A;  3UUX A;  4AIF A;  2I6H A;  4JHR A;  2R5S A;  2L6J A;  5CCM A;  2F69 A;  3GZ1 A;  3F9X A;  1ZBP A;  5A6C A;  2XPI A;  3OS5 A;  3HYM B;  2VGY A;  2JV0 A;  3BEE A;  5LSZ A;  2KCV A;  2VGX A;  2UY1 A;  4APO A;  2LSV A;  3PE3 A;  4NJ5 A; 
#chains in the Genus database with same CATH topology
 3G2U A;  3SO8 A;  3ZW3 A;  1D9S A;  4Q96 A;  1HS6 A;  4HOS A;  1H2U A;  1Z6T A;  1YMP A;  1AWC B;  2XCB A;  3MO5 A;  3GZS A;  4H7Y A;  1TN6 A;  4U95 D;  3E32 A;  3ZVV A;  4GTR A;  2C0L A;  5DIZ A;  3ZPJ A;  3ZN3 A;  4EBA A;  2PQR A;  4BSX A;  2DWZ A;  3SFZ A;  3ZRH A;  3U4T A;  3QNK A;  4ILH B;  4U0S A;  1GW6 A;  4FJZ A;  4BUP A;  3MA5 A;  5ITZ F;  4XZ4 A;  1TJF A;  1FT1 A;  4EBA G;  3FEY A;  3CK8 A;  5TH7 A;  2PM7 A;  2R03 A;  4L2Y A;  4Z68 A;  4U7E B;  1H6P A;  4LUN U;  4RG9 A;  1YA0 A;  4HOQ A;  1S63 A;  3FTW A;  4KVM A;  4RVB A;  4N39 A;  2OCC E;  5KJK A;  2R3A A;  4G25 A;  5FWQ A;  2GGF A;  3FY4 A;  4HBD A;  5EIL A;  5G05 J;  1OWO A;  4LNG A;  3SQV A;  5F6K C;  4JVS A;  3R9M A;  2QFC A;  1TNZ A;  3SWC A;  4A1S A;  4RLY A;  2J49 A;  3CKB A;  3FDH A;  3CHR A;  1TR4 A;  3PH0 C;  3G2W A;  1RW2 A;  4DLO A;  4MBG A;  5HQ8 A;  1Z3Y A;  3C72 A;  3QK0 A;  1QYM A;  5D0Q D;  5G04 J;  3B7B A;  4FMU A;  1TNO A;  3E34 A;  4UWK A;  1IYG A;  3AG4 E;  3QWW A;  1HX8 A;  2YIN A;  2IGQ A;  4HLL A;  2WXL A;  3ASH A;  3TGO A;  2GRR B;  3FWV A;  3BG0 B;  3OXG A;  4JZY A;  4U8H A;  1ELK A;  3SNX A;  4YPA A;  5A7D B;  4I43 A;  3VLE A;  5KBA A;  3UPV A;  3RSE G;  2EIM E;  1WDY A;  4FLB A;  4GAA A;  4J0U A;  3CR3 A;  2WQH A;  4K5A B;  4CGV A;  1OXJ A;  2X6I A;  3ZNG A;  1H19 A;  4TXQ A;  1PEG A;  3OXF A;  4I1A A;  2MHK A;  2F8X K;  3TJP A;  4B94 A;  2BF0 X;  3Q78 A;  2WM9 A;  3HNA A;  3TAX A;  4H7X A;  3NOG D;  2OVB A;  3M59 A;  3DPY A;  3FH5 A;  1DNP A;  4P29 A;  2XQ0 A;  5LCW C;  3TXM A;  5T8I A;  5B3S E;  3RAY A;  4A3V A;  5F5E A;  1Y8M A;  4A55 A;  5T5G A;  1IXV A;  3RO3 A;  3CKC A;  1XNF A;  3Q15 A;  2G46 A;  4Y6W A;  1TNY A;  2RG8 A;  3Q9N C;  2WXG A;  3M53 A;  1JCS A;  4U0Z A;  3U64 A;  3F9W A;  3D9P A;  3PZ4 A;  3FTV A;  3U66 A;  3VV0 A;  3D9L A;  1MX4 A;  3CVN A;  4LNB A;  2XS8 A;  4B89 A;  3APC A;  4I9C A;  3UT7 A;  4GCO A;  3J5Q B;  3M57 A;  4MRU A;  3CLJ A;  4UWG A;  5EIB E;  4BY6 A;  3C98 A;  4CT0 A;  3ZKJ A;  1D8E A;  2KC7 A;  3FUL A;  1KPS B;  4HRN A;  4I1M A;  4PS8 A;  3RU0 A;  4HXI A;  3X2Q E;  2CFU A;  3UM2 A;  4O30 A;  3Q7F A;  3FUH A;  2IJG X;  1JWG A;  5T0K A;  4PS3 A;  4QFV A;  4JA9 A;  3UT8 A;  3HXB A;  4CDN A;  3ZUV B;  5CPR B;  2ZU6 B;  1BD8 A;  4OVU A;  4DLQ A;  3ZIM A;  4EHM A;  5DBK A;  4HRM B;  1G3N B;  2ZIS A;  1HF8 A;  1OWP A;  3SF4 A;  3PS6 A;  2KCK A;  4O1O A;  1FVH A;  2WQ6 A;  1K1B A;  2GRP B;  4D10 C;  2P9I G;  3Q5M A;  3MGB A;  1N11 A;  2J4D A;  4HNA D;  4MLP A;  4DUI A;  4ILI A;  1INZ A;  4L2L A;  3D9I A;  3HXE A;  5EX0 A;  1O1S A;  1N6A A;  4JHK A;  3KAE A;  4U96 D;  3VLF A;  5EYL A;  2KXP C;  1NI1 A;  5LP0 A;  2IQC A;  2WXK A;  4JPS A;  2LSU A;  2AVP A;  2JEK A;  3NOC D;  3AAA C;  1JPL A;  3PZ2 A;  1HO8 A;  3DXM G;  3RRM B;  2ETA A;  3ZYM A;  4I17 A;  2VGX B;  1QNF A;  2P9L G;  5CED B;  3S7B A;  2WXN A;  2IFU A;  2A5U A;  4NIK A;  3KSQ A;  4YDY A;  1TNU A;  3BG1 B;  2WXF A;  4YPU A;  2KCL A;  3DSU A;  4WWN A;  2DVW A;  4GCN A;  4KVO A;  4PH4 B;  3D9J A;  5JJ0 A;  3O48 A;  3TWU A;  3BO5 A;  4YDO A;  2A4Z A;  5E76 A;  4DI4 A;  3D3M A;  4GTS A;  4LEU A;  1HZ4 A;  3HG0 D;  3HRA A;  4BTA A;  4C9B B;  1LTX A;  1JCQ A;  3WXX A;  4Z4P A;  5G2N A;  4G11 A;  3PRE A;  2MYO A;  5BV0 A;  2WVI A;  3TG5 A;  4DX2 A;  3FU5 A;  3ONK A;  4EQF A;  5E75 A;  3RRU A;  5F6L A;  1S64 A;  3EHM A;  5CRV A;  2L6J A;  2F69 A;  3GZ1 A;  1IQU A;  3F9X A;  1ZBP A;  5A6C A;  5BUZ A;  1KZP A;  4K5B A;  1BI7 B;  3C3O A;  1O1T A;  3U9W A;  3BEE A;  4K0R A;  4TRQ A;  5D2M C;  2VGX A;  3PE3 A;  3MX3 A;  2HM8 A;  1OY3 D;  3CBO A;  2L6B A;  1KT1 A;  1S0P A;  4AM9 A;  3UI2 A;  2F8Y A;  5FQ6 A;  3QWP A;  3KD7 A;  4KBQ A;  1ML9 A;  2YHE A;  4DX6 D;  3CV0 A;  3LEW A;  5AIJ A;  2IU1 A;  3AG1 E;  3KEA A;  1L5J A;  3BQO A;  2GRN B;  3GYZ A;  3CHQ A;  3EU9 A;  1HG2 A;  4LCT A;  1H0A A;  2XEV A;  3FP3 A;  1K1A A;  5ANL A;  3PUK A;  3ZEF A;  1IHG A;  5FIN A;  3FPD A;  3UT4 A;  2V4H C;  3C5R A;  4LNU D;  2XZT G;  4FU3 A;  4ABN A;  3OXL A;  4BEP A;  4CDR A;  2KAT A;  5AYF A;  3TG4 A;  4J8F A;  1OWM A;  1N94 A;  3ISM C;  4EZK A;  4BX8 A;  4I1O B;  4DJA A;  1MHQ A;  4RG6 A;  5D0O D;  3V30 A;  4C0E A;  3ZFW A;  3CHS A;  5CMY A;  4BET A;  2I1K A;  3TXN A;  4TXP A;  4YNP A;  3FH7 A;  3LXU X;  1EYH A;  5ARF A;  4AEZ C;  5KJM A;  1OCZ E;  3D9K A;  4UQX A;  4OVV A;  4L9P A;  1TYQ G;  3ZXS A;  3JXI A;  3QB2 A;  3M54 A;  4GPM A;  2XRY A;  3L54 A;  4GTM A;  4L23 A;  3NAW A;  1ZKK A;  5JA4 D;  3S7D A;  3CVU A;  3E33 A;  3I4R B;  3Q75 A;  2PM6 A;  1SZ9 A;  4DRX E;  1N54 A;  4YDW A;  2V0P A;  1ELW A;  2KM4 A;  3PNT B;  2RFA A;  3RRN B;  5AEN A;  3ZYL A;  1N4R A;  3KS2 A;  3FU0 A;  5FZR A;  3QJZ A;  1YYH A;  2CG3 A;  4JB8 P;  5ENO D;  4QQI A;  3FUK A;  4HRL A;  3IKO B;  4BTB A;  4GB9 A;  4WAF A;  3C3R A;  2GRQ B;  4YNM A;  5HKP A;  3RIB A;  3RK6 A;  5LOZ A;  5A23 A;  3CSF A;  3I3N A;  3WG7 E;  2Y4T A;  4G1T A;  2P9U G;  3M56 A;  1H2V C;  2V4L A;  4GYO A;  3S8P A;  3LY8 A;  3R7R A;  1MUF A;  4C1Q A;  3TWR A;  4JW1 A;  2Y3A A;  5KJN A;  1OWL A;  3ASG A;  4ANX A;  1E8Y A;  2EIL E;  2ZGD A;  4AVX A;  3FTU A;  3L16 A;  3TWQ A;  1HFA A;  3EHN A;  5AQA A;  3TWX A;  1A17 A;  5J90 A;  1H3I A;  3MO2 A;  2GRO B;  4TV3 A;  5FZS A;  2Y69 E;  2XCC A;  4KXK B;  4OYS A;  4MS6 A;  3KMA A;  2E2E A;  4A63 B;  3MYV A;  4N5Q A;  1OCC E;  4KYO B;  3CGH A;  4AJW A;  4MI0 A;  1U3C A;  4WNF A;  2CG2 A;  2X38 A;  1MVX A;  3IBE A;  3HXD A;  2EIN E;  2OEV A;  3APF A;  1QQE A;  1IHB A;  3S7J A;  3Q47 B;  3KMT A;  2BQZ A;  3FH8 A;  2V5F A;  4R7L A;  3FU3 A;  3UIP C;  2DYR E;  3NF1 A;  3DSW A;  4ZHB A;  5CBN A;  5AAO A;  3T8K A;  2R05 A;  4GYY A;  2LUH A;  3UX4 A;  3EHQ A;  2WMO A;  3ZGQ A;  5FIO A;  4XI0 A;  1EPU A;  1TJC A;  2QYU A;  1WG0 A;  1MYO A;  3ZXP A;  2AWI A;  1O9S A;  1PC2 A;  4PS7 A;  3CVP A;  1HU3 A;  3OOI A;  4G2V A;  3NBN B;  2P9K G;  4ME2 A;  4X8Q A;  4KZ0 A;  3E37 A;  4F3V A;  2LXL A;  4J6I A;  3PZ1 A;  5M72 A;  3ZHE B;  3JYS A;  1UOH A;  3SFY A;  4UWH A;  4H12 A;  5AAR A;  4FA6 A;  2LXM A;  1H6O A;  2QYJ A;  3CIA A;  3LVR E;  3B95 A;  3JUI A;  4HLE A;  4B8A A;  2YQ8 A;  5T4Y A;  5FQ4 A;  5C2Y A;  3LVQ E;  3ULE G;  3LS8 A;  1RZ4 A;  3QAQ A;  3UM3 A;  3UTM A;  3I4G A;  4U8V D;  1XGW A;  4C0M A;  3ABM E;  3UM0 A;  4GTQ A;  4HI8 A;  1MZC A;  1N6C A;  3RAU A;  1WY6 A;  4TUU A;  5CEA A;  1E7V A;  2OEW A;  4JEU A;  5EKQ D;  2VYI A;  3FTY A;  3SGH A;  4IRU A;  4FAD A;  4DX1 A;  4I6J A;  4JLG A;  1PY1 A;  4G24 A;  5EDS A;  1WM5 A;  2MRI A;  2OND A;  4BX9 A;  3MV3 B;  3ZHE A;  4QEN A;  4N5C A;  3VLD A;  1SA5 A;  4U04 A;  2WB2 A;  4N3C A;  4F6R D;  4GZ6 A;  3ULQ A;  2H6F A;  3BU8 A;  3SY2 A;  3HVE A;  3ZYQ A;  1NA0 A;  4N3A A;  3R9A B;  2P9S G;  3TWS A;  3BUA A;  4XEI G;  2XEH A;  2BED A;  2XPY A;  3ENE A;  3UUX A;  1H6K A;  4AIF A;  2R5S A;  3EHR A;  2XPI A;  4ATZ D;  5ENN A;  4KZC A;  3FTS A;  5LSZ A;  2UY1 A;  2LSV A;  2XS1 A;  4NJ5 A;  2VQ2 A;  1OCO E;  4AY6 A;  4BT8 A;  4LSZ E;  3CHP A;  2JLB A;  2RD0 A;  3EIQ C;  1QBQ A;  3I5P A;  1SZA A;  3HIZ A;  3FUE A;  4GTP A;  4J8Y A;  5LCW J;  2WXQ A;  1WAO 1;  3LY9 A;  4FHJ A;  5AJL A;  3FFL A;  1TEZ A;  3HVE B;  4J83 A;  3DB5 A;  2X6F A;  1MX6 A;  3FUJ A;  2H6I A;  4N3B A;  3K5K A;  4E85 A;  4CRW A;  3JXJ A;  1BU9 A;  3FU6 A;  3SHF A;  4DI3 A;  4A3T A;  3L08 A;  3EDT B;  4BSZ B;  2WXR A;  4M3O A;  4G8K A;  3AG2 E;  4WWP A;  3B7U X;  1SQM A;  4N2S A;  1D8D A;  1YCS B;  4B93 B;  4JXT A;  3FEX A;  5AQ7 A;  2RKK A;  4CDM A;  4G8L A;  3U3W A;  4J7F A;  3K9I A;  3LPZ A;  4HQD A;  3LDZ A;  5CHE E;  5ENQ D;  3PDN A;  5BNW A;  3PE4 A;  2XEE A;  4FLH A;  2H6H A;  1P5Q A;  5AQ9 A;  2LAI A;  4PUC A;  5B1B E;  5T3R A;  4YPE A;  1BPO A;  3D9H A;  3AS4 A;  5B1A E;  2XEN A;  3PZ3 A;  3DSX A;  3ABL E;  2J9Q A;  5JHA A;  4JC8 A;  1O1R A;  2LAH A;  2EQX A;  5TTF A;  1U2V G;  4GZC A;  3PVL A;  4GYW A;  3Q49 B;  4JD2 G;  3CVQ A;  4J8O A;  2DYS E;  3HDX A;  3CBM A;  4FP7 A;  3JCK C;  5BPP A;  3FTX A;  4EZL A;  4F53 A;  5IY5 E;  1XQH A;  4XE0 A;  4MKT A;  2GW1 A;  3O4Z A;  2GRL A;  1IKN D;  1W3B A;  4BWR A;  5JHN A;  3EU5 A;  5CCL A;  4XX5 A;  4OAV B;  3TWT A;  3QDN A;  1K3Z D;  4I2Z A;  1E8Z A;  4A1G A;  3PEU B;  2Y1L E;  2NC9 A;  2OVF A;  3S7F A;  4IJD A;  2J07 A;  1ELR A;  2J4B A;  3T5V A;  1SVX A;  3J5P A;  4UQZ A;  5LSX A;  2AXZ A;  3F9Z A;  4GZ5 A;  3L9T A;  1ZB1 A;  2BTD A;  2VJ8 A;  3CEQ A;  3T5X A;  3JUE A;  1N3J A;  1BLX B;  2XZD G;  2P9N G;  3ASN E;  3PNL B;  4CCA A;  4J8S A;  5ENR D;  2RFM A;  4GZD A;  3SD5 A;  2P2C P;  4UUC A;  4G23 A;  4K5C A;  1N4P A;  4GTV A;  2X6K A;  3T9K A;  1OWN A;  2WQ7 A;  5ANR A;  2X6J A;  3TWV A;  2IO2 C;  4HOU A;  2AJA A;  4W9R A;  3ZU7 B;  5BV1 A;  3CBP A;  1ZU2 A;  2IEJ A;  5FZQ A;  3OPE A;  2WXO A;  4IUL A;  2P58 C;  3PRZ A;  1HXI A;  2I9C A;  4E47 A;  2CHX A;  2OOE A;  3B7T A;  2X3M A;  5JMN D;  3FUN A;  2HR2 A;  4M7C A;  3QWV A;  4GMR A;  2WPV A;  3P2B A;  3ULY A;  5G55 A;  2DBA A;  4LRZ A;  1KT0 A;  5JJ7 A;  3JQ1 A;  2Y4U A;  5CBO A;  5JIN A;  4YVQ C;  5G05 C;  4GA0 A;  1E7U A;  3MV2 B;  4ACK A;  1HG5 A;  4C48 B;  3R7Q A;  1S70 B;  2AW6 A;  2CHZ A;  4HVB A;  2QPW A;  1IQR A;  1NL4 A;  1MVH A;  4UWF A;  2IO3 C;  3JQ0 A;  3FTZ A;  3Q9U C;  4CEM A;  3OTN A;  3M58 A;  3RQ4 A;  4ACL A;  5EG2 A;  4UWL A;  3AU5 A;  4AY5 A;  2C2L A;  4GTO A;  4YND A;  4ATG A;  4HS2 A;  2VSY A;  1B89 A;  2PL2 A;  3CK9 A;  3PEV B;  3L6A A;  3Q4A B;  1UN8 A;  1X81 A;  4J8E A;  2WXP A;  5AJD A;  3SW9 A;  4OAU C;  5BW8 C;  4NVQ A;  1K8K G;  4URK A;  1VDY A;  3G2V A;  2QY7 A;  4GMJ A;  4JA7 A;  4N2Q A;  5G04 C;  5ENT D;  4UQY A;  4HOT A;  2QC9 A;  4I6E A;  4DK5 A;  3G2T A;  1QZ2 A;  4JEH A;  1HH8 A;  2HO1 A;  3ASD A;  3GZ2 A;  5FT9 A;  3NZS A;  3VTY A;  2V8S E;  1UJK A;  4WNE A;  1PAQ A;  3DWL G;  5CRU A;  5CER B;  1H2T C;  1HE8 A;  3UIO C;  3UM1 A;  1OT8 A;  2FUL A;  2W5Z A;  3SBT B;  2HYZ A;  5C1D A;  2XPZ A;  4LDG A;  2FI7 A;  1LD7 A;  5KNG A;  3IHX A;  1SA4 A;  4CYM D;  2PNN A;  3ESK A;  5JHB A;  3LJ3 A;  4NUR A;  2B0O E;  3SI5 A;  3AJI A;  3DXK G;  4J7W A;  3W9G A;  3CVW A;  1NP7 A;  2GRM A;  1MT6 A;  2R59 A;  3RO2 A;  2I1J A;  1Y6I A;  1E90 A;  5ENP D;  5JJT A;  3TWW A;  1Z5S C;  4B8C B;  2XRZ A;  2L9B A;  4I6G A;  3CST A;  3CVX A;  4GTT A;  1MX2 A;  3E30 A;  1JCR A;  3ONL A;  1EDU A;  5BXO A;  3L13 A;  4RZ0 A;  3B13 A;  3MJW A;  3FUF A;  1UN9 A;  2ZIR A;  4I9E A;  4O60 A;  2BUG A;  1UW4 B;  4DPR A;  2BKK B;  3PUJ A;  2I6H A;  2ZXW E;  5H7P A;  1UG3 A;  4FHK A;  2CHW A;  5BXU A;  2VGY A;  4K03 A;  2ILR A;  1AP7 A;  2JV0 A;  2KCV A;  2AXV A;  2DIW A;  2F37 A;  4APO A;  2WXM A;  1A5E A;  5FJY A;  1N52 A;  3CHM A;  5BT1 A;  2VSN A;  3CVL A;  2FEZ A;  2Y0B G;  1JWF A;  4F1P A;  3NZU A;  4XI9 A;  2W5Y A;  2UWJ G;  4WWO A;  3E4B A;  4O6F A;  4F1S A;  4CZ2 D;  3F9Y A;  1MJ0 A;  2M63 A;  5TEG A;  4KMO A;  4LER A;  2FBN A;  2VTB A;  2WXJ A;  3KSL A;  4BT9 A;  3UMV A;  1TN7 A;  3FUM A;  2B6C A;  5AYW D;  4G26 A;  4HOR A;  3DAL A;  5JJ6 A;  2XGM A;  2ION A;  2EIJ E;  3MKR A;  1N0R A;  3VTX A;  3L22 A;  1N9A A;  4JL0 A;  3IHY A;  3Q73 A;  3B7S A;  5ENS D;  2R17 C;  3Q7A A;  4I51 A;  4NQ0 A;  2DZO A;  4CT4 A;  1FVF A;  4GML A;  1NZN A;  3UIN C;  3W9F A;  3CVV A;  3MEK A;  2VSO E;  4KT6 B;  2KBX A;  3SFX A;  1E8W A;  3CQG B;  4YDE A;  2XGS A;  4U0U A;  4Q94 A;  3MKQ A;  3DSS A;  3ASF A;  2KZT A;  2YNQ A;  2H6G A;  3UKR G;  4J8D A;  1V54 E;  3ESL A;  4FUL A;  1EF1 C;  2E0I A;  4GA2 A;  3N71 A;  4V3I A;  2BKG A;  2JAB A;  1E8X A;  5FTP A;  3EJN A;  3ML9 A;  3L17 A;  4PDX A;  3UQ3 A;  4IN3 B;  5LFA A;  1DCE A;  3HXC A;  5KNH D;  2RFI A;  3RJV A;  1FPP A;  3OAW A;  5EN5 D;  3AS5 A;  1O5M A;  4U07 A;  3UKU G;  5CMW A;  5KJL A;  4MI5 A;  4TXR A;  3CQC B;  2IF4 A;  2F0Y A;  4QEP A;  3CHO A;  5D66 A;  3PZD A;  4BES A;  1KLX A;  1E96 B;  2DCP A;  3RKV A;  5EID A;  1FT2 A;  3APD A;  1NFI E;  4Y6C A;  5HRY A;  3FUD A;  3DST A;  2C0M A;  3EIJ A;  2VTB B;  3SBS A;  1JUQ A;  1N0Q A;  5J08 A;  1LF8 A;  2ETB A;  2L0T B;  1V55 E;  2R2L A;  4GZ3 A;  5T0M A;  2LO6 A;  3KEZ A;  3D9M A;  5JIY A;  4GPK A;  1LD8 A;  4UI9 C;  4EZJ A;  2L0I A;  1DC2 A;  3IHV A;  1N4S A;  3DPD A;  4HFG A;  2NXP A;  5FQ7 A;  4ILG A;  1SW6 A;  4U63 A;  3LKU A;  3Q79 A;  4E6H A;  2P9P G;  4HI9 A;  4LG6 A;  3D9N A;  4EEC A;  3AS8 A;  2O8J A;  2FO1 E;  3IV0 A;  3KMJ A;  3DEP A;  5F59 A;  5ARG A;  4ZFH A;  5LX8 A;  1DCQ A;  5HS0 A;  3EUV A;  4ANU A;  4HB5 A;  2XGO A;  2CFZ A;  3V2O A;  3V2X A;  4U8Y D;  4ANV A;  1Q2Z A;  3AG3 E;  2LNI A;  3MO0 A;  2DZN A;  2WXI A;  3DEO A;  3DSV A;  3UXG A;  2IOL A;  2WMN A;  2KZT B;  4DX7 D;  3MKQ B;  2VSX E;  3M5A A;  4RSY A;  3NQP A;  4EPZ A;  3RJW A;  2I2O A;  4NRH B;  5EYP F;  2VGE A;  4WND A;  4I2W A;  4WUY A;  3SZ7 A;  1N95 A;  4WNG A;  2PZI A;  1X5B A;  3QAR A;  2FF4 A;  2WXH A;  3URZ A;  2QZA A;  3C3Q A;  3ZYK A;  2ZGG A;  4O1P A;  1MQS A;  3G2S A;  2AXU A;  2ETC A;  4TUM A;  4AP2 A;  4IYP A;  4AOF A;  2YHC A;  3DBS A;  3AU4 A;  1OCR E;  3EP0 A;  2V5Q C;  5KWD A;  2NYJ A;  3T8M A;  3DRA A;  4YVO A;  2OV8 A;  3HXF A;  3QKY A;  2R02 A;  4UI9 K;  4NAC A;  3CK7 A;  4XKC A;  1UJJ A;  1DVP A;  2EIK E;  5FQ8 A;  3V31 A;  3CVY A;  5HI7 A;  3TL5 A;  5KCM A;  4B0Z A;  3GW4 A;  3S2A A;  3LYA A;  4AU7 A;  2UY1 B;  5AN8 A;  1U3D A;  4J7I A;  4XIF A;  1TNB A;  4BER A;  1BI8 B;  2XHE A;  4RQI A;  4APF A;  4XKB A;  4BFR A;  4JDS A;  3L82 A;  2J09 A;  2MOW A;  3IEG A;  4GU5 A;  1TN8 A;  2Q7F A;  2PQN A;  1FCH A;  4GA1 A;  4QEO A;  2J8S D;  2NSZ A;  5EX3 A;  3V79 K;  3B7R L;  2FO7 A;  3LY7 A;  3FHE A;  5CEC B;  2A5E A;  3VUZ A;  3QOU A;  5AQB A;  1KZO A;  2IOS A;  1OUV A;  3MZL B;  3ABK E;  1N4Q A;  2IY0 C;  3ML8 A;  3LCA A;  4Q69 A;  3M55 A;  4DX5 D;  4F7A A;  4IJ8 A;  3FUI A;  2HE0 A;  4AV7 A;  3NB2 A;  3D9O A;  4L1B A;  4L7T A;  4UI9 J;  1NA3 A;  3QC1 A;  4CGW A;  2X6H A;  4FC8 A;  1Z3X A;  3HHM A;  4JHR A;  4FJY A;  3MCX A;  5CCM A;  3ASO E;  3LJN A;  3OS5 A;  4ANW A;  3HYM B;  3P1U A;  3IXE A;  4AXH A;  3F6Q A;  2J08 A;  4JHJ A; 
#chains in the Genus database with same CATH homology
 2VQ2 A;  3MX3 A;  3G2U A;  2WXM A;  4BT8 A;  4AY6 A;  3ZW3 A;  3CHP A;  2HM8 A;  4Q96 A;  5FJY A;  2JLB A;  3CBO A;  2RD0 A;  1N52 A;  3CHM A;  3EIQ C;  3I5P A;  1SZA A;  3HIZ A;  1KT1 A;  3FUE A;  1HS6 A;  1S0P A;  4AM9 A;  5BT1 A;  1H2U A;  4HOS A;  1Z6T A;  5LCW J;  2XCB A;  2WXQ A;  1WAO 1;  3LY9 A;  4FHJ A;  3MO5 A;  5FQ6 A;  3GZS A;  2VSN A;  3QWP A;  3CVL A;  2FEZ A;  5AJL A;  4H7Y A;  3KD7 A;  3FFL A;  1JWF A;  3HVE B;  4KBQ A;  1TEZ A;  2YHE A;  1ML9 A;  4J83 A;  3ZVV A;  3CV0 A;  3DB5 A;  2X6F A;  3LEW A;  2C0L A;  3NZU A;  3FUJ A;  5DIZ A;  3ZN3 A;  2IU1 A;  4XI9 A;  3ZPJ A;  4N3B A;  5AIJ A;  2W5Y A;  3K5K A;  4EBA A;  2PQR A;  2UWJ G;  4BSX A;  4WWO A;  4E85 A;  4CRW A;  3SFZ A;  1L5J A;  3E4B A;  3ZRH A;  3U4T A;  3GYZ A;  3CHQ A;  4O6F A;  3FU6 A;  3QNK A;  1HG2 A;  4LCT A;  1H0A A;  4ILH B;  4U0S A;  2XEV A;  3SHF A;  4F1S A;  4DI3 A;  1GW6 A;  3F9Y A;  3TGO A;  2M63 A;  4A3T A;  3FP3 A;  3L08 A;  3EDT B;  4FJZ A;  5TEG A;  4BUP A;  4KMO A;  2WXR A;  4M3O A;  2J08 A;  5ANL A;  4LER A;  2FBN A;  2VTB A;  3MA5 A;  2WXJ A;  3PUK A;  3ZEF A;  1IHG A;  3FPD A;  4WWP A;  4BT9 A;  3B7U X;  1TJF A;  4XZ4 A;  3UT4 A;  1SQM A;  3UMV A;  4N2S A;  3FUM A;  4FU3 A;  4ABN A;  4EBA G;  3FEY A;  5AYW D;  3OXL A;  4G26 A;  4HOR A;  3DAL A;  3CK8 A;  4JXT A;  5TH7 A;  4CDR A;  5JJ6 A;  2XGM A;  2ION A;  2PM7 A;  2KAT A;  3FEX A;  4L2Y A;  5AYF A;  3TG4 A;  4LUN U;  3MKR A;  4RG9 A;  4J8F A;  4CDM A;  1YA0 A;  3VTX A;  3U3W A;  1OWM A;  4J7F A;  3K9I A;  3L22 A;  3LPZ A;  4HOQ A;  4EZK A;  3FTW A;  4KVM A;  4RVB A;  4N39 A;  4JL0 A;  3LDZ A;  5CHE E;  4BX8 A;  3IHY A;  5KJK A;  3PDN A;  4I1O B;  5BNW A;  2R3A A;  3B7S A;  4G25 A;  5FWQ A;  3PE4 A;  1MHQ A;  4DJA A;  4RG6 A;  2GGF A;  2R17 C;  5D0O D;  3FY4 A;  4C0E A;  4FLH A;  4I51 A;  4NQ0 A;  3CHS A;  5CMY A;  5G05 J;  1OWO A;  1P5Q A;  3ZFW A;  2I1K A;  3TXN A;  2LAI A;  4PUC A;  4YNP A;  3FH7 A;  4CT4 A;  3LXU X;  5T3R A;  1FVF A;  4GML A;  4YPE A;  1BPO A;  5F6K C;  1EYH A;  5ARF A;  4AEZ C;  5KJM A;  3AS4 A;  4JVS A;  1NZN A;  2QFC A;  3D9K A;  3CVV A;  4UQX A;  4OVV A;  3SWC A;  4A1S A;  2J9Q A;  2J49 A;  5JHA A;  3MEK A;  4JC8 A;  3ZXS A;  3CKB A;  2VSO E;  2LAH A;  2EQX A;  4KT6 B;  5TTF A;  3FDH A;  3QB2 A;  3M54 A;  4GZC A;  3CHR A;  3PVL A;  4GYW A;  2XRY A;  3Q49 B;  3PH0 C;  3L54 A;  3CVQ A;  3G2W A;  1E8W A;  3CQG B;  4L23 A;  1ZKK A;  3S7D A;  3CVU A;  2XGS A;  4J8O A;  4DLO A;  4U0U A;  3I4R B;  4Q94 A;  5HQ8 A;  3MKQ A;  3HDX A;  2PM6 A;  1Z3Y A;  1SZ9 A;  3ASF A;  2KZT A;  3CBM A;  1N54 A;  3QK0 A;  4FP7 A;  2YNQ A;  3JCK C;  5D0Q D;  5BPP A;  5G04 J;  4FMU A;  3FTX A;  4EZL A;  4J8D A;  2V0P A;  1ELW A;  2KM4 A;  3ESL A;  3PNT B;  1EF1 C;  4FUL A;  4XE0 A;  2E0I A;  4UWK A;  3RRN B;  4GA2 A;  4MKT A;  3ZYL A;  5AEN A;  1IYG A;  3N71 A;  3QWW A;  4V3I A;  1HX8 A;  2YIN A;  2IGQ A;  1E8X A;  5FTP A;  3EJN A;  3ML9 A;  2GW1 A;  3KS2 A;  3L17 A;  3O4Z A;  4PDX A;  3FU0 A;  2WXL A;  3ASH A;  3QJZ A;  4IN3 B;  3FWV A;  2CG3 A;  3BG0 B;  5FZR A;  3OXG A;  4JZY A;  4F53 A;  5LFA A;  3FUK A;  4U8H A;  3IKO B;  1ELK A;  3SNX A;  2GRL A;  4YPA A;  5A7D B;  4BTB A;  2RFI A;  4I43 A;  4GB9 A;  3VLE A;  3UPV A;  1W3B A;  4BWR A;  3RJV A;  4WAF A;  5JHN A;  3OAW A;  4FLB A;  4GAA A;  4J0U A;  5CCL A;  4YNM A;  3CR3 A;  2WQH A;  4J7I A;  3AS5 A;  4CGV A;  4XX5 A;  3RIB A;  3RK6 A;  4U07 A;  5LOZ A;  5CMW A;  5A23 A;  3CSF A;  5KJL A;  3I3N A;  2X6I A;  3QDN A;  4MI5 A;  2Y4T A;  4G1T A;  1H19 A;  3CQC B;  1PEG A;  2IF4 A;  3OXF A;  4QEP A;  4I1A A;  2MHK A;  3CHO A;  3M56 A;  4I2Z A;  3TJP A;  1H2V C;  2V4L A;  1E8Z A;  4B94 A;  2BF0 X;  3PZD A;  3PEU B;  4GYO A;  4A1G A;  2WM9 A;  1KLX A;  3HNA A;  2NC9 A;  3S8P A;  3LY8 A;  2OVF A;  3R7R A;  3S7F A;  3TAX A;  1MUF A;  4IJD A;  4H7X A;  4C1Q A;  1E96 B;  2DCP A;  2OVB A;  3M59 A;  2J07 A;  1ELR A;  2J4B A;  3FH5 A;  3RKV A;  3T5V A;  3APD A;  4JW1 A;  1DNP A;  2Y3A A;  5KJN A;  4UQZ A;  1OWL A;  3ASG A;  4Y6C A;  4P29 A;  2XQ0 A;  4ANX A;  3FUD A;  5LSX A;  5LCW C;  2C0M A;  3TXM A;  2AXZ A;  5T8I A;  1E8Y A;  3EIJ A;  2VTB B;  3RAY A;  3F9Z A;  4A3V A;  4GZ5 A;  3SBS A;  5F5E A;  1Y8M A;  4A55 A;  5T5G A;  2BTD A;  2VJ8 A;  1JUQ A;  3RO3 A;  5J08 A;  1LF8 A;  3CEQ A;  3T5X A;  3CKC A;  4AVX A;  3FTU A;  2L0T B;  3L16 A;  1XNF A;  1N3J A;  3Q15 A;  2G46 A;  4Y6W A;  4GZ3 A;  2RG8 A;  2WXG A;  3M53 A;  5T0M A;  2LO6 A;  3KEZ A;  3D9M A;  3PNL B;  4CCA A;  4J8S A;  5JIY A;  4GPK A;  4GZD A;  4U0Z A;  3SD5 A;  1HFA A;  3EHN A;  3U64 A;  4G23 A;  4UI9 C;  4EZJ A;  2L0I A;  3F9W A;  3D9P A;  3IHV A;  2X6K A;  3FTV A;  3U66 A;  3VV0 A;  3DPD A;  4HFG A;  1OWN A;  2WQ7 A;  5ANR A;  1A17 A;  2NXP A;  3D9L A;  4ILG A;  5FQ7 A;  5J90 A;  1H3I A;  3MO2 A;  2X6J A;  3CVN A;  4TV3 A;  5FZS A;  4HOU A;  2XCC A;  3APC A;  4U63 A;  3LKU A;  4W9R A;  4B89 A;  4KXK B;  4OYS A;  5BV1 A;  4E6H A;  3CBP A;  1ZU2 A;  3D9N A;  5FZQ A;  4I9C A;  4EEC A;  3AS8 A;  3UT7 A;  2O8J A;  4MS6 A;  3IV0 A;  2E2E A;  4GCO A;  3KMA A;  3MYV A;  3KMJ A;  5ARG A;  3OPE A;  5F59 A;  3M57 A;  5LX8 A;  2WXO A;  4IUL A;  3CLJ A;  4MRU A;  4UWG A;  4BY6 A;  4KYO B;  2P58 C;  3C98 A;  3PRZ A;  4CT0 A;  4ANU A;  1HXI A;  3CGH A;  2I9C A;  4E47 A;  4AJW A;  2CHX A;  2XGO A;  2OOE A;  2KC7 A;  3B7T A;  4MI0 A;  2CFZ A;  2X3M A;  3FUL A;  1U3C A;  4WNF A;  2CG2 A;  2X38 A;  1MVX A;  4I1M A;  4ANV A;  3IBE A;  3FUN A;  1XQH A;  4PS8 A;  3RU0 A;  2LNI A;  2HR2 A;  3APF A;  1QQE A;  3MO0 A;  3QWV A;  3S7J A;  4HXI A;  2WXI A;  3Q47 B;  2IOL A;  2CFU A;  2WMN A;  2KZT B;  2WPV A;  3P2B A;  2BQZ A;  3KMT A;  4O30 A;  3FUH A;  3MKQ B;  2VSX E;  3FH8 A;  2IJG X;  2V5F A;  4R7L A;  5G55 A;  3FU3 A;  1JWG A;  5T0K A;  2DBA A;  4PS3 A;  4LRZ A;  4QFV A;  4JA9 A;  3UT8 A;  3M5A A;  4RSY A;  3NF1 A;  3NQP A;  1KT0 A;  4EPZ A;  5JJ7 A;  3RJW A;  3JQ1 A;  4CDN A;  2Y4U A;  2I2O A;  4NRH B;  5JIN A;  4GYY A;  4YVQ C;  5G05 C;  4GA0 A;  3UX4 A;  4WND A;  4I2W A;  5CPR B;  1E7U A;  2ZU6 B;  4WUY A;  3MV2 B;  3SZ7 A;  4ACK A;  4WNG A;  2PZI A;  2WMO A;  1HG5 A;  3ZGQ A;  1X5B A;  4OVU A;  4XI0 A;  3R7Q A;  1EPU A;  3QAR A;  3ZIM A;  4DLQ A;  1TJC A;  2AW6 A;  5DBK A;  2CHZ A;  2FF4 A;  2WXH A;  3URZ A;  4HVB A;  2QPW A;  1HF8 A;  1OWP A;  3SF4 A;  3PS6 A;  1IQR A;  2KCK A;  1FVH A;  1MVH A;  2AWI A;  1O9S A;  2WQ6 A;  3ZYK A;  4UWF A;  1PC2 A;  4PS7 A;  3JQ0 A;  3CVP A;  1MQS A;  1HU3 A;  3OOI A;  4G2V A;  3FTZ A;  4CEM A;  3OTN A;  3M58 A;  3RQ4 A;  4ACL A;  3G2S A;  5EG2 A;  4ME2 A;  4UWL A;  3AU5 A;  4KZ0 A;  4AY5 A;  2AXU A;  2C2L A;  4D10 C;  4YND A;  4ATG A;  3Q5M A;  2VSY A;  1B89 A;  4HS2 A;  2PL2 A;  3MGB A;  4F3V A;  3CK9 A;  3PEV B;  4AP2 A;  4IYP A;  2J4D A;  3L6A A;  2YHC A;  3DBS A;  4AOF A;  3Q4A B;  3AU4 A;  1UN8 A;  4J6I A;  4MLP A;  4ILI A;  5M72 A;  3EP0 A;  4J8E A;  2WXP A;  5AJD A;  1INZ A;  3SW9 A;  4L2L A;  4APO A;  5BW8 C;  3D9I A;  3ZHE B;  3T8M A;  4NVQ A;  5EX0 A;  1N6A A;  4URK A;  4JHK A;  4YVO A;  3KAE A;  2OV8 A;  3VLF A;  1VDY A;  3QKY A;  3JYS A;  4UI9 K;  3G2V A;  4NAC A;  5LP0 A;  3CK7 A;  4XKC A;  2QY7 A;  1UJJ A;  4UWH A;  4GMJ A;  1DVP A;  2IQC A;  5FQ8 A;  4JA7 A;  3CVY A;  2WXK A;  4JPS A;  4N2Q A;  2LSU A;  5G04 C;  5HI7 A;  4H12 A;  2AVP A;  2JEK A;  4UQY A;  4FA6 A;  3TL5 A;  5KCM A;  4B0Z A;  3GW4 A;  3S2A A;  3CIA A;  1JPL A;  4HOT A;  1HO8 A;  3LYA A;  3RRM B;  3LVR E;  3ZYM A;  4AU7 A;  3JUI A;  4I17 A;  4HLE A;  4I6E A;  2UY1 B;  4B8A A;  1U3D A;  2YQ8 A;  3G2T A;  1QZ2 A;  4XIF A;  2VGX B;  5T4Y A;  4DK5 A;  4JEH A;  5FQ4 A;  1HH8 A;  5C2Y A;  1QNF A;  3LVQ E;  2HO1 A;  2XHE A;  3S7B A;  4APF A;  3LS8 A;  2WXN A;  4XKB A;  3ASD A;  2IFU A;  4BFR A;  3QAQ A;  3GZ2 A;  5FT9 A;  4JDS A;  3I4G A;  3NZS A;  3VTY A;  2V8S E;  2A5U A;  1UJK A;  4WNE A;  1PAQ A;  3UQ3 A;  1XGW A;  2J09 A;  4C0M A;  1H2T C;  2MOW A;  3BG1 B;  2WXF A;  1HE8 A;  1N6C A;  4YPU A;  2KCL A;  3IEG A;  4WWN A;  1WY6 A;  4GU5 A;  4TUU A;  2FUL A;  2Q7F A;  4GCN A;  1E7V A;  3SBT B;  2HYZ A;  5C1D A;  2W5Z A;  2PQN A;  4KVO A;  2XPZ A;  4JEU A;  5EKQ D;  4PH4 B;  2VYI A;  2FI7 A;  3FTY A;  1FCH A;  3D9J A;  4GA1 A;  4IRU A;  3SGH A;  4LDG A;  2NSZ A;  4QEO A;  4FAD A;  5JJ0 A;  3IHX A;  3O48 A;  5EX3 A;  3B7R L;  4I6J A;  3ESK A;  5JHB A;  2FO7 A;  3LJ3 A;  3LY7 A;  4JLG A;  3FHE A;  1PY1 A;  4NUR A;  4G24 A;  3VUZ A;  5EDS A;  3BO5 A;  3SI5 A;  1WM5 A;  3QOU A;  2MRI A;  2A4Z A;  2OND A;  2IOS A;  5E76 A;  4BX9 A;  1NP7 A;  3D3M A;  1OUV A;  4DI4 A;  3CVW A;  3MZL B;  3MV3 B;  3ZHE A;  4LEU A;  2GRM A;  1MT6 A;  1HZ4 A;  3ML8 A;  2R59 A;  3RO2 A;  4QEN A;  4N5C A;  3VLD A;  2I1J A;  4BTA A;  1Y6I A;  1E90 A;  4C9B B;  3LCA A;  4U04 A;  2WB2 A;  5JJT A;  4N3C A;  4Q69 A;  3M55 A;  4GZ6 A;  4B8C B;  3ULQ A;  2L9B A;  2XRZ A;  4I6G A;  3WXX A;  3CST A;  3HVE A;  3ZYQ A;  3CVX A;  4Z4P A;  5G2N A;  1NA0 A;  4G11 A;  3ONL A;  4N3A A;  3R9A B;  4F7A A;  3PRE A;  1EDU A;  4IJ8 A;  5BV0 A;  2WVI A;  3TG5 A;  3FUI A;  3L13 A;  4RZ0 A;  4AV7 A;  3B13 A;  3D9O A;  3MJW A;  3FU5 A;  3FUF A;  4L1B A;  3ONK A;  4L7T A;  4EQF A;  4UI9 J;  5E75 A;  1UN9 A;  3RRU A;  2XPY A;  1NA3 A;  3ENE A;  5F6L A;  3EHM A;  4I9E A;  3QC1 A;  2BUG A;  4CGW A;  3UUX A;  1H6K A;  1UW4 B;  2X6H A;  4DPR A;  4AIF A;  3PUJ A;  2I6H A;  4FC8 A;  1Z3X A;  2R5S A;  3HHM A;  4JHR A;  4FJY A;  3MCX A;  2L6J A;  5CCM A;  1UG3 A;  3GZ1 A;  4FHK A;  2F69 A;  1IQU A;  3F9X A;  1ZBP A;  2CHW A;  2XPI A;  5A6C A;  3OS5 A;  4ANW A;  5BUZ A;  3HYM B;  3P1U A;  2VGY A;  4K03 A;  5ENN A;  4KZC A;  2ILR A;  3FTS A;  3U9W A;  4AXH A;  2JV0 A;  3BEE A;  4K0R A;  2KCV A;  2AXV A;  2DIW A;  4TRQ A;  5LSZ A;  2VGX A;  2UY1 A;  4JHJ A;  2LSV A;  3PE3 A;  4NJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...