4O6FA

Structural basis of estrogen receptor alpha methylation mediated by histone methyltransferase smyd2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
430
structure length
430
Chain Sequence
AEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Estrogen Receptor alpha Methylation by Histone Methyltransferase SMYD2, a Cellular Event Implicated in Estrogen Signaling Regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 145
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4o6fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4o6fA01
2P58C 5T0MA 4HORA 3CV0A 3CEQA 4N3AA 5AYWD 4ME2A 2AVPA 2LSUA 4Y6CA 2VGXA 4BT8A 3JYSA 4GCOA 3ZPJA 4G24A 3AS4A 5F6LA 4LDGA 3CVQA 3KD7A 1IYGA 3CKBA 3DB5A 3O48A 3S7BA 5KJKA 4N5CA 3PDNA 2FO7A 2FEZA 4RG9A 4GZ6A 5CPRB 3SWCA 2VSNA 4FMUA 2KATA 5FZQA 5ARGA 4MI5A 4AY5A 4H7YA 4J8DA 4J83A 1HZ4A 4YNPA 4QENA 5D0QD 2XCCA 3N71A 3WXXA 4O6FA 3CBPA 1PC2A 3QDNA 3GYZA 1Y8MA 2XGOA 1WM5A 4BWRA 3IEGA 4YPAA 4HOTA 2QFCA 4GYYA 2QPWA 4HOUA 3FWVA 4WNDA 3S7JA 4YNDA 2XPIA 4MI0A 2WQHA 4YVOA 2G46A 3RIBA 4GCNA 3ASDA 2HR2A 4Z4PA 5BW8C 3M58A 1QZ2A 4ABNA 4N3BA 1MVXA 1HXIA 3ASGA 4I9CA 3TAXA 3M5AA 2Y4TA 5TTFA 3F9XA 4GA1A 2V5FA 3E4BA 4U07A 2IF4A 5BT1A 4I51A 2C0LA 4BT9A 4U0SA 4WNGA 5JJ7A 2JLBA 3Q4AB 1P5QA 4NQ0A 3S7DA 2JV0A 4HOQA 3OXGA 3VUZA 4NVQA 3CBOA 2HO1A 5DIZA 1OUVA 3MO0A 3Q5MA 2R5SA 2KCLA 3CVPA 2VYIA 3RO3A 3RU0A 4YNMA 5LSXA 3VTXA 4KBQA 5CCLA 1MVHA 1MUFA 5KJMA 3ZHEB 5JHNA 3UPVA 3U3WA 4RG6A 4AU7A 4GZ3A 4G2VA 3DALA 3AS5A 5FJYA 5F5EA 1O9SA 2UWJG 4XI9A 5EX0A 1ELWA 5JIYA 1WAO1 2KCVA 2KC7A 4QEPA 4E47A 4G23A 4GZ5A 3S8PA 2YHCA 4UI9J 2E2EA 5G05J 2FI7A 1NA3A 5CHEE 3Q49B 3ESKA 1ZU2A 3BEEA 1NA0A 3LY8A 5C1DA 5G04C 3RAYA 4G25A 4AY6A 4APOA 4GYWA 3HNAA 3BO5A 4N2QA 4XIFA 5M72A 4H12A 4YVQC 5FZRA 3TGOA 1N6AA 1XNFA 4UQZA 2XEVA 2XGSA 5JJTA 3KMTA 4F3VA 4UQYA 4J8EA 2UY1B 4G26A 4AM9A 3S7FA 3HYMB 4HOSA 2PQNA 3PE3A 2XCBA 1KLXA 4XI0A 5KJLA 3M56A 4JDSA 3SZ7A 3K9IA 5FTPA 4N39A 3F9YA 2IFUA 5JINA 3MV3B 5G04J 1PEGA 4LEUA 3M55A 3GZ2A 4GA2A 4I1AA 2BUGA 3UQ3A 4GPKA 3ASHA 2RFIA 3ZN3A 2GW1A 3CK9A 4B94A 2IGQA 5KJNA 4A1SA 3KMJA 4BUPA 3CBMA 4CDRA 3AS8A 2HYZA 3TG5A 4WUYA 3GZ1A 2XGMA 4N3CA 3LY9A 5JJ0A 5F6KC 4I9EA 3Q15A 5LCWJ 4WNEA 2OOEA 4W9RA 3M57A 4RZ0A 3MV2B 3RQ4A 3QWWA 3QOUA 4U0UA 3CKCA 4O30A 1QQEA 2NC9A 3U4TA 2R3AA 2J9QA 4BTBA 2I6HA 4G1TA 4GYOA 1HH8A 3LCAA 3TG4A 1A17A 2ONDA 1FCHA 5A6CA 3M59A 4IJ8A 4JL0A 3OXLA 3CVLA 4J7IA 1XQHA 4JLGA 3LYAA 2C0MA 4WNFA 5TEGA 3QWPA 3VV0A 4KXKB 2MHKA 1TJCA 4I2ZA 3LPZA 4QEOA 3EDTB 3UUXA 4GA0A 4J0UA 3ASFA 2YQ8A 2PL2A 4IJDA 4N2SA 4UI9K 5T5GA 3NF1A 3VTYA 2C2LA 3R9AB 3MA5A 5LCWC 5D0OD 1MT6A 3OPEA 2VGXB 3KAEA 4YPEA 4KYOB 3M53A 3M54A 3FP3A 3MKRA 3QKYA 3KS2A 4Y6WA 3RJWA 1ZBPA 4UI9C 5LSZA 2Q7FA 3SF4A 4EQFA 4I17A 1KT0A 3FFLA 1N3JA 5EX3A 4BTAA 3MO5A 1W3BA 3EP0A 2LNIA 4I2WA 3ULQA 4YPUA 2WPVA 3LY7A 3URZA 5HQ8A 3KMAA 5CCMA 5HI7A 1KT1A 2FF4A 2PZIA 3LKUA 3QWVA 3ZHEA 5FZSA 1ML9A 4H7XA 2VGYA 3MO2A 5AYFA 4AIFA 3RKVA 5TH7A 3K5KA 1H3IA 3PE4A 2LSVA 4JA9A 5EG2A 1IHGA 2Y4UA 2W5YA 3SW9A 2BQZA 4NJ5A 5BNWA 4CGWA 1E96B 1YA0A 3OXFA 4JA7A 3ZGQA 1NZNA 2UY1A 4IN3B 3RO2A 4NRHB 3CK7A 2VQ2A 5A7DB 3F9ZA 5T0KA 4J8OA 4J7FA 3RJVA 4J8FA 4U0ZA 3GW4A 5FT9A 1N6CA 5JJ6A 3CVNA 4UQXA 4C1QA 2O8JA 5F59A 2PQRA 1ELRA 3IHXA 3ZFWA 2DBAA 3Q47B 1ZKKA 5DBKA 3OS5A 5EKQD 4JHRA 4U04A 3MEKA 2F69A 2W5ZA 3CK8A 3OOIA 2VSYA 2KCKA 2FBNA 4CGVA 3F9WA 5G05C 1B89A 3FPDA 2L6JA 5ARFA
chains in the Genus database with same CATH superfamily
2IU1A 4HORA 3VLFA 3IHYA 4ATGA 4GTVA 4ME2A 1ZB1A 3IXEA 2LSUA 1TYQG 2WXRA 2WXQA 3JYSA 2XQ0A 4N5QA 5F6LA 4LDGA 2X38A 5ENRD 4U96D 3ONLA 2L0IA 3KD7A 4Q94A 4F53A 3CKBA 3LVQE 1Z6TA 4KZ0A 3S7BA 4YDOA 1V55E 5CMYA 4DX1A 3LJ3A 3PDNA 2FO7A 2LAIA 3X2QE 2FEZA 4LNBA 4GTPA 2V4HC 3NZUA 3RRNB 2IO3C 1N9AA 3FY4A 1U3DA 2J07A 3Q7FA 5IY5E 4QENA 3ABLE 5ENQD 2OEWA 5D0QD 2H6HA 3D9LA 2CFZA 5EYPF 3WXXA 2MRIA 5AQ9A 4O6FA 4OVVA 5LOZA 3PZDA 2XGOA 1WM5A 4BWRA 3RRMB 1OWLA 3FULA 4YPAA 4JW1A 4GYYA 2XEHA 4WNDA 2XPIA 3JXIA 4YVOA 2ILRA 1FVFA 4EPZA 3D9HA 3MKQB 4TV3A 3HXEA 1QZ2A 2R05A 4I9CA 2DYSE 2Y4TA 3F9XA 3L9TA 1LD8A 4I51A 1IQRA 1P5QA 3S7DA 4GPMA 3OXGA 3CBOA 4FA6A 1E8WA 2EINE 4HRNA 2VYIA 4HRMB 3RO3A 4ZFHA 2GGFA 2WXFA 4OAUC 1K1BA 4KBQA 3B7SA 2CG3A 4LSZE 5JHBA 5KJMA 4DX6D 4GB9A 1MQSA 1YMPA 3PUKA 3HRAA 3FTVA 4WAFA 4F1SA 5B3SE 2R02A 1O9SA 1AWCB 4XI9A 1X5BA 4B89A 5JIYA 4D10C 2KC7A 4HRLA 3IKOB 5E76A 1TR4A 1NA3A 4F1PA 3PZ3A 5CHEE 5EYLA 1MYOA 1TN8A 5EIBE 3RAYA 4G25A 3AU4A 3HVEB 1ELKA 5G2NA 3DSWA 4GYWA 3NAWA 2GRNB 2XENA 1IXVA 1GW6A 5EDSA 5CRUA 4F3VA 3G2UA 4TXQA 4G26A 4AM9A 4M7CA 3SO8A 3BQOA 1UG3A 3FUMA 4HOSA 2PQNA 3DXKG 2H6GA 1H6KA 4JDSA 3SZ7A 3K9IA 4F7AA 3HXCA 4HVBA 5AENA 1TJFA 4I1AA 2VJ8A 4O1OA 3UKUG 4AOFA 2GW1A 4BSZB 2IGQA 5KJNA 4A1SA 4BSXA 2WXIA 3TG5A 5AQBA 1IQUA 1TNOA 4E85A 5JJ0A 2OCCE 5F6KC 3EHQA 4EBAG 3Q15A 3SFXA 3M57A 3MV2B 2X6HA 3PZ1A 3QOUA 4RVBA 1JCQA 5FWQA 3ONKA 1MZCA 2DYRE 4G1TA 4GYOA 3CHQA 3MZLB 3LCAA 4CEMA 1NFIE 4CT4A 3Q78A 1WG0A 3SFZA 3M59A 4ILHB 4RQIA 4KMOA 3ZNGA 3L17A 4J7IA 1S63A 4JLGA 3GZSA 4EZJA 1JWGA 2YNQA 1HU3A 1FT1A 1TJCA 4QEOA 3EDTB 2L9BA 2B6CA 1QYMA 1Z3XA 2YQ8A 4N2SA 4UI9K 3VLDA 3TWWA 3VTYA 3APDA 5FINA 3R9AB 4UWLA 5LCWC 5D0OD 1MT6A 4YPEA 3HHMA 2E0IA 4K03A 3ZKJA 3DSXA 5LSZA 1JCSA 4GMRA 3SF4A 1TEZA 4JXTA 3R7QA 5EX3A 3CHMA 1SZAA 1W3BA 3DBSA 4I43A 2DZOA 2WPVA 3URZA 3FUFA 2ZU6B 3L54A 2PZIA 3QWVA 3ZHEA 4L2LA 5FZSA 3FUHA 1ML9A 2VTBB 4GTSA 5AYFA 3RKVA 5TH7A 4HI9A 3K5KA 1U2VG 4TXRA 1LTXA 2AXVA 5EG2A 5BXUA 2GROB 4PUCA 3UM1A 2BQZA 4CGWA 4IYPA 3OXFA 4EZKA 4BESA 5CEDB 3UM0A 3ZGQA 1NZNA 1WDYA 2DZNA 3ZXPA 2EIJE 3MCXA 5A7DB 3P2BA 4J8OA 1H19A 3OTNA 2IO2C 4J7FA 3EJNA 5JJ6A 2Y0BG 3G2TA 3S2AA 1K3ZD 2XS1A 1ELRA 4CT0A 3UT8A 3U9WA 2DBAA 1OWPA 4Q69A 1XGWA 4OAVB 5AQ7A 5EKQD 2P9SG 1JWFA 4CRWA 4DRXE 4ANUA 3UI2A 2F69A 3CK8A 3AJIA 4URKA 1SZ9A 3BUAA 3F9WA 5G05C 1PY1A 1PAQA 3FH7A 2P58C 2ETBA 4XX5A 1JCRA 4K5CA 5AYWD 1YYHA 2AVPA 4Y6CA 2FO1E 1UW4B 3FTXA 2VGXA 2J4DA 3FU6A 4BT8A 3Q9UC 5T4YA 2I2OA 2WXKA 3JUEA 3SGHA 4G24A 3AS4A 4CDNA 4FULA 4FP7A 5AJLA 3DB5A 4JD2G 3O48A 1OWNA 4GZ6A 4LRZA 3ZU7B 3AG2E 5ARGA 4AY5A 1O1SA 4J83A 3B7RL 4O60A 2LUHA 2OVFA 4PS3A 2R59A 4RLYA 3N71A 3ZUVB 3CBPA 2Y69E 3FDHA 2Y1LE 3QDNA 3GYZA 1Y8MA 2EIKE 3DRAA 2A4ZA 3TWSA 3IEGA 3FWVA 5CRVA 4LUNU 3P1UA 4MI0A 2WQHA 2X6FA 1HF8A 4ATZD 3ZYLA 3G2VA 4HQDA 2R2LA 5BW8C 4JHJA 3UIOC 4B8CB 4ABNA 4N3BA 1MVXA 4TUMA 3ASGA 3JQ1A 4DUIA 4A3VA 3ZEFA 3TAXA 3M5AA 1TNUA 4UWKA 3NB2A 5FIOA 5JMND 5BT1A 4U0SA 4AXHA 5JJ7A 1U3CA 4HFGA 4NQ0A 3FTUA 2JV0A 4KVMA 3UM2A 3ZYKA 3MO0A 1OUVA 2KCLA 4UUCA 4AEZC 1MX4A 3HVEA 1SVXA 1HFAA 1MVHA 2J49A 3PUJA 3UPVA 3U3WA 3E33A 3ASOE 3EHNA 2EQXA 3AS5A 3APFA 3UINC 2XZTG 3HXFA 3TWRA 2AWIA 2ZGGA 4E47A 4A63B 2WXHA 2YHCA 3FTZA 3UIPC 3IHVA 2E2EA 5G05J 4DJAA 3Q49B 2XS8A 3CHPA 1N4QA 2WXPA 5G04C 5EN5D 3ZXSA 1FT2A 2J8SD 4AY6A 3QJZA 5D2MC 4YVQC 4LCTA 4J8SA 2X6KA 4C0EA 4LG6A 2XGSA 3KMTA 2UY1B 1E7UA 5KWDA 3S7FA 4G11A 2XCBA 5KJLA 3TWQA 4N39A 5BPPA 5CECB 4L9PA 4IULA 1X81A 1HE8A 2P2CP 2YINA 3PNTB 3SBSA 1PEGA 3M55A 1LD7A 3UQ3A 5JHAA 3ASHA 2RFIA 3ABME 3CK9A 1BLXB 1EYHA 3QAQA 2EIME 3ULYA 2IOSA 4MRUA 4BUPA 4CDRA 2HYZA 4WUYA 3LY9A 4G8KA 5LCWJ 2OOEA 4ILGA 4DX5D 5HS0A 4W9RA 5AN8A 5B1BE 4FJZA 5ENOD 2IY0C 2J9QA 4BTBA 1N4RA 3L82A 3JQ0A 2IEJA 3V31A 2BKKB 3FUEA 4CZ2D 3SBTB 4IJ8A 5H7PA 3IV0A 1SA4A 3FU3A 4V3IA 2R03A 3CVLA 1D8EA 4K5BA 3I3NA 3TWVA 5TEGA 3Q79A 2LAHA 3VV0A 4I2ZA 2WM9A 4GA0A 5AQAA 1QBQA 2PL2A 4IJDA 3DPYA 3D9IA 2C2LA 3PEVB 3G2SA 1UN9A 4I6JA 3DXMG 4Y6WA 3RJWA 3FUDA 2Q7FA 5J90A 4JZYA 4I17A 1N3JA 4JVSA 2P9UG 4BTAA 4DX2A 3U66A 3ULQA 3CQCB 3FUNA 3C72A 2IONA 4MLPA 2V8SE 3SQVA 2FF4A 4BX9A 1DNPA 1E8ZA 2X3MA 3CHOA 2WMNA 4H7XA 4EHMA 3LEWA 1TNYA 2A5UA 3FTSA 1H6OA 3KSQA 3D9JA 2XHEA 3PE4A 4DLOA 5BV0A 2WXJA 1DCEA 3RSEG 4FLBA 4ILIA 3KEAA 4BEPA 5HKPA 3UX4A 4BY6A 5E75A 3FHEA 2WVIA 2VQ2A 3W9FA 2CHZA 4LNUD 4J8FA 3FU0A 4UQXA 2I9CA 1AP7A 4C48B 2WXOA 2O8JA 2PQRA 3F6QA 2F8YA 3PEUB 3ZFWA 1ZKKA 3Q47B 2NYJA 2B0OE 4X8QA 4HLEA 4WWOA 4TUUA 4BX8A 3HIZA 4U63A 2LXMA 3MX3A 3OOIA 2VSYA 4UWFA 2CFUA 1H6PA 4UWGA 3ZW3A 5T0MA 3CV0A 3UMVA 4N3AA 2DIWA 1S64A 3ABKE 1EPUA 1V54E 1NL4A 1N54A 2BTDA 4BETA 4CDMA 3DSVA 3AG4E 4GCOA 3ZPJA 5AJDA 4PS7A 3DEPA 2RFAA 1OWMA 3CLJA 4AV7A 1IYGA 2ZXWE 4B0ZA 5KJKA 4XEIG 2M63A 2Y3AA 3E32A 4RG9A 4Z68A 5CPRB 2R17C 3SWCA 4J6IA 4FMUA 5FZQA 4APFA 2RFMA 3DSSA 3NQPA 3SD5A 2F37A 3UT4A 3HDXA 2EILE 2XCCA 4DX7D 5CBNA 2F0YA 5ANRA 1H2UA 4LNGA 3L22A 5KCMA 1OY3D 2PNNA 3EUVA 3FU5A 1PC2A 3PREA 4R7LA 2XPYA 3KEZA 4GTTA 1RW2A 2QPWA 3EHRA 4HOUA 3FH5A 2I1JA 1G3NB 2LXLA 3RIBA 3Q73A 4Z4PA 2OVBA 1OCOE 3M58A 4JPSA 3CQGB 4DPRA 3KSLA 2H6IA 2V5QC 1HXIA 3NZSA 3ISMC 2BF0X 4GTMA 1FPPA 5TTFA 4ACKA 3DPDA 1HS6A 2V5FA 3ULEG 3PZ4A 4U07A 2C0LA 1NI1A 4BT9A 4HB5A 3AG1E 2JLBA 3LXUX 3Q4AB 3QB2A 3VUZA 1OCRE 2DWZA 1N95A 4MKTA 3Q5MA 2R5SA 4C0MA 3RU0A 5LSXA 3VTXA 5CCLA 3J5QB 3APCA 2AJAA 1MUFA 3B7BA 3ZHEB 3LS8A 5JHNA 4FU3A 3UKRG 1IHBA 2JABA 2RD0A 4A1GA 2WMOA 3D9KA 4GZ3A 5FJYA 1BD8A 2WB2A 2KBXA 5F5EA 3EIJA 5LFAA 5EX0A 4DI4A 1S70B 2KCVA 4QEPA 1O1TA 4GZ5A 4GTRA 1QNFA 4YDEA 4UI9J 4YDWA 3AAAC 5ITZF 1L5JA 1DCQA 1N94A 3R9MA 4B8AA 4QFVA 1ZU2A 3NOCD 3BEEA 3DSUA 3FUKA 2IJGX 3LY8A 5ENSD 4RSYA 4MBGA 3BG0B 3BO5A 4N2QA 4H12A 5M72A 1YCSB 4AJWA 5G55A 3TGOA 1N6AA 3ASNE 4UQZA 2XEVA 4JHKA 5JJTA 3J5PA 4J8EA 1N4PA 3HYMB 1Y6IA 5BV1A 4XI0A 1N52A 3L16A 3D9PA 3F9YA 5AIJA 2IFUA 3FTYA 1OT8A 3L13A 4JB8P 3GZ2A 4GA2A 4UWHA 2CHXA 2BUGA 3E37A 3PNLB 5C2YA 3C5RA 2ZIRA 3ZN3A 2GRPB 3MYVA 1A5EA 2GRQB 1OCZE 4B94A 1SQMA 3C3RA 2BEDA 2P9IG 4AP2A 4TRQA 3QK0A 3KMJA 4NACA 2WXLA 3CVVA 2HE0A 2KZTA 1JPLA 4GU5A 4WNEA 2KZTB 4RZ0A 2AW6A 4U0UA 3U4TA 4LERA 2R3AA 3EU9A 2P9NG 3SHFA 1HH8A 3TG4A 1MJ0A 1A17A 2ONDA 1FCHA 4FHJA 3OXLA 3L6AA 2WXGA 1TN7A 4MS6A 2WQ7A 2C0MA 4XKBA 3QWPA 4KXKB 3LPZA 2IOLA 4ZHBA 3ASFA 3HG0D 4HNAD 5LX8A 4XE0A 3NF1A 4JEUA 3MA5A 3MGBA 1UN8A 3OPEA 3WG7E 5BXOA 4KYOB 3M53A 1H2VC 1HO8A 4ANVA 4UI9C 1HG5A 3E30A 4EQFA 1KPSB 5CEAA 3FEXA 3BG1B 4OVUA 3ZYMA 1N0RA 2LNIA 4I2WA 3Q9NC 3EP0A 4YPUA 4GAAA 3LY7A 3DSTA 3C3OA 5CCMA 3CSTA 1KT1A 4DK5A 1S0PA 1UJJA 2VGYA 3LVRE 3MO2A 5J08A 5EIDA 4AIFA 2L0TB 3C98A 3PH0C 4Q96A 2AXZA 4HBDA 3ZVVA 3CIAA 2BKGA 4NJ5A 2X6IA 5BNWA 5ENPD 3ML9A 1YA0A 1HX8A 4JA7A 4C9BB 3ZYQA 4IN3B 4BERA 4O1PA 3VLEA 1Z3YA 4NRHB 4PH4B 1DVPA 3F9ZA 4U0ZA 5FQ6A 2DVWA 3GW4A 2GRMA 1KZPA 3AU5A 1E7VA 4ACLA 1K1AA 2MYOA 3IHXA 4CYMD 2CG2A 3RAUA 3ZIMA 1SW6A 3RRUA 3D9NA 3PRZA 4JC8A 3TWTA 2ZGDA 3DEOA 3HXDA 1B89A 2L6JA 3B7TA 5ARFA 4JEHA 3HXBA 3T5XA 1OXJA 3CEQA 2PM7A 3CVUA 2V4LA 3C3QA 1SA5A 1TNZA 3CHRA 3T8KA 3CVXA 3JUIA 3CVWA 5CMWA 4M3OA 3UM3A 3CVQA 4WWNA 2QC9A 4K0RA 4NIKA 3T8MA 4N5CA 2QYUA 4K5AB 2J4BA 1TN6A 2VSNA 4OYSA 2KATA 4MI5A 2WXMA 5CERB 5A23A 4H7YA 4J8DA 3JXJA 3I4RB 1NP7A 1HZ4A 4YNPA 4J7WA 3OAWA 4GMLA 4FHKA 4A55A 3V30A 5KNGA 4QQIA 2J09A 4WWPA 3Q7AA 1UOHA 1K8KG 4HOTA 2QFCA 4A3TA 3ESLA 3S7JA 1D9SA 3CGHA 3FEYA 4YDYA 4YNDA 2X6JA 3SNXA 4U7EB 2G46A 1O1RA 4GCNA 3ASDA 2HR2A 3IBEA 4B93B 4AVXA 3TJPA 1Q2ZA 2F8XK 3UT7A 2QY7A 3BU8A 5ENNA 2P9PG 3V79K 2RKKA 3SY2A 4GA1A 1RZ4A 1IKND 4ANWA 3E4BA 2XEEA 2IF4A 1Z5SC 3Q75A 4DI3A 4WNGA 4FADA 4HOQA 1EDUA 4NVQA 2HO1A 3B13A 5DIZA 3SI5A 2WQ6A 3CVPA 4YNMA 1FVHA 2XRZA 1N4SA 1H0AA 1UJKA 4RG6A 5AAOA 2OV8A 5FQ4A 4AU7A 4G2VA 2KXPC 3DALA 2I1KA 1E8YA 4L2YA 2YHEA 4I6GA 3NBNB 2UWJG 1ELWA 5ENTD 2PM6A 1WAO1 3RK6A 2MOWA 4G23A 5JA4D 3S8PA 3TXNA 1MHQA 3TXMA 4I1OB 2JEKA 4CCAA 4ANXA 1E8XA 4GTQA 2FI7A 4XZ4A 2XPZA 3ESKA 1NA0A 3UXGA 3LDZA 5D66A 4HXIA 5C1DA 4I6EA 4APOA 5FQ8A 3HNAA 3QNKA 5BUZA 4XIFA 5FZRA 3TWUA 1XNFA 4I1MA 1WY6A 5CBOA 2GRRB 3SFYA 3R7RA 4L23A 4UQYA 3FH8A 1MX6A 2QZAA 2OEVA 2IQCA 3PE3A 3UTMA 1KLXA 2NSZA 3M56A 3PZ2A 4L7TA 5FTPA 1VDYA 5JINA 2HM8A 3MV3B 2ETAA 5G04J 3G2WA 4LEUA 4U8YD 4HI8A 3E34A 3D9OA 3L08A 5B1AE 4TXPA 1N11A 1O5MA 2P9KG 5KBAA 3D9MA 4GPKA 2FULA 1LF8A 1DC2A 2ETCA 2ZISA 3PVLA 4KT6B 2VTBA 3EIQC 1BU9A 3CBMA 3AS8A 3U64A 4L1BA 2AXUA 3GZ1A 2XGMA 4N3CA 1INZA 4I9EA 3LJNA 4HS2A 5LP0A 2DCPA 3RQ4A 3AG3E 3QWWA 2VSOE 4G8LA 3CSFA 3CKCA 4O30A 1QQEA 2NC9A 3ENEA 5T8IA 4P29A 3MKQA 3B95A 2NXPA 1BI8B 5ANLA 2I6HA 3MJWA 4U8HA 3FTWA 3TWXA 3V2XA 5A6CA 4JL0A 1OCCE 3FUIA 1HG2A 3DWLG 4GTOA 2XRYA 1XQHA 3ZRHA 2RG8A 5T3RA 3LYAA 4WNFA 1D8DA 2MHKA 2CHWA 2KM4A 4GZDA 3W9GA 4IRUA 3UUXA 4J0UA 3I5PA 5T5GA 2VGEA 3B7UX 2LO6A 2VGXB 3KAEA 3TL5A 3M54A 3CVYA 3FP3A 3MKRA 3QKYA 3KS2A 1ZBPA 4PS8A 4EZLA 1KT0A 3FFLA 3FUJA 1BPOA 1JUQA 4FC8A 3CR3A 3MO5A 2WXNA 1BI7B 2GRLA 5KNHD 5HQ8A 3NOGD 3KMAA 3EU5A 3O4ZA 5HI7A 3LKUA 4J8YA 3PS6A 1H2TC 3T9KA 1TNBA 2P9LG 5FQ7A 1H3IA 4FJYA 3JCKC 3I4GA 2V0PA 4U8VD 2VSXE 2LSVA 4JA9A 1OWOA 3CHSA 2L6BA 1IHGA 2QYJA 4KZCA 4F6RD 2Y4UA 3EHMA 2W5YA 3SW9A 3QARA 3D3MA 1E96B 2UY1A 1N0QA 3RO2A 4BFRA 3CK7A 4E6HA 4KVOA 5T0KA 2H6FA 3RJVA 4EBAA 4XKCA 3V2OA 4NURA 1MX2A 5FT9A 1N6CA 3CVNA 3ML8A 3QC1A 4C1QA 1EF1C 5F59A 4PDXA 4HLLA 4U95D 4DLQA 1E90A 5DBKA 3OS5A 5AARA 4FLHA 1KZOA 4GZCA 4JHRA 4U04A 3MEKA 4GMJA 4EECA 3T5VA 2XZDG 2W5ZA 2A5EA 2KCKA 2FBNA 4CGVA 5EILA 2J08A 3FPDA 5HRYA
chains in the Genus database with same CATH topology
1PAQA 4JEHA 3FH7A 2P58C 4XX5A 5T0MA 2IU1A 4HORA 3VLFA 3CV0A 3T5XA 3IHYA 3CEQA 2PM7A 3UMVA 4ATGA 4N3AA 5AYWD 4ME2A 2DIWA 3CVUA 1EPUA 2AVPA 2LSUA 4Y6CA 1UW4B 3FTXA 2VGXA 1N54A 2BTDA 2J4DA 2V4LA 3FU6A 4BT8A 4CDMA 3CHRA 5T4YA 3CVXA 2I2OA 2WXKA 2WXQA 2WXRA 3JYSA 2XQ0A 3JUIA 4GCOA 3CVWA 3ZPJA 5AJDA 3SGHA 4PS7A 4G24A 3AS4A 5CMWA 5F6LA 4LDGA 1OWMA 2X38A 3CLJA 4M3OA 4AV7A 4FULA 4CDNA 3CVQA 2L0IA 3KD7A 3ONLA 4Q94A 4WWNA 4F53A 4FP7A 1IYGA 3CKBA 5AJLA 3LVQE 3DB5A 3O48A 4B0ZA 1Z6TA 4K0RA 4KZ0A 3S7BA 3T8MA 4N5CA 5KJKA 5CMYA 2M63A 3LJ3A 3PDNA 2FO7A 2LAIA 2FEZA 2Y3AA 4RG9A 1OWNA 4GZ6A 1N3JA 5CPRB 4LRZA 2R17C 2J4BA 3NZUA 3SWCA 2VSNA 4J6IA 4OYSA 3RRNB 4FMUA 3PS6A 2KATA 5FZQA 5ARGA 4APFA 3FY4A 2WXMA 4MI5A 4AY5A 5A23A 1U3DA 3NQPA 4H7YA 4J8DA 3SD5A 4J83A 3B7RL 3I4RB 1NP7A 1HZ4A 2J07A 4YNPA 3UT4A 3HDXA 4QENA 5D0QD 3OAWA 2XCCA 2OVFA 4GMLA 4FHKA 5ANRA 5FZSA 1H2UA 4A55A 3D9LA 4PS3A 2CFZA 3L22A 2R59A 3N71A 3WXXA 5KCMA 2MRIA 2J09A 4O6FA 3FU5A 4OVVA 1PC2A 4WWPA 3CBPA 3PREA 3FDHA 4R7LA 3QDNA 3GYZA 5LOZA 1Y8MA 2XPYA 3KEZA 3PZDA 2A4ZA 2XGOA 1WM5A 4BWRA 3RRMB 1OWLA 3IEGA 3FULA 4HOTA 4YPAA 2QFCA 4GYYA 4JW1A 4A3TA 2QPWA 4HOUA 3FWVA 3ESLA 3FH5A 4WNDA 3S7JA 4LUNU 3CGHA 3FEYA 4YNDA 2X6JA 3P1UA 2XPIA 3SNXA 4MI0A 2I1JA 2WQHA 4YVOA 2G46A 3RIBA 2ILRA 2X6FA 1HF8A 4GCNA 3ASDA 1FVFA 4EPZA 2HR2A 3IBEA 3G2VA 3MKQB 3ZYLA 4TV3A 4Z4PA 2OVBA 5BW8C 4JHJA 3M58A 1QZ2A 4AVXA 4JPSA 4B8CB 3CQGB 4ABNA 3TJPA 4N3BA 4DPRA 1MVXA 1HXIA 3UT7A 3ASGA 2QY7A 3JQ1A 3NZSA 5ENNA 3ZEFA 4A3VA 4I9CA 3TAXA 2BF0X 3M5AA 2Y4TA 4ACKA 5TTFA 3F9XA 3DPDA 4UWKA 1HS6A 4GA1A 4ANWA 2V5FA 3E4BA 4U07A 2IF4A 5BT1A 4I51A 2C0LA 4BT9A 1IQRA 4DI3A 4U0SA 4AXHA 4WNGA 5JJ7A 2JLBA 3LXUX 3Q4AB 1P5QA 4FADA 1U3CA 4HFGA 4NQ0A 3S7DA 3FTUA 2JV0A 4HOQA 4KVMA 3OXGA 3QB2A 1EDUA 3VUZA 4NVQA 3CBOA 4FA6A 2HO1A 3ZYKA 1E8WA 3B13A 1OUVA 4MKTA 5DIZA 3SI5A 3MO0A 3Q5MA 2R5SA 2KCLA 4C0MA 2WQ6A 3CVPA 2VYIA 3RO3A 3RU0A 4YNMA 1FVHA 5LSXA 2GGFA 2WXFA 4AEZC 3HVEA 3VTXA 4KBQA 3B7SA 5CCLA 2CG3A 3APCA 2XRZA 1HFAA 5JHBA 1MUFA 1MVHA 5KJMA 3ZHEB 2J49A 3LS8A 4GB9A 5JHNA 3PUJA 1H0AA 3UPVA 3U3WA 4FU3A 1MQSA 2RD0A 1UJKA 3PUKA 4A1GA 4RG6A 2WMOA 3D9KA 2OV8A 5FQ4A 4AU7A 3EHNA 3FTVA 4GZ3A 2EQXA 4G2VA 4WAFA 3DALA 2I1KA 3AS5A 1E8YA 5FJYA 4L2YA 2WB2A 5F5EA 4F1SA 1O9SA 2YHEA 4I6GA 2UWJG 3APFA 3EIJA 5LFAA 4XI9A 5EX0A 1X5BA 1ELWA 4B89A 2PM6A 4DI4A 5JIYA 1WAO1 2AWIA 2KCVA 2KC7A 3RK6A 4D10C 4QEPA 4E47A 2MOWA 4G23A 4GZ5A 3IKOB 2WXHA 5E76A 3S8PA 2YHCA 3FTZA 3TXNA 1MHQA 1QNFA 4I1OB 4UI9J 2JEKA 3IHVA 3TXMA 4CCAA 4ANXA 1E8XA 2E2EA 5G05J 4DJAA 2FI7A 1NA3A 4XZ4A 2XPZA 5CHEE 1L5JA 3Q49B 3ESKA 4B8AA 4QFVA 1ZU2A 3CHPA 3BEEA 2WXPA 3FUKA 1NA0A 3LDZA 4HXIA 2IJGX 3LY8A 5C1DA 5G04C 3ZXSA 4RSYA 3RAYA 4G25A 4AY6A 3AU4A 3HVEB 4I6EA 1ELKA 4APOA 5G2NA 4GYWA 5FQ8A 3BG0B 3QNKA 3BO5A 5BUZA 3HNAA 4N2QA 3QJZA 4XIFA 5M72A 4H12A 4YVQC 4LCTA 5FZRA 4AJWA 5G55A 3TGOA 1N6AA 1GW6A 1XNFA 4J8SA 5EDSA 4UQZA 2X6KA 4C0EA 4I1MA 1WY6A 2XEVA 2XGSA 4JHKA 5JJTA 3KMTA 3R7RA 4L23A 4UQYA 4F3VA 3G2UA 2UY1B 4J8EA 1E7UA 3FH8A 4G26A 4AM9A 3S7FA 4G11A 1UG3A 3FUMA 1Y6IA 3HYMB 4HOSA 2PQNA 2IQCA 3PE3A 5BV1A 2XCBA 1KLXA 4XI0A 2NSZA 1N52A 1H6KA 3L16A 5KJLA 3M56A 4L7TA 3FPDA 4JDSA 3D9PA 3SZ7A 3K9IA 5FTPA 4F7AA 4N39A 3F9YA 5AIJA 5BPPA 2IFUA 1VDYA 3FTYA 4IULA 5JINA 2HM8A 4HVBA 3L13A 3MV3B 5G04J 1HE8A 2YINA 3PNTB 3SBSA 5AENA 3G2WA 1PEGA 4LEUA 3M55A 3GZ2A 4GA2A 1TJFA 3D9OA 3L08A 4UWHA 4I1AA 2CHXA 2BUGA 2VJ8A 3PNLB 5C2YA 3UQ3A 3D9MA 5JHAA 4GPKA 3ASHA 2RFIA 2FULA 3ZN3A 3MYVA 4AOFA 2GW1A 3CK9A 1LF8A 1EYHA 4B94A 1SQMA 3QAQA 2IGQA 5KJNA 3PVLA 4A1SA 4KT6B 4TRQA 4AP2A 2VTBA 2IOSA 3EIQC 4MRUA 3QK0A 4BSXA 3KMJA 4BUPA 2WXIA 4NACA 4CDRA 3CBMA 3AS8A 2WXLA 2HYZA 3TG5A 3U64A 4WUYA 3CVVA 4L1BA 2KZTA 1IQUA 2AXUA 3GZ1A 2XGMA 1JPLA 3LY9A 4GU5A 4N3CA 4E85A 1INZA 5JJ0A 5F6KC 4I9EA 4EBAG 3Q15A 5LCWJ 4HS2A 5LP0A 4WNEA 2OOEA 2DCPA 4ILGA 2KZTB 4W9RA 3M57A 4RZ0A 3MV2B 3RQ4A 2X6HA 4FJZA 3QWWA 2VSOE 3CSFA 3QOUA 2AW6A 4U0UA 3CKCA 4O30A 1QQEA 2NC9A 3ENEA 4RVBA 5T8IA 4LERA 5FWQA 4P29A 3U4TA 2R3AA 3ONKA 3MKQA 2J9QA 4BTBA 2NXPA 5ANLA 3JQ0A 2I6HA 3SHFA 4G1TA 4GYOA 3CHQA 3MZLB 3MJWA 1HH8A 3LCAA 3TG4A 4U8HA 4CEMA 3FTWA 4CT4A 1A17A 2ONDA 3FUEA 1FCHA 3SBTB 3SFZA 5A6CA 3M59A 4ILHB 4IJ8A 4JL0A 4KMOA 4FHJA 3OXLA 3FUIA 1HG2A 3IV0A 3FU3A 4V3IA 3L6AA 2WXGA 3L17A 3CVLA 4J7IA 2XRYA 4MS6A 2WQ7A 1XQHA 3ZRHA 3I3NA 2RG8A 4JLGA 5T3RA 3LYAA 2C0MA 3GZSA 4WNFA 4EZJA 5TEGA 4XKBA 2LAHA 3QWPA 4KXKB 1JWGA 3VV0A 2YNQA 2MHKA 2CHWA 1HU3A 2KM4A 1TJCA 4I2ZA 2WM9A 3LPZA 4GZDA 3EDTB 4IRUA 3UUXA 2L9BA 2IOLA 4QEOA 4GA0A 4J0UA 3ASFA 1Z3XA 2YQ8A 2PL2A 4IJDA 5LX8A 3I5PA 4XE0A 4UI9K 4N2SA 5T5GA 3D9IA 3VLDA 3B7UX 3NF1A 3VTYA 2C2LA 4JEUA 3APDA 3PEVB 3G2SA 3R9AB 4UWLA 3MA5A 1UN9A 3MGBA 2LO6A 5LCWC 5D0OD 1UN8A 1MT6A 3OPEA 2VGXB 4I6JA 3KAEA 4YPEA 3TL5A 4KYOB 3HHMA 3CVYA 3M53A 3FP3A 2E0IA 3M54A 1H2VC 3MKRA 3QKYA 1HO8A 3KS2A 4Y6WA 4ANVA 4K03A 3RJWA 3FUDA 1ZBPA 4UI9C 5LSZA 1HG5A 2Q7FA 5J90A 4PS8A 3SF4A 1TEZA 4EQFA 4JXTA 4JZYA 4EZLA 4I17A 1KT0A 3FFLA 3FUJA 1BPOA 1JUQA 4FC8A 4JVSA 5EX3A 3R7QA 3CHMA 4BTAA 3CR3A 1SZAA 3MO5A 3FEXA 1W3BA 2WXNA 3BG1B 3DBSA 4OVUA 3ZYMA 2LNIA 4I2WA 3ULQA 3U66A 3EP0A 4YPUA 4I43A 3CQCB 2GRLA 3FUNA 2WPVA 4GAAA 3LY7A 3URZA 5HQ8A 2IONA 3KMAA 3FUFA 4MLPA 2V8SE 2ZU6B 3O4ZA 5CCMA 3CSTA 1KT1A 3L54A 2FF4A 5HI7A 2PZIA 3LKUA 3QWVA 4L2LA 3ZHEA 4DK5A 4BX9A 1DNPA 1E8ZA 2X3MA 1S0PA 2WMNA 3CHOA 3FUHA 1H2TC 1UJJA 2VGYA 4H7XA 1ML9A 3LEWA 3LVRE 3MO2A 2VTBB 2A5UA 5J08A 5AYFA 3FTSA 4AIFA 2L0TB 3C98A 3RKVA 3PH0C 5TH7A 5FQ7A 3K5KA 1H3IA 4Q96A 3D9JA 4FJYA 3JCKC 2XHEA 3I4GA 3PE4A 2V0PA 2AXZA 2VSXE 2AXVA 2LSVA 4JA9A 4DLOA 1OWOA 3CHSA 2WXJA 5BV0A 5EG2A 1IHGA 4FLBA 4ILIA 4KZCA 3ZVVA 2Y4UA 3CIAA 4PUCA 3EHMA 2W5YA 3SW9A 2BQZA 4NJ5A 2X6IA 5BNWA 3QARA 4CGWA 3D3MA 3ML9A 1E96B 1YA0A 3OXFA 1HX8A 4IYPA 4EZKA 3UX4A 4BY6A 4JA7A 5E75A 3FHEA 4C9BB 3ZGQA 3ZYQA 1NZNA 2UY1A 4IN3B 3VLEA 3RO2A 1Z3YA 4NRHB 4PH4B 4BFRA 3CK7A 3MCXA 1DVPA 2WVIA 2VQ2A 5A7DB 4E6HA 3F9ZA 4KVOA 3P2BA 4J8OA 1H19A 2CHZA 3OTNA 5T0KA 4J7FA 3RJVA 4J8FA 4U0ZA 4XKCA 5FQ6A 4EBAA 4NURA 3GW4A 5FT9A 2GRMA 1N6CA 3EJNA 3FU0A 5JJ6A 3CVNA 4UQXA 3ML8A 3AU5A 2I9CA 3QC1A 1E7VA 3G2TA 3S2AA 4C1QA 2WXOA 1EF1C 4ACLA 2O8JA 5F59A 2PQRA 1ELRA 4CT0A 4PDXA 3IHXA 3UT8A 4DLQA 3PEUB 2CG2A 3U9WA 2DBAA 3Q47B 1E90A 5DBKA 3ZFWA 1ZKKA 3OS5A 1OWPA 3ZIMA 4Q69A 1XGWA 4HLEA 4FLHA 4GZCA 5EKQD 4JHRA 1JWFA 4WWOA 4TUUA 4BX8A 4CRWA 3HIZA 3RRUA 4U04A 4U63A 4ANUA 3MEKA 3MX3A 4GMJA 4EECA 2F69A 3T5VA 3D9NA 2W5ZA 3CK8A 3PRZA 2VSYA 4JC8A 2KCKA 4UWFA 3OOIA 2FBNA 4URKA 1SZ9A 4CGVA 3F9WA 2CFUA 5G05C 1B89A 2J08A 1PY1A 2L6JA 4UWGA 3B7TA 3ZW3A 5ARFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P58 C;  5T0M A;  4HOR A;  3CV0 A;  3CEQ A;  4N3A A;  5AYW D;  4ME2 A;  2AVP A;  2LSU A;  4Y6C A;  2VGX A;  4BT8 A;  3JYS A;  4GCO A;  3ZPJ A;  4G24 A;  3AS4 A;  5F6L A;  4LDG A;  3CVQ A;  3KD7 A;  1IYG A;  3CKB A;  3DB5 A;  3O48 A;  3S7B A;  5KJK A;  4N5C A;  3PDN A;  2FO7 A;  2FEZ A;  4RG9 A;  4GZ6 A;  5CPR B;  3SWC A;  2VSN A;  4FMU A;  2KAT A;  5FZQ A;  5ARG A;  4MI5 A;  4AY5 A;  4H7Y A;  4J8D A;  4J83 A;  1HZ4 A;  4YNP A;  4QEN A;  5D0Q D;  2XCC A;  3N71 A;  3WXX A;  4O6F A;  3CBP A;  1PC2 A;  3QDN A;  3GYZ A;  1Y8M A;  2XGO A;  1WM5 A;  4BWR A;  3IEG A;  4YPA A;  4HOT A;  2QFC A;  4GYY A;  2QPW A;  4HOU A;  3FWV A;  4WND A;  3S7J A;  4YND A;  2XPI A;  4MI0 A;  2WQH A;  4YVO A;  2G46 A;  3RIB A;  4GCN A;  3ASD A;  2HR2 A;  4Z4P A;  5BW8 C;  3M58 A;  1QZ2 A;  4ABN A;  4N3B A;  1MVX A;  1HXI A;  3ASG A;  4I9C A;  3TAX A;  3M5A A;  2Y4T A;  5TTF A;  3F9X A;  4GA1 A;  2V5F A;  3E4B A;  4U07 A;  2IF4 A;  5BT1 A;  4I51 A;  2C0L A;  4BT9 A;  4U0S A;  4WNG A;  5JJ7 A;  2JLB A;  3Q4A B;  1P5Q A;  4NQ0 A;  3S7D A;  2JV0 A;  4HOQ A;  3OXG A;  3VUZ A;  4NVQ A;  3CBO A;  2HO1 A;  5DIZ A;  1OUV A;  3MO0 A;  3Q5M A;  2R5S A;  2KCL A;  3CVP A;  2VYI A;  3RO3 A;  3RU0 A;  4YNM A;  5LSX A;  3VTX A;  4KBQ A;  5CCL A;  1MVH A;  1MUF A;  5KJM A;  3ZHE B;  5JHN A;  3UPV A;  3U3W A;  4RG6 A;  4AU7 A;  4GZ3 A;  4G2V A;  3DAL A;  3AS5 A;  5FJY A;  5F5E A;  1O9S A;  2UWJ G;  4XI9 A;  5EX0 A;  1ELW A;  5JIY A;  1WAO 1;  2KCV A;  2KC7 A;  4QEP A;  4E47 A;  4G23 A;  4GZ5 A;  3S8P A;  2YHC A;  4UI9 J;  2E2E A;  5G05 J;  2FI7 A;  1NA3 A;  5CHE E;  3Q49 B;  3ESK A;  1ZU2 A;  3BEE A;  1NA0 A;  3LY8 A;  5C1D A;  5G04 C;  3RAY A;  4G25 A;  4AY6 A;  4APO A;  4GYW A;  3HNA A;  3BO5 A;  4N2Q A;  4XIF A;  5M72 A;  4H12 A;  4YVQ C;  5FZR A;  3TGO A;  1N6A A;  1XNF A;  4UQZ A;  2XEV A;  2XGS A;  5JJT A;  3KMT A;  4F3V A;  4UQY A;  4J8E A;  2UY1 B;  4G26 A;  4AM9 A;  3S7F A;  3HYM B;  4HOS A;  2PQN A;  3PE3 A;  2XCB A;  1KLX A;  4XI0 A;  5KJL A;  3M56 A;  4JDS A;  3SZ7 A;  3K9I A;  5FTP A;  4N39 A;  3F9Y A;  2IFU A;  5JIN A;  3MV3 B;  5G04 J;  1PEG A;  4LEU A;  3M55 A;  3GZ2 A;  4GA2 A;  4I1A A;  2BUG A;  3UQ3 A;  4GPK A;  3ASH A;  2RFI A;  3ZN3 A;  2GW1 A;  3CK9 A;  4B94 A;  2IGQ A;  5KJN A;  4A1S A;  3KMJ A;  4BUP A;  3CBM A;  4CDR A;  3AS8 A;  2HYZ A;  3TG5 A;  4WUY A;  3GZ1 A;  2XGM A;  4N3C A;  3LY9 A;  5JJ0 A;  5F6K C;  4I9E A;  3Q15 A;  5LCW J;  4WNE A;  2OOE A;  4W9R A;  3M57 A;  4RZ0 A;  3MV2 B;  3RQ4 A;  3QWW A;  3QOU A;  4U0U A;  3CKC A;  4O30 A;  1QQE A;  2NC9 A;  3U4T A;  2R3A A;  2J9Q A;  4BTB A;  2I6H A;  4G1T A;  4GYO A;  1HH8 A;  3LCA A;  3TG4 A;  1A17 A;  2OND A;  1FCH A;  5A6C A;  3M59 A;  4IJ8 A;  4JL0 A;  3OXL A;  3CVL A;  4J7I A;  1XQH A;  4JLG A;  3LYA A;  2C0M A;  4WNF A;  5TEG A;  3QWP A;  3VV0 A;  4KXK B;  2MHK A;  1TJC A;  4I2Z A;  3LPZ A;  4QEO A;  3EDT B;  3UUX A;  4GA0 A;  4J0U A;  3ASF A;  2YQ8 A;  2PL2 A;  4IJD A;  4N2S A;  4UI9 K;  5T5G A;  3NF1 A;  3VTY A;  2C2L A;  3R9A B;  3MA5 A;  5LCW C;  5D0O D;  1MT6 A;  3OPE A;  2VGX B;  3KAE A;  4YPE A;  4KYO B;  3M53 A;  3M54 A;  3FP3 A;  3MKR A;  3QKY A;  3KS2 A;  4Y6W A;  3RJW A;  1ZBP A;  4UI9 C;  5LSZ A;  2Q7F A;  3SF4 A;  4EQF A;  4I17 A;  1KT0 A;  3FFL A;  1N3J A;  5EX3 A;  4BTA A;  3MO5 A;  1W3B A;  3EP0 A;  2LNI A;  4I2W A;  3ULQ A;  4YPU A;  2WPV A;  3LY7 A;  3URZ A;  5HQ8 A;  3KMA A;  5CCM A;  5HI7 A;  1KT1 A;  2FF4 A;  2PZI A;  3LKU A;  3QWV A;  3ZHE A;  5FZS A;  1ML9 A;  4H7X A;  2VGY A;  3MO2 A;  5AYF A;  4AIF A;  3RKV A;  5TH7 A;  3K5K A;  1H3I A;  3PE4 A;  2LSV A;  4JA9 A;  5EG2 A;  1IHG A;  2Y4U A;  2W5Y A;  3SW9 A;  2BQZ A;  4NJ5 A;  5BNW A;  4CGW A;  1E96 B;  1YA0 A;  3OXF A;  4JA7 A;  3ZGQ A;  1NZN A;  2UY1 A;  4IN3 B;  3RO2 A;  4NRH B;  3CK7 A;  2VQ2 A;  5A7D B;  3F9Z A;  5T0K A;  4J8O A;  4J7F A;  3RJV A;  4J8F A;  4U0Z A;  3GW4 A;  5FT9 A;  1N6C A;  5JJ6 A;  3CVN A;  4UQX A;  4C1Q A;  2O8J A;  5F59 A;  2PQR A;  1ELR A;  3IHX A;  3ZFW A;  2DBA A;  3Q47 B;  1ZKK A;  5DBK A;  3OS5 A;  5EKQ D;  4JHR A;  4U04 A;  3MEK A;  2F69 A;  2W5Z A;  3CK8 A;  3OOI A;  2VSY A;  2KCK A;  2FBN A;  4CGV A;  3F9W A;  5G05 C;  1B89 A;  3FPD A;  2L6J A;  5ARF A; 
#chains in the Genus database with same CATH topology
 2IU1 A;  4HOR A;  3VLF A;  3IHY A;  4ATG A;  4GTV A;  4ME2 A;  1ZB1 A;  3IXE A;  2LSU A;  1TYQ G;  2WXR A;  2WXQ A;  3JYS A;  2XQ0 A;  4N5Q A;  5F6L A;  4LDG A;  2X38 A;  5ENR D;  4U96 D;  3ONL A;  2L0I A;  3KD7 A;  4Q94 A;  4F53 A;  3CKB A;  3LVQ E;  1Z6T A;  4KZ0 A;  3S7B A;  4YDO A;  1V55 E;  5CMY A;  4DX1 A;  3LJ3 A;  3PDN A;  2FO7 A;  2LAI A;  3X2Q E;  2FEZ A;  4LNB A;  4GTP A;  2V4H C;  3NZU A;  3RRN B;  2IO3 C;  1N9A A;  3FY4 A;  1U3D A;  2J07 A;  3Q7F A;  5IY5 E;  4QEN A;  3ABL E;  5ENQ D;  2OEW A;  5D0Q D;  2H6H A;  3D9L A;  2CFZ A;  5EYP F;  3WXX A;  2MRI A;  5AQ9 A;  4O6F A;  4OVV A;  5LOZ A;  3PZD A;  2XGO A;  1WM5 A;  4BWR A;  3RRM B;  1OWL A;  3FUL A;  4YPA A;  4JW1 A;  4GYY A;  2XEH A;  4WND A;  2XPI A;  3JXI A;  4YVO A;  2ILR A;  1FVF A;  4EPZ A;  3D9H A;  3MKQ B;  4TV3 A;  3HXE A;  1QZ2 A;  2R05 A;  4I9C A;  2DYS E;  2Y4T A;  3F9X A;  3L9T A;  1LD8 A;  4I51 A;  1IQR A;  1P5Q A;  3S7D A;  4GPM A;  3OXG A;  3CBO A;  4FA6 A;  1E8W A;  2EIN E;  4HRN A;  2VYI A;  4HRM B;  3RO3 A;  4ZFH A;  2GGF A;  2WXF A;  4OAU C;  1K1B A;  4KBQ A;  3B7S A;  2CG3 A;  4LSZ E;  5JHB A;  5KJM A;  4DX6 D;  4GB9 A;  1MQS A;  1YMP A;  3PUK A;  3HRA A;  3FTV A;  4WAF A;  4F1S A;  5B3S E;  2R02 A;  1O9S A;  1AWC B;  4XI9 A;  1X5B A;  4B89 A;  5JIY A;  4D10 C;  2KC7 A;  4HRL A;  3IKO B;  5E76 A;  1TR4 A;  1NA3 A;  4F1P A;  3PZ3 A;  5CHE E;  5EYL A;  1MYO A;  1TN8 A;  5EIB E;  3RAY A;  4G25 A;  3AU4 A;  3HVE B;  1ELK A;  5G2N A;  3DSW A;  4GYW A;  3NAW A;  2GRN B;  2XEN A;  1IXV A;  1GW6 A;  5EDS A;  5CRU A;  4F3V A;  3G2U A;  4TXQ A;  4G26 A;  4AM9 A;  4M7C A;  3SO8 A;  3BQO A;  1UG3 A;  3FUM A;  4HOS A;  2PQN A;  3DXK G;  2H6G A;  1H6K A;  4JDS A;  3SZ7 A;  3K9I A;  4F7A A;  3HXC A;  4HVB A;  5AEN A;  1TJF A;  4I1A A;  2VJ8 A;  4O1O A;  3UKU G;  4AOF A;  2GW1 A;  4BSZ B;  2IGQ A;  5KJN A;  4A1S A;  4BSX A;  2WXI A;  3TG5 A;  5AQB A;  1IQU A;  1TNO A;  4E85 A;  5JJ0 A;  2OCC E;  5F6K C;  3EHQ A;  4EBA G;  3Q15 A;  3SFX A;  3M57 A;  3MV2 B;  2X6H A;  3PZ1 A;  3QOU A;  4RVB A;  1JCQ A;  5FWQ A;  3ONK A;  1MZC A;  2DYR E;  4G1T A;  4GYO A;  3CHQ A;  3MZL B;  3LCA A;  4CEM A;  1NFI E;  4CT4 A;  3Q78 A;  1WG0 A;  3SFZ A;  3M59 A;  4ILH B;  4RQI A;  4KMO A;  3ZNG A;  3L17 A;  4J7I A;  1S63 A;  4JLG A;  3GZS A;  4EZJ A;  1JWG A;  2YNQ A;  1HU3 A;  1FT1 A;  1TJC A;  4QEO A;  3EDT B;  2L9B A;  2B6C A;  1QYM A;  1Z3X A;  2YQ8 A;  4N2S A;  4UI9 K;  3VLD A;  3TWW A;  3VTY A;  3APD A;  5FIN A;  3R9A B;  4UWL A;  5LCW C;  5D0O D;  1MT6 A;  4YPE A;  3HHM A;  2E0I A;  4K03 A;  3ZKJ A;  3DSX A;  5LSZ A;  1JCS A;  4GMR A;  3SF4 A;  1TEZ A;  4JXT A;  3R7Q A;  5EX3 A;  3CHM A;  1SZA A;  1W3B A;  3DBS A;  4I43 A;  2DZO A;  2WPV A;  3URZ A;  3FUF A;  2ZU6 B;  3L54 A;  2PZI A;  3QWV A;  3ZHE A;  4L2L A;  5FZS A;  3FUH A;  1ML9 A;  2VTB B;  4GTS A;  5AYF A;  3RKV A;  5TH7 A;  4HI9 A;  3K5K A;  1U2V G;  4TXR A;  1LTX A;  2AXV A;  5EG2 A;  5BXU A;  2GRO B;  4PUC A;  3UM1 A;  2BQZ A;  4CGW A;  4IYP A;  3OXF A;  4EZK A;  4BES A;  5CED B;  3UM0 A;  3ZGQ A;  1NZN A;  1WDY A;  2DZN A;  3ZXP A;  2EIJ E;  3MCX A;  5A7D B;  3P2B A;  4J8O A;  1H19 A;  3OTN A;  2IO2 C;  4J7F A;  3EJN A;  5JJ6 A;  2Y0B G;  3G2T A;  3S2A A;  1K3Z D;  2XS1 A;  1ELR A;  4CT0 A;  3UT8 A;  3U9W A;  2DBA A;  1OWP A;  4Q69 A;  1XGW A;  4OAV B;  5AQ7 A;  5EKQ D;  2P9S G;  1JWF A;  4CRW A;  4DRX E;  4ANU A;  3UI2 A;  2F69 A;  3CK8 A;  3AJI A;  4URK A;  1SZ9 A;  3BUA A;  3F9W A;  5G05 C;  1PY1 A;  1PAQ A;  3FH7 A;  2P58 C;  2ETB A;  4XX5 A;  1JCR A;  4K5C A;  5AYW D;  1YYH A;  2AVP A;  4Y6C A;  2FO1 E;  1UW4 B;  3FTX A;  2VGX A;  2J4D A;  3FU6 A;  4BT8 A;  3Q9U C;  5T4Y A;  2I2O A;  2WXK A;  3JUE A;  3SGH A;  4G24 A;  3AS4 A;  4CDN A;  4FUL A;  4FP7 A;  5AJL A;  3DB5 A;  4JD2 G;  3O48 A;  1OWN A;  4GZ6 A;  4LRZ A;  3ZU7 B;  3AG2 E;  5ARG A;  4AY5 A;  1O1S A;  4J83 A;  3B7R L;  4O60 A;  2LUH A;  2OVF A;  4PS3 A;  2R59 A;  4RLY A;  3N71 A;  3ZUV B;  3CBP A;  2Y69 E;  3FDH A;  2Y1L E;  3QDN A;  3GYZ A;  1Y8M A;  2EIK E;  3DRA A;  2A4Z A;  3TWS A;  3IEG A;  3FWV A;  5CRV A;  4LUN U;  3P1U A;  4MI0 A;  2WQH A;  2X6F A;  1HF8 A;  4ATZ D;  3ZYL A;  3G2V A;  4HQD A;  2R2L A;  5BW8 C;  4JHJ A;  3UIO C;  4B8C B;  4ABN A;  4N3B A;  1MVX A;  4TUM A;  3ASG A;  3JQ1 A;  4DUI A;  4A3V A;  3ZEF A;  3TAX A;  3M5A A;  1TNU A;  4UWK A;  3NB2 A;  5FIO A;  5JMN D;  5BT1 A;  4U0S A;  4AXH A;  5JJ7 A;  1U3C A;  4HFG A;  4NQ0 A;  3FTU A;  2JV0 A;  4KVM A;  3UM2 A;  3ZYK A;  3MO0 A;  1OUV A;  2KCL A;  4UUC A;  4AEZ C;  1MX4 A;  3HVE A;  1SVX A;  1HFA A;  1MVH A;  2J49 A;  3PUJ A;  3UPV A;  3U3W A;  3E33 A;  3ASO E;  3EHN A;  2EQX A;  3AS5 A;  3APF A;  3UIN C;  2XZT G;  3HXF A;  3TWR A;  2AWI A;  2ZGG A;  4E47 A;  4A63 B;  2WXH A;  2YHC A;  3FTZ A;  3UIP C;  3IHV A;  2E2E A;  5G05 J;  4DJA A;  3Q49 B;  2XS8 A;  3CHP A;  1N4Q A;  2WXP A;  5G04 C;  5EN5 D;  3ZXS A;  1FT2 A;  2J8S D;  4AY6 A;  3QJZ A;  5D2M C;  4YVQ C;  4LCT A;  4J8S A;  2X6K A;  4C0E A;  4LG6 A;  2XGS A;  3KMT A;  2UY1 B;  1E7U A;  5KWD A;  3S7F A;  4G11 A;  2XCB A;  5KJL A;  3TWQ A;  4N39 A;  5BPP A;  5CEC B;  4L9P A;  4IUL A;  1X81 A;  1HE8 A;  2P2C P;  2YIN A;  3PNT B;  3SBS A;  1PEG A;  3M55 A;  1LD7 A;  3UQ3 A;  5JHA A;  3ASH A;  2RFI A;  3ABM E;  3CK9 A;  1BLX B;  1EYH A;  3QAQ A;  2EIM E;  3ULY A;  2IOS A;  4MRU A;  4BUP A;  4CDR A;  2HYZ A;  4WUY A;  3LY9 A;  4G8K A;  5LCW J;  2OOE A;  4ILG A;  4DX5 D;  5HS0 A;  4W9R A;  5AN8 A;  5B1B E;  4FJZ A;  5ENO D;  2IY0 C;  2J9Q A;  4BTB A;  1N4R A;  3L82 A;  3JQ0 A;  2IEJ A;  3V31 A;  2BKK B;  3FUE A;  4CZ2 D;  3SBT B;  4IJ8 A;  5H7P A;  3IV0 A;  1SA4 A;  3FU3 A;  4V3I A;  2R03 A;  3CVL A;  1D8E A;  4K5B A;  3I3N A;  3TWV A;  5TEG A;  3Q79 A;  2LAH A;  3VV0 A;  4I2Z A;  2WM9 A;  4GA0 A;  5AQA A;  1QBQ A;  2PL2 A;  4IJD A;  3DPY A;  3D9I A;  2C2L A;  3PEV B;  3G2S A;  1UN9 A;  4I6J A;  3DXM G;  4Y6W A;  3RJW A;  3FUD A;  2Q7F A;  5J90 A;  4JZY A;  4I17 A;  1N3J A;  4JVS A;  2P9U G;  4BTA A;  4DX2 A;  3U66 A;  3ULQ A;  3CQC B;  3FUN A;  3C72 A;  2ION A;  4MLP A;  2V8S E;  3SQV A;  2FF4 A;  4BX9 A;  1DNP A;  1E8Z A;  2X3M A;  3CHO A;  2WMN A;  4H7X A;  4EHM A;  3LEW A;  1TNY A;  2A5U A;  3FTS A;  1H6O A;  3KSQ A;  3D9J A;  2XHE A;  3PE4 A;  4DLO A;  5BV0 A;  2WXJ A;  1DCE A;  3RSE G;  4FLB A;  4ILI A;  3KEA A;  4BEP A;  5HKP A;  3UX4 A;  4BY6 A;  5E75 A;  3FHE A;  2WVI A;  2VQ2 A;  3W9F A;  2CHZ A;  4LNU D;  4J8F A;  3FU0 A;  4UQX A;  2I9C A;  1AP7 A;  4C48 B;  2WXO A;  2O8J A;  2PQR A;  3F6Q A;  2F8Y A;  3PEU B;  3ZFW A;  1ZKK A;  3Q47 B;  2NYJ A;  2B0O E;  4X8Q A;  4HLE A;  4WWO A;  4TUU A;  4BX8 A;  3HIZ A;  4U63 A;  2LXM A;  3MX3 A;  3OOI A;  2VSY A;  4UWF A;  2CFU A;  1H6P A;  4UWG A;  3ZW3 A;  5T0M A;  3CV0 A;  3UMV A;  4N3A A;  2DIW A;  1S64 A;  3ABK E;  1EPU A;  1V54 E;  1NL4 A;  1N54 A;  2BTD A;  4BET A;  4CDM A;  3DSV A;  3AG4 E;  4GCO A;  3ZPJ A;  5AJD A;  4PS7 A;  3DEP A;  2RFA A;  1OWM A;  3CLJ A;  4AV7 A;  1IYG A;  2ZXW E;  4B0Z A;  5KJK A;  4XEI G;  2M63 A;  2Y3A A;  3E32 A;  4RG9 A;  4Z68 A;  5CPR B;  2R17 C;  3SWC A;  4J6I A;  4FMU A;  5FZQ A;  4APF A;  2RFM A;  3DSS A;  3NQP A;  3SD5 A;  2F37 A;  3UT4 A;  3HDX A;  2EIL E;  2XCC A;  4DX7 D;  5CBN A;  2F0Y A;  5ANR A;  1H2U A;  4LNG A;  3L22 A;  5KCM A;  1OY3 D;  2PNN A;  3EUV A;  3FU5 A;  1PC2 A;  3PRE A;  4R7L A;  2XPY A;  3KEZ A;  4GTT A;  1RW2 A;  2QPW A;  3EHR A;  4HOU A;  3FH5 A;  2I1J A;  1G3N B;  2LXL A;  3RIB A;  3Q73 A;  4Z4P A;  2OVB A;  1OCO E;  3M58 A;  4JPS A;  3CQG B;  4DPR A;  3KSL A;  2H6I A;  2V5Q C;  1HXI A;  3NZS A;  3ISM C;  2BF0 X;  4GTM A;  1FPP A;  5TTF A;  4ACK A;  3DPD A;  1HS6 A;  2V5F A;  3ULE G;  3PZ4 A;  4U07 A;  2C0L A;  1NI1 A;  4BT9 A;  4HB5 A;  3AG1 E;  2JLB A;  3LXU X;  3Q4A B;  3QB2 A;  3VUZ A;  1OCR E;  2DWZ A;  1N95 A;  4MKT A;  3Q5M A;  2R5S A;  4C0M A;  3RU0 A;  5LSX A;  3VTX A;  5CCL A;  3J5Q B;  3APC A;  2AJA A;  1MUF A;  3B7B A;  3ZHE B;  3LS8 A;  5JHN A;  4FU3 A;  3UKR G;  1IHB A;  2JAB A;  2RD0 A;  4A1G A;  2WMO A;  3D9K A;  4GZ3 A;  5FJY A;  1BD8 A;  2WB2 A;  2KBX A;  5F5E A;  3EIJ A;  5LFA A;  5EX0 A;  4DI4 A;  1S70 B;  2KCV A;  4QEP A;  1O1T A;  4GZ5 A;  4GTR A;  1QNF A;  4YDE A;  4UI9 J;  4YDW A;  3AAA C;  5ITZ F;  1L5J A;  1DCQ A;  1N94 A;  3R9M A;  4B8A A;  4QFV A;  1ZU2 A;  3NOC D;  3BEE A;  3DSU A;  3FUK A;  2IJG X;  3LY8 A;  5ENS D;  4RSY A;  4MBG A;  3BG0 B;  3BO5 A;  4N2Q A;  4H12 A;  5M72 A;  1YCS B;  4AJW A;  5G55 A;  3TGO A;  1N6A A;  3ASN E;  4UQZ A;  2XEV A;  4JHK A;  5JJT A;  3J5P A;  4J8E A;  1N4P A;  3HYM B;  1Y6I A;  5BV1 A;  4XI0 A;  1N52 A;  3L16 A;  3D9P A;  3F9Y A;  5AIJ A;  2IFU A;  3FTY A;  1OT8 A;  3L13 A;  4JB8 P;  3GZ2 A;  4GA2 A;  4UWH A;  2CHX A;  2BUG A;  3E37 A;  3PNL B;  5C2Y A;  3C5R A;  2ZIR A;  3ZN3 A;  2GRP B;  3MYV A;  1A5E A;  2GRQ B;  1OCZ E;  4B94 A;  1SQM A;  3C3R A;  2BED A;  2P9I G;  4AP2 A;  4TRQ A;  3QK0 A;  3KMJ A;  4NAC A;  2WXL A;  3CVV A;  2HE0 A;  2KZT A;  1JPL A;  4GU5 A;  4WNE A;  2KZT B;  4RZ0 A;  2AW6 A;  4U0U A;  3U4T A;  4LER A;  2R3A A;  3EU9 A;  2P9N G;  3SHF A;  1HH8 A;  3TG4 A;  1MJ0 A;  1A17 A;  2OND A;  1FCH A;  4FHJ A;  3OXL A;  3L6A A;  2WXG A;  1TN7 A;  4MS6 A;  2WQ7 A;  2C0M A;  4XKB A;  3QWP A;  4KXK B;  3LPZ A;  2IOL A;  4ZHB A;  3ASF A;  3HG0 D;  4HNA D;  5LX8 A;  4XE0 A;  3NF1 A;  4JEU A;  3MA5 A;  3MGB A;  1UN8 A;  3OPE A;  3WG7 E;  5BXO A;  4KYO B;  3M53 A;  1H2V C;  1HO8 A;  4ANV A;  4UI9 C;  1HG5 A;  3E30 A;  4EQF A;  1KPS B;  5CEA A;  3FEX A;  3BG1 B;  4OVU A;  3ZYM A;  1N0R A;  2LNI A;  4I2W A;  3Q9N C;  3EP0 A;  4YPU A;  4GAA A;  3LY7 A;  3DST A;  3C3O A;  5CCM A;  3CST A;  1KT1 A;  4DK5 A;  1S0P A;  1UJJ A;  2VGY A;  3LVR E;  3MO2 A;  5J08 A;  5EID A;  4AIF A;  2L0T B;  3C98 A;  3PH0 C;  4Q96 A;  2AXZ A;  4HBD A;  3ZVV A;  3CIA A;  2BKG A;  4NJ5 A;  2X6I A;  5BNW A;  5ENP D;  3ML9 A;  1YA0 A;  1HX8 A;  4JA7 A;  4C9B B;  3ZYQ A;  4IN3 B;  4BER A;  4O1P A;  3VLE A;  1Z3Y A;  4NRH B;  4PH4 B;  1DVP A;  3F9Z A;  4U0Z A;  5FQ6 A;  2DVW A;  3GW4 A;  2GRM A;  1KZP A;  3AU5 A;  1E7V A;  4ACL A;  1K1A A;  2MYO A;  3IHX A;  4CYM D;  2CG2 A;  3RAU A;  3ZIM A;  1SW6 A;  3RRU A;  3D9N A;  3PRZ A;  4JC8 A;  3TWT A;  2ZGD A;  3DEO A;  3HXD A;  1B89 A;  2L6J A;  3B7T A;  5ARF A;  4JEH A;  3HXB A;  3T5X A;  1OXJ A;  3CEQ A;  2PM7 A;  3CVU A;  2V4L A;  3C3Q A;  1SA5 A;  1TNZ A;  3CHR A;  3T8K A;  3CVX A;  3JUI A;  3CVW A;  5CMW A;  4M3O A;  3UM3 A;  3CVQ A;  4WWN A;  2QC9 A;  4K0R A;  4NIK A;  3T8M A;  4N5C A;  2QYU A;  4K5A B;  2J4B A;  1TN6 A;  2VSN A;  4OYS A;  2KAT A;  4MI5 A;  2WXM A;  5CER B;  5A23 A;  4H7Y A;  4J8D A;  3JXJ A;  3I4R B;  1NP7 A;  1HZ4 A;  4YNP A;  4J7W A;  3OAW A;  4GML A;  4FHK A;  4A55 A;  3V30 A;  5KNG A;  4QQI A;  2J09 A;  4WWP A;  3Q7A A;  1UOH A;  1K8K G;  4HOT A;  2QFC A;  4A3T A;  3ESL A;  3S7J A;  1D9S A;  3CGH A;  3FEY A;  4YDY A;  4YND A;  2X6J A;  3SNX A;  4U7E B;  2G46 A;  1O1R A;  4GCN A;  3ASD A;  2HR2 A;  3IBE A;  4B93 B;  4AVX A;  3TJP A;  1Q2Z A;  2F8X K;  3UT7 A;  2QY7 A;  3BU8 A;  5ENN A;  2P9P G;  3V79 K;  2RKK A;  3SY2 A;  4GA1 A;  1RZ4 A;  1IKN D;  4ANW A;  3E4B A;  2XEE A;  2IF4 A;  1Z5S C;  3Q75 A;  4DI3 A;  4WNG A;  4FAD A;  4HOQ A;  1EDU A;  4NVQ A;  2HO1 A;  3B13 A;  5DIZ A;  3SI5 A;  2WQ6 A;  3CVP A;  4YNM A;  1FVH A;  2XRZ A;  1N4S A;  1H0A A;  1UJK A;  4RG6 A;  5AAO A;  2OV8 A;  5FQ4 A;  4AU7 A;  4G2V A;  2KXP C;  3DAL A;  2I1K A;  1E8Y A;  4L2Y A;  2YHE A;  4I6G A;  3NBN B;  2UWJ G;  1ELW A;  5ENT D;  2PM6 A;  1WAO 1;  3RK6 A;  2MOW A;  4G23 A;  5JA4 D;  3S8P A;  3TXN A;  1MHQ A;  3TXM A;  4I1O B;  2JEK A;  4CCA A;  4ANX A;  1E8X A;  4GTQ A;  2FI7 A;  4XZ4 A;  2XPZ A;  3ESK A;  1NA0 A;  3UXG A;  3LDZ A;  5D66 A;  4HXI A;  5C1D A;  4I6E A;  4APO A;  5FQ8 A;  3HNA A;  3QNK A;  5BUZ A;  4XIF A;  5FZR A;  3TWU A;  1XNF A;  4I1M A;  1WY6 A;  5CBO A;  2GRR B;  3SFY A;  3R7R A;  4L23 A;  4UQY A;  3FH8 A;  1MX6 A;  2QZA A;  2OEV A;  2IQC A;  3PE3 A;  3UTM A;  1KLX A;  2NSZ A;  3M56 A;  3PZ2 A;  4L7T A;  5FTP A;  1VDY A;  5JIN A;  2HM8 A;  3MV3 B;  2ETA A;  5G04 J;  3G2W A;  4LEU A;  4U8Y D;  4HI8 A;  3E34 A;  3D9O A;  3L08 A;  5B1A E;  4TXP A;  1N11 A;  1O5M A;  2P9K G;  5KBA A;  3D9M A;  4GPK A;  2FUL A;  1LF8 A;  1DC2 A;  2ETC A;  2ZIS A;  3PVL A;  4KT6 B;  2VTB A;  3EIQ C;  1BU9 A;  3CBM A;  3AS8 A;  3U64 A;  4L1B A;  2AXU A;  3GZ1 A;  2XGM A;  4N3C A;  1INZ A;  4I9E A;  3LJN A;  4HS2 A;  5LP0 A;  2DCP A;  3RQ4 A;  3AG3 E;  3QWW A;  2VSO E;  4G8L A;  3CSF A;  3CKC A;  4O30 A;  1QQE A;  2NC9 A;  3ENE A;  5T8I A;  4P29 A;  3MKQ A;  3B95 A;  2NXP A;  1BI8 B;  5ANL A;  2I6H A;  3MJW A;  4U8H A;  3FTW A;  3TWX A;  3V2X A;  5A6C A;  4JL0 A;  1OCC E;  3FUI A;  1HG2 A;  3DWL G;  4GTO A;  2XRY A;  1XQH A;  3ZRH A;  2RG8 A;  5T3R A;  3LYA A;  4WNF A;  1D8D A;  2MHK A;  2CHW A;  2KM4 A;  4GZD A;  3W9G A;  4IRU A;  3UUX A;  4J0U A;  3I5P A;  5T5G A;  2VGE A;  3B7U X;  2LO6 A;  2VGX B;  3KAE A;  3TL5 A;  3M54 A;  3CVY A;  3FP3 A;  3MKR A;  3QKY A;  3KS2 A;  1ZBP A;  4PS8 A;  4EZL A;  1KT0 A;  3FFL A;  3FUJ A;  1BPO A;  1JUQ A;  4FC8 A;  3CR3 A;  3MO5 A;  2WXN A;  1BI7 B;  2GRL A;  5KNH D;  5HQ8 A;  3NOG D;  3KMA A;  3EU5 A;  3O4Z A;  5HI7 A;  3LKU A;  4J8Y A;  3PS6 A;  1H2T C;  3T9K A;  1TNB A;  2P9L G;  5FQ7 A;  1H3I A;  4FJY A;  3JCK C;  3I4G A;  2V0P A;  4U8V D;  2VSX E;  2LSV A;  4JA9 A;  1OWO A;  3CHS A;  2L6B A;  1IHG A;  2QYJ A;  4KZC A;  4F6R D;  2Y4U A;  3EHM A;  2W5Y A;  3SW9 A;  3QAR A;  3D3M A;  1E96 B;  2UY1 A;  1N0Q A;  3RO2 A;  4BFR A;  3CK7 A;  4E6H A;  4KVO A;  5T0K A;  2H6F A;  3RJV A;  4EBA A;  4XKC A;  3V2O A;  4NUR A;  1MX2 A;  5FT9 A;  1N6C A;  3CVN A;  3ML8 A;  3QC1 A;  4C1Q A;  1EF1 C;  5F59 A;  4PDX A;  4HLL A;  4U95 D;  4DLQ A;  1E90 A;  5DBK A;  3OS5 A;  5AAR A;  4FLH A;  1KZO A;  4GZC A;  4JHR A;  4U04 A;  3MEK A;  4GMJ A;  4EEC A;  3T5V A;  2XZD G;  2W5Z A;  2A5E A;  2KCK A;  2FBN A;  4CGV A;  5EIL A;  2J08 A;  3FPD A;  5HRY A; 
#chains in the Genus database with same CATH homology
 1PAQ A;  4JEH A;  3FH7 A;  2P58 C;  4XX5 A;  5T0M A;  2IU1 A;  4HOR A;  3VLF A;  3CV0 A;  3T5X A;  3IHY A;  3CEQ A;  2PM7 A;  3UMV A;  4ATG A;  4N3A A;  5AYW D;  4ME2 A;  2DIW A;  3CVU A;  1EPU A;  2AVP A;  2LSU A;  4Y6C A;  1UW4 B;  3FTX A;  2VGX A;  1N54 A;  2BTD A;  2J4D A;  2V4L A;  3FU6 A;  4BT8 A;  4CDM A;  3CHR A;  5T4Y A;  3CVX A;  2I2O A;  2WXK A;  2WXQ A;  2WXR A;  3JYS A;  2XQ0 A;  3JUI A;  4GCO A;  3CVW A;  3ZPJ A;  5AJD A;  3SGH A;  4PS7 A;  4G24 A;  3AS4 A;  5CMW A;  5F6L A;  4LDG A;  1OWM A;  2X38 A;  3CLJ A;  4M3O A;  4AV7 A;  4FUL A;  4CDN A;  3CVQ A;  2L0I A;  3KD7 A;  3ONL A;  4Q94 A;  4WWN A;  4F53 A;  4FP7 A;  1IYG A;  3CKB A;  5AJL A;  3LVQ E;  3DB5 A;  3O48 A;  4B0Z A;  1Z6T A;  4K0R A;  4KZ0 A;  3S7B A;  3T8M A;  4N5C A;  5KJK A;  5CMY A;  2M63 A;  3LJ3 A;  3PDN A;  2FO7 A;  2LAI A;  2FEZ A;  2Y3A A;  4RG9 A;  1OWN A;  4GZ6 A;  1N3J A;  5CPR B;  4LRZ A;  2R17 C;  2J4B A;  3NZU A;  3SWC A;  2VSN A;  4J6I A;  4OYS A;  3RRN B;  4FMU A;  3PS6 A;  2KAT A;  5FZQ A;  5ARG A;  4APF A;  3FY4 A;  2WXM A;  4MI5 A;  4AY5 A;  5A23 A;  1U3D A;  3NQP A;  4H7Y A;  4J8D A;  3SD5 A;  4J83 A;  3B7R L;  3I4R B;  1NP7 A;  1HZ4 A;  2J07 A;  4YNP A;  3UT4 A;  3HDX A;  4QEN A;  5D0Q D;  3OAW A;  2XCC A;  2OVF A;  4GML A;  4FHK A;  5ANR A;  5FZS A;  1H2U A;  4A55 A;  3D9L A;  4PS3 A;  2CFZ A;  3L22 A;  2R59 A;  3N71 A;  3WXX A;  5KCM A;  2MRI A;  2J09 A;  4O6F A;  3FU5 A;  4OVV A;  1PC2 A;  4WWP A;  3CBP A;  3PRE A;  3FDH A;  4R7L A;  3QDN A;  3GYZ A;  5LOZ A;  1Y8M A;  2XPY A;  3KEZ A;  3PZD A;  2A4Z A;  2XGO A;  1WM5 A;  4BWR A;  3RRM B;  1OWL A;  3IEG A;  3FUL A;  4HOT A;  4YPA A;  2QFC A;  4GYY A;  4JW1 A;  4A3T A;  2QPW A;  4HOU A;  3FWV A;  3ESL A;  3FH5 A;  4WND A;  3S7J A;  4LUN U;  3CGH A;  3FEY A;  4YND A;  2X6J A;  3P1U A;  2XPI A;  3SNX A;  4MI0 A;  2I1J A;  2WQH A;  4YVO A;  2G46 A;  3RIB A;  2ILR A;  2X6F A;  1HF8 A;  4GCN A;  3ASD A;  1FVF A;  4EPZ A;  2HR2 A;  3IBE A;  3G2V A;  3MKQ B;  3ZYL A;  4TV3 A;  4Z4P A;  2OVB A;  5BW8 C;  4JHJ A;  3M58 A;  1QZ2 A;  4AVX A;  4JPS A;  4B8C B;  3CQG B;  4ABN A;  3TJP A;  4N3B A;  4DPR A;  1MVX A;  1HXI A;  3UT7 A;  3ASG A;  2QY7 A;  3JQ1 A;  3NZS A;  5ENN A;  3ZEF A;  4A3V A;  4I9C A;  3TAX A;  2BF0 X;  3M5A A;  2Y4T A;  4ACK A;  5TTF A;  3F9X A;  3DPD A;  4UWK A;  1HS6 A;  4GA1 A;  4ANW A;  2V5F A;  3E4B A;  4U07 A;  2IF4 A;  5BT1 A;  4I51 A;  2C0L A;  4BT9 A;  1IQR A;  4DI3 A;  4U0S A;  4AXH A;  4WNG A;  5JJ7 A;  2JLB A;  3LXU X;  3Q4A B;  1P5Q A;  4FAD A;  1U3C A;  4HFG A;  4NQ0 A;  3S7D A;  3FTU A;  2JV0 A;  4HOQ A;  4KVM A;  3OXG A;  3QB2 A;  1EDU A;  3VUZ A;  4NVQ A;  3CBO A;  4FA6 A;  2HO1 A;  3ZYK A;  1E8W A;  3B13 A;  1OUV A;  4MKT A;  5DIZ A;  3SI5 A;  3MO0 A;  3Q5M A;  2R5S A;  2KCL A;  4C0M A;  2WQ6 A;  3CVP A;  2VYI A;  3RO3 A;  3RU0 A;  4YNM A;  1FVH A;  5LSX A;  2GGF A;  2WXF A;  4AEZ C;  3HVE A;  3VTX A;  4KBQ A;  3B7S A;  5CCL A;  2CG3 A;  3APC A;  2XRZ A;  1HFA A;  5JHB A;  1MUF A;  1MVH A;  5KJM A;  3ZHE B;  2J49 A;  3LS8 A;  4GB9 A;  5JHN A;  3PUJ A;  1H0A A;  3UPV A;  3U3W A;  4FU3 A;  1MQS A;  2RD0 A;  1UJK A;  3PUK A;  4A1G A;  4RG6 A;  2WMO A;  3D9K A;  2OV8 A;  5FQ4 A;  4AU7 A;  3EHN A;  3FTV A;  4GZ3 A;  2EQX A;  4G2V A;  4WAF A;  3DAL A;  2I1K A;  3AS5 A;  1E8Y A;  5FJY A;  4L2Y A;  2WB2 A;  5F5E A;  4F1S A;  1O9S A;  2YHE A;  4I6G A;  2UWJ G;  3APF A;  3EIJ A;  5LFA A;  4XI9 A;  5EX0 A;  1X5B A;  1ELW A;  4B89 A;  2PM6 A;  4DI4 A;  5JIY A;  1WAO 1;  2AWI A;  2KCV A;  2KC7 A;  3RK6 A;  4D10 C;  4QEP A;  4E47 A;  2MOW A;  4G23 A;  4GZ5 A;  3IKO B;  2WXH A;  5E76 A;  3S8P A;  2YHC A;  3FTZ A;  3TXN A;  1MHQ A;  1QNF A;  4I1O B;  4UI9 J;  2JEK A;  3IHV A;  3TXM A;  4CCA A;  4ANX A;  1E8X A;  2E2E A;  5G05 J;  4DJA A;  2FI7 A;  1NA3 A;  4XZ4 A;  2XPZ A;  5CHE E;  1L5J A;  3Q49 B;  3ESK A;  4B8A A;  4QFV A;  1ZU2 A;  3CHP A;  3BEE A;  2WXP A;  3FUK A;  1NA0 A;  3LDZ A;  4HXI A;  2IJG X;  3LY8 A;  5C1D A;  5G04 C;  3ZXS A;  4RSY A;  3RAY A;  4G25 A;  4AY6 A;  3AU4 A;  3HVE B;  4I6E A;  1ELK A;  4APO A;  5G2N A;  4GYW A;  5FQ8 A;  3BG0 B;  3QNK A;  3BO5 A;  5BUZ A;  3HNA A;  4N2Q A;  3QJZ A;  4XIF A;  5M72 A;  4H12 A;  4YVQ C;  4LCT A;  5FZR A;  4AJW A;  5G55 A;  3TGO A;  1N6A A;  1GW6 A;  1XNF A;  4J8S A;  5EDS A;  4UQZ A;  2X6K A;  4C0E A;  4I1M A;  1WY6 A;  2XEV A;  2XGS A;  4JHK A;  5JJT A;  3KMT A;  3R7R A;  4L23 A;  4UQY A;  4F3V A;  3G2U A;  2UY1 B;  4J8E A;  1E7U A;  3FH8 A;  4G26 A;  4AM9 A;  3S7F A;  4G11 A;  1UG3 A;  3FUM A;  1Y6I A;  3HYM B;  4HOS A;  2PQN A;  2IQC A;  3PE3 A;  5BV1 A;  2XCB A;  1KLX A;  4XI0 A;  2NSZ A;  1N52 A;  1H6K A;  3L16 A;  5KJL A;  3M56 A;  4L7T A;  3FPD A;  4JDS A;  3D9P A;  3SZ7 A;  3K9I A;  5FTP A;  4F7A A;  4N39 A;  3F9Y A;  5AIJ A;  5BPP A;  2IFU A;  1VDY A;  3FTY A;  4IUL A;  5JIN A;  2HM8 A;  4HVB A;  3L13 A;  3MV3 B;  5G04 J;  1HE8 A;  2YIN A;  3PNT B;  3SBS A;  5AEN A;  3G2W A;  1PEG A;  4LEU A;  3M55 A;  3GZ2 A;  4GA2 A;  1TJF A;  3D9O A;  3L08 A;  4UWH A;  4I1A A;  2CHX A;  2BUG A;  2VJ8 A;  3PNL B;  5C2Y A;  3UQ3 A;  3D9M A;  5JHA A;  4GPK A;  3ASH A;  2RFI A;  2FUL A;  3ZN3 A;  3MYV A;  4AOF A;  2GW1 A;  3CK9 A;  1LF8 A;  1EYH A;  4B94 A;  1SQM A;  3QAQ A;  2IGQ A;  5KJN A;  3PVL A;  4A1S A;  4KT6 B;  4TRQ A;  4AP2 A;  2VTB A;  2IOS A;  3EIQ C;  4MRU A;  3QK0 A;  4BSX A;  3KMJ A;  4BUP A;  2WXI A;  4NAC A;  4CDR A;  3CBM A;  3AS8 A;  2WXL A;  2HYZ A;  3TG5 A;  3U64 A;  4WUY A;  3CVV A;  4L1B A;  2KZT A;  1IQU A;  2AXU A;  3GZ1 A;  2XGM A;  1JPL A;  3LY9 A;  4GU5 A;  4N3C A;  4E85 A;  1INZ A;  5JJ0 A;  5F6K C;  4I9E A;  4EBA G;  3Q15 A;  5LCW J;  4HS2 A;  5LP0 A;  4WNE A;  2OOE A;  2DCP A;  4ILG A;  2KZT B;  4W9R A;  3M57 A;  4RZ0 A;  3MV2 B;  3RQ4 A;  2X6H A;  4FJZ A;  3QWW A;  2VSO E;  3CSF A;  3QOU A;  2AW6 A;  4U0U A;  3CKC A;  4O30 A;  1QQE A;  2NC9 A;  3ENE A;  4RVB A;  5T8I A;  4LER A;  5FWQ A;  4P29 A;  3U4T A;  2R3A A;  3ONK A;  3MKQ A;  2J9Q A;  4BTB A;  2NXP A;  5ANL A;  3JQ0 A;  2I6H A;  3SHF A;  4G1T A;  4GYO A;  3CHQ A;  3MZL B;  3MJW A;  1HH8 A;  3LCA A;  3TG4 A;  4U8H A;  4CEM A;  3FTW A;  4CT4 A;  1A17 A;  2OND A;  3FUE A;  1FCH A;  3SBT B;  3SFZ A;  5A6C A;  3M59 A;  4ILH B;  4IJ8 A;  4JL0 A;  4KMO A;  4FHJ A;  3OXL A;  3FUI A;  1HG2 A;  3IV0 A;  3FU3 A;  4V3I A;  3L6A A;  2WXG A;  3L17 A;  3CVL A;  4J7I A;  2XRY A;  4MS6 A;  2WQ7 A;  1XQH A;  3ZRH A;  3I3N A;  2RG8 A;  4JLG A;  5T3R A;  3LYA A;  2C0M A;  3GZS A;  4WNF A;  4EZJ A;  5TEG A;  4XKB A;  2LAH A;  3QWP A;  4KXK B;  1JWG A;  3VV0 A;  2YNQ A;  2MHK A;  2CHW A;  1HU3 A;  2KM4 A;  1TJC A;  4I2Z A;  2WM9 A;  3LPZ A;  4GZD A;  3EDT B;  4IRU A;  3UUX A;  2L9B A;  2IOL A;  4QEO A;  4GA0 A;  4J0U A;  3ASF A;  1Z3X A;  2YQ8 A;  2PL2 A;  4IJD A;  5LX8 A;  3I5P A;  4XE0 A;  4UI9 K;  4N2S A;  5T5G A;  3D9I A;  3VLD A;  3B7U X;  3NF1 A;  3VTY A;  2C2L A;  4JEU A;  3APD A;  3PEV B;  3G2S A;  3R9A B;  4UWL A;  3MA5 A;  1UN9 A;  3MGB A;  2LO6 A;  5LCW C;  5D0O D;  1UN8 A;  1MT6 A;  3OPE A;  2VGX B;  4I6J A;  3KAE A;  4YPE A;  3TL5 A;  4KYO B;  3HHM A;  3CVY A;  3M53 A;  3FP3 A;  2E0I A;  3M54 A;  1H2V C;  3MKR A;  3QKY A;  1HO8 A;  3KS2 A;  4Y6W A;  4ANV A;  4K03 A;  3RJW A;  3FUD A;  1ZBP A;  4UI9 C;  5LSZ A;  1HG5 A;  2Q7F A;  5J90 A;  4PS8 A;  3SF4 A;  1TEZ A;  4EQF A;  4JXT A;  4JZY A;  4EZL A;  4I17 A;  1KT0 A;  3FFL A;  3FUJ A;  1BPO A;  1JUQ A;  4FC8 A;  4JVS A;  5EX3 A;  3R7Q A;  3CHM A;  4BTA A;  3CR3 A;  1SZA A;  3MO5 A;  3FEX A;  1W3B A;  2WXN A;  3BG1 B;  3DBS A;  4OVU A;  3ZYM A;  2LNI A;  4I2W A;  3ULQ A;  3U66 A;  3EP0 A;  4YPU A;  4I43 A;  3CQC B;  2GRL A;  3FUN A;  2WPV A;  4GAA A;  3LY7 A;  3URZ A;  5HQ8 A;  2ION A;  3KMA A;  3FUF A;  4MLP A;  2V8S E;  2ZU6 B;  3O4Z A;  5CCM A;  3CST A;  1KT1 A;  3L54 A;  2FF4 A;  5HI7 A;  2PZI A;  3LKU A;  3QWV A;  4L2L A;  3ZHE A;  4DK5 A;  4BX9 A;  1DNP A;  1E8Z A;  2X3M A;  1S0P A;  2WMN A;  3CHO A;  3FUH A;  1H2T C;  1UJJ A;  2VGY A;  4H7X A;  1ML9 A;  3LEW A;  3LVR E;  3MO2 A;  2VTB B;  2A5U A;  5J08 A;  5AYF A;  3FTS A;  4AIF A;  2L0T B;  3C98 A;  3RKV A;  3PH0 C;  5TH7 A;  5FQ7 A;  3K5K A;  1H3I A;  4Q96 A;  3D9J A;  4FJY A;  3JCK C;  2XHE A;  3I4G A;  3PE4 A;  2V0P A;  2AXZ A;  2VSX E;  2AXV A;  2LSV A;  4JA9 A;  4DLO A;  1OWO A;  3CHS A;  2WXJ A;  5BV0 A;  5EG2 A;  1IHG A;  4FLB A;  4ILI A;  4KZC A;  3ZVV A;  2Y4U A;  3CIA A;  4PUC A;  3EHM A;  2W5Y A;  3SW9 A;  2BQZ A;  4NJ5 A;  2X6I A;  5BNW A;  3QAR A;  4CGW A;  3D3M A;  3ML9 A;  1E96 B;  1YA0 A;  3OXF A;  1HX8 A;  4IYP A;  4EZK A;  3UX4 A;  4BY6 A;  4JA7 A;  5E75 A;  3FHE A;  4C9B B;  3ZGQ A;  3ZYQ A;  1NZN A;  2UY1 A;  4IN3 B;  3VLE A;  3RO2 A;  1Z3Y A;  4NRH B;  4PH4 B;  4BFR A;  3CK7 A;  3MCX A;  1DVP A;  2WVI A;  2VQ2 A;  5A7D B;  4E6H A;  3F9Z A;  4KVO A;  3P2B A;  4J8O A;  1H19 A;  2CHZ A;  3OTN A;  5T0K A;  4J7F A;  3RJV A;  4J8F A;  4U0Z A;  4XKC A;  5FQ6 A;  4EBA A;  4NUR A;  3GW4 A;  5FT9 A;  2GRM A;  1N6C A;  3EJN A;  3FU0 A;  5JJ6 A;  3CVN A;  4UQX A;  3ML8 A;  3AU5 A;  2I9C A;  3QC1 A;  1E7V A;  3G2T A;  3S2A A;  4C1Q A;  2WXO A;  1EF1 C;  4ACL A;  2O8J A;  5F59 A;  2PQR A;  1ELR A;  4CT0 A;  4PDX A;  3IHX A;  3UT8 A;  4DLQ A;  3PEU B;  2CG2 A;  3U9W A;  2DBA A;  3Q47 B;  1E90 A;  5DBK A;  3ZFW A;  1ZKK A;  3OS5 A;  1OWP A;  3ZIM A;  4Q69 A;  1XGW A;  4HLE A;  4FLH A;  4GZC A;  5EKQ D;  4JHR A;  1JWF A;  4WWO A;  4TUU A;  4BX8 A;  4CRW A;  3HIZ A;  3RRU A;  4U04 A;  4U63 A;  4ANU A;  3MEK A;  3MX3 A;  4GMJ A;  4EEC A;  2F69 A;  3T5V A;  3D9N A;  2W5Z A;  3CK8 A;  3PRZ A;  2VSY A;  4JC8 A;  2KCK A;  4UWF A;  3OOI A;  2FBN A;  4URK A;  1SZ9 A;  4CGV A;  3F9W A;  2CFU A;  5G05 C;  1B89 A;  2J08 A;  1PY1 A;  2L6J A;  4UWG A;  3B7T A;  3ZW3 A;  5ARF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...