4O6FA

Structural basis of estrogen receptor alpha methylation mediated by histone methyltransferase smyd2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
430
structure length
430
Chain Sequence
AEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Insights into Estrogen Receptor alpha Methylation by Histone Methyltransferase SMYD2, a Cellular Event Implicated in Estrogen Signaling Regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 145
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4o6fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4o6fA01
4NJ5A 1YA0A 5EG2A 3FPDA 2VGYA 5CPRB 5C1DA 2L6JA 4GYOA 5JJTA 4GZ5A 2J9QA 5KJNA 4MI0A 5G04C 5G04J 4H7YA 3M53A 3TG5A 1HZ4A 2FBNA 4G25A 1OUVA 4ME2A 3CEQA 3U3WA 4UQZA 4GCNA 3TAXA 3CK7A 4YPAA 3Q47B 4HOUA 2JV0A 5F6LA 2XCBA 3RO2A 5ARGA 3M56A 4U0SA 1ZU2A 4J83A 3MKRA 3HYMB 5F59A 3F9WA 2UWJG 5TH7A 3S7FA 3BEEA 4GA2A 3PDNA 3OPEA 2C2LA 5LSZA 4RG6A 2ONDA 3CVLA 3GZ1A 3UUXA 4I51A 3KS2A 4UQYA 2WQHA 3ZHEA 3OXLA 4GYWA 5BNWA 3EDTB 4N2QA 5JINA 3FP3A 2LSUA 4JHRA 4C1QA 3CVNA 3KAEA 2LSVA 4F3VA 3MO0A 4KYOB 2KATA 5CCLA 3SF4A 2FEZA 3LPZA 3N71A 1O9SA 2HYZA 2O8JA 3OS5A 3CK9A 2KCKA 5T0KA 2Q7FA 3RU0A 2VGXA 4N2SA 3RAYA 3CBOA 3ZPJA 2KC7A 3RKVA 2C0LA 4KBQA 3QWWA 4BWRA 3PE3A 3F9XA 5JJ7A 4YNMA 2G46A 3IHXA 4YNDA 3MO5A 1MUFA 4G24A 3QWVA 5FZQA 4Y6WA 3AS5A 5BW8C 2JLBA 4I2ZA 3Q15A 3S7DA 1B89A 4HORA 1IYGA 2UY1A 2AVPA 4IJ8A 4UI9C 3KD7A 4UI9J 3CV0A 3UQ3A 5ARFA 4LEUA 1MVXA 2PQNA 4H12A 4AM9A 4A1SA 5CHEE 3URZA 5G05C 2YHCA 4BT8A 2XEVA 5F5EA 4YVQC 3ULQA 3U4TA 2I6HA 4WNEA 2VGXB 4GYYA 3SZ7A 3M54A 5EX0A 1MT6A 2NC9A 1XQHA 3WXXA 2QPWA 4J8EA 5LCWC 5LCWJ 3QDNA 5JIYA 3S7JA 4I17A 4AIFA 2BUGA 3M59A 4GPKA 3QKYA 2UY1B 4HOQA 3IEGA 3VTXA 4J8FA 4WUYA 1E96B 3RJVA 1KT0A 1NA0A 4B94A 4G1TA 3SWCA 4Y6CA 4NVQA 3MV3B 3ASGA 4RG9A 5FTPA 4J8OA 3QWPA 2MHKA 4G23A 3O48A 3CBMA 5EX3A 2OOEA 3TGOA 5T0MA 5JJ6A 4UI9K 4JA7A 5F6KC 3AS8A 3UPVA 1ELRA 4JLGA 5TTFA 1ZKKA 2PZIA 2IFUA 5HQ8A 3S7BA 3RQ4A 3ZFWA 4J7FA 1WM5A 1ELWA 4CGVA 1HXIA 1P5QA 3KMAA 3CK8A 5AYWD 3TG4A 3LYAA 4O30A 3RO3A 2LNIA 4WNFA 2W5ZA 4GA0A 3NF1A 1FCHA 3K5KA 3SW9A 1N6CA 5D0OD 4GZ6A 1HH8A 3E4BA 4U0ZA 3VUZA 4JL0A 3EP0A 1WAO1 1Y8MA 3ASFA 2F69A 3F9ZA 3S8PA 4XI0A 3KMTA 5FT9A 3M55A 1ML9A 4IJDA 4JDSA 1PC2A 2HR2A 4GA1A 4GZ3A 2XGSA 4J8DA 3VTYA 2E2EA 3Q5MA 2XCCA 3ZGQA 3CVQA 3MA5A 1KLXA 3Q49B 5AYFA 1NA3A 3CKBA 2R5SA 3HNAA 2W5YA 5A7DB 1ZBPA 3KMJA 4CDRA 3OXFA 3FFLA 2WPVA 3MEKA 4FMUA 3GYZA 1A17A 1QZ2A 4J7IA 5LSXA 4BT9A 2KCVA 3Q4AB 3MV2B 4N3CA 3OOIA 2XGMA 4YVOA 4HOTA 4WNGA 4H7XA 4N3AA 4I9EA 2GW1A 3F9YA 2KCLA 4GCOA 3MO2A 4U07A 2VSNA 3R9AB 3M5AA 1KT1A 5KJKA 5M72A 4W9RA 4APOA 4IN3B 4MI5A 3ASHA 4UQXA 4AU7A 5TEGA 4BTAA 1N3JA 4N3BA 2XGOA 5T5GA 5A6CA 4AY6A 3CKCA 4N5CA 5FJYA 2RFIA 3CBPA 3RJWA 3M57A 5FZSA 5JHNA 3LY8A 1MVHA 4BUPA 2P58C 2Y4TA 4JA9A 3AS4A 2FO7A 3ASDA 4HOSA 4G26A 4ABNA 1QQEA 3ZN3A 2XPIA 3BO5A 3CVPA 3RIBA 3LCAA 2YQ8A 4KXKB 3DALA 2PL2A 2PQRA 2FI7A 5KJLA 5HI7A 4LDGA 3LY9A 2IF4A 2FF4A 3GZ2A 2HO1A 3VV0A 1NZNA 4NRHB 3K9IA 4BTBA 4I2WA 4I9CA 5JJ0A 4YPEA 4E47A 4WNDA 4N39A 3ESKA 3GW4A 4G2VA 5KJMA 5DIZA 3LKUA 1H3IA 4CGWA 2V5FA 4XI9A 5FZRA 3FWVA 2VQ2A 4RZ0A 3PE4A 4AY5A 4EQFA 1PEGA 4QENA 4U0UA 3DB5A 3M58A 3QOUA 4XIFA 3ZHEB 5D0QD 5BT1A 4NQ0A 4YNPA 2VSYA 4YPUA 4O6FA 4QEPA 3JYSA 4U04A 2BQZA 1IHGA 5EKQD 5CCMA 4I1AA 1TJCA 1XNFA 2R3AA 2QFCA 1N6AA 2DBAA 2VYIA 3OXGA 5DBKA 5G05J 4J0UA 2C0MA 3LY7A 2Y4UA 4QEOA 4Z4PA 2IGQA 1W3BA
chains in the Genus database with same CATH superfamily
4DI4A 2DIWA 2R02A 5EG2A 3BG1B 2F8XK 5C1DA 3ZEFA 2X38A 1H19A 4UWLA 1UG3A 4A63B 4GZ5A 5G04C 1HE8A 1OWMA 5G04J 4H7YA 4G25A 4ME2A 3CEQA 3NZUA 2X6HA 2QYUA 3FH5A 2KXPC 4FULA 2B0OE 3RO2A 2GRRB 1IXVA 4U0SA 3R7RA 1N0RA 3NAWA 4OVUA 3HYMB 5F59A 3L17A 4DX5D 1EPUA 5TH7A 3S7FA 4CEMA 2FO1E 4AEZC 3PDNA 1DVPA 3FTWA 4K5CA 3FTZA 2H6HA 4RG6A 3CVLA 4L2YA 3UUXA 3ULEG 5AQAA 2VGEA 2WQHA 4GYWA 1H6PA 3D9LA 3EHNA 3JQ1A 4C9BB 3HHMA 4K0RA 5JHBA 4HI9A 3DXMG 5LOZA 4ANWA 1O9SA 3N71A 2HYZA 1A5EA 3UM2A 3C3RA 3G2UA 5BUZA 2VGXA 3DRAA 2Y1LE 4BSXA 2P9IG 3D3MA 5KCMA 3ZPJA 3Q78A 2KC7A 1HS6A 3FUJA 4FJYA 2L6BA 3QWWA 4BWRA 3D9MA 2J4BA 3D9IA 1NFIE 3QWVA 3AS5A 3Q15A 1IYGA 2R2LA 3D9NA 4DUIA 3D9PA 1H2UA 4GZCA 5ARFA 3QAQA 3E34A 4FHKA 3IBEA 2P2CP 4AM9A 2BTDA 3URZA 3NZSA 5G05C 2XEVA 1OCCE 4QFVA 3ULQA 2DCPA 2VGXB 1TNZA 3ENEA 1V54E 1IKND 3SZ7A 1MX4A 5AJLA 4XKCA 3BQOA 4F1SA 2WXFA 1FVHA 3TWQA 3CVWA 3AG3E 4I17A 1EDUA 4AIFA 1EYHA 4A55A 1DCQA 5FINA 3MYVA 1BLXB 4DJAA 1PY1A 5D66A 1NA0A 4ACLA 4B94A 3ML9A 3V30A 4CCAA 1HU3A 3TJPA 3MV3B 3APCA 4DX6D 1N4PA 1D9SA 4J8OA 3CVYA 2B6CA 3DSXA 3RSEG 3CBMA 4I6EA 4OVVA 3OAWA 2LAHA 3TGOA 3QC1A 4C48B 5JJ6A 4ACKA 4JA7A 3ZYQA 4EHMA 3AS8A 1WG0A 3RAUA 2VTBB 2DYSE 1N4QA 5ITZF 3EHMA 3U9WA 2P9UG 4WWNA 1D8EA 1IHBA 1DC2A 3B7TA 1FVFA 3RQ4A 5JHAA 5HKPA 1K8KG 3G2TA 1BI8B 5BV1A 5CMWA 3PS6A 3ZFWA 4K03A 3I3NA 5JA4D 1P5QA 2IO3C 4I6GA 4LG6A 4EZJA 2ZGDA 3TG4A 4TXRA 2MOWA 2LNIA 2GRQB 2W5ZA 3V79K 3UMVA 3NF1A 1S70B 1FCHA 1N0QA 4Q96A 5D0OD 5G2NA 4U0ZA 4TXQA 3EP0A 1WAO1 2F69A 3E30A 3KMTA 4J8YA 2IQCA 1PC2A 2HR2A 3VTYA 3Q5MA 2XCCA 3DSSA 3UT8A 1KLXA 3Q9NC 4FU3A 3SD5A 3Q49B 2WMNA 5A7DB 3TWSA 1ZBPA 3KMJA 1K1BA 3PUKA 4TXPA 4CDRA 2WPVA 4ANVA 3MEKA 3SBSA 4DRXE 2A5EA 3C3QA 5LSXA 3Q4AB 4CT4A 4FLHA 4XE0A 1QYMA 1OCZE 1JWFA 3OOIA 4DK5A 2DZOA 4N3AA 4UWHA 1L5JA 4KZ0A 4U7EB 2EIME 2I2OA 3MO2A 4CDNA 4BX8A 5J08A 4KMOA 1MJ0A 3MCXA 5CECB 3P2BA 2XEEA 3CGHA 4AU7A 5TEGA 2LO6A 4AY6A 3CHOA 5ENSD 4N5CA 1TN8A 4C0EA 4OAUC 4RLYA 1IQRA 3M57A 3RJWA 2CHXA 3PRZA 3PREA 5KNHD 5EYPF 3FH8A 2I1JA 3AS4A 4HOSA 2R05A 4GMRA 1QQEA 3UINC 2XPIA 2EIKE 1UW4B 3G2SA 2F8YA 2P9SG 3FUMA 5ANRA 4LDGA 5HI7A 5EILA 3ABLE 4IYPA 4J8SA 4V3IA 2VJ8A 2AXZA 3VV0A 3ASOE 4BTBA 5JJ0A 1N9AA 4GAAA 2WXNA 3LKUA 4XI9A 2Y69E 3B95A 4RZ0A 1QBQA 4EQFA 2WXPA 3M58A 3FUIA 5D0QD 4NQ0A 3J5QB 1EF1C 3PEVB 4O6FA 4QEPA 3R7QA 2RD0A 4U04A 4U63A 2J49A 2H6IA 2MYOA 5BXOA 4MS6A 1XNFA 2QFCA 4U8HA 5DBKA 3HVEA 3LY7A 4B8CB 3CSFA 3ISMC 3FPDA 2VGYA 3QB2A 5CPRB 3NBNB 2L6JA 4GYOA 3Q7FA 1MHQA 3W9GA 5KJNA 4ZFHA 1V55E 3TG5A 1JCQA 3PUJA 5CRUA 3U3WA 2V4LA 4EBAA 4LERA 4HOUA 1BU9A 5F6LA 1RZ4A 4LNUD 2XRYA 1AP7A 2RKKA 1RW2A 3FTXA 3EHQA 3TWTA 4EZKA 3LEWA 2BF0X 2A5UA 4GA2A 2C2LA 3SGHA 2AWIA 2IOSA 3L22A 3PZ1A 4UQYA 3PNTB 3HVEB 2WQ6A 3ZHEA 3HXEA 5BNWA 3EDTB 4N2QA 2QZAA 3FP3A 2ETBA 1E7VA 2ZU6B 4F3VA 3MO0A 4GTVA 1OWOA 2HM8A 1UJKA 2HE0A 4KVOA 3OS5A 2NXPA 3CK9A 3J5PA 4E85A 2Q7FA 5T4YA 3CHSA 4I43A 4N2SA 3CBOA 4A3VA 3RKVA 4D10C 2XPZA 3EIJA 3UKUG 3F9XA 3ESLA 3FULA 4G24A 3PZ2A 5CRVA 5FZQA 2L0TB 4I2ZA 1FPPA 3PH0C 3PEUB 2AVPA 4IJ8A 2WMOA 2Y3AA 2ETAA 1PAQA 2R03A 1MQSA 4UUCA 2KZTA 3D9OA 5AJDA 2LXMA 4UWFA 3LS8A 5CHEE 5F5EA 3PZDA 4HS2A 4WNEA 3LDZA 4BY6A 4GYYA 1BPOA 1IQUA 3UT4A 2NC9A 1XQHA 3WXXA 4JW1A 3FU0A 3JUEA 4UWGA 2OVFA 3CVVA 4U8VD 3QDNA 2ZISA 4AV7A 4ATZD 3QKYA 3UX4A 3IEGA 3RRMB 3KSLA 4G1TA 3SWCA 5BV0A 1SA5A 2P9NG 4Y6CA 2KZTB 3LJNA 3RRNB 5CBNA 3ASGA 5FTPA 1MX6A 5ENOD 3EU5A 4BSZB 4YDYA 2ZXWE 2I9CA 2H6FA 4UI9K 2X6KA 2EQXA 4XZ4A 3V2OA 3JXJA 1Z3XA 1ELRA 5TTFA 1HF8A 4QQIA 5FQ4A 1FT1A 4HXIA 5J90A 2CG3A 3NOGD 3IHVA 1HFAA 1NI1A 4ANUA 5ANLA 4XKBA 1Y6IA 1OT8A 1HXIA 4CGVA 4JEHA 4PDXA 3CK8A 3NB2A 3RO3A 4RVBA 1K1AA 3KEAA 4WNFA 4GA0A 4LUNU 4HLLA 5BPPA 3K5KA 4I6JA 3SFYA 1KZPA 1YMPA 4PH4B 4L1BA 4JL0A 3S2AA 3F9ZA 3S8PA 2RFAA 3HXDA 4XI0A 4NIKA 3M55A 1ML9A 4JDSA 4GA1A 4GZ3A 2PM7A 2XGSA 3MGBA 4PS7A 2E2EA 3B13A 4ILIA 2OEVA 5B1BE 2R59A 3CVQA 3MA5A 3HIZA 4FP7A 4F7AA 3C98A 1NA3A 2R5SA 1H2TC 2VTBA 3HNAA 2ILRA 4PS3A 3PZ4A 4JXTA 4FMUA 4GTRA 3SO8A 1QZ2A 3I4GA 4BT9A 4GZDA 3CVXA 4GTTA 1DNPA 2BKGA 4FADA 5EIDA 3I5PA 4GPMA 4HOTA 4H7XA 3FUKA 2WVIA 2GW1A 3F9YA 3UTMA 4URKA 4GTSA 4L2LA 3M5AA 1KT1A 5KJKA 3FUFA 4W9RA 3SBTB 4B89A 4G8KA 3G2VA 2CHZA 2P9KG 4IN3B 5CMYA 3V2XA 3EUVA 5KNGA 4BTAA 4N3BA 2XGOA 4IULA 4BESA 4WWOA 2RFIA 3D9JA 1MYOA 5C2YA 2WXOA 5FQ8A 4K5AB 3LY8A 1MVHA 1E8ZA 1TN7A 1TR4A 3ASDA 3ASNE 4J7WA 1MZCA 1TNBA 3ZN3A 4AJWA 3BO5A 1N94A 4KXKB 1KZOA 1MX2A 3LY9A 3FTUA 2IF4A 4HI8A 2HO1A 3CHRA 4LCTA 2X6FA 1NZNA 3DSTA 3UM3A 4I2WA 2GRPB 4L23A 4YPEA 3V31A 4TUUA 3GW4A 4WWPA 4LSZE 5KJMA 1JCSA 5CBOA 2KM4A 1HO8A 3U66A 1JCRA 5FZRA 4NACA 3ZIMA 2VQ2A 1N11A 3EU9A 3PE4A 1HG5A 3AG2E 4U0UA 3DWLG 1S0PA 4Q94A 3AAAC 4XIFA 4K5BA 3CHQA 3ONKA 3FTYA 4YNPA 3ZXPA 3HG0D 5ENTD 2BQZA 1SZAA 5CCMA 1TJCA 2VYIA 3OXGA 4F1PA 2C0MA 4QEOA 2V8SE 2IGQA 1W3BA 3BG0B 4NJ5A 1TNOA 1X81A 4HRMB 2LUHA 1TNUA 3M53A 3SI5A 1HZ4A 1YCSB 4YDEA 4GCNA 1LD8A 1N54A 3SFXA 4YPAA 3Q47B 2VSXE 4RQIA 2JV0A 5B3SE 2XCBA 5ARGA 1E7UA 2QC9A 4CDMA 3MKRA 1ELKA 3F9WA 2AXVA 2WXMA 4FLBA 3BEEA 3CHMA 3FU3A 2XPYA 2OV8A 4PS8A 5LSZA 2AXUA 3WG7E 4JZYA 4OAVB 3C72A 3KSQA 3R9MA 3AG1E 1O1RA 4JHRA 3MZLB 5AQ7A 3CVNA 3DSVA 2WXRA 3KAEA 2WM9A 3CLJA 3L16A 2LSVA 4LRZA 4KYOB 5CCLA 4YDWA 4EBAG 2O8JA 1JUQA 2PM6A 5T0KA 1VDYA 1UOHA 1BI7B 3JUIA 3RAYA 3L08A 4ZHBA 3UM0A 3VLDA 2C0LA 5KBAA 2WXGA 4KBQA 2WXQA 5JJ7A 4YNMA 3P1UA 4Y6WA 5BW8C 2JLBA 3S7DA 1B89A 4HORA 4RSYA 4L7TA 2Y0BG 4KT6B 3QNKA 3DBSA 1E8WA 1TNYA 4R7LA 2IOLA 5HRYA 1MVXA 2PQNA 2NYJA 4H12A 3CIAA 2WXJA 3TWVA 2EIJE 3QJZA 2YHCA 4YVQC 2IY0C 4MRUA 5FQ6A 5AARA 4GTPA 3M54A 5EX0A 1SQMA 2QPWA 4BEPA 5LCWC 3Q9UC 1TJFA 4XEIG 5LCWJ 1UN8A 1ZB1A 5JIYA 1JPLA 2WXHA 4G11A 3M59A 4GPKA 4MLPA 5CEDB 1SA4A 3AG4E 2KBXA 3VTXA 4J8FA 1E96B 3RJVA 2XENA 2WXLA 2IO2C 4M7CA 4HRNA 4NVQA 1INZA 1JWGA 3QWPA 1FT2A 2MHKA 4G23A 3O48A 2CHWA 3IHYA 1OCOE 5T0MA 3T5XA 4CZ2D 3UPVA 3TXMA 4JLGA 3FTVA 1OXJA 1OWLA 2VSOE 3ZW3A 2PZIA 2ZGGA 3QARA 1SVXA 4ILHB 3TWUA 5FIOA 3FHEA 1AWCB 4PUCA 3IV0A 3ZXSA 3ZYLA 3EJNA 3DSWA 2M63A 3LYAA 4O30A 3ABKE 3AU4A 2J08A 3ONLA 5FQ7A 5ENPD 3CSTA 3AJIA 2DWZA 4CYMD 2GRLA 2OVBA 4XX5A 1HH8A 3E4BA 3VUZA 3RK6A 2AJAA 4EECA 3FEYA 3ASFA 4U96D 2V0PA 3TWWA 4I1MA 5IY5E 4HBDA 1N95A 3ZU7B 3SHFA 4GMJA 4J8DA 2WXIA 2IEJA 2XZTG 4NURA 5LP0A 1TYQG 4GTMA 4CT0A 2CFUA 3NQPA 5D2MC 1HX8A 1UN9A 3AU5A 3FFLA 3GYZA 1A17A 4J7IA 2KCVA 3TWXA 2V5QC 2GGFA 4N3CA 2XGMA 1O1TA 1S64A 4YVOA 1BD8A 4WNGA 3UM1A 3UIOC 4JHJA 4U95D 1OWNA 2NSZA 4AP2A 4O60A 4GCOA 4A3TA 4B93B 2VSNA 3APFA 4HQDA 5M72A 1Q2ZA 4APOA 2OEWA 3FUNA 2IONA 4UQXA 3CKCA 5ENNA 4BERA 3CBPA 5FZSA 4WAFA 5AENA 2Y4TA 4Z68A 1O5MA 3L9TA 4DX7D 2FO7A 4G26A 2QYJA 4U8YD 2IU1A 3CVPA 2YQ8A 2H6GA 4FC8A 3BUAA 5KJLA 3D9KA 4B0ZA 4GTOA 3GZ2A 1QNFA 3X2QE 3T5VA 1H0AA 3I4RB 4TUMA 4NRHB 4O1OA 4E6HA 3K9IA 4MKTA 3T9KA 4E47A 3VLFA 4MBGA 4WNDA 4DLOA 2X6JA 2V5FA 1TEZA 1HG2A 5G55A 3CVUA 4HB5A 2BEDA 4AY5A 1UJJA 2X6IA 2YNQA 1PEGA 3KEZA 4QENA 4B8AA 2LAIA 3JCKC 4ANXA 3UKRG 4F53A 5AIJA 2I1KA 4JHKA 1NP7A 3DEPA 3D9HA 2L0IA 3ML8A 3SFZA 4HVBA 3CHPA 4F6RD 4TV3A 4ATGA 5EKQD 4G8LA 4O1PA 5T3RA 2R3AA 3VLEA 1N6AA 2L9BA 3IKOB 5G05J 4J0UA 5AQ9A 3TWRA 1G3NB 2E0IA 1H6KA 1N4RA 4Z4PA 3ZUVB 1YA0A 2XQ0A 3PZ3A 3BU8A 2MRIA 3LVQE 3HXCA 2IJGX 4DX2A 5JJTA 2P9PG 2J9QA 4MI0A 1D8DA 4P29A 4Q69A 2FBNA 1OUVA 1S63A 1KPSB 4UQZA 4GB9A 3TAXA 3CK7A 1Z3YA 3M56A 1WDYA 1ZU2A 4J83A 5EN5D 2WQ7A 2UWJG 1U3CA 3LXUX 3MJWA 3DEOA 3ZKJA 2J09A 3OPEA 2CG2A 2ONDA 3GZ1A 3L6AA 4I51A 3KS2A 1LF8A 5KWDA 3OTNA 3FU6A 3ULYA 3TL5A 3OXLA 4JVSA 5JINA 3F6QA 2LSUA 5BXUA 4C1QA 2XZDG 3MX3A 2YINA 3CR3A 1N52A 3MKQA 4BETA 4YDOA 3PVLA 2KATA 4JEUA 3SF4A 1LD7A 2FEZA 2PNNA 3LPZA 5AQBA 2F0YA 2KCKA 3RU0A 4GMLA 1E8YA 3TXNA 4DPRA 2X3MA 5AN8A 5LFAA 2JEKA 3FUDA 3PE3A 3DSUA 2G46A 3IHXA 4YNDA 3MO5A 3NOCD 1Z6TA 1MUFA 3ABME 2XEHA 2UY1A 3DXKG 3FH7A 4N5QA 4FHJA 4UI9C 3KD7A 4UI9J 2YHEA 3CV0A 3PNLB 2DYRE 1OWPA 1N4SA 3UQ3A 4I1OB 1Z5SC 5B1AE 4LEUA 5E75A 3C3OA 3T8KA 3MKQB 1SW6A 4A1SA 5HS0A 4FJZA 4BT8A 3U4TA 2I6HA 4JB8P 3RRUA 3C5RA 5H7PA 3FU5A 3FY4A 1NL4A 1MT6A 3ZNGA 3EIQC 3T8MA 4J8EA 3B7BA 5LX8A 2GRNB 4GTQA 3S7JA 1OY3D 3HRAA 2BUGA 3FEXA 2UY1B 1OCRE 3Q79A 4HOQA 1XGWA 4WUYA 1GW6A 4HFGA 1KT0A 3ZYKA 2XS1A 4APFA 4X8QA 3CQCB 4JPSA 5EIBE 2DVWA 4RG9A 5EX3A 4DLQA 4EPZA 2XHEA 2OOEA 3UI2A 1E90A 5F6KC 4ILGA 2CFZA 5EDSA 4DX1A 3HXFA 2J8SD 1ZKKA 2V4HC 2IFUA 3LVRE 4LNBA 2AW6A 3LJ3A 5JMND 5HQ8A 3S7BA 2JABA 4IRUA 1E8XA 2J4DA 5CEAA 4J7FA 1WM5A 1ELWA 2QY7A 3ZYMA 3KMAA 3IXEA 5AYWD 3DPDA 4M3OA 2GROB 2XS8A 4HLEA 3B7UX 3SY2A 5A23A 4OYSA 2EINE 3E33A 3FUEA 3SW9A 1H6OA 1N6CA 4GZ6A 3GZSA 4JD2G 5ENQD 4TRQA 4AVXA 1Y8MA 2OCCE 3DPYA 5FT9A 4IJDA 5AAOA 2LXLA 1LTXA 3FTSA 3EHRA 3ZGQA 2XRZA 1X5BA 3JQ0A 5AYFA 4C0MA 2RG8A 3CKBA 2W5YA 4BX9A 3QK0A 2BKKB 3OXFA 1WY6A 4HRLA 1YYHA 3MV2B 4BFRA 2ETCA 3Q75A 4EZLA 4CRWA 4LNGA 3W9FA 3HXBA 4DI3A 4I9EA 2GRMA 3APDA 2R17C 2WB2A 3O4ZA 2KCLA 3U64A 4U07A 2P9LG 3R9AB 3B7SA 4J6IA 4FA6A 3CQGB 4MI5A 3E37A 1U3DA 3ASHA 4GU5A 1N3JA 2F37A 5T5GA 5A6CA 5FJYA 4HNAD 3UIPC 5E76A 1H2VC 5JHNA 1DCEA 4BUPA 3L13A 2P58C 4JA9A 2A4ZA 1O1SA 4ABNA 3RIBA 3LCAA 3FDHA 3DALA 2PL2A 2PQRA 2FI7A 3SQVA 3ZVVA 2EILE 5EYLA 2FF4A 4A1GA 4AXHA 1K3ZD 4KZCA 4L9PA 3Q7AA 1SZ9A 1U2VG 2ZIRA 4I9CA 3UXGA 3L82A 3HDXA 4N39A 3ESKA 3JXIA 5T8IA 4G2VA 5DIZA 5CERB 5ENRD 1H3IA 4CGWA 4KVMA 3FWVA 2DZNA 1TN6A 3DB5A 3SNXA 5FWQA 3QOUA 4JC8A 3ZHEB 5BT1A 3L54A 3Q73A 2FULA 2VSYA 4YPUA 3G2WA 4AOFA 3JYSA 3FUHA 2J07A 1IHGA 2WXKA 4I1AA 4UWKA 3E32A 2DBAA 3B7RL 2RFMA 3UT7A 3ZRHA 2Y4UA
chains in the Genus database with same CATH topology
4DI4A 2DIWA 3BG0B 3CSFA 1YA0A 4NJ5A 2XQ0A 5EG2A 3FPDA 2VGYA 3BG1B 3QB2A 5CPRB 5C1DA 2L6JA 4GYOA 2MRIA 3LVQE 3ZEFA 1MHQA 2IJGX 2X38A 1H19A 4UWLA 1UG3A 5JJTA 4GZ5A 2J9QA 5KJNA 4MI0A 5G04C 1HE8A 1OWMA 5G04J 4H7YA 4P29A 3TG5A 3SI5A 1HZ4A 4Q69A 2FBNA 4G25A 3M53A 1OUVA 3PUJA 4ME2A 3CEQA 3U3WA 4UQZA 4QEOA 2V4LA 4GCNA 3NZUA 4GB9A 2X6HA 3TAXA 3CK7A 1N54A 4EBAA 3FH5A 4FULA 4LERA 4YPAA 3Q47B 2VSXE 4HOUA 2JV0A 5F6LA 2XCBA 3RO2A 5ARGA 1E7UA 1Z3YA 3M56A 4U0SA 3R7RA 2XRYA 1ZU2A 4OVUA 4CDMA 3MKRA 4J83A 1ELKA 3HYMB 5F59A 3F9WA 2WQ7A 2AXVA 2UWJG 1EPUA 2WXMA 1U3CA 3FTXA 3L17A 3LXUX 5TH7A 3S7FA 4FLBA 3MJWA 4EZKA 3LEWA 2BF0X 3BEEA 3CHMA 3FU3A 4CEMA 2J09A 2A5UA 4AEZC 4GA2A 2XPYA 1DVPA 3PDNA 2CG2A 3FTWA 3OPEA 3FTZA 2C2LA 2OV8A 4PS8A 3SGHA 4RG6A 2AWIA 2ONDA 3CVLA 3GZ1A 4L2YA 5LSZA 2AXUA 3L6AA 2IOSA 3UUXA 4I51A 3KS2A 1LF8A 3L22A 4JZYA 4UQYA 3OTNA 3PNTB 2WQHA 3FU6A 3HVEB 2WQ6A 3ZHEA 3TL5A 3OXLA 4GYWA 4JVSA 3EDTB 5BNWA 4N2QA 5JINA 5AIJA 3FP3A 2LSUA 4JHRA 3D9LA 3EHNA 3MZLB 3JQ1A 4C9BB 4C1QA 3CVNA 3HHMA 3MX3A 1E7VA 2YINA 3CR3A 2WXRA 3KAEA 2ZU6B 4K0RA 1N52A 2WM9A 3CLJA 3L16A 3MKQA 5JHBA 2LSVA 4F3VA 3MO0A 3PVLA 4LRZA 1OWOA 4KYOB 2HM8A 2KATA 5LOZA 4JEUA 5CCLA 3SF4A 1UJKA 4ANWA 2FEZA 3LPZA 3N71A 4KVOA 2HYZA 4EBAG 2NXPA 1O9SA 2O8JA 3CK9A 3OS5A 4E85A 2KCKA 1JUQA 2PM6A 5T0KA 1VDYA 2Q7FA 3G2UA 3RU0A 4GMLA 1E8YA 2VGXA 5T4YA 3CHSA 3JUIA 3TXNA 5BUZA 4I43A 4BSXA 4N2SA 3RAYA 3D3MA 3CBOA 3L08A 4A3VA 5KCMA 4DPRA 3VLDA 3ZPJA 2KC7A 1HS6A 3FUJA 2C0LA 2X3MA 3RKVA 2WXGA 4KBQA 5LFAA 4D10C 2XPZA 4FJYA 2JEKA 3QWWA 3EIJA 3FUDA 2WXQA 3PE3A 4BWRA 5JJ7A 4YNMA 3F9XA 3P1UA 2G46A 3IHXA 3D9MA 4YNDA 3ESLA 3MO5A 1Z6TA 3FULA 1MUFA 4G24A 2J4BA 3D9IA 3QWVA 4Y6WA 3AS5A 5FZQA 5BW8C 2JLBA 2L0TB 3Q15A 4I2ZA 3S7DA 1B89A 4HORA 1IYGA 4RSYA 4L7TA 2UY1A 3PH0C 3PEUB 2AVPA 4IJ8A 3FH7A 3D9NA 2WMOA 4FHJA 4KT6B 2Y3AA 3QNKA 3D9PA 4UI9C 3KD7A 4UI9J 1PAQA 2YHEA 3CV0A 1H2UA 3PNLB 1OWPA 3DBSA 3UQ3A 1E8WA 4GZCA 4I1OB 2IOLA 4R7LA 5ARFA 3QAQA 4LEUA 5E75A 4FHKA 1MQSA 3IBEA 1MVXA 2KZTA 2PQNA 3D9OA 5AJDA 4H12A 3MKQB 3CIAA 2WXJA 4UWFA 4AM9A 4A1SA 2BTDA 3LS8A 5CHEE 3URZA 3NZSA 4FJZA 3QJZA 5G05C 2YHCA 4BT8A 2XEVA 5F5EA 4YVQC 4QFVA 3PZDA 3ULQA 3U4TA 4HS2A 4MRUA 2DCPA 2I6HA 3RRUA 4WNEA 3LDZA 4BY6A 3FU5A 5FQ6A 2VGXB 4GYYA 3FY4A 3ENEA 1IQUA 1BPOA 3SZ7A 5EX0A 1MT6A 3M54A 3UT4A 2NC9A 1XQHA 5AJLA 3WXXA 4JW1A 1SQMA 3FU0A 3EIQC 2QPWA 4XKCA 3T8MA 4UWGA 4J8EA 5LCWC 1TJFA 2OVFA 4F1SA 5LCWJ 3CVVA 1UN8A 2WXFA 5LX8A 3QDNA 1FVHA 5JIYA 3CVWA 1JPLA 3S7JA 2WXHA 4G11A 1EDUA 4I17A 4AIFA 1EYHA 4AV7A 4A55A 2BUGA 3M59A 4GPKA 3FEXA 4MLPA 3MYVA 3QKYA 2UY1B 3UX4A 4DJAA 4HOQA 1XGWA 3IEGA 3VTXA 4J8FA 4WUYA 1GW6A 1E96B 4HFGA 3RRMB 3RJVA 1KT0A 1PY1A 3ZYKA 1NA0A 4ACLA 4B94A 4G1TA 3ML9A 3SWCA 2WXLA 4APFA 5BV0A 4Y6CA 4CCAA 2KZTB 4NVQA 3CQCB 3RRNB 1HU3A 4JPSA 3TJPA 3MV3B 3ASGA 4RG9A 1INZA 5FTPA 3APCA 1JWGA 4J8OA 3QWPA 3CVYA 2MHKA 4G23A 3RJWA 3O48A 2CHWA 3IHYA 3CBMA 4I6EA 5EX3A 4DLQA 4EPZA 2XHEA 4OVVA 2OOEA 2LAHA 3OAWA 2I9CA 3TGOA 3QC1A 5T0MA 5JJ6A 4ACKA 4UI9K 4JA7A 2X6KA 2EQXA 1E90A 3ZYQA 4XZ4A 5F6KC 3AS8A 4ILGA 3T5XA 2VTBB 3UPVA 2CFZA 5EDSA 1Z3XA 1ELRA 3TXMA 4JLGA 3FTVA 5TTFA 1OWLA 1HF8A 2VSOE 1ZKKA 5FQ4A 3ZW3A 3EHMA 2PZIA 3U9WA 2IFUA 4WWNA 4HXIA 5J90A 3LVRE 3QARA 4ILHB 3B7TA 1FVFA 2CG3A 2AW6A 3LJ3A 5HQ8A 3S7BA 5JHAA 3RQ4A 3FHEA 3IHVA 3G2TA 4IRUA 5BV1A 1E8XA 5CMWA 4PUCA 1HFAA 3IV0A 4ANUA 3PS6A 3ZFWA 2J4DA 5ANLA 4K03A 1Y6IA 1WM5A 4XKBA 3ZXSA 1ELWA 3I3NA 3ZYLA 4J7FA 2QY7A 3ZYMA 1HXIA 4CGVA 4JEHA 3EJNA 4PDXA 1P5QA 4I6GA 3KMAA 3CK8A 2M63A 5AYWD 4EZJA 3DPDA 3TG4A 3LYAA 4M3OA 4O30A 2MOWA 3RO3A 2LNIA 4RVBA 4WNFA 3AU4A 2W5ZA 4HLEA 4GA0A 4LUNU 2J08A 3UMVA 3NF1A 3B7UX 5BPPA 1FCHA 5A23A 3K5KA 3ONLA 4I6JA 4OYSA 5FQ7A 3CSTA 3FUEA 4Q96A 3SW9A 1N6CA 5D0OD 2GRLA 4GZ6A 2OVBA 3GZSA 4PH4B 1HH8A 3E4BA 4U0ZA 4XX5A 5G2NA 3VUZA 3RK6A 4L1BA 4JL0A 4TRQA 3S2AA 4AVXA 3EP0A 1WAO1 1Y8MA 3FEYA 3ASFA 4EECA 2F69A 3F9ZA 3S8PA 2V0PA 4I1MA 4XI0A 3KMTA 5FT9A 3M55A 1ML9A 4IJDA 4JDSA 2IQCA 3SHFA 1PC2A 2HR2A 4GA1A 2PM7A 4GMJA 2XGSA 3MGBA 4GZ3A 4J8DA 4PS7A 2WXIA 3VTYA 2E2EA 3B13A 3Q5MA 4ILIA 4NURA 2XCCA 5LP0A 3FTSA 2R59A 3ZGQA 3CVQA 3UT8A 3MA5A 4CT0A 2XRZA 3HIZA 1KLXA 2CFUA 4FP7A 4FU3A 3SD5A 1X5BA 3Q49B 3C98A 4F7AA 3JQ0A 2WMNA 3NQPA 5AYFA 1NA3A 4C0MA 2RG8A 3CKBA 2R5SA 1H2TC 2VTBA 2W5YA 5A7DB 4BX9A 3HNAA 1ZBPA 3KMJA 3PUKA 2ILRA 3QK0A 4CDRA 1HX8A 1UN9A 3AU5A 3OXFA 4PS3A 3FFLA 2WPVA 3MEKA 4JXTA 3GYZA 1A17A 3SBSA 1WY6A 4ANVA 1QZ2A 4FMUA 4J7IA 3I4GA 5LSXA 4BT9A 2KCVA 3Q4AB 4CT4A 4FLHA 4GZDA 4XE0A 3CVXA 3MV2B 1JWFA 4BFRA 1DNPA 2GGFA 4N3CA 3OOIA 2XGMA 4DK5A 4EZLA 4FADA 4CRWA 4YVOA 3I5PA 4HOTA 4WNGA 4H7XA 3FUKA 4JHJA 4N3AA 2WVIA 4DI3A 4I9EA 1OWNA 2GRMA 4UWHA 2NSZA 3APDA 1L5JA 2GW1A 3F9YA 2R17C 4AP2A 2WB2A 3O4ZA 4KZ0A 4URKA 2KCLA 3U64A 4GCOA 2I2OA 4L2LA 4A3TA 3MO2A 4CDNA 4BX8A 4U07A 2VSNA 3APFA 3R9AB 1KT1A 5J08A 3M5AA 3B7SA 4KMOA 5KJKA 5M72A 3FUFA 4W9RA 3SBTB 4J6IA 4B89A 3G2VA 2CHZA 4APOA 3MCXA 4IN3B 4FA6A 3CQGB 3FUNA 5CMYA 4MI5A 3P2BA 1U3DA 3CGHA 3ASHA 2IONA 4UQXA 5TEGA 4AU7A 4GU5A 4BTAA 1N3JA 4N3BA 2XGOA 4IULA 5T5GA 2LO6A 5A6CA 3CHOA 4WWOA 4AY6A 3CKCA 4N5CA 5FJYA 2RFIA 3D9JA 4C0EA 5ENNA 3CBPA 5E76A 1IQRA 3M57A 5C2YA 2WXOA 1H2VC 2CHXA 5FQ8A 3PRZA 5FZSA 5JHNA 3LY8A 4WAFA 1MVHA 4BUPA 1E8ZA 2P58C 3L13A 2Y4TA 3PREA 4JA9A 5AENA 3FH8A 2I1JA 2A4ZA 3AS4A 2FO7A 3ASDA 4HOSA 4G26A 4ABNA 1QQEA 3ZN3A 2XPIA 4AJWA 3BO5A 1UW4B 3G2SA 2IU1A 3CVPA 3RIBA 3LCAA 3FDHA 2YQ8A 4KXKB 3FUMA 3DALA 4FC8A 2PL2A 5ANRA 2PQRA 2FI7A 3ZVVA 3D9KA 5HI7A 5KJLA 4LDGA 3LY9A 3FTUA 2IF4A 4B0ZA 4IYPA 4J8SA 2FF4A 4V3IA 4A1GA 3GZ2A 4AXHA 2HO1A 1QNFA 2VJ8A 2AXZA 3CHRA 4LCTA 4KZCA 2X6FA 3T5VA 3VV0A 1NZNA 1H0AA 3I4RB 4NRHB 4E6HA 1SZ9A 3K9IA 4MKTA 4BTBA 4I2WA 4I9CA 5JJ0A 4L23A 4YPEA 3VLFA 4E47A 3HDXA 4GAAA 4TUUA 4WNDA 4N39A 3ESKA 3GW4A 4WWPA 4DLOA 5T8IA 2WXNA 4G2VA 5KJMA 5DIZA 2X6JA 3LKUA 1H3IA 4CGWA 2KM4A 1HO8A 2V5FA 4XI9A 3U66A 1HG2A 1TEZA 5G55A 5FZRA 4NACA 3CVUA 4KVMA 3FWVA 3ZIMA 2VQ2A 4RZ0A 3PE4A 4AY5A 1UJJA 2X6IA 4EQFA 2YNQA 1HG5A 3KEZA 1PEGA 4QENA 4U0UA 4B8AA 2WXPA 2LAIA 3JCKC 1S0PA 4ANXA 4Q94A 3DB5A 3M58A 3SNXA 4F53A 5FWQA 2I1KA 3QOUA 4JC8A 3FUIA 4XIFA 3CHQA 3L54A 5D0QD 4JHKA 1NP7A 3ZHEB 5BT1A 3ONKA 4NQ0A 3FTYA 4YNPA 2FULA 2VSYA 4YPUA 1EF1C 3PEVB 4O6FA 3G2WA 4AOFA 4QEPA 2L0IA 3ML8A 3JYSA 3FUHA 3R7QA 3SFZA 4HVBA 2RD0A 3CHPA 4U04A 2BQZA 4TV3A 4ATGA 2J07A 1IHGA 1SZAA 2WXKA 4U63A 5EKQD 5CCMA 2J49A 4I1AA 4MS6A 1TJCA 4UWKA 1XNFA 5T3RA 3VLEA 2R3AA 2QFCA 1N6AA 2L9BA 2DBAA 3B7RL 3IKOB 2VYIA 3OXGA 4U8HA 5DBKA 5G05J 3UT7A 3ZRHA 4J0UA 3HVEA 2C0MA 3LY7A 4B8CB 2E0IA 2Y4UA 1H6KA 2V8SE 4Z4PA 2IGQA 1W3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ5 A;  1YA0 A;  5EG2 A;  3FPD A;  2VGY A;  5CPR B;  5C1D A;  2L6J A;  4GYO A;  5JJT A;  4GZ5 A;  2J9Q A;  5KJN A;  4MI0 A;  5G04 C;  5G04 J;  4H7Y A;  3M53 A;  3TG5 A;  1HZ4 A;  2FBN A;  4G25 A;  1OUV A;  4ME2 A;  3CEQ A;  3U3W A;  4UQZ A;  4GCN A;  3TAX A;  3CK7 A;  4YPA A;  3Q47 B;  4HOU A;  2JV0 A;  5F6L A;  2XCB A;  3RO2 A;  5ARG A;  3M56 A;  4U0S A;  1ZU2 A;  4J83 A;  3MKR A;  3HYM B;  5F59 A;  3F9W A;  2UWJ G;  5TH7 A;  3S7F A;  3BEE A;  4GA2 A;  3PDN A;  3OPE A;  2C2L A;  5LSZ A;  4RG6 A;  2OND A;  3CVL A;  3GZ1 A;  3UUX A;  4I51 A;  3KS2 A;  4UQY A;  2WQH A;  3ZHE A;  3OXL A;  4GYW A;  5BNW A;  3EDT B;  4N2Q A;  5JIN A;  3FP3 A;  2LSU A;  4JHR A;  4C1Q A;  3CVN A;  3KAE A;  2LSV A;  4F3V A;  3MO0 A;  4KYO B;  2KAT A;  5CCL A;  3SF4 A;  2FEZ A;  3LPZ A;  3N71 A;  1O9S A;  2HYZ A;  2O8J A;  3OS5 A;  3CK9 A;  2KCK A;  5T0K A;  2Q7F A;  3RU0 A;  2VGX A;  4N2S A;  3RAY A;  3CBO A;  3ZPJ A;  2KC7 A;  3RKV A;  2C0L A;  4KBQ A;  3QWW A;  4BWR A;  3PE3 A;  3F9X A;  5JJ7 A;  4YNM A;  2G46 A;  3IHX A;  4YND A;  3MO5 A;  1MUF A;  4G24 A;  3QWV A;  5FZQ A;  4Y6W A;  3AS5 A;  5BW8 C;  2JLB A;  4I2Z A;  3Q15 A;  3S7D A;  1B89 A;  4HOR A;  1IYG A;  2UY1 A;  2AVP A;  4IJ8 A;  4UI9 C;  3KD7 A;  4UI9 J;  3CV0 A;  3UQ3 A;  5ARF A;  4LEU A;  1MVX A;  2PQN A;  4H12 A;  4AM9 A;  4A1S A;  5CHE E;  3URZ A;  5G05 C;  2YHC A;  4BT8 A;  2XEV A;  5F5E A;  4YVQ C;  3ULQ A;  3U4T A;  2I6H A;  4WNE A;  2VGX B;  4GYY A;  3SZ7 A;  3M54 A;  5EX0 A;  1MT6 A;  2NC9 A;  1XQH A;  3WXX A;  2QPW A;  4J8E A;  5LCW C;  5LCW J;  3QDN A;  5JIY A;  3S7J A;  4I17 A;  4AIF A;  2BUG A;  3M59 A;  4GPK A;  3QKY A;  2UY1 B;  4HOQ A;  3IEG A;  3VTX A;  4J8F A;  4WUY A;  1E96 B;  3RJV A;  1KT0 A;  1NA0 A;  4B94 A;  4G1T A;  3SWC A;  4Y6C A;  4NVQ A;  3MV3 B;  3ASG A;  4RG9 A;  5FTP A;  4J8O A;  3QWP A;  2MHK A;  4G23 A;  3O48 A;  3CBM A;  5EX3 A;  2OOE A;  3TGO A;  5T0M A;  5JJ6 A;  4UI9 K;  4JA7 A;  5F6K C;  3AS8 A;  3UPV A;  1ELR A;  4JLG A;  5TTF A;  1ZKK A;  2PZI A;  2IFU A;  5HQ8 A;  3S7B A;  3RQ4 A;  3ZFW A;  4J7F A;  1WM5 A;  1ELW A;  4CGV A;  1HXI A;  1P5Q A;  3KMA A;  3CK8 A;  5AYW D;  3TG4 A;  3LYA A;  4O30 A;  3RO3 A;  2LNI A;  4WNF A;  2W5Z A;  4GA0 A;  3NF1 A;  1FCH A;  3K5K A;  3SW9 A;  1N6C A;  5D0O D;  4GZ6 A;  1HH8 A;  3E4B A;  4U0Z A;  3VUZ A;  4JL0 A;  3EP0 A;  1WAO 1;  1Y8M A;  3ASF A;  2F69 A;  3F9Z A;  3S8P A;  4XI0 A;  3KMT A;  5FT9 A;  3M55 A;  1ML9 A;  4IJD A;  4JDS A;  1PC2 A;  2HR2 A;  4GA1 A;  4GZ3 A;  2XGS A;  4J8D A;  3VTY A;  2E2E A;  3Q5M A;  2XCC A;  3ZGQ A;  3CVQ A;  3MA5 A;  1KLX A;  3Q49 B;  5AYF A;  1NA3 A;  3CKB A;  2R5S A;  3HNA A;  2W5Y A;  5A7D B;  1ZBP A;  3KMJ A;  4CDR A;  3OXF A;  3FFL A;  2WPV A;  3MEK A;  4FMU A;  3GYZ A;  1A17 A;  1QZ2 A;  4J7I A;  5LSX A;  4BT9 A;  2KCV A;  3Q4A B;  3MV2 B;  4N3C A;  3OOI A;  2XGM A;  4YVO A;  4HOT A;  4WNG A;  4H7X A;  4N3A A;  4I9E A;  2GW1 A;  3F9Y A;  2KCL A;  4GCO A;  3MO2 A;  4U07 A;  2VSN A;  3R9A B;  3M5A A;  1KT1 A;  5KJK A;  5M72 A;  4W9R A;  4APO A;  4IN3 B;  4MI5 A;  3ASH A;  4UQX A;  4AU7 A;  5TEG A;  4BTA A;  1N3J A;  4N3B A;  2XGO A;  5T5G A;  5A6C A;  4AY6 A;  3CKC A;  4N5C A;  5FJY A;  2RFI A;  3CBP A;  3RJW A;  3M57 A;  5FZS A;  5JHN A;  3LY8 A;  1MVH A;  4BUP A;  2P58 C;  2Y4T A;  4JA9 A;  3AS4 A;  2FO7 A;  3ASD A;  4HOS A;  4G26 A;  4ABN A;  1QQE A;  3ZN3 A;  2XPI A;  3BO5 A;  3CVP A;  3RIB A;  3LCA A;  2YQ8 A;  4KXK B;  3DAL A;  2PL2 A;  2PQR A;  2FI7 A;  5KJL A;  5HI7 A;  4LDG A;  3LY9 A;  2IF4 A;  2FF4 A;  3GZ2 A;  2HO1 A;  3VV0 A;  1NZN A;  4NRH B;  3K9I A;  4BTB A;  4I2W A;  4I9C A;  5JJ0 A;  4YPE A;  4E47 A;  4WND A;  4N39 A;  3ESK A;  3GW4 A;  4G2V A;  5KJM A;  5DIZ A;  3LKU A;  1H3I A;  4CGW A;  2V5F A;  4XI9 A;  5FZR A;  3FWV A;  2VQ2 A;  4RZ0 A;  3PE4 A;  4AY5 A;  4EQF A;  1PEG A;  4QEN A;  4U0U A;  3DB5 A;  3M58 A;  3QOU A;  4XIF A;  3ZHE B;  5D0Q D;  5BT1 A;  4NQ0 A;  4YNP A;  2VSY A;  4YPU A;  4O6F A;  4QEP A;  3JYS A;  4U04 A;  2BQZ A;  1IHG A;  5EKQ D;  5CCM A;  4I1A A;  1TJC A;  1XNF A;  2R3A A;  2QFC A;  1N6A A;  2DBA A;  2VYI A;  3OXG A;  5DBK A;  5G05 J;  4J0U A;  2C0M A;  3LY7 A;  2Y4U A;  4QEO A;  4Z4P A;  2IGQ A;  1W3B A; 
#chains in the Genus database with same CATH topology
 4DI4 A;  2DIW A;  2R02 A;  5EG2 A;  3BG1 B;  2F8X K;  5C1D A;  3ZEF A;  2X38 A;  1H19 A;  4UWL A;  1UG3 A;  4A63 B;  4GZ5 A;  5G04 C;  1HE8 A;  1OWM A;  5G04 J;  4H7Y A;  4G25 A;  4ME2 A;  3CEQ A;  3NZU A;  2X6H A;  2QYU A;  3FH5 A;  2KXP C;  4FUL A;  2B0O E;  3RO2 A;  2GRR B;  1IXV A;  4U0S A;  3R7R A;  1N0R A;  3NAW A;  4OVU A;  3HYM B;  5F59 A;  3L17 A;  4DX5 D;  1EPU A;  5TH7 A;  3S7F A;  4CEM A;  2FO1 E;  4AEZ C;  3PDN A;  1DVP A;  3FTW A;  4K5C A;  3FTZ A;  2H6H A;  4RG6 A;  3CVL A;  4L2Y A;  3UUX A;  3ULE G;  5AQA A;  2VGE A;  2WQH A;  4GYW A;  1H6P A;  3D9L A;  3EHN A;  3JQ1 A;  4C9B B;  3HHM A;  4K0R A;  5JHB A;  4HI9 A;  3DXM G;  5LOZ A;  4ANW A;  1O9S A;  3N71 A;  2HYZ A;  1A5E A;  3UM2 A;  3C3R A;  3G2U A;  5BUZ A;  2VGX A;  3DRA A;  2Y1L E;  4BSX A;  2P9I G;  3D3M A;  5KCM A;  3ZPJ A;  3Q78 A;  2KC7 A;  1HS6 A;  3FUJ A;  4FJY A;  2L6B A;  3QWW A;  4BWR A;  3D9M A;  2J4B A;  3D9I A;  1NFI E;  3QWV A;  3AS5 A;  3Q15 A;  1IYG A;  2R2L A;  3D9N A;  4DUI A;  3D9P A;  1H2U A;  4GZC A;  5ARF A;  3QAQ A;  3E34 A;  4FHK A;  3IBE A;  2P2C P;  4AM9 A;  2BTD A;  3URZ A;  3NZS A;  5G05 C;  2XEV A;  1OCC E;  4QFV A;  3ULQ A;  2DCP A;  2VGX B;  1TNZ A;  3ENE A;  1V54 E;  1IKN D;  3SZ7 A;  1MX4 A;  5AJL A;  4XKC A;  3BQO A;  4F1S A;  2WXF A;  1FVH A;  3TWQ A;  3CVW A;  3AG3 E;  4I17 A;  1EDU A;  4AIF A;  1EYH A;  4A55 A;  1DCQ A;  5FIN A;  3MYV A;  1BLX B;  4DJA A;  1PY1 A;  5D66 A;  1NA0 A;  4ACL A;  4B94 A;  3ML9 A;  3V30 A;  4CCA A;  1HU3 A;  3TJP A;  3MV3 B;  3APC A;  4DX6 D;  1N4P A;  1D9S A;  4J8O A;  3CVY A;  2B6C A;  3DSX A;  3RSE G;  3CBM A;  4I6E A;  4OVV A;  3OAW A;  2LAH A;  3TGO A;  3QC1 A;  4C48 B;  5JJ6 A;  4ACK A;  4JA7 A;  3ZYQ A;  4EHM A;  3AS8 A;  1WG0 A;  3RAU A;  2VTB B;  2DYS E;  1N4Q A;  5ITZ F;  3EHM A;  3U9W A;  2P9U G;  4WWN A;  1D8E A;  1IHB A;  1DC2 A;  3B7T A;  1FVF A;  3RQ4 A;  5JHA A;  5HKP A;  1K8K G;  3G2T A;  1BI8 B;  5BV1 A;  5CMW A;  3PS6 A;  3ZFW A;  4K03 A;  3I3N A;  5JA4 D;  1P5Q A;  2IO3 C;  4I6G A;  4LG6 A;  4EZJ A;  2ZGD A;  3TG4 A;  4TXR A;  2MOW A;  2LNI A;  2GRQ B;  2W5Z A;  3V79 K;  3UMV A;  3NF1 A;  1S70 B;  1FCH A;  1N0Q A;  4Q96 A;  5D0O D;  5G2N A;  4U0Z A;  4TXQ A;  3EP0 A;  1WAO 1;  2F69 A;  3E30 A;  3KMT A;  4J8Y A;  2IQC A;  1PC2 A;  2HR2 A;  3VTY A;  3Q5M A;  2XCC A;  3DSS A;  3UT8 A;  1KLX A;  3Q9N C;  4FU3 A;  3SD5 A;  3Q49 B;  2WMN A;  5A7D B;  3TWS A;  1ZBP A;  3KMJ A;  1K1B A;  3PUK A;  4TXP A;  4CDR A;  2WPV A;  4ANV A;  3MEK A;  3SBS A;  4DRX E;  2A5E A;  3C3Q A;  5LSX A;  3Q4A B;  4CT4 A;  4FLH A;  4XE0 A;  1QYM A;  1OCZ E;  1JWF A;  3OOI A;  4DK5 A;  2DZO A;  4N3A A;  4UWH A;  1L5J A;  4KZ0 A;  4U7E B;  2EIM E;  2I2O A;  3MO2 A;  4CDN A;  4BX8 A;  5J08 A;  4KMO A;  1MJ0 A;  3MCX A;  5CEC B;  3P2B A;  2XEE A;  3CGH A;  4AU7 A;  5TEG A;  2LO6 A;  4AY6 A;  3CHO A;  5ENS D;  4N5C A;  1TN8 A;  4C0E A;  4OAU C;  4RLY A;  1IQR A;  3M57 A;  3RJW A;  2CHX A;  3PRZ A;  3PRE A;  5KNH D;  5EYP F;  3FH8 A;  2I1J A;  3AS4 A;  4HOS A;  2R05 A;  4GMR A;  1QQE A;  3UIN C;  2XPI A;  2EIK E;  1UW4 B;  3G2S A;  2F8Y A;  2P9S G;  3FUM A;  5ANR A;  4LDG A;  5HI7 A;  5EIL A;  3ABL E;  4IYP A;  4J8S A;  4V3I A;  2VJ8 A;  2AXZ A;  3VV0 A;  3ASO E;  4BTB A;  5JJ0 A;  1N9A A;  4GAA A;  2WXN A;  3LKU A;  4XI9 A;  2Y69 E;  3B95 A;  4RZ0 A;  1QBQ A;  4EQF A;  2WXP A;  3M58 A;  3FUI A;  5D0Q D;  4NQ0 A;  3J5Q B;  1EF1 C;  3PEV B;  4O6F A;  4QEP A;  3R7Q A;  2RD0 A;  4U04 A;  4U63 A;  2J49 A;  2H6I A;  2MYO A;  5BXO A;  4MS6 A;  1XNF A;  2QFC A;  4U8H A;  5DBK A;  3HVE A;  3LY7 A;  4B8C B;  3CSF A;  3ISM C;  3FPD A;  2VGY A;  3QB2 A;  5CPR B;  3NBN B;  2L6J A;  4GYO A;  3Q7F A;  1MHQ A;  3W9G A;  5KJN A;  4ZFH A;  1V55 E;  3TG5 A;  1JCQ A;  3PUJ A;  5CRU A;  3U3W A;  2V4L A;  4EBA A;  4LER A;  4HOU A;  1BU9 A;  5F6L A;  1RZ4 A;  4LNU D;  2XRY A;  1AP7 A;  2RKK A;  1RW2 A;  3FTX A;  3EHQ A;  3TWT A;  4EZK A;  3LEW A;  2BF0 X;  2A5U A;  4GA2 A;  2C2L A;  3SGH A;  2AWI A;  2IOS A;  3L22 A;  3PZ1 A;  4UQY A;  3PNT B;  3HVE B;  2WQ6 A;  3ZHE A;  3HXE A;  5BNW A;  3EDT B;  4N2Q A;  2QZA A;  3FP3 A;  2ETB A;  1E7V A;  2ZU6 B;  4F3V A;  3MO0 A;  4GTV A;  1OWO A;  2HM8 A;  1UJK A;  2HE0 A;  4KVO A;  3OS5 A;  2NXP A;  3CK9 A;  3J5P A;  4E85 A;  2Q7F A;  5T4Y A;  3CHS A;  4I43 A;  4N2S A;  3CBO A;  4A3V A;  3RKV A;  4D10 C;  2XPZ A;  3EIJ A;  3UKU G;  3F9X A;  3ESL A;  3FUL A;  4G24 A;  3PZ2 A;  5CRV A;  5FZQ A;  2L0T B;  4I2Z A;  1FPP A;  3PH0 C;  3PEU B;  2AVP A;  4IJ8 A;  2WMO A;  2Y3A A;  2ETA A;  1PAQ A;  2R03 A;  1MQS A;  4UUC A;  2KZT A;  3D9O A;  5AJD A;  2LXM A;  4UWF A;  3LS8 A;  5CHE E;  5F5E A;  3PZD A;  4HS2 A;  4WNE A;  3LDZ A;  4BY6 A;  4GYY A;  1BPO A;  1IQU A;  3UT4 A;  2NC9 A;  1XQH A;  3WXX A;  4JW1 A;  3FU0 A;  3JUE A;  4UWG A;  2OVF A;  3CVV A;  4U8V D;  3QDN A;  2ZIS A;  4AV7 A;  4ATZ D;  3QKY A;  3UX4 A;  3IEG A;  3RRM B;  3KSL A;  4G1T A;  3SWC A;  5BV0 A;  1SA5 A;  2P9N G;  4Y6C A;  2KZT B;  3LJN A;  3RRN B;  5CBN A;  3ASG A;  5FTP A;  1MX6 A;  5ENO D;  3EU5 A;  4BSZ B;  4YDY A;  2ZXW E;  2I9C A;  2H6F A;  4UI9 K;  2X6K A;  2EQX A;  4XZ4 A;  3V2O A;  3JXJ A;  1Z3X A;  1ELR A;  5TTF A;  1HF8 A;  4QQI A;  5FQ4 A;  1FT1 A;  4HXI A;  5J90 A;  2CG3 A;  3NOG D;  3IHV A;  1HFA A;  1NI1 A;  4ANU A;  5ANL A;  4XKB A;  1Y6I A;  1OT8 A;  1HXI A;  4CGV A;  4JEH A;  4PDX A;  3CK8 A;  3NB2 A;  3RO3 A;  4RVB A;  1K1A A;  3KEA A;  4WNF A;  4GA0 A;  4LUN U;  4HLL A;  5BPP A;  3K5K A;  4I6J A;  3SFY A;  1KZP A;  1YMP A;  4PH4 B;  4L1B A;  4JL0 A;  3S2A A;  3F9Z A;  3S8P A;  2RFA A;  3HXD A;  4XI0 A;  4NIK A;  3M55 A;  1ML9 A;  4JDS A;  4GA1 A;  4GZ3 A;  2PM7 A;  2XGS A;  3MGB A;  4PS7 A;  2E2E A;  3B13 A;  4ILI A;  2OEV A;  5B1B E;  2R59 A;  3CVQ A;  3MA5 A;  3HIZ A;  4FP7 A;  4F7A A;  3C98 A;  1NA3 A;  2R5S A;  1H2T C;  2VTB A;  3HNA A;  2ILR A;  4PS3 A;  3PZ4 A;  4JXT A;  4FMU A;  4GTR A;  3SO8 A;  1QZ2 A;  3I4G A;  4BT9 A;  4GZD A;  3CVX A;  4GTT A;  1DNP A;  2BKG A;  4FAD A;  5EID A;  3I5P A;  4GPM A;  4HOT A;  4H7X A;  3FUK A;  2WVI A;  2GW1 A;  3F9Y A;  3UTM A;  4URK A;  4GTS A;  4L2L A;  3M5A A;  1KT1 A;  5KJK A;  3FUF A;  4W9R A;  3SBT B;  4B89 A;  4G8K A;  3G2V A;  2CHZ A;  2P9K G;  4IN3 B;  5CMY A;  3V2X A;  3EUV A;  5KNG A;  4BTA A;  4N3B A;  2XGO A;  4IUL A;  4BES A;  4WWO A;  2RFI A;  3D9J A;  1MYO A;  5C2Y A;  2WXO A;  5FQ8 A;  4K5A B;  3LY8 A;  1MVH A;  1E8Z A;  1TN7 A;  1TR4 A;  3ASD A;  3ASN E;  4J7W A;  1MZC A;  1TNB A;  3ZN3 A;  4AJW A;  3BO5 A;  1N94 A;  4KXK B;  1KZO A;  1MX2 A;  3LY9 A;  3FTU A;  2IF4 A;  4HI8 A;  2HO1 A;  3CHR A;  4LCT A;  2X6F A;  1NZN A;  3DST A;  3UM3 A;  4I2W A;  2GRP B;  4L23 A;  4YPE A;  3V31 A;  4TUU A;  3GW4 A;  4WWP A;  4LSZ E;  5KJM A;  1JCS A;  5CBO A;  2KM4 A;  1HO8 A;  3U66 A;  1JCR A;  5FZR A;  4NAC A;  3ZIM A;  2VQ2 A;  1N11 A;  3EU9 A;  3PE4 A;  1HG5 A;  3AG2 E;  4U0U A;  3DWL G;  1S0P A;  4Q94 A;  3AAA C;  4XIF A;  4K5B A;  3CHQ A;  3ONK A;  3FTY A;  4YNP A;  3ZXP A;  3HG0 D;  5ENT D;  2BQZ A;  1SZA A;  5CCM A;  1TJC A;  2VYI A;  3OXG A;  4F1P A;  2C0M A;  4QEO A;  2V8S E;  2IGQ A;  1W3B A;  3BG0 B;  4NJ5 A;  1TNO A;  1X81 A;  4HRM B;  2LUH A;  1TNU A;  3M53 A;  3SI5 A;  1HZ4 A;  1YCS B;  4YDE A;  4GCN A;  1LD8 A;  1N54 A;  3SFX A;  4YPA A;  3Q47 B;  2VSX E;  4RQI A;  2JV0 A;  5B3S E;  2XCB A;  5ARG A;  1E7U A;  2QC9 A;  4CDM A;  3MKR A;  1ELK A;  3F9W A;  2AXV A;  2WXM A;  4FLB A;  3BEE A;  3CHM A;  3FU3 A;  2XPY A;  2OV8 A;  4PS8 A;  5LSZ A;  2AXU A;  3WG7 E;  4JZY A;  4OAV B;  3C72 A;  3KSQ A;  3R9M A;  3AG1 E;  1O1R A;  4JHR A;  3MZL B;  5AQ7 A;  3CVN A;  3DSV A;  2WXR A;  3KAE A;  2WM9 A;  3CLJ A;  3L16 A;  2LSV A;  4LRZ A;  4KYO B;  5CCL A;  4YDW A;  4EBA G;  2O8J A;  1JUQ A;  2PM6 A;  5T0K A;  1VDY A;  1UOH A;  1BI7 B;  3JUI A;  3RAY A;  3L08 A;  4ZHB A;  3UM0 A;  3VLD A;  2C0L A;  5KBA A;  2WXG A;  4KBQ A;  2WXQ A;  5JJ7 A;  4YNM A;  3P1U A;  4Y6W A;  5BW8 C;  2JLB A;  3S7D A;  1B89 A;  4HOR A;  4RSY A;  4L7T A;  2Y0B G;  4KT6 B;  3QNK A;  3DBS A;  1E8W A;  1TNY A;  4R7L A;  2IOL A;  5HRY A;  1MVX A;  2PQN A;  2NYJ A;  4H12 A;  3CIA A;  2WXJ A;  3TWV A;  2EIJ E;  3QJZ A;  2YHC A;  4YVQ C;  2IY0 C;  4MRU A;  5FQ6 A;  5AAR A;  4GTP A;  3M54 A;  5EX0 A;  1SQM A;  2QPW A;  4BEP A;  5LCW C;  3Q9U C;  1TJF A;  4XEI G;  5LCW J;  1UN8 A;  1ZB1 A;  5JIY A;  1JPL A;  2WXH A;  4G11 A;  3M59 A;  4GPK A;  4MLP A;  5CED B;  1SA4 A;  3AG4 E;  2KBX A;  3VTX A;  4J8F A;  1E96 B;  3RJV A;  2XEN A;  2WXL A;  2IO2 C;  4M7C A;  4HRN A;  4NVQ A;  1INZ A;  1JWG A;  3QWP A;  1FT2 A;  2MHK A;  4G23 A;  3O48 A;  2CHW A;  3IHY A;  1OCO E;  5T0M A;  3T5X A;  4CZ2 D;  3UPV A;  3TXM A;  4JLG A;  3FTV A;  1OXJ A;  1OWL A;  2VSO E;  3ZW3 A;  2PZI A;  2ZGG A;  3QAR A;  1SVX A;  4ILH B;  3TWU A;  5FIO A;  3FHE A;  1AWC B;  4PUC A;  3IV0 A;  3ZXS A;  3ZYL A;  3EJN A;  3DSW A;  2M63 A;  3LYA A;  4O30 A;  3ABK E;  3AU4 A;  2J08 A;  3ONL A;  5FQ7 A;  5ENP D;  3CST A;  3AJI A;  2DWZ A;  4CYM D;  2GRL A;  2OVB A;  4XX5 A;  1HH8 A;  3E4B A;  3VUZ A;  3RK6 A;  2AJA A;  4EEC A;  3FEY A;  3ASF A;  4U96 D;  2V0P A;  3TWW A;  4I1M A;  5IY5 E;  4HBD A;  1N95 A;  3ZU7 B;  3SHF A;  4GMJ A;  4J8D A;  2WXI A;  2IEJ A;  2XZT G;  4NUR A;  5LP0 A;  1TYQ G;  4GTM A;  4CT0 A;  2CFU A;  3NQP A;  5D2M C;  1HX8 A;  1UN9 A;  3AU5 A;  3FFL A;  3GYZ A;  1A17 A;  4J7I A;  2KCV A;  3TWX A;  2V5Q C;  2GGF A;  4N3C A;  2XGM A;  1O1T A;  1S64 A;  4YVO A;  1BD8 A;  4WNG A;  3UM1 A;  3UIO C;  4JHJ A;  4U95 D;  1OWN A;  2NSZ A;  4AP2 A;  4O60 A;  4GCO A;  4A3T A;  4B93 B;  2VSN A;  3APF A;  4HQD A;  5M72 A;  1Q2Z A;  4APO A;  2OEW A;  3FUN A;  2ION A;  4UQX A;  3CKC A;  5ENN A;  4BER A;  3CBP A;  5FZS A;  4WAF A;  5AEN A;  2Y4T A;  4Z68 A;  1O5M A;  3L9T A;  4DX7 D;  2FO7 A;  4G26 A;  2QYJ A;  4U8Y D;  2IU1 A;  3CVP A;  2YQ8 A;  2H6G A;  4FC8 A;  3BUA A;  5KJL A;  3D9K A;  4B0Z A;  4GTO A;  3GZ2 A;  1QNF A;  3X2Q E;  3T5V A;  1H0A A;  3I4R B;  4TUM A;  4NRH B;  4O1O A;  4E6H A;  3K9I A;  4MKT A;  3T9K A;  4E47 A;  3VLF A;  4MBG A;  4WND A;  4DLO A;  2X6J A;  2V5F A;  1TEZ A;  1HG2 A;  5G55 A;  3CVU A;  4HB5 A;  2BED A;  4AY5 A;  1UJJ A;  2X6I A;  2YNQ A;  1PEG A;  3KEZ A;  4QEN A;  4B8A A;  2LAI A;  3JCK C;  4ANX A;  3UKR G;  4F53 A;  5AIJ A;  2I1K A;  4JHK A;  1NP7 A;  3DEP A;  3D9H A;  2L0I A;  3ML8 A;  3SFZ A;  4HVB A;  3CHP A;  4F6R D;  4TV3 A;  4ATG A;  5EKQ D;  4G8L A;  4O1P A;  5T3R A;  2R3A A;  3VLE A;  1N6A A;  2L9B A;  3IKO B;  5G05 J;  4J0U A;  5AQ9 A;  3TWR A;  1G3N B;  2E0I A;  1H6K A;  1N4R A;  4Z4P A;  3ZUV B;  1YA0 A;  2XQ0 A;  3PZ3 A;  3BU8 A;  2MRI A;  3LVQ E;  3HXC A;  2IJG X;  4DX2 A;  5JJT A;  2P9P G;  2J9Q A;  4MI0 A;  1D8D A;  4P29 A;  4Q69 A;  2FBN A;  1OUV A;  1S63 A;  1KPS B;  4UQZ A;  4GB9 A;  3TAX A;  3CK7 A;  1Z3Y A;  3M56 A;  1WDY A;  1ZU2 A;  4J83 A;  5EN5 D;  2WQ7 A;  2UWJ G;  1U3C A;  3LXU X;  3MJW A;  3DEO A;  3ZKJ A;  2J09 A;  3OPE A;  2CG2 A;  2OND A;  3GZ1 A;  3L6A A;  4I51 A;  3KS2 A;  1LF8 A;  5KWD A;  3OTN A;  3FU6 A;  3ULY A;  3TL5 A;  3OXL A;  4JVS A;  5JIN A;  3F6Q A;  2LSU A;  5BXU A;  4C1Q A;  2XZD G;  3MX3 A;  2YIN A;  3CR3 A;  1N52 A;  3MKQ A;  4BET A;  4YDO A;  3PVL A;  2KAT A;  4JEU A;  3SF4 A;  1LD7 A;  2FEZ A;  2PNN A;  3LPZ A;  5AQB A;  2F0Y A;  2KCK A;  3RU0 A;  4GML A;  1E8Y A;  3TXN A;  4DPR A;  2X3M A;  5AN8 A;  5LFA A;  2JEK A;  3FUD A;  3PE3 A;  3DSU A;  2G46 A;  3IHX A;  4YND A;  3MO5 A;  3NOC D;  1Z6T A;  1MUF A;  3ABM E;  2XEH A;  2UY1 A;  3DXK G;  3FH7 A;  4N5Q A;  4FHJ A;  4UI9 C;  3KD7 A;  4UI9 J;  2YHE A;  3CV0 A;  3PNL B;  2DYR E;  1OWP A;  1N4S A;  3UQ3 A;  4I1O B;  1Z5S C;  5B1A E;  4LEU A;  5E75 A;  3C3O A;  3T8K A;  3MKQ B;  1SW6 A;  4A1S A;  5HS0 A;  4FJZ A;  4BT8 A;  3U4T A;  2I6H A;  4JB8 P;  3RRU A;  3C5R A;  5H7P A;  3FU5 A;  3FY4 A;  1NL4 A;  1MT6 A;  3ZNG A;  3EIQ C;  3T8M A;  4J8E A;  3B7B A;  5LX8 A;  2GRN B;  4GTQ A;  3S7J A;  1OY3 D;  3HRA A;  2BUG A;  3FEX A;  2UY1 B;  1OCR E;  3Q79 A;  4HOQ A;  1XGW A;  4WUY A;  1GW6 A;  4HFG A;  1KT0 A;  3ZYK A;  2XS1 A;  4APF A;  4X8Q A;  3CQC B;  4JPS A;  5EIB E;  2DVW A;  4RG9 A;  5EX3 A;  4DLQ A;  4EPZ A;  2XHE A;  2OOE A;  3UI2 A;  1E90 A;  5F6K C;  4ILG A;  2CFZ A;  5EDS A;  4DX1 A;  3HXF A;  2J8S D;  1ZKK A;  2V4H C;  2IFU A;  3LVR E;  4LNB A;  2AW6 A;  3LJ3 A;  5JMN D;  5HQ8 A;  3S7B A;  2JAB A;  4IRU A;  1E8X A;  2J4D A;  5CEA A;  4J7F A;  1WM5 A;  1ELW A;  2QY7 A;  3ZYM A;  3KMA A;  3IXE A;  5AYW D;  3DPD A;  4M3O A;  2GRO B;  2XS8 A;  4HLE A;  3B7U X;  3SY2 A;  5A23 A;  4OYS A;  2EIN E;  3E33 A;  3FUE A;  3SW9 A;  1H6O A;  1N6C A;  4GZ6 A;  3GZS A;  4JD2 G;  5ENQ D;  4TRQ A;  4AVX A;  1Y8M A;  2OCC E;  3DPY A;  5FT9 A;  4IJD A;  5AAO A;  2LXL A;  1LTX A;  3FTS A;  3EHR A;  3ZGQ A;  2XRZ A;  1X5B A;  3JQ0 A;  5AYF A;  4C0M A;  2RG8 A;  3CKB A;  2W5Y A;  4BX9 A;  3QK0 A;  2BKK B;  3OXF A;  1WY6 A;  4HRL A;  1YYH A;  3MV2 B;  4BFR A;  2ETC A;  3Q75 A;  4EZL A;  4CRW A;  4LNG A;  3W9F A;  3HXB A;  4DI3 A;  4I9E A;  2GRM A;  3APD A;  2R17 C;  2WB2 A;  3O4Z A;  2KCL A;  3U64 A;  4U07 A;  2P9L G;  3R9A B;  3B7S A;  4J6I A;  4FA6 A;  3CQG B;  4MI5 A;  3E37 A;  1U3D A;  3ASH A;  4GU5 A;  1N3J A;  2F37 A;  5T5G A;  5A6C A;  5FJY A;  4HNA D;  3UIP C;  5E76 A;  1H2V C;  5JHN A;  1DCE A;  4BUP A;  3L13 A;  2P58 C;  4JA9 A;  2A4Z A;  1O1S A;  4ABN A;  3RIB A;  3LCA A;  3FDH A;  3DAL A;  2PL2 A;  2PQR A;  2FI7 A;  3SQV A;  3ZVV A;  2EIL E;  5EYL A;  2FF4 A;  4A1G A;  4AXH A;  1K3Z D;  4KZC A;  4L9P A;  3Q7A A;  1SZ9 A;  1U2V G;  2ZIR A;  4I9C A;  3UXG A;  3L82 A;  3HDX A;  4N39 A;  3ESK A;  3JXI A;  5T8I A;  4G2V A;  5DIZ A;  5CER B;  5ENR D;  1H3I A;  4CGW A;  4KVM A;  3FWV A;  2DZN A;  1TN6 A;  3DB5 A;  3SNX A;  5FWQ A;  3QOU A;  4JC8 A;  3ZHE B;  5BT1 A;  3L54 A;  3Q73 A;  2FUL A;  2VSY A;  4YPU A;  3G2W A;  4AOF A;  3JYS A;  3FUH A;  2J07 A;  1IHG A;  2WXK A;  4I1A A;  4UWK A;  3E32 A;  2DBA A;  3B7R L;  2RFM A;  3UT7 A;  3ZRH A;  2Y4U A; 
#chains in the Genus database with same CATH homology
 4DI4 A;  2DIW A;  3BG0 B;  3CSF A;  1YA0 A;  4NJ5 A;  2XQ0 A;  5EG2 A;  3FPD A;  2VGY A;  3BG1 B;  3QB2 A;  5CPR B;  5C1D A;  2L6J A;  4GYO A;  2MRI A;  3LVQ E;  3ZEF A;  1MHQ A;  2IJG X;  2X38 A;  1H19 A;  4UWL A;  1UG3 A;  5JJT A;  4GZ5 A;  2J9Q A;  5KJN A;  4MI0 A;  5G04 C;  1HE8 A;  1OWM A;  5G04 J;  4H7Y A;  4P29 A;  3TG5 A;  3SI5 A;  1HZ4 A;  4Q69 A;  2FBN A;  4G25 A;  3M53 A;  1OUV A;  3PUJ A;  4ME2 A;  3CEQ A;  3U3W A;  4UQZ A;  4QEO A;  2V4L A;  4GCN A;  3NZU A;  4GB9 A;  2X6H A;  3TAX A;  3CK7 A;  1N54 A;  4EBA A;  3FH5 A;  4FUL A;  4LER A;  4YPA A;  3Q47 B;  2VSX E;  4HOU A;  2JV0 A;  5F6L A;  2XCB A;  3RO2 A;  5ARG A;  1E7U A;  1Z3Y A;  3M56 A;  4U0S A;  3R7R A;  2XRY A;  1ZU2 A;  4OVU A;  4CDM A;  3MKR A;  4J83 A;  1ELK A;  3HYM B;  5F59 A;  3F9W A;  2WQ7 A;  2AXV A;  2UWJ G;  1EPU A;  2WXM A;  1U3C A;  3FTX A;  3L17 A;  3LXU X;  5TH7 A;  3S7F A;  4FLB A;  3MJW A;  4EZK A;  3LEW A;  2BF0 X;  3BEE A;  3CHM A;  3FU3 A;  4CEM A;  2J09 A;  2A5U A;  4AEZ C;  4GA2 A;  2XPY A;  1DVP A;  3PDN A;  2CG2 A;  3FTW A;  3OPE A;  3FTZ A;  2C2L A;  2OV8 A;  4PS8 A;  3SGH A;  4RG6 A;  2AWI A;  2OND A;  3CVL A;  3GZ1 A;  4L2Y A;  5LSZ A;  2AXU A;  3L6A A;  2IOS A;  3UUX A;  4I51 A;  3KS2 A;  1LF8 A;  3L22 A;  4JZY A;  4UQY A;  3OTN A;  3PNT B;  2WQH A;  3FU6 A;  3HVE B;  2WQ6 A;  3ZHE A;  3TL5 A;  3OXL A;  4GYW A;  4JVS A;  3EDT B;  5BNW A;  4N2Q A;  5JIN A;  5AIJ A;  3FP3 A;  2LSU A;  4JHR A;  3D9L A;  3EHN A;  3MZL B;  3JQ1 A;  4C9B B;  4C1Q A;  3CVN A;  3HHM A;  3MX3 A;  1E7V A;  2YIN A;  3CR3 A;  2WXR A;  3KAE A;  2ZU6 B;  4K0R A;  1N52 A;  2WM9 A;  3CLJ A;  3L16 A;  3MKQ A;  5JHB A;  2LSV A;  4F3V A;  3MO0 A;  3PVL A;  4LRZ A;  1OWO A;  4KYO B;  2HM8 A;  2KAT A;  5LOZ A;  4JEU A;  5CCL A;  3SF4 A;  1UJK A;  4ANW A;  2FEZ A;  3LPZ A;  3N71 A;  4KVO A;  2HYZ A;  4EBA G;  2NXP A;  1O9S A;  2O8J A;  3CK9 A;  3OS5 A;  4E85 A;  2KCK A;  1JUQ A;  2PM6 A;  5T0K A;  1VDY A;  2Q7F A;  3G2U A;  3RU0 A;  4GML A;  1E8Y A;  2VGX A;  5T4Y A;  3CHS A;  3JUI A;  3TXN A;  5BUZ A;  4I43 A;  4BSX A;  4N2S A;  3RAY A;  3D3M A;  3CBO A;  3L08 A;  4A3V A;  5KCM A;  4DPR A;  3VLD A;  3ZPJ A;  2KC7 A;  1HS6 A;  3FUJ A;  2C0L A;  2X3M A;  3RKV A;  2WXG A;  4KBQ A;  5LFA A;  4D10 C;  2XPZ A;  4FJY A;  2JEK A;  3QWW A;  3EIJ A;  3FUD A;  2WXQ A;  3PE3 A;  4BWR A;  5JJ7 A;  4YNM A;  3F9X A;  3P1U A;  2G46 A;  3IHX A;  3D9M A;  4YND A;  3ESL A;  3MO5 A;  1Z6T A;  3FUL A;  1MUF A;  4G24 A;  2J4B A;  3D9I A;  3QWV A;  4Y6W A;  3AS5 A;  5FZQ A;  5BW8 C;  2JLB A;  2L0T B;  3Q15 A;  4I2Z A;  3S7D A;  1B89 A;  4HOR A;  1IYG A;  4RSY A;  4L7T A;  2UY1 A;  3PH0 C;  3PEU B;  2AVP A;  4IJ8 A;  3FH7 A;  3D9N A;  2WMO A;  4FHJ A;  4KT6 B;  2Y3A A;  3QNK A;  3D9P A;  4UI9 C;  3KD7 A;  4UI9 J;  1PAQ A;  2YHE A;  3CV0 A;  1H2U A;  3PNL B;  1OWP A;  3DBS A;  3UQ3 A;  1E8W A;  4GZC A;  4I1O B;  2IOL A;  4R7L A;  5ARF A;  3QAQ A;  4LEU A;  5E75 A;  4FHK A;  1MQS A;  3IBE A;  1MVX A;  2KZT A;  2PQN A;  3D9O A;  5AJD A;  4H12 A;  3MKQ B;  3CIA A;  2WXJ A;  4UWF A;  4AM9 A;  4A1S A;  2BTD A;  3LS8 A;  5CHE E;  3URZ A;  3NZS A;  4FJZ A;  3QJZ A;  5G05 C;  2YHC A;  4BT8 A;  2XEV A;  5F5E A;  4YVQ C;  4QFV A;  3PZD A;  3ULQ A;  3U4T A;  4HS2 A;  4MRU A;  2DCP A;  2I6H A;  3RRU A;  4WNE A;  3LDZ A;  4BY6 A;  3FU5 A;  5FQ6 A;  2VGX B;  4GYY A;  3FY4 A;  3ENE A;  1IQU A;  1BPO A;  3SZ7 A;  5EX0 A;  1MT6 A;  3M54 A;  3UT4 A;  2NC9 A;  1XQH A;  5AJL A;  3WXX A;  4JW1 A;  1SQM A;  3FU0 A;  3EIQ C;  2QPW A;  4XKC A;  3T8M A;  4UWG A;  4J8E A;  5LCW C;  1TJF A;  2OVF A;  4F1S A;  5LCW J;  3CVV A;  1UN8 A;  2WXF A;  5LX8 A;  3QDN A;  1FVH A;  5JIY A;  3CVW A;  1JPL A;  3S7J A;  2WXH A;  4G11 A;  1EDU A;  4I17 A;  4AIF A;  1EYH A;  4AV7 A;  4A55 A;  2BUG A;  3M59 A;  4GPK A;  3FEX A;  4MLP A;  3MYV A;  3QKY A;  2UY1 B;  3UX4 A;  4DJA A;  4HOQ A;  1XGW A;  3IEG A;  3VTX A;  4J8F A;  4WUY A;  1GW6 A;  1E96 B;  4HFG A;  3RRM B;  3RJV A;  1KT0 A;  1PY1 A;  3ZYK A;  1NA0 A;  4ACL A;  4B94 A;  4G1T A;  3ML9 A;  3SWC A;  2WXL A;  4APF A;  5BV0 A;  4Y6C A;  4CCA A;  2KZT B;  4NVQ A;  3CQC B;  3RRN B;  1HU3 A;  4JPS A;  3TJP A;  3MV3 B;  3ASG A;  4RG9 A;  1INZ A;  5FTP A;  3APC A;  1JWG A;  4J8O A;  3QWP A;  3CVY A;  2MHK A;  4G23 A;  3RJW A;  3O48 A;  2CHW A;  3IHY A;  3CBM A;  4I6E A;  5EX3 A;  4DLQ A;  4EPZ A;  2XHE A;  4OVV A;  2OOE A;  2LAH A;  3OAW A;  2I9C A;  3TGO A;  3QC1 A;  5T0M A;  5JJ6 A;  4ACK A;  4UI9 K;  4JA7 A;  2X6K A;  2EQX A;  1E90 A;  3ZYQ A;  4XZ4 A;  5F6K C;  3AS8 A;  4ILG A;  3T5X A;  2VTB B;  3UPV A;  2CFZ A;  5EDS A;  1Z3X A;  1ELR A;  3TXM A;  4JLG A;  3FTV A;  5TTF A;  1OWL A;  1HF8 A;  2VSO E;  1ZKK A;  5FQ4 A;  3ZW3 A;  3EHM A;  2PZI A;  3U9W A;  2IFU A;  4WWN A;  4HXI A;  5J90 A;  3LVR E;  3QAR A;  4ILH B;  3B7T A;  1FVF A;  2CG3 A;  2AW6 A;  3LJ3 A;  5HQ8 A;  3S7B A;  5JHA A;  3RQ4 A;  3FHE A;  3IHV A;  3G2T A;  4IRU A;  5BV1 A;  1E8X A;  5CMW A;  4PUC A;  1HFA A;  3IV0 A;  4ANU A;  3PS6 A;  3ZFW A;  2J4D A;  5ANL A;  4K03 A;  1Y6I A;  1WM5 A;  4XKB A;  3ZXS A;  1ELW A;  3I3N A;  3ZYL A;  4J7F A;  2QY7 A;  3ZYM A;  1HXI A;  4CGV A;  4JEH A;  3EJN A;  4PDX A;  1P5Q A;  4I6G A;  3KMA A;  3CK8 A;  2M63 A;  5AYW D;  4EZJ A;  3DPD A;  3TG4 A;  3LYA A;  4M3O A;  4O30 A;  2MOW A;  3RO3 A;  2LNI A;  4RVB A;  4WNF A;  3AU4 A;  2W5Z A;  4HLE A;  4GA0 A;  4LUN U;  2J08 A;  3UMV A;  3NF1 A;  3B7U X;  5BPP A;  1FCH A;  5A23 A;  3K5K A;  3ONL A;  4I6J A;  4OYS A;  5FQ7 A;  3CST A;  3FUE A;  4Q96 A;  3SW9 A;  1N6C A;  5D0O D;  2GRL A;  4GZ6 A;  2OVB A;  3GZS A;  4PH4 B;  1HH8 A;  3E4B A;  4U0Z A;  4XX5 A;  5G2N A;  3VUZ A;  3RK6 A;  4L1B A;  4JL0 A;  4TRQ A;  3S2A A;  4AVX A;  3EP0 A;  1WAO 1;  1Y8M A;  3FEY A;  3ASF A;  4EEC A;  2F69 A;  3F9Z A;  3S8P A;  2V0P A;  4I1M A;  4XI0 A;  3KMT A;  5FT9 A;  3M55 A;  1ML9 A;  4IJD A;  4JDS A;  2IQC A;  3SHF A;  1PC2 A;  2HR2 A;  4GA1 A;  2PM7 A;  4GMJ A;  2XGS A;  3MGB A;  4GZ3 A;  4J8D A;  4PS7 A;  2WXI A;  3VTY A;  2E2E A;  3B13 A;  3Q5M A;  4ILI A;  4NUR A;  2XCC A;  5LP0 A;  3FTS A;  2R59 A;  3ZGQ A;  3CVQ A;  3UT8 A;  3MA5 A;  4CT0 A;  2XRZ A;  3HIZ A;  1KLX A;  2CFU A;  4FP7 A;  4FU3 A;  3SD5 A;  1X5B A;  3Q49 B;  3C98 A;  4F7A A;  3JQ0 A;  2WMN A;  3NQP A;  5AYF A;  1NA3 A;  4C0M A;  2RG8 A;  3CKB A;  2R5S A;  1H2T C;  2VTB A;  2W5Y A;  5A7D B;  4BX9 A;  3HNA A;  1ZBP A;  3KMJ A;  3PUK A;  2ILR A;  3QK0 A;  4CDR A;  1HX8 A;  1UN9 A;  3AU5 A;  3OXF A;  4PS3 A;  3FFL A;  2WPV A;  3MEK A;  4JXT A;  3GYZ A;  1A17 A;  3SBS A;  1WY6 A;  4ANV A;  1QZ2 A;  4FMU A;  4J7I A;  3I4G A;  5LSX A;  4BT9 A;  2KCV A;  3Q4A B;  4CT4 A;  4FLH A;  4GZD A;  4XE0 A;  3CVX A;  3MV2 B;  1JWF A;  4BFR A;  1DNP A;  2GGF A;  4N3C A;  3OOI A;  2XGM A;  4DK5 A;  4EZL A;  4FAD A;  4CRW A;  4YVO A;  3I5P A;  4HOT A;  4WNG A;  4H7X A;  3FUK A;  4JHJ A;  4N3A A;  2WVI A;  4DI3 A;  4I9E A;  1OWN A;  2GRM A;  4UWH A;  2NSZ A;  3APD A;  1L5J A;  2GW1 A;  3F9Y A;  2R17 C;  4AP2 A;  2WB2 A;  3O4Z A;  4KZ0 A;  4URK A;  2KCL A;  3U64 A;  4GCO A;  2I2O A;  4L2L A;  4A3T A;  3MO2 A;  4CDN A;  4BX8 A;  4U07 A;  2VSN A;  3APF A;  3R9A B;  1KT1 A;  5J08 A;  3M5A A;  3B7S A;  4KMO A;  5KJK A;  5M72 A;  3FUF A;  4W9R A;  3SBT B;  4J6I A;  4B89 A;  3G2V A;  2CHZ A;  4APO A;  3MCX A;  4IN3 B;  4FA6 A;  3CQG B;  3FUN A;  5CMY A;  4MI5 A;  3P2B A;  1U3D A;  3CGH A;  3ASH A;  2ION A;  4UQX A;  5TEG A;  4AU7 A;  4GU5 A;  4BTA A;  1N3J A;  4N3B A;  2XGO A;  4IUL A;  5T5G A;  2LO6 A;  5A6C A;  3CHO A;  4WWO A;  4AY6 A;  3CKC A;  4N5C A;  5FJY A;  2RFI A;  3D9J A;  4C0E A;  5ENN A;  3CBP A;  5E76 A;  1IQR A;  3M57 A;  5C2Y A;  2WXO A;  1H2V C;  2CHX A;  5FQ8 A;  3PRZ A;  5FZS A;  5JHN A;  3LY8 A;  4WAF A;  1MVH A;  4BUP A;  1E8Z A;  2P58 C;  3L13 A;  2Y4T A;  3PRE A;  4JA9 A;  5AEN A;  3FH8 A;  2I1J A;  2A4Z A;  3AS4 A;  2FO7 A;  3ASD A;  4HOS A;  4G26 A;  4ABN A;  1QQE A;  3ZN3 A;  2XPI A;  4AJW A;  3BO5 A;  1UW4 B;  3G2S A;  2IU1 A;  3CVP A;  3RIB A;  3LCA A;  3FDH A;  2YQ8 A;  4KXK B;  3FUM A;  3DAL A;  4FC8 A;  2PL2 A;  5ANR A;  2PQR A;  2FI7 A;  3ZVV A;  3D9K A;  5HI7 A;  5KJL A;  4LDG A;  3LY9 A;  3FTU A;  2IF4 A;  4B0Z A;  4IYP A;  4J8S A;  2FF4 A;  4V3I A;  4A1G A;  3GZ2 A;  4AXH A;  2HO1 A;  1QNF A;  2VJ8 A;  2AXZ A;  3CHR A;  4LCT A;  4KZC A;  2X6F A;  3T5V A;  3VV0 A;  1NZN A;  1H0A A;  3I4R B;  4NRH B;  4E6H A;  1SZ9 A;  3K9I A;  4MKT A;  4BTB A;  4I2W A;  4I9C A;  5JJ0 A;  4L23 A;  4YPE A;  3VLF A;  4E47 A;  3HDX A;  4GAA A;  4TUU A;  4WND A;  4N39 A;  3ESK A;  3GW4 A;  4WWP A;  4DLO A;  5T8I A;  2WXN A;  4G2V A;  5KJM A;  5DIZ A;  2X6J A;  3LKU A;  1H3I A;  4CGW A;  2KM4 A;  1HO8 A;  2V5F A;  4XI9 A;  3U66 A;  1HG2 A;  1TEZ A;  5G55 A;  5FZR A;  4NAC A;  3CVU A;  4KVM A;  3FWV A;  3ZIM A;  2VQ2 A;  4RZ0 A;  3PE4 A;  4AY5 A;  1UJJ A;  2X6I A;  4EQF A;  2YNQ A;  1HG5 A;  3KEZ A;  1PEG A;  4QEN A;  4U0U A;  4B8A A;  2WXP A;  2LAI A;  3JCK C;  1S0P A;  4ANX A;  4Q94 A;  3DB5 A;  3M58 A;  3SNX A;  4F53 A;  5FWQ A;  2I1K A;  3QOU A;  4JC8 A;  3FUI A;  4XIF A;  3CHQ A;  3L54 A;  5D0Q D;  4JHK A;  1NP7 A;  3ZHE B;  5BT1 A;  3ONK A;  4NQ0 A;  3FTY A;  4YNP A;  2FUL A;  2VSY A;  4YPU A;  1EF1 C;  3PEV B;  4O6F A;  3G2W A;  4AOF A;  4QEP A;  2L0I A;  3ML8 A;  3JYS A;  3FUH A;  3R7Q A;  3SFZ A;  4HVB A;  2RD0 A;  3CHP A;  4U04 A;  2BQZ A;  4TV3 A;  4ATG A;  2J07 A;  1IHG A;  1SZA A;  2WXK A;  4U63 A;  5EKQ D;  5CCM A;  2J49 A;  4I1A A;  4MS6 A;  1TJC A;  4UWK A;  1XNF A;  5T3R A;  3VLE A;  2R3A A;  2QFC A;  1N6A A;  2L9B A;  2DBA A;  3B7R L;  3IKO B;  2VYI A;  3OXG A;  4U8H A;  5DBK A;  5G05 J;  3UT7 A;  3ZRH A;  4J0U A;  3HVE A;  2C0M A;  3LY7 A;  4B8C B;  2E0I A;  2Y4U A;  1H6K A;  2V8S E;  4Z4P A;  2IGQ A;  1W3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...