3RIBA

Human lysine methyltransferase smyd2 in complex with adohcy
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
430
structure length
430
Chain Sequence
GGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESHLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human lysine methyltransferase Smyd2 reveals insights into the substrate divergence in Smyd proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 139
structure length 430
sequence length 430
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ribA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ribA01
3CK8A 1KT0A 3KS2A 3AS5A 4I9CA 1HH8A 1PC2A 1IHGA 3Q47B 3ASHA 5CPRB 3F9YA 2E2EA 2VQ2A 4KBQA 1QZ2A 4BT9A 4J0UA 1HZ4A 3ASGA 3UUXA 3QWWA 2W5YA 3TG4A 1ZBPA 2AVPA 4N3BA 3QWPA 2J9QA 3LKUA 4B94A 2VYIA 2WPVA 3FWVA 3IHXA 2KCKA 2VGXB 3M59A 4YNMA 4CDRA 4H7YA 1MUFA 4CGWA 2QPWA 4XI9A 3SW9A 2KCLA 3PE4A 3M54A 4APOA 2ONDA 5KJKA 3FPDA 3M58A 4BTAA 4NRHB 4U0ZA 5D0OD 1ZKKA 2FBNA 2KCVA 2HYZA 3SWCA 3F9XA 4G1TA 5CCMA 4WNFA 3QOUA 4ME2A 2Q7FA 3CEQA 3N71A 5DIZA 3ZHEB 3CBOA 3JYSA 4I51A 3CV0A 2FO7A 5DBKA 2RFIA 3ZGQA 5D0QD 1QQEA 3CK7A 4WNGA 3FFLA 2V5FA 3R9AB 5LSZA 4JDSA 3M57A 2G46A 5A6CA 3VUZA 2C0LA 3KD7A 4N2QA 5TEGA 1B89A 4MI5A 4BWRA 1MVXA 1ZU2A 3MA5A 4YVQC 5F6KC 4WUYA 3OXFA 3TAXA 3CVPA 4N3CA 5EG2A 3M5AA 5ARGA 3CKCA 5T5GA 4HOUA 1MVHA 2BUGA 5AYWD 4QEOA 3QKYA 5HQ8A 4GCNA 2YHCA 2IFUA 4H7XA 4CGVA 3MO0A 4U04A 4JLGA 2VGYA 3S8PA 5G05J 5HI7A 1KT1A 3RKVA 3F9WA 3S7BA 4I1AA 3QDNA 4I17A 5FZSA 3VTYA 3MEKA 3EP0A 4AY6A 5JIYA 1XNFA 3RJWA 2Y4TA 2O8JA 3U4TA 4U0UA 2XGSA 4AY5A 5FT9A 3ASFA 4RG9A 1NZNA 5A7DB 3OOIA 4GA1A 3SF4A 2XCBA 5M72A 5EX3A 2PL2A 3URZA 2LSUA 2YQ8A 2BQZA 4NJ5A 4KYOB 5BW8C 4BT8A 4U07A 4C1QA 3ZHEA 2VSYA 3ULQA 3E4BA 4UI9K 3S7JA 4RZ0A 4UI9J 1WAO1 3LY9A 4IJDA 3RQ4A 2DBAA 4AIFA 3U3WA 4RG6A 4GCOA 3CVQA 4GZ6A 5G04J 4JHRA 2XGOA 1NA0A 5JINA 3M55A 5BT1A 4NVQA 5T0MA 2KATA 5TH7A 4IN3B 3ZN3A 3OXGA 3GZ1A 2XPIA 3KAEA 4YPEA 4AU7A 4UQYA 4UQZA 1P5QA 3BO5A 2IF4A 4I2WA 5G05C 4BUPA 3Q15A 2PQRA 4J7FA 4G25A 4QEPA 2LNIA 3WXXA 5T0KA 3OS5A 3MV2B 5JJ0A 4IJ8A 3IEGA 3M53A 3KMTA 2W5ZA 1O9SA 3GZ2A 1OUVA 3CK9A 2HR2A 3Q4AB 3GYZA 2GW1A 4G23A 3RO3A 3CBMA 3PE3A 3MV3B 4XIFA 3ZPJA 4GYYA 5LCWJ 5FZQA 2IGQA 4BTBA 3RAYA 4YPUA 4UI9C 2FEZA 3LPZA 4E47A 3K5KA 5EX0A 2F69A 5TTFA 4H12A 3LYAA 2FI7A 4U0SA 3DALA 3MO2A 3LY7A 5G04C 4KXKB 2I6HA 4N39A 2JLBA 3ESKA 1N3JA 3KMAA 5JJTA 3Q49B 3RIBA 4J8OA 3HYMB 2L6JA 3AS4A 4J8DA 2MHKA 1A17A 2R3AA 3M56A 4GZ5A 1HXIA 3VTXA 4GYWA 3LCAA 4JL0A 3SZ7A 5JHNA 3K9IA 2XEVA 4J8EA 4HORA 2UWJG 2C0MA 2KC7A 4W9RA 3UPVA 1N6AA 5CHEE 4NQ0A 3S7FA 1NA3A 1N6CA 4WNDA 3S7DA 4QENA 4GYOA 3NF1A 3TGOA 3DB5A 4YVOA 4XI0A 2FF4A 2R5SA 1W3BA 4YNPA 4N5CA 5KJLA 5LCWC 3QWVA 2LSVA 5ARFA 3Q5MA 1E96B 1KLXA 4GPKA 4O30A 2P58C 5EKQD 4I9EA 2Y4UA 5F59A 3CVNA 4LEUA 4ABNA 3BEEA 1IYGA 1Y8MA 3CKBA 3MKRA 4Y6WA 1FCHA 3ASDA 3RJVA 5BNWA 4I2ZA 5AYFA 3RU0A 2PZIA 2XCCA 4GZ3A 3TG5A 3AS8A 5CCLA 2PQNA 4GA0A 4F3VA 4JA9A 4MI0A 4WNEA 3FP3A 2JV0A 4A1SA 3OXLA 5FZRA 5JJ6A 5C1DA 5F6LA 2WQHA 3GW4A 5JJ7A 3O48A 1MT6A 3F9ZA 3OPEA 5KJNA 4UQXA 2HO1A 1YA0A 3LY8A 5F5EA 4HOTA 5FTPA 3MO5A 2UY1A 1TJCA 1WM5A 1XQHA 4Y6CA 3ZFWA 4G26A 3KMJA 3VV0A 4JA7A 4J8FA 4J83A 4O6FA 4HOSA 4YPAA 4FMUA 3UQ3A 4G2VA 1ELRA 4AM9A 1ML9A 3RO2A 4J7IA 3PDNA 3CVLA 2C2LA 2OOEA 2VSNA 4GA2A 3HNAA 1ELWA 3CBPA 4N3AA 4EQFA 4Z4PA 1H3IA 4G24A 2QFCA 4N2SA 3EDTB 2VGXA 4YNDA 4HOQA 5FJYA 5LSXA 1PEGA 4LDGA 5KJMA 2NC9A 2XGMA 2UY1B
chains in the Genus database with same CATH superfamily
4HI9A 4XZ4A 3D9HA 4I9CA 2CHWA 2IO2C 1UW4B 1IHGA 3Q9UC 1KPSB 4EHMA 4TUUA 2E2EA 3TWWA 2VQ2A 3UM3A 5ENNA 2VTBB 3FTUA 1HZ4A 3JUIA 2BTDA 3TG4A 1ZBPA 4CT4A 4A55A 2XEHA 5CMWA 2EILE 3JQ0A 2XRYA 2IOLA 4ILIA 3T8MA 4LERA 2PNNA 4H7YA 5AN8A 4JXTA 3SFZA 3SW9A 1FVHA 3ZYMA 3NZSA 1IXVA 3BU8A 4CCAA 2ONDA 5BPPA 3RRUA 3AJIA 3FUKA 1SZ9A 5D2MC 3HRAA 1U2VG 2KCVA 2HYZA 3SWCA 4ATGA 5EIBE 3ABME 5CCMA 3PEUB 4WNFA 1N4SA 1DC2A 3C98A 3QOUA 2Q7FA 5AQ7A 3Q7AA 3N71A 3CBOA 3JYSA 4I51A 5DBKA 3ZGQA 2YNQA 3JUEA 1QQEA 4JDSA 3M57A 3FU3A 1TNYA 4YDOA 3UT7A 4CT0A 5H7PA 4GAAA 4JVSA 2B0OE 4C0EA 1NP7A 1JCRA 2P9IG 4MI5A 3MA5A 5F6KC 3PH0C 3TAXA 4GU5A 3CVPA 2DIWA 5EG2A 4AP2A 3CKCA 4QEOA 5JA4D 5HQ8A 2XHEA 2ZXWE 4H7XA 4WWPA 1EDUA 4CGVA 3MO0A 4JLGA 1HS6A 4DX7D 5AENA 3F9WA 4I1AA 3ONLA 3J5QB 3B7RL 3MEKA 4C0MA 5CMYA 1KZPA 1XNFA 5KCMA 4G8KA 1N54A 3FUJA 3U4TA 2XGSA 3BUAA 4AY5A 1D9SA 4ANXA 3L13A 1AWCB 3BG0B 3ASFA 4K03A 4RG9A 3NOGD 1BD8A 4GA1A 3SF4A 1Z5SC 5M72A 5B1AE 2IU1A 2BQZA 5ITZF 3LXUX 2WXOA 5ENRD 4F53A 3ASNE 4BT8A 4YDYA 4GZCA 2AJAA 3ZYLA 4UI9K 3BQOA 3S7JA 4RZ0A 3X2QE 4I43A 4GPMA 4IJDA 4AIFA 3CVVA 3Q75A 4F1SA 3U3WA 3JQ1A 4GZ6A 3KEAA 5G04J 4J8YA 2XZTG 3T9KA 3NBNB 5AQ9A 2KATA 4LG6A 2WXMA 2X3MA 2GRPB 3HXFA 3CHQA 4IULA 1P5QA 2R05A 4JZYA 4CDMA 3EU5A 5G05C 3D9PA 4O1OA 4DI4A 3FUIA 4G25A 5BV1A 2DZNA 3WXXA 3G2TA 5T0KA 3ZXSA 1O9SA 3UIOC 1S64A 1JWGA 3CK9A 2F8YA 2OCCE 5FQ4A 2XZDG 3Q4AB 1O1RA 4AV7A 4DI3A 4DK5A 3CBMA 5JHAA 4XIFA 3ZPJA 5JHBA 1O1TA 1TN7A 3C3RA 2ZGGA 3NAWA 1IHBA 2IGQA 4BTBA 4UWGA 4UI9C 3LPZA 1H6PA 3DPDA 4GMJA 5TTFA 4UWHA 4KZCA 4U0SA 3DALA 1X5BA 5ENPD 5FWQA 2J4BA 4C48B 3KEZA 4ANUA 1H2UA 3ZYKA 2OV8A 5JJTA 2KXPC 4J8DA 3ABKE 3PNTB 4OAVB 3D9IA 3T8KA 3M56A 1E90A 4RSYA 1X81A 5BXOA 3O4ZA 1Z6TA 3VTXA 3MKQB 4J7WA 3LCAA 2A5UA 1A5EA 2L9BA 3SFYA 3IHVA 3SZ7A 4J8EA 3B7SA 1MQSA 4GB9A 3R7QA 2UWJG 4A3TA 4FJYA 4NACA 2J4DA 3SI5A 3CVYA 3NF1A 4GYOA 4XI0A 1Q2ZA 4YNPA 3ZXPA 5KJLA 4I6JA 2OVBA 5ARFA 3G2VA 3Q5MA 4EPZA 3UXGA 4LEUA 2IOSA 4ABNA 3BEEA 1IYGA 3S2AA 1LD8A 2IEJA 1XGWA 4KVMA 1MYOA 4I2ZA 1KZOA 4GZ3A 4A3VA 3ML9A 3AS8A 2A5EA 4ATZD 4M3OA 4WNEA 4HI8A 4A1SA 3DXKG 3W9GA 3TWXA 3NZUA 5EN5D 1MT6A 4BERA 4EECA 3OPEA 4UQXA 2HO1A 1YA0A 4G8LA 3ZYQA 4IRUA 3ENEA 3NOCD 2J08A 3C72A 4JA7A 4UUCA 3AAAC 4FMUA 3L17A 1ELRA 2M63A 3G2SA 3DSTA 2P9SG 1WY6A 2VSNA 3CQCB 4UWFA 3NB2A 4GA2A 4I1OB 4PS8A 3CHMA 3TWTA 4EQFA 4Z4PA 5AIJA 1E8ZA 3APFA 4N2SA 4K0RA 3SHFA 1TN6A 4ZFHA 3FTSA 5KJMA 2GRMA 3R7RA 2ZGDA 1HG2A 4XKCA 3LJNA 3KS2A 4HFGA 1PC2A 3BG1B 3IBEA 3KSLA 3Q47B 3ASHA 4HVBA 1V54E 5CRVA 5HRYA 3E37A 3PNLB 3PVLA 3P1UA 4B8CB 3FTYA 5J90A 3PZ2A 3UUXA 3ASGA 5FINA 3L6AA 4RQIA 1QYMA 3LKUA 3P2BA 2VYIA 2WPVA 4B0ZA 5FQ6A 3DSUA 5KNGA 4I1MA 5E75A 3G2WA 3UT8A 4CGWA 3ML8A 4XI9A 3VLEA 2WQ7A 2KCLA 3PE4A 1BLXB 4X8QA 1TYQG 3EHRA 2XS8A 3G2UA 3FPDA 4QQIA 2MRIA 2H6HA 3PRZA 5D0OD 1O1SA 1EPUA 2V8SE 3B7TA 4A63B 1ZKKA 3FUDA 3CLJA 3HVEA 4MKTA 2QYJA 4ME2A 4BSZB 2WXIA 3MZLB 3ZVVA 5DIZA 3ZHEB 3AG4E 4K5AB 4LSZE 3UTMA 2J07A 5E76A 1HO8A 5D0QD 2R59A 2G46A 2KBXA 2C0LA 5ENOD 2X38A 2QZAA 3LEWA 4GMRA 3FEXA 5TEGA 5T3RA 1B89A 1HG5A 3E34A 4YVQC 4BETA 4FC8A 2LXMA 3AG2E 3OXFA 3RRNB 2WXHA 2GRLA 4N3CA 3M5AA 3D9MA 5LX8A 4CYMD 4URKA 3CSFA 1MX6A 2BUGA 2F37A 1MVHA 3FUFA 3QKYA 4GCNA 2WXNA 1MHQA 2IFUA 2YHCA 4U04A 1N4PA 2VGYA 5HI7A 1EF1C 1FT1A 1MJ0A 3HIZA 4AVXA 1IQRA 5JIYA 3RJWA 1Z3YA 3PUJA 4HB5A 2RFAA 3V2OA 2DYRE 2WXFA 4GMLA 2XCBA 5EDSA 3TWRA 4BEPA 2XPZA 4WWOA 4KYOB 4LNBA 2FO1E 1TR4A 4C1QA 2OEWA 5B3SE 4NIKA 3HHMA 4L2YA 2XRZA 3DXMG 4HRNA 3FTVA 1OWOA 2WVIA 4I6GA 5KNHD 1N4RA 3HXEA 4JHRA 1NA0A 5JINA 4BSXA 4LCTA 3RSEG 1IQUA 1O5MA 4IN3B 3ZN3A 3RK6A 4YPEA 2F8XK 4AU7A 5T4YA 3UM2A 4U96D 4I2WA 3UINC 3D9NA 2PQRA 4J7FA 4FHKA 4HXIA 3OS5A 3MV2B 4IJ8A 1UJJA 2P2CP 1K8KG 2LAIA 2W5ZA 1RW2A 1TEZA 3D9OA 1OUVA 3IHYA 4GTSA 4F1PA 1E8WA 2H6GA 2HR2A 2NXPA 2WXKA 3GYZA 3NQPA 3PE3A 2XS1A 4GYYA 2VSXE 1SA5A 5AARA 2GRQB 4GZDA 4L23A 4GTPA 5BUZA 4E47A 5EX0A 3ONKA 5AJDA 2FI7A 5G04C 2RG8A 3OAWA 3FU0A 1UN8A 3ESKA 2V5QC 3Q78A 5C2YA 1DCEA 3RIBA 4J8OA 2L6JA 4APFA 3MGBA 1A17A 2I2OA 2R3AA 3L82A 2ETCA 4GZ5A 4JEUA 3V79K 1HXIA 2CHXA 2X6JA 1WDYA 2R02A 2Y3AA 2P9PG 4LRZA 2XEVA 3CVXA 2WXPA 1TJFA 3CHOA 3DSSA 2OEVA 1N6AA 3FEYA 3IXEA 3ZU7B 1WG0A 3S7FA 2X6KA 1S70B 1NA3A 1H19A 3UX4A 3TGOA 3I3NA 4YVOA 3FUNA 3CHRA 4N5CA 3UKRG 4EZKA 2WMOA 2FULA 4OVUA 4O30A 2P58C 5EKQD 4I9EA 2Y4UA 2R17C 3MKRA 1D8DA 3ASDA 5BNWA 5HKPA 4V3IA 5FQ8A 3RU0A 3MYVA 2AW6A 4F3VA 3ZW3A 3MCXA 3OXLA 3CQGB 5C1DA 2LO6A 3WG7E 3GW4A 3F9ZA 2PM7A 1QNFA 4JHKA 3E30A 3PZ1A 5F5EA 5FTPA 3PZ4A 3MO5A 3ZIMA 3PZDA 2RKKA 1N0RA 1WM5A 1S0PA 4Y6CA 3AU5A 3VV0A 2IONA 3ZNGA 1H0AA 3EHQA 3UIPC 4RLYA 1SW6A 4J7IA 3LJ3A 3PDNA 3UT4A 3CVLA 1BI7B 1N95A 3J5PA 4EZLA 4EBAA 4FADA 3FHEA 2C2LA 1NFIE 4A1GA 4MS6A 1GW6A 4LNGA 1ELWA 3TWQA 1BU9A 4F7AA 4BX8A 3L9TA 4DRXE 4YNDA 1N94A 4HOQA 5FJYA 1FVFA 2QY7A 3D3MA 5LSXA 1EYHA 3T5XA 2XGMA 2UY1B 3CK8A 2GRRB 4J6IA 4MLPA 4L2LA 2YINA 4DPRA 2HM8A 5CPRB 3L22A 3EHMA 2A4ZA 3I5PA 4XKBA 2GROB 4KBQA 4BT9A 4J0UA 2EIJE 2ETAA 3QWWA 2W5YA 3C3OA 4CDNA 3SGHA 2WMNA 3CIAA 3FWVA 3IHXA 2AWIA 2XQ0A 1V55E 1DNPA 1OT8A 2JEKA 3D9LA 3DWLG 2QYUA 3SQVA 4TV3A 4DLOA 1MX4A 4JEHA 4APOA 4IYPA 3FH5A 5KJKA 3M58A 4BTAA 3APDA 3EJNA 2GRNB 4U63A 3PUKA 2AXUA 3F9XA 1JPLA 3ULEG 1TNUA 4G1TA 3DSVA 1TNOA 3AU4A 3U9WA 1NI1A 5KWDA 3FUMA 4JHJA 4ILHB 2RFIA 1PY1A 4WNGA 4DJAA 3HXBA 4EZJA 3VUZA 3IKOB 3KD7A 4N2QA 2R2LA 4KMOA 1N9AA 4BWRA 1ZU2A 3VLDA 4XX5A 3TL5A 1OWPA 4WAFA 2VTBA 4Q96A 2KZTB 5ARGA 3CHPA 5T5GA 5LP0A 1Z3XA 5AYWD 5G2NA 4TXQA 3S8PA 2EIKE 4DX6D 4MRUA 4E85A 5EIDA 3LDZA 3S7BA 5FQ7A 4I17A 3VTYA 3EP0A 3T5VA 4FULA 4HNAD 4JC8A 2XENA 2PM6A 3LVQE 3SBTB 4GTQA 2MYOA 1NZNA 3OOIA 2EINE 4FLBA 4P29A 3EIQC 2PL2A 3URZA 3PS6A 2YQ8A 3TXMA 3FH8A 3I4RB 4NJ5A 5BW8C 1L5JA 4U07A 4FLHA 3AG3E 4JW1A 2ZU6B 3ULQA 3UM1A 5J08A 4HLEA 2P9UG 5BXUA 4TUMA 3LY9A 3RQ4A 4OAUC 1SA4A 4RG6A 4GCOA 4YDEA 5AQBA 3PREA 4BX9A 3M55A 5BT1A 1TNBA 5T0MA 5TH7A 3OXGA 2XPIA 3KAEA 4GTMA 1TN8A 1MX2A 3TWUA 2HE0A 2AXZA 3BO5A 4BUPA 3Q15A 4G11A 3V30A 4QEPA 3FU5A 1D8EA 4J8SA 3IEGA 3M53A 2RFMA 4LUNU 2V4LA 4U8VD 4E6HA 1HX8A 3APCA 3LS8A 5KBAA 3CR3A 4JPSA 4L9PA 4F6RD 2LXLA 3RO3A 1S63A 3MV3B 5LCWJ 1K1BA 4M7CA 2FEZA 1JUQA 2BF0X 2F0YA 3LYAA 2CFUA 3SBSA 4KXKB 4U8HA 4MBGA 2JLBA 2WXGA 1N3JA 3KMAA 4ANVA 3ZRHA 1BPOA 4HRLA 4B89A 3Q49B 1N0QA 3D9KA 3HG0D 3HYMB 4GTVA 3AS4A 3ZUVB 3PZ3A 3TXNA 2ZIRA 4YDWA 3D9JA 1MZCA 3Q7FA 4ILGA 5JHNA 3K9IA 1SZAA 4EBAG 3FY4A 4HORA 1H6KA 2C0MA 2BKKB 2EQXA 4W9RA 2V4HC 5CHEE 3FDHA 2B6CA 3CSTA 4B8AA 4QENA 4WNDA 1LTXA 2JABA 1H6OA 2R5SA 1W3BA 4OYSA 3HXCA 2IJGX 4AOFA 3ESLA 3B95A 1KLXA 4GPKA 5F59A 4FU3A 3CVNA 3Q73A 3QAQA 2OVFA 1Y8MA 3CKBA 1OCCE 4Y6WA 4TXPA 4N5QA 1H2TC 2PZIA 2XCCA 3Q9NC 3TG5A 2P9NG 5CCLA 2VSOE 2Y69E 4GA0A 4U95D 3JCKC 3JXJA 3OTNA 4Q69A 3FP3A 2JV0A 3HXDA 2MOWA 5FZRA 2ILRA 3QARA 2CHZA 4HOTA 1HFAA 2WXRA 3SFXA 2WB2A 2UY1A 2DZOA 1TJCA 1E7UA 3MKQA 1UN9A 1XQHA 3ZFWA 4G26A 2BEDA 3UI2A 3R9MA 1OWLA 2XPYA 4O6FA 3U64A 4HOSA 3HDXA 2H6FA 3UQ3A 3DRAA 3FUHA 4PDXA 1OCZE 3E32A 3HNAA 4DUIA 5JMND 3ASOE 3HVEB 3CBPA 4GTTA 4N3AA 3UMVA 3JXIA 1OCRE 4G24A 3ABLE 2QFCA 2WM9A 3EDTB 3CVWA 4FJZA 1N52A 3C3QA 2NC9A 3UM0A 4DX2A 1KT0A 3AS5A 3FTXA 5ENSD 2LAHA 5ANLA 1HH8A 3L16A 3DSXA 5B1BE 1OWNA 3F9YA 4BESA 1QZ2A 3W9FA 3TWVA 3U66A 3UKUG 5A23A 2AVPA 3FUEA 4N3BA 3LVRE 1FPPA 4LNUD 3QWPA 2J9QA 4B94A 3ISMC 4FHJA 5CBNA 2KCKA 2VGXB 3M59A 4YNMA 4BY6A 4CDRA 5EYPF 3SY2A 4O60A 2X6HA 4ACKA 1MUFA 2R03A 3M54A 1OY3D 3B7BA 4GTOA 4KZ0A 4NURA 4NRHB 4U0ZA 4JB8P 5CEDB 2FBNA 5CRUA 4Z68A 2J09A 1E8XA 1E8YA 2KM4A 2KZTA 1SVXA 3DSWA 3CEQA 1IKND 2I9CA 3EHNA 3CV0A 2FO7A 3QC1A 4ZHBA 1DVPA 5ENQD 3CK7A 5G55A 3GZSA 3FFLA 2V5FA 3R9AB 5LSZA 3CHSA 5A6CA 3QK0A 4WWNA 3DBSA 3L54A 5D66A 1MVXA 5AAOA 1UJKA 4OVVA 2VGEA 5EILA 4D10C 2CG3A 1JCQA 4WUYA 3EUVA 2X6IA 4GTRA 3DEPA 5LFAA 1ELKA 5CECB 3SNXA 2WXJA 5AJLA 1FT2A 4HOUA 5BV0A 3PEVB 4XE0A 4FP7A 4L7TA 3EU9A 3CVUA 5G05J 1KT1A 3RKVA 3QDNA 5FZSA 4DX1A 2Y1LE 4AY6A 2P9KG 5ANRA 2Y4TA 2O8JA 3DPYA 4HQDA 4U0UA 5FT9A 3DEOA 2QC9A 5A7DB 1K1AA 5EX3A 1E7VA 2LSUA 5AQAA 2DYSE 3CGHA 5ENTD 1BI8B 2E0IA 4CRWA 3FTWA 3ZHEA 1G3NB 3SD5A 2VSYA 2I1KA 3E33A 3E4BA 1H2VC 4UI9J 3AG1E 1U3CA 1WAO1 3TJPA 2H6IA 3KSQA 2WXLA 3ZEFA 2DBAA 1HU3A 2P9LG 1K3ZD 3CVQA 2AXVA 4QFVA 2Y0BG 2XGOA 1HE8A 2BKGA 1JCSA 1OXJA 4NVQA 3ZKJA 2YHEA 2VJ8A 3GZ1A 1QBQA 2ZISA 4DX5D 4UQYA 4UQZA 4AXHA 1SQMA 1DCQA 5EYLA 2IF4A 1HF8A 2L0IA 3Q79A 4BFRA 2LNIA 3VLFA 3QJZA 2IY0C 3MX3A 2CFZA 4HLLA 5JJ0A 4CZ2D 4FA6A 5CEAA 1YCSB 3KMTA 1TNZA 3EIJA 1UOHA 2LUHA 3RRMB 1VDYA 3GZ2A 3QB2A 5LOZA 3QNKA 2NSZA 2I1JA 1PAQA 3ULYA 1OCOE 4DLQA 2GW1A 4G23A 3B7UX 3B13A 5FIOA 5FZQA 2GGFA 4XEIG 3V2XA 4AJWA 3RAYA 4I6EA 4YPUA 2IO3C 1N4QA 3K5KA 2L0TB 2F69A 3TWSA 4H12A 2WXQA 4UWLA 3MO2A 2J8SD 3LY7A 1UG3A 4C9BB 2I6HA 4N39A 4O1PA 1U3DA 5HS0A 2MHKA 4JD2G 4U8YD 1AP7A 5IY5E 3MJWA 4ANWA 2NYJA 4GYWA 2WQ6A 4JL0A 2L6BA 1N11A 1ZB1A 2KC7A 3UPVA 4HRMB 1NL4A 4NQ0A 2J49A 4RVBA 2DCPA 2XEEA 1N6CA 3S7DA 3C5RA 3DB5A 2V0PA 5CBOA 2FF4A 4KVOA 1RZ4A 5LCWC 3QWVA 2DVWA 2LSVA 2RD0A 1LD7A 1E96B 4U7EB 4PS7A 2EIME 4AEZC 2X6FA 1JWFA 4PH4B 3FTZA 2DWZA 3V31A 1FCHA 4HS2A 3RJVA 3I4GA 5AYFA 4K5CA 3L08A 4HBDA 1LF8A 5CERB 2PQNA 3SO8A 4TXRA 4JA9A 4MI0A 1YYHA 4B93B 5F6LA 5JJ6A 3FULA 4CEMA 5T8IA 2WQHA 5JJ7A 3O48A 3IV0A 5KJNA 3LY8A 3RAUA 3FU6A 4L1BA 4UWKA 4K5BA 3FH7A 1INZA 3KMJA 4J8FA 4ACLA 4J83A 4YPAA 4KT6B 4TRQA 4G2VA 4R7LA 4AM9A 1ML9A 3RO2A 4Q94A 2CG2A 2OOEA 3F6QA 1YMPA 1OWMA 1H3IA 1Y6IA 4PS3A 2ETBA 2IQCA 2VGXA 4PUCA 1PEGA 4LDGA 2QPWA
chains in the Genus database with same CATH topology
3CK8A 4XKCA 4XZ4A 1KT0A 3KS2A 3AS5A 4I9CA 2CHWA 3FTXA 4HFGA 2LAHA 4J6IA 4MLPA 1HH8A 5ANLA 1PC2A 1UW4B 3BG1B 3L16A 1IHGA 2YINA 3IBEA 3Q47B 4L2LA 4DPRA 3ASHA 4HVBA 2HM8A 5CPRB 3L22A 3PNLB 3PVLA 3EHMA 2A4ZA 3I5PA 3P1UA 4XKBA 4TUUA 1OWNA 4B8CB 3F9YA 2E2EA 3FTYA 2VQ2A 4KBQA 5J90A 1QZ2A 4BT9A 5ENNA 4J0UA 2VTBB 3FTUA 1HZ4A 3ASGA 3JUIA 2BTDA 3UUXA 3L6AA 3QWWA 3U66A 2W5YA 3TG4A 5A23A 1ZBPA 2AVPA 3FUEA 4N3BA 3LVRE 4CDNA 4CT4A 3QWPA 2J9QA 3LKUA 3P2BA 2VYIA 3SGHA 2WPVA 4B94A 4FHJA 4A55A 4B0ZA 2WMNA 3CIAA 3FWVA 5CMWA 2AWIA 2KCKA 2XQ0A 2VGXB 3JQ0A 5FQ6A 3IHXA 3M59A 4YNMA 1DNPA 2XRYA 4I1MA 2IOLA 4ILIA 5E75A 3T8MA 2JEKA 4BY6A 4CDRA 3G2WA 4LERA 4ACKA 2X6HA 4H7YA 1MUFA 3D9LA 3UT8A 4JXTA 4CGWA 2QPWA 3ML8A 4XI9A 3SFZA 3VLEA 2WQ7A 1FVHA 2KCLA 3SW9A 4TV3A 3PE4A 3ZYMA 4DLOA 3NZSA 4CCAA 3M54A 4JEHA 4APOA 4IYPA 3FH5A 3G2UA 2ONDA 5BPPA 5KJKA 3FPDA 3M58A 4BTAA 3RRUA 2MRIA 3APDA 3EJNA 3FUKA 1SZ9A 4KZ0A 3PRZA 4NURA 4NRHB 4U0ZA 5D0OD 4U63A 3PUKA 1EPUA 2V8SE 3B7TA 1ZKKA 2AXUA 2FBNA 2KCVA 2HYZA 3FUDA 3SWCA 2J09A 3F9XA 4ATGA 3CLJA 1JPLA 3HVEA 1E8XA 4G1TA 4MKTA 1E8YA 2KM4A 3PEUB 4WNFA 5CCMA 2KZTA 3AU4A 3C98A 3QOUA 4ME2A 2Q7FA 3U9WA 3CEQA 2WXIA 3MZLB 3FUMA 2I9CA 3N71A 3ZVVA 3EHNA 5DIZA 3ZHEB 3CBOA 3JYSA 4I51A 3CV0A 2FO7A 3QC1A 5DBKA 4JHJA 4ILHB 2RFIA 3ZGQA 2J07A 1DVPA 5E76A 1HO8A 2YNQA 5D0QD 1QQEA 3CK7A 5G55A 1PY1A 3GZSA 2R59A 4WNGA 3FFLA 2V5FA 3R9AB 4DJAA 5LSZA 3CHSA 4JDSA 3M57A 2G46A 4EZJA 3FU3A 3UT7A 5A6CA 4CT0A 3VUZA 2C0LA 3IKOB 3QK0A 4GAAA 4WWNA 3DBSA 3KD7A 2X38A 4JVSA 4C0EA 3LEWA 1NP7A 3FEXA 4N2QA 4KMOA 5TEGA 5T3RA 3L54A 1B89A 4MI5A 1HG5A 4BWRA 1MVXA 1ZU2A 3MA5A 3VLDA 1UJKA 4OVVA 4XX5A 4YVQC 3TL5A 1OWPA 4WAFA 4D10C 5F6KC 2CG3A 4FC8A 2VTBA 3PH0C 4WUYA 3OXFA 3RRNB 2WXHA 3TAXA 4GU5A 2X6IA 3CVPA 5LFAA 2GRLA 1ELKA 2DIWA 4N3CA 3SNXA 2WXJA 4Q96A 5EG2A 3M5AA 2KZTB 3D9MA 4AP2A 5AJLA 5LX8A 5ARGA 3CKCA 3CHPA 4URKA 5LP0A 4HOUA 3CSFA 5BV0A 1Z3XA 2BUGA 5AYWD 1MVHA 5T5GA 3PEVB 3FUFA 4QEOA 3QKYA 4FP7A 2XHEA 4L7TA 4XE0A 5HQ8A 3CBMA 4GCNA 5G2NA 2WXNA 1MHQA 2IFUA 1EDUA 2YHCA 4H7XA 4WWPA 4CGVA 3MO0A 4U04A 3CVUA 1HS6A 2VGYA 4JLGA 5G05J 5HI7A 3S8PA 5AENA 1KT1A 4MRUA 4E85A 3RKVA 3F9WA 3LDZA 3S7BA 4I1AA 1EF1C 3ONLA 3QDNA 4I17A 5FQ7A 5FZSA 3B7RL 3VTYA 3HIZA 3MEKA 3EP0A 4C0MA 4AY6A 5CMYA 4AVXA 1IQRA 5JIYA 1XNFA 5KCMA 5ANRA 3T5VA 3RJWA 1Z3YA 4FULA 2Y4TA 1N54A 2O8JA 3PUJA 3FUJA 4JC8A 3U4TA 4U0UA 2XGSA 4AY5A 4ANXA 2PM6A 3L13A 5FT9A 3BG0B 3LVQE 3SBTB 3ASFA 2WXFA 4K03A 1NZNA 4RG9A 5A7DB 3OOIA 4GA1A 4GMLA 3SF4A 2XCBA 4FLBA 4P29A 3EIQC 5EX3A 5M72A 1E7VA 2PL2A 5EDSA 3URZA 2IU1A 2LSUA 3PS6A 2YQ8A 2BQZA 3LXUX 3TXMA 2XPZA 4WWOA 2WXOA 3FH8A 3I4RB 4F53A 4NJ5A 3CGHA 4KYOB 5BW8C 4BT8A 1L5JA 4U07A 4FLHA 4GZCA 4C1QA 2E0IA 4CRWA 4JW1A 2ZU6B 3FTWA 3ZHEA 3SD5A 2VSYA 2I1KA 3ULQA 3HHMA 3E4BA 4L2YA 4UI9K 3ZYLA 3S7JA 4HLEA 5J08A 1H2VC 4RZ0A 4UI9J 2XRZA 1U3CA 1WAO1 4I43A 3TJPA 3LY9A 2WXLA 3FTVA 3ZEFA 4IJDA 1OWOA 1HU3A 2DBAA 3RQ4A 4AIFA 2WVIA 4I6GA 4F1SA 3CVVA 3U3WA 3JQ1A 4RG6A 4GCOA 3CVQA 2AXVA 4GZ6A 4QFVA 3PREA 5G04J 4BX9A 4JHRA 2XGOA 1NA0A 1HE8A 5JINA 3M55A 4BSXA 5BT1A 4LCTA 1IQUA 4NVQA 2KATA 5T0MA 5TH7A 2WXMA 2X3MA 2YHEA 2VJ8A 4IN3B 3ZN3A 3OXGA 3GZ1A 2XPIA 3RK6A 3KAEA 4YPEA 4AU7A 4UQYA 3CHQA 4IULA 5T4YA 4UQZA 1P5QA 4AXHA 1SQMA 2AXZA 3BO5A 4JZYA 2IF4A 4CDMA 4I2WA 5G05C 1HF8A 2L0IA 3D9PA 3Q15A 3D9NA 4BUPA 2PQRA 4BFRA 4G11A 4DI4A 4J7FA 3FUIA 4G25A 5BV1A 4FHKA 4QEPA 2LNIA 3G2TA 3FU5A 3QJZA 3VLFA 3WXXA 5T0KA 3MX3A 4HXIA 2CFZA 3OS5A 4J8SA 3MV2B 5JJ0A 4IJ8A 1UJJA 3IEGA 3ZXSA 4FA6A 3M53A 3KMTA 2LAIA 3EIJA 2W5ZA 4LUNU 2V4LA 4E6HA 3RRMB 1HX8A 1O9SA 1VDYA 3GZ2A 3QB2A 3APCA 3LS8A 3D9OA 1TEZA 1JWGA 1OUVA 3IHYA 3CR3A 3CK9A 3QNKA 1E8WA 2NSZA 5LOZA 4JPSA 2I1JA 1PAQA 5FQ4A 2HR2A 3Q4AB 2NXPA 2WXKA 3GYZA 4DLQA 2GW1A 3NQPA 4G23A 4AV7A 3B7UX 4DI3A 3RO3A 4DK5A 3PE3A 3B13A 3MV3B 5JHAA 4XIFA 3ZPJA 4GYYA 5JHBA 5LCWJ 2VSXE 5FZQA 2GGFA 2IGQA 4BTBA 4AJWA 3RAYA 4I6EA 4UWGA 4UI9C 4YPUA 4GZDA 4L23A 2FEZA 1JUQA 3LPZA 5BUZA 4E47A 3K5KA 5EX0A 2L0TB 2F69A 3DPDA 2BF0X 4GMJA 5TTFA 4H12A 3ONKA 4UWHA 2WXQA 3LYAA 2FI7A 4KZCA 4U0SA 4UWLA 5AJDA 3DALA 3MO2A 1X5BA 2CFUA 5FWQA 3SBSA 3LY7A 1UG3A 5G04C 2RG8A 4KXKB 4U8HA 4C9BB 3OAWA 3FU0A 2I6HA 4N39A 2JLBA 1UN8A 2J4BA 2WXGA 1U3DA 3ESKA 1N3JA 3KEZA 3KMAA 4ANVA 3ZRHA 4ANUA 1H2UA 1BPOA 5C2YA 3ZYKA 2OV8A 4B89A 5JJTA 3Q49B 3RIBA 3D9KA 4J8OA 3HYMB 2L6JA 4APFA 3AS4A 4J8DA 2MHKA 3PNTB 3MGBA 1A17A 2I2OA 2R3AA 3D9IA 3M56A 1E90A 4RSYA 4GZ5A 4JEUA 3MJWA 3TXNA 1HXIA 3O4ZA 1Z6TA 4ANWA 3VTXA 3D9JA 3MKQB 4GYWA 3LCAA 2A5UA 2CHXA 2X6JA 2WQ6A 2L9BA 2Y3AA 4ILGA 3IHVA 4JL0A 3SZ7A 5JHNA 3K9IA 4LRZA 2XEVA 3CVXA 4J8EA 1SZAA 4EBAG 3B7SA 2WXPA 3FY4A 1MQSA 4HORA 4GB9A 3R7QA 1H6KA 2UWJG 1TJFA 3CHOA 2C0MA 2EQXA 2KC7A 4W9RA 4A3TA 3UPVA 5CHEE 1N6AA 3FEYA 4NQ0A 4FJYA 3FDHA 2J49A 3CSTA 3S7FA 4RVBA 2X6KA 4NACA 2J4DA 3SI5A 4B8AA 3CVYA 2DCPA 1NA3A 1N6CA 4WNDA 1H19A 3S7DA 3UX4A 4QENA 3NF1A 4GYOA 3TGOA 3I3NA 3DB5A 2V0PA 4YVOA 4XI0A 3FUNA 5LSXA 2FF4A 2R5SA 1W3BA 4YNPA 3CHRA 4OYSA 4N5CA 5KJLA 4I6JA 4KVOA 5LCWC 3QWVA 4EZKA 2OVBA 2IJGX 4AOFA 2LSVA 2WMOA 2RD0A 2FULA 5ARFA 3ESLA 3G2VA 4OVUA 3Q5MA 1E96B 1KLXA 4GPKA 4O30A 4EPZA 4PS7A 2P58C 5EKQD 4I9EA 2Y4UA 2R17C 4AEZC 4FU3A 5F59A 3CVNA 4LEUA 2IOSA 4ABNA 3BEEA 2X6FA 3QAQA 1JWFA 1IYGA 2OVFA 1Y8MA 3CKBA 3MKRA 4PH4B 3FTZA 3S2AA 4Y6WA 1XGWA 4KVMA 1FCHA 3ASDA 4HS2A 3RJVA 5BNWA 4I2ZA 3I4GA 5AYFA 3L08A 4V3IA 5FQ8A 3RU0A 1LF8A 1H2TC 2PZIA 2XCCA 4GZ3A 3TG5A 3MYVA 4A3VA 3ML9A 2AW6A 3AS8A 5CCLA 2PQNA 2VSOE 4GA0A 4F3VA 3JCKC 4JA9A 4MI0A 3OTNA 4M3OA 4Q69A 4WNEA 3FP3A 3ZW3A 2JV0A 3MCXA 2MOWA 4A1SA 3OXLA 3CQGB 5FZRA 5JJ6A 2LO6A 3FULA 5C1DA 5F6LA 2ILRA 4CEMA 5T8IA 2WQHA 3GW4A 3NZUA 5JJ7A 3O48A 1MT6A 3F9ZA 2PM7A 4EECA 1QNFA 3IV0A 3OPEA 4JHKA 5KJNA 4UQXA 2HO1A 1YA0A 2CHZA 3LY8A 3QARA 5F5EA 4HOTA 1HFAA 2WXRA 5FTPA 2WB2A 3MO5A 2UY1A 3ZYQA 3ZIMA 4IRUA 1TJCA 3PZDA 1E7UA 3FU6A 3ENEA 2J08A 4L1BA 1WM5A 3MKQA 4UWKA 1S0PA 1UN9A 1XQHA 3FH7A 4Y6CA 1INZA 3ZFWA 4G26A 3KMJA 3AU5A 3VV0A 2IONA 4JA7A 4J8FA 1OWLA 2XPYA 4O6FA 3U64A 4ACLA 4HOSA 3HDXA 4J83A 1H0AA 4YPAA 4KT6B 4FMUA 4TRQA 3UQ3A 4G2VA 3L17A 4R7LA 1ELRA 2M63A 3G2SA 4AM9A 1ML9A 3RO2A 3LJ3A 4J7IA 3PDNA 2CG2A 4Q94A 3UT4A 1WY6A 3CVLA 4EZLA 4EBAA 4FADA 3FHEA 2C2LA 2OOEA 2VSNA 3FUHA 3CQCB 4PDXA 4UWFA 4MS6A 4GA2A 1GW6A 4A1GA 3HNAA 4I1OB 4PS8A 3CHMA 1ELWA 3HVEB 1OWMA 3CBPA 4N3AA 4EQFA 4Z4PA 1H3IA 1Y6IA 5AIJA 1E8ZA 4PS3A 3UMVA 4G24A 3APFA 2QFCA 2WM9A 4K0RA 3EDTB 3SHFA 3CVWA 2IQCA 4N2SA 4F7AA 4BX8A 4FJZA 2VGXA 4YNDA 4HOQA 5FJYA 1FVFA 1N52A 2QY7A 3D3MA 1EYHA 3FTSA 4PUCA 1PEGA 5KJMA 2GRMA 4LDGA 2NC9A 2XGMA 3R7RA 3T5XA 2UY1B 1HG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK8 A;  1KT0 A;  3KS2 A;  3AS5 A;  4I9C A;  1HH8 A;  1PC2 A;  1IHG A;  3Q47 B;  3ASH A;  5CPR B;  3F9Y A;  2E2E A;  2VQ2 A;  4KBQ A;  1QZ2 A;  4BT9 A;  4J0U A;  1HZ4 A;  3ASG A;  3UUX A;  3QWW A;  2W5Y A;  3TG4 A;  1ZBP A;  2AVP A;  4N3B A;  3QWP A;  2J9Q A;  3LKU A;  4B94 A;  2VYI A;  2WPV A;  3FWV A;  3IHX A;  2KCK A;  2VGX B;  3M59 A;  4YNM A;  4CDR A;  4H7Y A;  1MUF A;  4CGW A;  2QPW A;  4XI9 A;  3SW9 A;  2KCL A;  3PE4 A;  3M54 A;  4APO A;  2OND A;  5KJK A;  3FPD A;  3M58 A;  4BTA A;  4NRH B;  4U0Z A;  5D0O D;  1ZKK A;  2FBN A;  2KCV A;  2HYZ A;  3SWC A;  3F9X A;  4G1T A;  5CCM A;  4WNF A;  3QOU A;  4ME2 A;  2Q7F A;  3CEQ A;  3N71 A;  5DIZ A;  3ZHE B;  3CBO A;  3JYS A;  4I51 A;  3CV0 A;  2FO7 A;  5DBK A;  2RFI A;  3ZGQ A;  5D0Q D;  1QQE A;  3CK7 A;  4WNG A;  3FFL A;  2V5F A;  3R9A B;  5LSZ A;  4JDS A;  3M57 A;  2G46 A;  5A6C A;  3VUZ A;  2C0L A;  3KD7 A;  4N2Q A;  5TEG A;  1B89 A;  4MI5 A;  4BWR A;  1MVX A;  1ZU2 A;  3MA5 A;  4YVQ C;  5F6K C;  4WUY A;  3OXF A;  3TAX A;  3CVP A;  4N3C A;  5EG2 A;  3M5A A;  5ARG A;  3CKC A;  5T5G A;  4HOU A;  1MVH A;  2BUG A;  5AYW D;  4QEO A;  3QKY A;  5HQ8 A;  4GCN A;  2YHC A;  2IFU A;  4H7X A;  4CGV A;  3MO0 A;  4U04 A;  4JLG A;  2VGY A;  3S8P A;  5G05 J;  5HI7 A;  1KT1 A;  3RKV A;  3F9W A;  3S7B A;  4I1A A;  3QDN A;  4I17 A;  5FZS A;  3VTY A;  3MEK A;  3EP0 A;  4AY6 A;  5JIY A;  1XNF A;  3RJW A;  2Y4T A;  2O8J A;  3U4T A;  4U0U A;  2XGS A;  4AY5 A;  5FT9 A;  3ASF A;  4RG9 A;  1NZN A;  5A7D B;  3OOI A;  4GA1 A;  3SF4 A;  2XCB A;  5M72 A;  5EX3 A;  2PL2 A;  3URZ A;  2LSU A;  2YQ8 A;  2BQZ A;  4NJ5 A;  4KYO B;  5BW8 C;  4BT8 A;  4U07 A;  4C1Q A;  3ZHE A;  2VSY A;  3ULQ A;  3E4B A;  4UI9 K;  3S7J A;  4RZ0 A;  4UI9 J;  1WAO 1;  3LY9 A;  4IJD A;  3RQ4 A;  2DBA A;  4AIF A;  3U3W A;  4RG6 A;  4GCO A;  3CVQ A;  4GZ6 A;  5G04 J;  4JHR A;  2XGO A;  1NA0 A;  5JIN A;  3M55 A;  5BT1 A;  4NVQ A;  5T0M A;  2KAT A;  5TH7 A;  4IN3 B;  3ZN3 A;  3OXG A;  3GZ1 A;  2XPI A;  3KAE A;  4YPE A;  4AU7 A;  4UQY A;  4UQZ A;  1P5Q A;  3BO5 A;  2IF4 A;  4I2W A;  5G05 C;  4BUP A;  3Q15 A;  2PQR A;  4J7F A;  4G25 A;  4QEP A;  2LNI A;  3WXX A;  5T0K A;  3OS5 A;  3MV2 B;  5JJ0 A;  4IJ8 A;  3IEG A;  3M53 A;  3KMT A;  2W5Z A;  1O9S A;  3GZ2 A;  1OUV A;  3CK9 A;  2HR2 A;  3Q4A B;  3GYZ A;  2GW1 A;  4G23 A;  3RO3 A;  3CBM A;  3PE3 A;  3MV3 B;  4XIF A;  3ZPJ A;  4GYY A;  5LCW J;  5FZQ A;  2IGQ A;  4BTB A;  3RAY A;  4YPU A;  4UI9 C;  2FEZ A;  3LPZ A;  4E47 A;  3K5K A;  5EX0 A;  2F69 A;  5TTF A;  4H12 A;  3LYA A;  2FI7 A;  4U0S A;  3DAL A;  3MO2 A;  3LY7 A;  5G04 C;  4KXK B;  2I6H A;  4N39 A;  2JLB A;  3ESK A;  1N3J A;  3KMA A;  5JJT A;  3Q49 B;  3RIB A;  4J8O A;  3HYM B;  2L6J A;  3AS4 A;  4J8D A;  2MHK A;  1A17 A;  2R3A A;  3M56 A;  4GZ5 A;  1HXI A;  3VTX A;  4GYW A;  3LCA A;  4JL0 A;  3SZ7 A;  5JHN A;  3K9I A;  2XEV A;  4J8E A;  4HOR A;  2UWJ G;  2C0M A;  2KC7 A;  4W9R A;  3UPV A;  1N6A A;  5CHE E;  4NQ0 A;  3S7F A;  1NA3 A;  1N6C A;  4WND A;  3S7D A;  4QEN A;  4GYO A;  3NF1 A;  3TGO A;  3DB5 A;  4YVO A;  4XI0 A;  2FF4 A;  2R5S A;  1W3B A;  4YNP A;  4N5C A;  5KJL A;  5LCW C;  3QWV A;  2LSV A;  5ARF A;  3Q5M A;  1E96 B;  1KLX A;  4GPK A;  4O30 A;  2P58 C;  5EKQ D;  4I9E A;  2Y4U A;  5F59 A;  3CVN A;  4LEU A;  4ABN A;  3BEE A;  1IYG A;  1Y8M A;  3CKB A;  3MKR A;  4Y6W A;  1FCH A;  3ASD A;  3RJV A;  5BNW A;  4I2Z A;  5AYF A;  3RU0 A;  2PZI A;  2XCC A;  4GZ3 A;  3TG5 A;  3AS8 A;  5CCL A;  2PQN A;  4GA0 A;  4F3V A;  4JA9 A;  4MI0 A;  4WNE A;  3FP3 A;  2JV0 A;  4A1S A;  3OXL A;  5FZR A;  5JJ6 A;  5C1D A;  5F6L A;  2WQH A;  3GW4 A;  5JJ7 A;  3O48 A;  1MT6 A;  3F9Z A;  3OPE A;  5KJN A;  4UQX A;  2HO1 A;  1YA0 A;  3LY8 A;  5F5E A;  4HOT A;  5FTP A;  3MO5 A;  2UY1 A;  1TJC A;  1WM5 A;  1XQH A;  4Y6C A;  3ZFW A;  4G26 A;  3KMJ A;  3VV0 A;  4JA7 A;  4J8F A;  4J83 A;  4O6F A;  4HOS A;  4YPA A;  4FMU A;  3UQ3 A;  4G2V A;  1ELR A;  4AM9 A;  1ML9 A;  3RO2 A;  4J7I A;  3PDN A;  3CVL A;  2C2L A;  2OOE A;  2VSN A;  4GA2 A;  3HNA A;  1ELW A;  3CBP A;  4N3A A;  4EQF A;  4Z4P A;  1H3I A;  4G24 A;  2QFC A;  4N2S A;  3EDT B;  2VGX A;  4YND A;  4HOQ A;  5FJY A;  5LSX A;  1PEG A;  4LDG A;  5KJM A;  2NC9 A;  2XGM A;  2UY1 B; 
#chains in the Genus database with same CATH topology
 4HI9 A;  4XZ4 A;  3D9H A;  4I9C A;  2CHW A;  2IO2 C;  1UW4 B;  1IHG A;  3Q9U C;  1KPS B;  4EHM A;  4TUU A;  2E2E A;  3TWW A;  2VQ2 A;  3UM3 A;  5ENN A;  2VTB B;  3FTU A;  1HZ4 A;  3JUI A;  2BTD A;  3TG4 A;  1ZBP A;  4CT4 A;  4A55 A;  2XEH A;  5CMW A;  2EIL E;  3JQ0 A;  2XRY A;  2IOL A;  4ILI A;  3T8M A;  4LER A;  2PNN A;  4H7Y A;  5AN8 A;  4JXT A;  3SFZ A;  3SW9 A;  1FVH A;  3ZYM A;  3NZS A;  1IXV A;  3BU8 A;  4CCA A;  2OND A;  5BPP A;  3RRU A;  3AJI A;  3FUK A;  1SZ9 A;  5D2M C;  3HRA A;  1U2V G;  2KCV A;  2HYZ A;  3SWC A;  4ATG A;  5EIB E;  3ABM E;  5CCM A;  3PEU B;  4WNF A;  1N4S A;  1DC2 A;  3C98 A;  3QOU A;  2Q7F A;  5AQ7 A;  3Q7A A;  3N71 A;  3CBO A;  3JYS A;  4I51 A;  5DBK A;  3ZGQ A;  2YNQ A;  3JUE A;  1QQE A;  4JDS A;  3M57 A;  3FU3 A;  1TNY A;  4YDO A;  3UT7 A;  4CT0 A;  5H7P A;  4GAA A;  4JVS A;  2B0O E;  4C0E A;  1NP7 A;  1JCR A;  2P9I G;  4MI5 A;  3MA5 A;  5F6K C;  3PH0 C;  3TAX A;  4GU5 A;  3CVP A;  2DIW A;  5EG2 A;  4AP2 A;  3CKC A;  4QEO A;  5JA4 D;  5HQ8 A;  2XHE A;  2ZXW E;  4H7X A;  4WWP A;  1EDU A;  4CGV A;  3MO0 A;  4JLG A;  1HS6 A;  4DX7 D;  5AEN A;  3F9W A;  4I1A A;  3ONL A;  3J5Q B;  3B7R L;  3MEK A;  4C0M A;  5CMY A;  1KZP A;  1XNF A;  5KCM A;  4G8K A;  1N54 A;  3FUJ A;  3U4T A;  2XGS A;  3BUA A;  4AY5 A;  1D9S A;  4ANX A;  3L13 A;  1AWC B;  3BG0 B;  3ASF A;  4K03 A;  4RG9 A;  3NOG D;  1BD8 A;  4GA1 A;  3SF4 A;  1Z5S C;  5M72 A;  5B1A E;  2IU1 A;  2BQZ A;  5ITZ F;  3LXU X;  2WXO A;  5ENR D;  4F53 A;  3ASN E;  4BT8 A;  4YDY A;  4GZC A;  2AJA A;  3ZYL A;  4UI9 K;  3BQO A;  3S7J A;  4RZ0 A;  3X2Q E;  4I43 A;  4GPM A;  4IJD A;  4AIF A;  3CVV A;  3Q75 A;  4F1S A;  3U3W A;  3JQ1 A;  4GZ6 A;  3KEA A;  5G04 J;  4J8Y A;  2XZT G;  3T9K A;  3NBN B;  5AQ9 A;  2KAT A;  4LG6 A;  2WXM A;  2X3M A;  2GRP B;  3HXF A;  3CHQ A;  4IUL A;  1P5Q A;  2R05 A;  4JZY A;  4CDM A;  3EU5 A;  5G05 C;  3D9P A;  4O1O A;  4DI4 A;  3FUI A;  4G25 A;  5BV1 A;  2DZN A;  3WXX A;  3G2T A;  5T0K A;  3ZXS A;  1O9S A;  3UIO C;  1S64 A;  1JWG A;  3CK9 A;  2F8Y A;  2OCC E;  5FQ4 A;  2XZD G;  3Q4A B;  1O1R A;  4AV7 A;  4DI3 A;  4DK5 A;  3CBM A;  5JHA A;  4XIF A;  3ZPJ A;  5JHB A;  1O1T A;  1TN7 A;  3C3R A;  2ZGG A;  3NAW A;  1IHB A;  2IGQ A;  4BTB A;  4UWG A;  4UI9 C;  3LPZ A;  1H6P A;  3DPD A;  4GMJ A;  5TTF A;  4UWH A;  4KZC A;  4U0S A;  3DAL A;  1X5B A;  5ENP D;  5FWQ A;  2J4B A;  4C48 B;  3KEZ A;  4ANU A;  1H2U A;  3ZYK A;  2OV8 A;  5JJT A;  2KXP C;  4J8D A;  3ABK E;  3PNT B;  4OAV B;  3D9I A;  3T8K A;  3M56 A;  1E90 A;  4RSY A;  1X81 A;  5BXO A;  3O4Z A;  1Z6T A;  3VTX A;  3MKQ B;  4J7W A;  3LCA A;  2A5U A;  1A5E A;  2L9B A;  3SFY A;  3IHV A;  3SZ7 A;  4J8E A;  3B7S A;  1MQS A;  4GB9 A;  3R7Q A;  2UWJ G;  4A3T A;  4FJY A;  4NAC A;  2J4D A;  3SI5 A;  3CVY A;  3NF1 A;  4GYO A;  4XI0 A;  1Q2Z A;  4YNP A;  3ZXP A;  5KJL A;  4I6J A;  2OVB A;  5ARF A;  3G2V A;  3Q5M A;  4EPZ A;  3UXG A;  4LEU A;  2IOS A;  4ABN A;  3BEE A;  1IYG A;  3S2A A;  1LD8 A;  2IEJ A;  1XGW A;  4KVM A;  1MYO A;  4I2Z A;  1KZO A;  4GZ3 A;  4A3V A;  3ML9 A;  3AS8 A;  2A5E A;  4ATZ D;  4M3O A;  4WNE A;  4HI8 A;  4A1S A;  3DXK G;  3W9G A;  3TWX A;  3NZU A;  5EN5 D;  1MT6 A;  4BER A;  4EEC A;  3OPE A;  4UQX A;  2HO1 A;  1YA0 A;  4G8L A;  3ZYQ A;  4IRU A;  3ENE A;  3NOC D;  2J08 A;  3C72 A;  4JA7 A;  4UUC A;  3AAA C;  4FMU A;  3L17 A;  1ELR A;  2M63 A;  3G2S A;  3DST A;  2P9S G;  1WY6 A;  2VSN A;  3CQC B;  4UWF A;  3NB2 A;  4GA2 A;  4I1O B;  4PS8 A;  3CHM A;  3TWT A;  4EQF A;  4Z4P A;  5AIJ A;  1E8Z A;  3APF A;  4N2S A;  4K0R A;  3SHF A;  1TN6 A;  4ZFH A;  3FTS A;  5KJM A;  2GRM A;  3R7R A;  2ZGD A;  1HG2 A;  4XKC A;  3LJN A;  3KS2 A;  4HFG A;  1PC2 A;  3BG1 B;  3IBE A;  3KSL A;  3Q47 B;  3ASH A;  4HVB A;  1V54 E;  5CRV A;  5HRY A;  3E37 A;  3PNL B;  3PVL A;  3P1U A;  4B8C B;  3FTY A;  5J90 A;  3PZ2 A;  3UUX A;  3ASG A;  5FIN A;  3L6A A;  4RQI A;  1QYM A;  3LKU A;  3P2B A;  2VYI A;  2WPV A;  4B0Z A;  5FQ6 A;  3DSU A;  5KNG A;  4I1M A;  5E75 A;  3G2W A;  3UT8 A;  4CGW A;  3ML8 A;  4XI9 A;  3VLE A;  2WQ7 A;  2KCL A;  3PE4 A;  1BLX B;  4X8Q A;  1TYQ G;  3EHR A;  2XS8 A;  3G2U A;  3FPD A;  4QQI A;  2MRI A;  2H6H A;  3PRZ A;  5D0O D;  1O1S A;  1EPU A;  2V8S E;  3B7T A;  4A63 B;  1ZKK A;  3FUD A;  3CLJ A;  3HVE A;  4MKT A;  2QYJ A;  4ME2 A;  4BSZ B;  2WXI A;  3MZL B;  3ZVV A;  5DIZ A;  3ZHE B;  3AG4 E;  4K5A B;  4LSZ E;  3UTM A;  2J07 A;  5E76 A;  1HO8 A;  5D0Q D;  2R59 A;  2G46 A;  2KBX A;  2C0L A;  5ENO D;  2X38 A;  2QZA A;  3LEW A;  4GMR A;  3FEX A;  5TEG A;  5T3R A;  1B89 A;  1HG5 A;  3E34 A;  4YVQ C;  4BET A;  4FC8 A;  2LXM A;  3AG2 E;  3OXF A;  3RRN B;  2WXH A;  2GRL A;  4N3C A;  3M5A A;  3D9M A;  5LX8 A;  4CYM D;  4URK A;  3CSF A;  1MX6 A;  2BUG A;  2F37 A;  1MVH A;  3FUF A;  3QKY A;  4GCN A;  2WXN A;  1MHQ A;  2IFU A;  2YHC A;  4U04 A;  1N4P A;  2VGY A;  5HI7 A;  1EF1 C;  1FT1 A;  1MJ0 A;  3HIZ A;  4AVX A;  1IQR A;  5JIY A;  3RJW A;  1Z3Y A;  3PUJ A;  4HB5 A;  2RFA A;  3V2O A;  2DYR E;  2WXF A;  4GML A;  2XCB A;  5EDS A;  3TWR A;  4BEP A;  2XPZ A;  4WWO A;  4KYO B;  4LNB A;  2FO1 E;  1TR4 A;  4C1Q A;  2OEW A;  5B3S E;  4NIK A;  3HHM A;  4L2Y A;  2XRZ A;  3DXM G;  4HRN A;  3FTV A;  1OWO A;  2WVI A;  4I6G A;  5KNH D;  1N4R A;  3HXE A;  4JHR A;  1NA0 A;  5JIN A;  4BSX A;  4LCT A;  3RSE G;  1IQU A;  1O5M A;  4IN3 B;  3ZN3 A;  3RK6 A;  4YPE A;  2F8X K;  4AU7 A;  5T4Y A;  3UM2 A;  4U96 D;  4I2W A;  3UIN C;  3D9N A;  2PQR A;  4J7F A;  4FHK A;  4HXI A;  3OS5 A;  3MV2 B;  4IJ8 A;  1UJJ A;  2P2C P;  1K8K G;  2LAI A;  2W5Z A;  1RW2 A;  1TEZ A;  3D9O A;  1OUV A;  3IHY A;  4GTS A;  4F1P A;  1E8W A;  2H6G A;  2HR2 A;  2NXP A;  2WXK A;  3GYZ A;  3NQP A;  3PE3 A;  2XS1 A;  4GYY A;  2VSX E;  1SA5 A;  5AAR A;  2GRQ B;  4GZD A;  4L23 A;  4GTP A;  5BUZ A;  4E47 A;  5EX0 A;  3ONK A;  5AJD A;  2FI7 A;  5G04 C;  2RG8 A;  3OAW A;  3FU0 A;  1UN8 A;  3ESK A;  2V5Q C;  3Q78 A;  5C2Y A;  1DCE A;  3RIB A;  4J8O A;  2L6J A;  4APF A;  3MGB A;  1A17 A;  2I2O A;  2R3A A;  3L82 A;  2ETC A;  4GZ5 A;  4JEU A;  3V79 K;  1HXI A;  2CHX A;  2X6J A;  1WDY A;  2R02 A;  2Y3A A;  2P9P G;  4LRZ A;  2XEV A;  3CVX A;  2WXP A;  1TJF A;  3CHO A;  3DSS A;  2OEV A;  1N6A A;  3FEY A;  3IXE A;  3ZU7 B;  1WG0 A;  3S7F A;  2X6K A;  1S70 B;  1NA3 A;  1H19 A;  3UX4 A;  3TGO A;  3I3N A;  4YVO A;  3FUN A;  3CHR A;  4N5C A;  3UKR G;  4EZK A;  2WMO A;  2FUL A;  4OVU A;  4O30 A;  2P58 C;  5EKQ D;  4I9E A;  2Y4U A;  2R17 C;  3MKR A;  1D8D A;  3ASD A;  5BNW A;  5HKP A;  4V3I A;  5FQ8 A;  3RU0 A;  3MYV A;  2AW6 A;  4F3V A;  3ZW3 A;  3MCX A;  3OXL A;  3CQG B;  5C1D A;  2LO6 A;  3WG7 E;  3GW4 A;  3F9Z A;  2PM7 A;  1QNF A;  4JHK A;  3E30 A;  3PZ1 A;  5F5E A;  5FTP A;  3PZ4 A;  3MO5 A;  3ZIM A;  3PZD A;  2RKK A;  1N0R A;  1WM5 A;  1S0P A;  4Y6C A;  3AU5 A;  3VV0 A;  2ION A;  3ZNG A;  1H0A A;  3EHQ A;  3UIP C;  4RLY A;  1SW6 A;  4J7I A;  3LJ3 A;  3PDN A;  3UT4 A;  3CVL A;  1BI7 B;  1N95 A;  3J5P A;  4EZL A;  4EBA A;  4FAD A;  3FHE A;  2C2L A;  1NFI E;  4A1G A;  4MS6 A;  1GW6 A;  4LNG A;  1ELW A;  3TWQ A;  1BU9 A;  4F7A A;  4BX8 A;  3L9T A;  4DRX E;  4YND A;  1N94 A;  4HOQ A;  5FJY A;  1FVF A;  2QY7 A;  3D3M A;  5LSX A;  1EYH A;  3T5X A;  2XGM A;  2UY1 B;  3CK8 A;  2GRR B;  4J6I A;  4MLP A;  4L2L A;  2YIN A;  4DPR A;  2HM8 A;  5CPR B;  3L22 A;  3EHM A;  2A4Z A;  3I5P A;  4XKB A;  2GRO B;  4KBQ A;  4BT9 A;  4J0U A;  2EIJ E;  2ETA A;  3QWW A;  2W5Y A;  3C3O A;  4CDN A;  3SGH A;  2WMN A;  3CIA A;  3FWV A;  3IHX A;  2AWI A;  2XQ0 A;  1V55 E;  1DNP A;  1OT8 A;  2JEK A;  3D9L A;  3DWL G;  2QYU A;  3SQV A;  4TV3 A;  4DLO A;  1MX4 A;  4JEH A;  4APO A;  4IYP A;  3FH5 A;  5KJK A;  3M58 A;  4BTA A;  3APD A;  3EJN A;  2GRN B;  4U63 A;  3PUK A;  2AXU A;  3F9X A;  1JPL A;  3ULE G;  1TNU A;  4G1T A;  3DSV A;  1TNO A;  3AU4 A;  3U9W A;  1NI1 A;  5KWD A;  3FUM A;  4JHJ A;  4ILH B;  2RFI A;  1PY1 A;  4WNG A;  4DJA A;  3HXB A;  4EZJ A;  3VUZ A;  3IKO B;  3KD7 A;  4N2Q A;  2R2L A;  4KMO A;  1N9A A;  4BWR A;  1ZU2 A;  3VLD A;  4XX5 A;  3TL5 A;  1OWP A;  4WAF A;  2VTB A;  4Q96 A;  2KZT B;  5ARG A;  3CHP A;  5T5G A;  5LP0 A;  1Z3X A;  5AYW D;  5G2N A;  4TXQ A;  3S8P A;  2EIK E;  4DX6 D;  4MRU A;  4E85 A;  5EID A;  3LDZ A;  3S7B A;  5FQ7 A;  4I17 A;  3VTY A;  3EP0 A;  3T5V A;  4FUL A;  4HNA D;  4JC8 A;  2XEN A;  2PM6 A;  3LVQ E;  3SBT B;  4GTQ A;  2MYO A;  1NZN A;  3OOI A;  2EIN E;  4FLB A;  4P29 A;  3EIQ C;  2PL2 A;  3URZ A;  3PS6 A;  2YQ8 A;  3TXM A;  3FH8 A;  3I4R B;  4NJ5 A;  5BW8 C;  1L5J A;  4U07 A;  4FLH A;  3AG3 E;  4JW1 A;  2ZU6 B;  3ULQ A;  3UM1 A;  5J08 A;  4HLE A;  2P9U G;  5BXU A;  4TUM A;  3LY9 A;  3RQ4 A;  4OAU C;  1SA4 A;  4RG6 A;  4GCO A;  4YDE A;  5AQB A;  3PRE A;  4BX9 A;  3M55 A;  5BT1 A;  1TNB A;  5T0M A;  5TH7 A;  3OXG A;  2XPI A;  3KAE A;  4GTM A;  1TN8 A;  1MX2 A;  3TWU A;  2HE0 A;  2AXZ A;  3BO5 A;  4BUP A;  3Q15 A;  4G11 A;  3V30 A;  4QEP A;  3FU5 A;  1D8E A;  4J8S A;  3IEG A;  3M53 A;  2RFM A;  4LUN U;  2V4L A;  4U8V D;  4E6H A;  1HX8 A;  3APC A;  3LS8 A;  5KBA A;  3CR3 A;  4JPS A;  4L9P A;  4F6R D;  2LXL A;  3RO3 A;  1S63 A;  3MV3 B;  5LCW J;  1K1B A;  4M7C A;  2FEZ A;  1JUQ A;  2BF0 X;  2F0Y A;  3LYA A;  2CFU A;  3SBS A;  4KXK B;  4U8H A;  4MBG A;  2JLB A;  2WXG A;  1N3J A;  3KMA A;  4ANV A;  3ZRH A;  1BPO A;  4HRL A;  4B89 A;  3Q49 B;  1N0Q A;  3D9K A;  3HG0 D;  3HYM B;  4GTV A;  3AS4 A;  3ZUV B;  3PZ3 A;  3TXN A;  2ZIR A;  4YDW A;  3D9J A;  1MZC A;  3Q7F A;  4ILG A;  5JHN A;  3K9I A;  1SZA A;  4EBA G;  3FY4 A;  4HOR A;  1H6K A;  2C0M A;  2BKK B;  2EQX A;  4W9R A;  2V4H C;  5CHE E;  3FDH A;  2B6C A;  3CST A;  4B8A A;  4QEN A;  4WND A;  1LTX A;  2JAB A;  1H6O A;  2R5S A;  1W3B A;  4OYS A;  3HXC A;  2IJG X;  4AOF A;  3ESL A;  3B95 A;  1KLX A;  4GPK A;  5F59 A;  4FU3 A;  3CVN A;  3Q73 A;  3QAQ A;  2OVF A;  1Y8M A;  3CKB A;  1OCC E;  4Y6W A;  4TXP A;  4N5Q A;  1H2T C;  2PZI A;  2XCC A;  3Q9N C;  3TG5 A;  2P9N G;  5CCL A;  2VSO E;  2Y69 E;  4GA0 A;  4U95 D;  3JCK C;  3JXJ A;  3OTN A;  4Q69 A;  3FP3 A;  2JV0 A;  3HXD A;  2MOW A;  5FZR A;  2ILR A;  3QAR A;  2CHZ A;  4HOT A;  1HFA A;  2WXR A;  3SFX A;  2WB2 A;  2UY1 A;  2DZO A;  1TJC A;  1E7U A;  3MKQ A;  1UN9 A;  1XQH A;  3ZFW A;  4G26 A;  2BED A;  3UI2 A;  3R9M A;  1OWL A;  2XPY A;  4O6F A;  3U64 A;  4HOS A;  3HDX A;  2H6F A;  3UQ3 A;  3DRA A;  3FUH A;  4PDX A;  1OCZ E;  3E32 A;  3HNA A;  4DUI A;  5JMN D;  3ASO E;  3HVE B;  3CBP A;  4GTT A;  4N3A A;  3UMV A;  3JXI A;  1OCR E;  4G24 A;  3ABL E;  2QFC A;  2WM9 A;  3EDT B;  3CVW A;  4FJZ A;  1N52 A;  3C3Q A;  2NC9 A;  3UM0 A;  4DX2 A;  1KT0 A;  3AS5 A;  3FTX A;  5ENS D;  2LAH A;  5ANL A;  1HH8 A;  3L16 A;  3DSX A;  5B1B E;  1OWN A;  3F9Y A;  4BES A;  1QZ2 A;  3W9F A;  3TWV A;  3U66 A;  3UKU G;  5A23 A;  2AVP A;  3FUE A;  4N3B A;  3LVR E;  1FPP A;  4LNU D;  3QWP A;  2J9Q A;  4B94 A;  3ISM C;  4FHJ A;  5CBN A;  2KCK A;  2VGX B;  3M59 A;  4YNM A;  4BY6 A;  4CDR A;  5EYP F;  3SY2 A;  4O60 A;  2X6H A;  4ACK A;  1MUF A;  2R03 A;  3M54 A;  1OY3 D;  3B7B A;  4GTO A;  4KZ0 A;  4NUR A;  4NRH B;  4U0Z A;  4JB8 P;  5CED B;  2FBN A;  5CRU A;  4Z68 A;  2J09 A;  1E8X A;  1E8Y A;  2KM4 A;  2KZT A;  1SVX A;  3DSW A;  3CEQ A;  1IKN D;  2I9C A;  3EHN A;  3CV0 A;  2FO7 A;  3QC1 A;  4ZHB A;  1DVP A;  5ENQ D;  3CK7 A;  5G55 A;  3GZS A;  3FFL A;  2V5F A;  3R9A B;  5LSZ A;  3CHS A;  5A6C A;  3QK0 A;  4WWN A;  3DBS A;  3L54 A;  5D66 A;  1MVX A;  5AAO A;  1UJK A;  4OVV A;  2VGE A;  5EIL A;  4D10 C;  2CG3 A;  1JCQ A;  4WUY A;  3EUV A;  2X6I A;  4GTR A;  3DEP A;  5LFA A;  1ELK A;  5CEC B;  3SNX A;  2WXJ A;  5AJL A;  1FT2 A;  4HOU A;  5BV0 A;  3PEV B;  4XE0 A;  4FP7 A;  4L7T A;  3EU9 A;  3CVU A;  5G05 J;  1KT1 A;  3RKV A;  3QDN A;  5FZS A;  4DX1 A;  2Y1L E;  4AY6 A;  2P9K G;  5ANR A;  2Y4T A;  2O8J A;  3DPY A;  4HQD A;  4U0U A;  5FT9 A;  3DEO A;  2QC9 A;  5A7D B;  1K1A A;  5EX3 A;  1E7V A;  2LSU A;  5AQA A;  2DYS E;  3CGH A;  5ENT D;  1BI8 B;  2E0I A;  4CRW A;  3FTW A;  3ZHE A;  1G3N B;  3SD5 A;  2VSY A;  2I1K A;  3E33 A;  3E4B A;  1H2V C;  4UI9 J;  3AG1 E;  1U3C A;  1WAO 1;  3TJP A;  2H6I A;  3KSQ A;  2WXL A;  3ZEF A;  2DBA A;  1HU3 A;  2P9L G;  1K3Z D;  3CVQ A;  2AXV A;  4QFV A;  2Y0B G;  2XGO A;  1HE8 A;  2BKG A;  1JCS A;  1OXJ A;  4NVQ A;  3ZKJ A;  2YHE A;  2VJ8 A;  3GZ1 A;  1QBQ A;  2ZIS A;  4DX5 D;  4UQY A;  4UQZ A;  4AXH A;  1SQM A;  1DCQ A;  5EYL A;  2IF4 A;  1HF8 A;  2L0I A;  3Q79 A;  4BFR A;  2LNI A;  3VLF A;  3QJZ A;  2IY0 C;  3MX3 A;  2CFZ A;  4HLL A;  5JJ0 A;  4CZ2 D;  4FA6 A;  5CEA A;  1YCS B;  3KMT A;  1TNZ A;  3EIJ A;  1UOH A;  2LUH A;  3RRM B;  1VDY A;  3GZ2 A;  3QB2 A;  5LOZ A;  3QNK A;  2NSZ A;  2I1J A;  1PAQ A;  3ULY A;  1OCO E;  4DLQ A;  2GW1 A;  4G23 A;  3B7U X;  3B13 A;  5FIO A;  5FZQ A;  2GGF A;  4XEI G;  3V2X A;  4AJW A;  3RAY A;  4I6E A;  4YPU A;  2IO3 C;  1N4Q A;  3K5K A;  2L0T B;  2F69 A;  3TWS A;  4H12 A;  2WXQ A;  4UWL A;  3MO2 A;  2J8S D;  3LY7 A;  1UG3 A;  4C9B B;  2I6H A;  4N39 A;  4O1P A;  1U3D A;  5HS0 A;  2MHK A;  4JD2 G;  4U8Y D;  1AP7 A;  5IY5 E;  3MJW A;  4ANW A;  2NYJ A;  4GYW A;  2WQ6 A;  4JL0 A;  2L6B A;  1N11 A;  1ZB1 A;  2KC7 A;  3UPV A;  4HRM B;  1NL4 A;  4NQ0 A;  2J49 A;  4RVB A;  2DCP A;  2XEE A;  1N6C A;  3S7D A;  3C5R A;  3DB5 A;  2V0P A;  5CBO A;  2FF4 A;  4KVO A;  1RZ4 A;  5LCW C;  3QWV A;  2DVW A;  2LSV A;  2RD0 A;  1LD7 A;  1E96 B;  4U7E B;  4PS7 A;  2EIM E;  4AEZ C;  2X6F A;  1JWF A;  4PH4 B;  3FTZ A;  2DWZ A;  3V31 A;  1FCH A;  4HS2 A;  3RJV A;  3I4G A;  5AYF A;  4K5C A;  3L08 A;  4HBD A;  1LF8 A;  5CER B;  2PQN A;  3SO8 A;  4TXR A;  4JA9 A;  4MI0 A;  1YYH A;  4B93 B;  5F6L A;  5JJ6 A;  3FUL A;  4CEM A;  5T8I A;  2WQH A;  5JJ7 A;  3O48 A;  3IV0 A;  5KJN A;  3LY8 A;  3RAU A;  3FU6 A;  4L1B A;  4UWK A;  4K5B A;  3FH7 A;  1INZ A;  3KMJ A;  4J8F A;  4ACL A;  4J83 A;  4YPA A;  4KT6 B;  4TRQ A;  4G2V A;  4R7L A;  4AM9 A;  1ML9 A;  3RO2 A;  4Q94 A;  2CG2 A;  2OOE A;  3F6Q A;  1YMP A;  1OWM A;  1H3I A;  1Y6I A;  4PS3 A;  2ETB A;  2IQC A;  2VGX A;  4PUC A;  1PEG A;  4LDG A;  2QPW A; 
#chains in the Genus database with same CATH homology
 3CK8 A;  4XKC A;  4XZ4 A;  1KT0 A;  3KS2 A;  3AS5 A;  4I9C A;  2CHW A;  3FTX A;  4HFG A;  2LAH A;  4J6I A;  4MLP A;  1HH8 A;  5ANL A;  1PC2 A;  1UW4 B;  3BG1 B;  3L16 A;  1IHG A;  2YIN A;  3IBE A;  3Q47 B;  4L2L A;  4DPR A;  3ASH A;  4HVB A;  2HM8 A;  5CPR B;  3L22 A;  3PNL B;  3PVL A;  3EHM A;  2A4Z A;  3I5P A;  3P1U A;  4XKB A;  4TUU A;  1OWN A;  4B8C B;  3F9Y A;  2E2E A;  3FTY A;  2VQ2 A;  4KBQ A;  5J90 A;  1QZ2 A;  4BT9 A;  5ENN A;  4J0U A;  2VTB B;  3FTU A;  1HZ4 A;  3ASG A;  3JUI A;  2BTD A;  3UUX A;  3L6A A;  3QWW A;  3U66 A;  2W5Y A;  3TG4 A;  5A23 A;  1ZBP A;  2AVP A;  3FUE A;  4N3B A;  3LVR E;  4CDN A;  4CT4 A;  3QWP A;  2J9Q A;  3LKU A;  3P2B A;  2VYI A;  3SGH A;  2WPV A;  4B94 A;  4FHJ A;  4A55 A;  4B0Z A;  2WMN A;  3CIA A;  3FWV A;  5CMW A;  2AWI A;  2KCK A;  2XQ0 A;  2VGX B;  3JQ0 A;  5FQ6 A;  3IHX A;  3M59 A;  4YNM A;  1DNP A;  2XRY A;  4I1M A;  2IOL A;  4ILI A;  5E75 A;  3T8M A;  2JEK A;  4BY6 A;  4CDR A;  3G2W A;  4LER A;  4ACK A;  2X6H A;  4H7Y A;  1MUF A;  3D9L A;  3UT8 A;  4JXT A;  4CGW A;  2QPW A;  3ML8 A;  4XI9 A;  3SFZ A;  3VLE A;  2WQ7 A;  1FVH A;  2KCL A;  3SW9 A;  4TV3 A;  3PE4 A;  3ZYM A;  4DLO A;  3NZS A;  4CCA A;  3M54 A;  4JEH A;  4APO A;  4IYP A;  3FH5 A;  3G2U A;  2OND A;  5BPP A;  5KJK A;  3FPD A;  3M58 A;  4BTA A;  3RRU A;  2MRI A;  3APD A;  3EJN A;  3FUK A;  1SZ9 A;  4KZ0 A;  3PRZ A;  4NUR A;  4NRH B;  4U0Z A;  5D0O D;  4U63 A;  3PUK A;  1EPU A;  2V8S E;  3B7T A;  1ZKK A;  2AXU A;  2FBN A;  2KCV A;  2HYZ A;  3FUD A;  3SWC A;  2J09 A;  3F9X A;  4ATG A;  3CLJ A;  1JPL A;  3HVE A;  1E8X A;  4G1T A;  4MKT A;  1E8Y A;  2KM4 A;  3PEU B;  4WNF A;  5CCM A;  2KZT A;  3AU4 A;  3C98 A;  3QOU A;  4ME2 A;  2Q7F A;  3U9W A;  3CEQ A;  2WXI A;  3MZL B;  3FUM A;  2I9C A;  3N71 A;  3ZVV A;  3EHN A;  5DIZ A;  3ZHE B;  3CBO A;  3JYS A;  4I51 A;  3CV0 A;  2FO7 A;  3QC1 A;  5DBK A;  4JHJ A;  4ILH B;  2RFI A;  3ZGQ A;  2J07 A;  1DVP A;  5E76 A;  1HO8 A;  2YNQ A;  5D0Q D;  1QQE A;  3CK7 A;  5G55 A;  1PY1 A;  3GZS A;  2R59 A;  4WNG A;  3FFL A;  2V5F A;  3R9A B;  4DJA A;  5LSZ A;  3CHS A;  4JDS A;  3M57 A;  2G46 A;  4EZJ A;  3FU3 A;  3UT7 A;  5A6C A;  4CT0 A;  3VUZ A;  2C0L A;  3IKO B;  3QK0 A;  4GAA A;  4WWN A;  3DBS A;  3KD7 A;  2X38 A;  4JVS A;  4C0E A;  3LEW A;  1NP7 A;  3FEX A;  4N2Q A;  4KMO A;  5TEG A;  5T3R A;  3L54 A;  1B89 A;  4MI5 A;  1HG5 A;  4BWR A;  1MVX A;  1ZU2 A;  3MA5 A;  3VLD A;  1UJK A;  4OVV A;  4XX5 A;  4YVQ C;  3TL5 A;  1OWP A;  4WAF A;  4D10 C;  5F6K C;  2CG3 A;  4FC8 A;  2VTB A;  3PH0 C;  4WUY A;  3OXF A;  3RRN B;  2WXH A;  3TAX A;  4GU5 A;  2X6I A;  3CVP A;  5LFA A;  2GRL A;  1ELK A;  2DIW A;  4N3C A;  3SNX A;  2WXJ A;  4Q96 A;  5EG2 A;  3M5A A;  2KZT B;  3D9M A;  4AP2 A;  5AJL A;  5LX8 A;  5ARG A;  3CKC A;  3CHP A;  4URK A;  5LP0 A;  4HOU A;  3CSF A;  5BV0 A;  1Z3X A;  2BUG A;  5AYW D;  1MVH A;  5T5G A;  3PEV B;  3FUF A;  4QEO A;  3QKY A;  4FP7 A;  2XHE A;  4L7T A;  4XE0 A;  5HQ8 A;  3CBM A;  4GCN A;  5G2N A;  2WXN A;  1MHQ A;  2IFU A;  1EDU A;  2YHC A;  4H7X A;  4WWP A;  4CGV A;  3MO0 A;  4U04 A;  3CVU A;  1HS6 A;  2VGY A;  4JLG A;  5G05 J;  5HI7 A;  3S8P A;  5AEN A;  1KT1 A;  4MRU A;  4E85 A;  3RKV A;  3F9W A;  3LDZ A;  3S7B A;  4I1A A;  1EF1 C;  3ONL A;  3QDN A;  4I17 A;  5FQ7 A;  5FZS A;  3B7R L;  3VTY A;  3HIZ A;  3MEK A;  3EP0 A;  4C0M A;  4AY6 A;  5CMY A;  4AVX A;  1IQR A;  5JIY A;  1XNF A;  5KCM A;  5ANR A;  3T5V A;  3RJW A;  1Z3Y A;  4FUL A;  2Y4T A;  1N54 A;  2O8J A;  3PUJ A;  3FUJ A;  4JC8 A;  3U4T A;  4U0U A;  2XGS A;  4AY5 A;  4ANX A;  2PM6 A;  3L13 A;  5FT9 A;  3BG0 B;  3LVQ E;  3SBT B;  3ASF A;  2WXF A;  4K03 A;  1NZN A;  4RG9 A;  5A7D B;  3OOI A;  4GA1 A;  4GML A;  3SF4 A;  2XCB A;  4FLB A;  4P29 A;  3EIQ C;  5EX3 A;  5M72 A;  1E7V A;  2PL2 A;  5EDS A;  3URZ A;  2IU1 A;  2LSU A;  3PS6 A;  2YQ8 A;  2BQZ A;  3LXU X;  3TXM A;  2XPZ A;  4WWO A;  2WXO A;  3FH8 A;  3I4R B;  4F53 A;  4NJ5 A;  3CGH A;  4KYO B;  5BW8 C;  4BT8 A;  1L5J A;  4U07 A;  4FLH A;  4GZC A;  4C1Q A;  2E0I A;  4CRW A;  4JW1 A;  2ZU6 B;  3FTW A;  3ZHE A;  3SD5 A;  2VSY A;  2I1K A;  3ULQ A;  3HHM A;  3E4B A;  4L2Y A;  4UI9 K;  3ZYL A;  3S7J A;  4HLE A;  5J08 A;  1H2V C;  4RZ0 A;  4UI9 J;  2XRZ A;  1U3C A;  1WAO 1;  4I43 A;  3TJP A;  3LY9 A;  2WXL A;  3FTV A;  3ZEF A;  4IJD A;  1OWO A;  1HU3 A;  2DBA A;  3RQ4 A;  4AIF A;  2WVI A;  4I6G A;  4F1S A;  3CVV A;  3U3W A;  3JQ1 A;  4RG6 A;  4GCO A;  3CVQ A;  2AXV A;  4GZ6 A;  4QFV A;  3PRE A;  5G04 J;  4BX9 A;  4JHR A;  2XGO A;  1NA0 A;  1HE8 A;  5JIN A;  3M55 A;  4BSX A;  5BT1 A;  4LCT A;  1IQU A;  4NVQ A;  2KAT A;  5T0M A;  5TH7 A;  2WXM A;  2X3M A;  2YHE A;  2VJ8 A;  4IN3 B;  3ZN3 A;  3OXG A;  3GZ1 A;  2XPI A;  3RK6 A;  3KAE A;  4YPE A;  4AU7 A;  4UQY A;  3CHQ A;  4IUL A;  5T4Y A;  4UQZ A;  1P5Q A;  4AXH A;  1SQM A;  2AXZ A;  3BO5 A;  4JZY A;  2IF4 A;  4CDM A;  4I2W A;  5G05 C;  1HF8 A;  2L0I A;  3D9P A;  3Q15 A;  3D9N A;  4BUP A;  2PQR A;  4BFR A;  4G11 A;  4DI4 A;  4J7F A;  3FUI A;  4G25 A;  5BV1 A;  4FHK A;  4QEP A;  2LNI A;  3G2T A;  3FU5 A;  3QJZ A;  3VLF A;  3WXX A;  5T0K A;  3MX3 A;  4HXI A;  2CFZ A;  3OS5 A;  4J8S A;  3MV2 B;  5JJ0 A;  4IJ8 A;  1UJJ A;  3IEG A;  3ZXS A;  4FA6 A;  3M53 A;  3KMT A;  2LAI A;  3EIJ A;  2W5Z A;  4LUN U;  2V4L A;  4E6H A;  3RRM B;  1HX8 A;  1O9S A;  1VDY A;  3GZ2 A;  3QB2 A;  3APC A;  3LS8 A;  3D9O A;  1TEZ A;  1JWG A;  1OUV A;  3IHY A;  3CR3 A;  3CK9 A;  3QNK A;  1E8W A;  2NSZ A;  5LOZ A;  4JPS A;  2I1J A;  1PAQ A;  5FQ4 A;  2HR2 A;  3Q4A B;  2NXP A;  2WXK A;  3GYZ A;  4DLQ A;  2GW1 A;  3NQP A;  4G23 A;  4AV7 A;  3B7U X;  4DI3 A;  3RO3 A;  4DK5 A;  3PE3 A;  3B13 A;  3MV3 B;  5JHA A;  4XIF A;  3ZPJ A;  4GYY A;  5JHB A;  5LCW J;  2VSX E;  5FZQ A;  2GGF A;  2IGQ A;  4BTB A;  4AJW A;  3RAY A;  4I6E A;  4UWG A;  4UI9 C;  4YPU A;  4GZD A;  4L23 A;  2FEZ A;  1JUQ A;  3LPZ A;  5BUZ A;  4E47 A;  3K5K A;  5EX0 A;  2L0T B;  2F69 A;  3DPD A;  2BF0 X;  4GMJ A;  5TTF A;  4H12 A;  3ONK A;  4UWH A;  2WXQ A;  3LYA A;  2FI7 A;  4KZC A;  4U0S A;  4UWL A;  5AJD A;  3DAL A;  3MO2 A;  1X5B A;  2CFU A;  5FWQ A;  3SBS A;  3LY7 A;  1UG3 A;  5G04 C;  2RG8 A;  4KXK B;  4U8H A;  4C9B B;  3OAW A;  3FU0 A;  2I6H A;  4N39 A;  2JLB A;  1UN8 A;  2J4B A;  2WXG A;  1U3D A;  3ESK A;  1N3J A;  3KEZ A;  3KMA A;  4ANV A;  3ZRH A;  4ANU A;  1H2U A;  1BPO A;  5C2Y A;  3ZYK A;  2OV8 A;  4B89 A;  5JJT A;  3Q49 B;  3RIB A;  3D9K A;  4J8O A;  3HYM B;  2L6J A;  4APF A;  3AS4 A;  4J8D A;  2MHK A;  3PNT B;  3MGB A;  1A17 A;  2I2O A;  2R3A A;  3D9I A;  3M56 A;  1E90 A;  4RSY A;  4GZ5 A;  4JEU A;  3MJW A;  3TXN A;  1HXI A;  3O4Z A;  1Z6T A;  4ANW A;  3VTX A;  3D9J A;  3MKQ B;  4GYW A;  3LCA A;  2A5U A;  2CHX A;  2X6J A;  2WQ6 A;  2L9B A;  2Y3A A;  4ILG A;  3IHV A;  4JL0 A;  3SZ7 A;  5JHN A;  3K9I A;  4LRZ A;  2XEV A;  3CVX A;  4J8E A;  1SZA A;  4EBA G;  3B7S A;  2WXP A;  3FY4 A;  1MQS A;  4HOR A;  4GB9 A;  3R7Q A;  1H6K A;  2UWJ G;  1TJF A;  3CHO A;  2C0M A;  2EQX A;  2KC7 A;  4W9R A;  4A3T A;  3UPV A;  5CHE E;  1N6A A;  3FEY A;  4NQ0 A;  4FJY A;  3FDH A;  2J49 A;  3CST A;  3S7F A;  4RVB A;  2X6K A;  4NAC A;  2J4D A;  3SI5 A;  4B8A A;  3CVY A;  2DCP A;  1NA3 A;  1N6C A;  4WND A;  1H19 A;  3S7D A;  3UX4 A;  4QEN A;  3NF1 A;  4GYO A;  3TGO A;  3I3N A;  3DB5 A;  2V0P A;  4YVO A;  4XI0 A;  3FUN A;  5LSX A;  2FF4 A;  2R5S A;  1W3B A;  4YNP A;  3CHR A;  4OYS A;  4N5C A;  5KJL A;  4I6J A;  4KVO A;  5LCW C;  3QWV A;  4EZK A;  2OVB A;  2IJG X;  4AOF A;  2LSV A;  2WMO A;  2RD0 A;  2FUL A;  5ARF A;  3ESL A;  3G2V A;  4OVU A;  3Q5M A;  1E96 B;  1KLX A;  4GPK A;  4O30 A;  4EPZ A;  4PS7 A;  2P58 C;  5EKQ D;  4I9E A;  2Y4U A;  2R17 C;  4AEZ C;  4FU3 A;  5F59 A;  3CVN A;  4LEU A;  2IOS A;  4ABN A;  3BEE A;  2X6F A;  3QAQ A;  1JWF A;  1IYG A;  2OVF A;  1Y8M A;  3CKB A;  3MKR A;  4PH4 B;  3FTZ A;  3S2A A;  4Y6W A;  1XGW A;  4KVM A;  1FCH A;  3ASD A;  4HS2 A;  3RJV A;  5BNW A;  4I2Z A;  3I4G A;  5AYF A;  3L08 A;  4V3I A;  5FQ8 A;  3RU0 A;  1LF8 A;  1H2T C;  2PZI A;  2XCC A;  4GZ3 A;  3TG5 A;  3MYV A;  4A3V A;  3ML9 A;  2AW6 A;  3AS8 A;  5CCL A;  2PQN A;  2VSO E;  4GA0 A;  4F3V A;  3JCK C;  4JA9 A;  4MI0 A;  3OTN A;  4M3O A;  4Q69 A;  4WNE A;  3FP3 A;  3ZW3 A;  2JV0 A;  3MCX A;  2MOW A;  4A1S A;  3OXL A;  3CQG B;  5FZR A;  5JJ6 A;  2LO6 A;  3FUL A;  5C1D A;  5F6L A;  2ILR A;  4CEM A;  5T8I A;  2WQH A;  3GW4 A;  3NZU A;  5JJ7 A;  3O48 A;  1MT6 A;  3F9Z A;  2PM7 A;  4EEC A;  1QNF A;  3IV0 A;  3OPE A;  4JHK A;  5KJN A;  4UQX A;  2HO1 A;  1YA0 A;  2CHZ A;  3LY8 A;  3QAR A;  5F5E A;  4HOT A;  1HFA A;  2WXR A;  5FTP A;  2WB2 A;  3MO5 A;  2UY1 A;  3ZYQ A;  3ZIM A;  4IRU A;  1TJC A;  3PZD A;  1E7U A;  3FU6 A;  3ENE A;  2J08 A;  4L1B A;  1WM5 A;  3MKQ A;  4UWK A;  1S0P A;  1UN9 A;  1XQH A;  3FH7 A;  4Y6C A;  1INZ A;  3ZFW A;  4G26 A;  3KMJ A;  3AU5 A;  3VV0 A;  2ION A;  4JA7 A;  4J8F A;  1OWL A;  2XPY A;  4O6F A;  3U64 A;  4ACL A;  4HOS A;  3HDX A;  4J83 A;  1H0A A;  4YPA A;  4KT6 B;  4FMU A;  4TRQ A;  3UQ3 A;  4G2V A;  3L17 A;  4R7L A;  1ELR A;  2M63 A;  3G2S A;  4AM9 A;  1ML9 A;  3RO2 A;  3LJ3 A;  4J7I A;  3PDN A;  2CG2 A;  4Q94 A;  3UT4 A;  1WY6 A;  3CVL A;  4EZL A;  4EBA A;  4FAD A;  3FHE A;  2C2L A;  2OOE A;  2VSN A;  3FUH A;  3CQC B;  4PDX A;  4UWF A;  4MS6 A;  4GA2 A;  1GW6 A;  4A1G A;  3HNA A;  4I1O B;  4PS8 A;  3CHM A;  1ELW A;  3HVE B;  1OWM A;  3CBP A;  4N3A A;  4EQF A;  4Z4P A;  1H3I A;  1Y6I A;  5AIJ A;  1E8Z A;  4PS3 A;  3UMV A;  4G24 A;  3APF A;  2QFC A;  2WM9 A;  4K0R A;  3EDT B;  3SHF A;  3CVW A;  2IQC A;  4N2S A;  4F7A A;  4BX8 A;  4FJZ A;  2VGX A;  4YND A;  4HOQ A;  5FJY A;  1FVF A;  1N52 A;  2QY7 A;  3D3M A;  1EYH A;  3FTS A;  4PUC A;  1PEG A;  5KJM A;  2GRM A;  4LDG A;  2NC9 A;  2XGM A;  3R7R A;  3T5X A;  2UY1 B;  1HG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...