4O6FA

Structural basis of estrogen receptor alpha methylation mediated by histone methyltransferase smyd2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
430
structure length
430
Chain Sequence
b'AEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Insights into Estrogen Receptor alpha Methylation by Histone Methyltransferase SMYD2, a Cellular Event Implicated in Estrogen Signaling Regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 145
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4o6fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4o6fA01
1W3BA 3RU0A 4HOUA 4Y6CA 2XCCA 4QENA 4O30A 4I9CA 2G46A 3AS4A 3CKCA 4LDGA 2BQZA 5JINA 3GW4A 2YHCA 2VGYA 4BTBA 5KJNA 5D0OD 1QZ2A 4BTAA 3M54A 4GYWA 2PZIA 4KXKB 5HI7A 5DBKA 4RG9A 4CGVA 3S8PA 4XI0A 4WNDA 4BT8A 1MT6A 4G26A 3CEQA 4UQXA 3VTXA 4YNDA 2XCBA 4U0UA 5D0QD 2UWJG 1NA0A 2HO1A 4MI5A 4E47A 5EX0A 1PC2A 4HOQA 5A7DB 5KJLA 1ELRA 4YPUA 3M55A 2E2EA 4CGWA 3M56A 2PL2A 4ABNA 3ZPJA 5A6CA 4GA2A 1TJCA 2XEVA 3RJWA 3ASHA 3JYSA 4ME2A 3FWVA 5LSZA 2L6JA 1KLXA 3K5KA 4U04A 4IJ8A 3M5AA 3NF1A 2FO7A 2XGSA 3CV0A 5AYFA 2DBAA 4J8EA 5FTPA 3CK9A 3AS5A 1O9SA 4J7IA 4G24A 4WNFA 5LCWJ 4RZ0A 1N6CA 1A17A 2KCKA 1WAO1 5EX3A 3MKRA 4GCNA 1N3JA 4Z4PA 4J0UA 3Q4AB 4GA1A 2IF4A 2NC9A 3PE4A 3SWCA 3MV3B 4YPAA 3EP0A 3M58A 3LY7A 3SF4A 3QWPA 4WUYA 3R9AB 3RAYA 3UQ3A 2LSUA 1H3IA 1PEGA 5F6KC 4IJDA 2QFCA 5ARFA 5M72A 4JA9A 3N71A 3U3WA 5TH7A 5TTFA 2KCVA 3WXXA 2J9QA 2FF4A 3ASFA 2I6HA 3K9IA 5FJYA 2RFIA 3M57A 3ASDA 5FZRA 2W5ZA 5BW8C 3RO2A 2LSVA 1NA3A 3HNAA 3GZ2A 3CBMA 3PDNA 2W5YA 3MO5A 3ULQA 2O8JA 4A1SA 3M59A 5KJMA 3FPDA 1MUFA 1N6AA 5DIZA 2KC7A 4U0ZA 4B94A 5F5EA 3LKUA 5CCLA 4N5CA 5JIYA 5LSXA 3RKVA 3AS8A 3UUXA 1ZKKA 3RO3A 4YNMA 5G05C 3OOIA 2WPVA 2IFUA 2FEZA 3O48A 3QKYA 3E4BA 4O6FA 4NJ5A 4BT9A 5T0KA 4UI9C 3CVQA 3RIBA 4G25A 1MVHA 3RJVA 4YVQC 2ONDA 3S7JA 5JHNA 1XNFA 4YPEA 5CCMA 4NQ0A 4JDSA 3M53A 2VGXB 4AY5A 3KS2A 4GZ6A 4F3VA 1IYGA 4IN3B 3DALA 2VSYA 4JA7A 1ZU2A 3BEEA 4RG6A 3TG4A 2HR2A 3F9XA 5F59A 3ESKA 3OPEA 4AU7A 3MEKA 4KBQA 2UY1A 2PQRA 5AYWD 4I2WA 4XI9A 2XGOA 3RQ4A 3ASGA 3Q5MA 3LPZA 5G04C 5BT1A 3TG5A 4BUPA 5JJTA 2C0LA 3UPVA 3TGOA 4N3AA 4UI9J 2F69A 4CDRA 4N2QA 3CK8A 5JJ0A 3HYMB 4I17A 3S7FA 4QEPA 2JV0A 1ML9A 3LY8A 2C0MA 4H12A 3CKBA 2HYZA 3QDNA 4J8OA 5FT9A 2QPWA 4N39A 3SW9A 3OS5A 4UI9K 4J83A 3OXFA 3OXGA 1KT1A 1XQHA 1HZ4A 4BWRA 5EG2A 5TEGA 3QWVA 4G23A 4J8FA 2VSNA 5JJ6A 1OUVA 4JHRA 4YVOA 5T5GA 4LEUA 3CVPA 4APOA 3QWWA 4UQYA 3URZA 4C1QA 4GYOA 2BUGA 4J8DA 2KATA 4J7FA 4I1AA 3FP3A 4YNPA 3IEGA 2P58C 3Q47B 2YQ8A 4AY6A 2FI7A 2GW1A 3BO5A 1ZBPA 3CBPA 4N3BA 4GZ3A 4H7XA 2WQHA 4KYOB 5T0MA 3F9YA 3GZ1A 4AIFA 4HOTA 1WM5A 2C2LA 4G1TA 4WNEA 3KMJA 4G2VA 2UY1B 3OXLA 3VUZA 5FZSA 4I51A 2R5SA 3S7DA 2JLBA 2VQ2A 3LY9A 2XPIA 1HXIA 3ZHEA 4HOSA 2MHKA 3LCAA 4N2SA 4XIFA 3Q49B 2OOEA 3CVNA 2AVPA 3MV2B 4UQZA 5F6LA 2Q7FA 1FCHA 1P5QA 3F9WA 2R3AA 3VV0A 2IGQA 3KD7A 4HORA 3KAEA 3SZ7A 4JLGA 2V5FA 3GYZA 3EDTB 5LCWC 1E96B 1B89A 1IHGA 5FZQA 5CHEE 1HH8A 5G05J 4QEOA 3MO0A 2Y4TA 2KCLA 4AM9A 3ZN3A 4W9RA 5ARGA 4NRHB 1YA0A 4GA0A 4GYYA 4FMUA 3Q15A 1KT0A 3QOUA 4I9EA 4H7YA 3ZFWA 4GCOA 5C1DA 4N3CA 2XGMA 4JL0A 5EKQD 3KMAA 4I2ZA 1Y8MA 2Y4UA 4GZ5A 4WNGA 3CBOA 4NVQA 1NZNA 5KJKA 5CPRB 4GPKA 3LYAA 3KMTA 2LNIA 2PQNA 3S7BA 5BNWA 1MVXA 3DB5A 3U4TA 4U0SA 3CK7A 3ZGQA 3PE3A 5JJ7A 3MA5A 1QQEA 3ZHEB 3IHXA 2VGXA 5G04J 3F9ZA 3TAXA 4U07A 4EQFA 3MO2A 3CVLA 5HQ8A 2VYIA 4MI0A 1ELWA 3VTYA 4Y6WA 3FFLA 2FBNA
chains in the Genus database with same CATH superfamily
1W3BA 4HXIA 3UIPC 4Y6CA 4XZ4A 2OV8A 4JVSA 1O5MA 3AS4A 4CCAA 2IJGX 3L82A 4NIKA 3CVWA 3D9NA 3M54A 1TJFA 4HRLA 2VGEA 3B7TA 4A1GA 3G2WA 4HS2A 1BD8A 2MOWA 2Y1LE 4BSXA 3X2QE 3ZNGA 4XI0A 4BEPA 4WNDA 1H2TC 4BT8A 1MT6A 3VTXA 4YNDA 4RLYA 4WAFA 4L2YA 3F6QA 2P9SG 3CHOA 3G2SA 3MKQB 3M55A 4CGWA 1KZPA 2PNNA 4TXRA 3ISMC 2X6JA 2ZU6B 1TJCA 4EZLA 3CHPA 2DZOA 3BG1B 3HG0D 4ME2A 3Q78A 3RSEG 4U8HA 4DJAA 2JABA 2DBAA 4HLLA 3ABME 4N5QA 3JUEA 4G24A 4E85A 3UM0A 1DVPA 2J49A 3CLJA 1N6CA 3PZ1A 5H7PA 5JMND 2EIJE 1N3JA 4K0RA 1UN9A 4GB9A 4KVOA 2NC9A 3MV3B 5CRUA 3M58A 2XZTG 3QWPA 1O1SA 2NYJA 4J8YA 2ZXWE 2IOSA 4IJDA 2AW6A 3IXEA 1EYHA 4UUCA 1OCZE 3ZYQA 2KCVA 2J9QA 4OVVA 2ETAA 2R59A 4FA6A 2XQ0A 4ILHB 4AOFA 2I6HA 2ETCA 3J5PA 2Y69E 4A3TA 1NA3A 2GGFA 3ULEG 3CBMA 3PDNA 3MO5A 5ITZF 2KXPC 3ULQA 4WWNA 4UWGA 4OAVB 4PS3A 1MUFA 5DIZA 2KC7A 4B94A 2XRZA 5F5EA 2XPYA 4FHKA 4ANVA 3HDXA 4YDWA 4BX9A 1BLXB 3RAUA 3FTXA 3PZ4A 2WQ7A 1HX8A 3OOIA 3ABLE 5CEAA 2FEZA 3AU4A 3D9JA 4ILIA 3PEVB 2EILE 2LXLA 3ZUVB 1MX4A 5CCMA 4QQIA 4DI4A 4JDSA 3M53A 3KS2A 3D3MA 2GROB 1DCEA 3R9MA 2AWIA 3C3QA 3ESKA 1S0PA 5JHAA 3OPEA 1IQUA 2PQRA 1H19A 2RFAA 3Q5MA 3LPZA 4BUPA 5JJTA 3CHMA 4LRZA 4O1PA 3T8KA 5T4YA 5T3RA 1ML9A 3L22A 5B1AE 3HXEA 1U3CA 3TJPA 2HYZA 2Y3AA 4J8OA 2OEVA 2XEHA 4N39A 1JWFA 3SW9A 3QB2A 2P9PG 4FP7A 3OTNA 1KT1A 1XQHA 3SFXA 4O1OA 1E8XA 5AQAA 2VSNA 1KPSB 3FTZA 4UQYA 1AWCB 1HS6A 5LP0A 4U95D 4J8DA 3FUFA 3IEGA 3HHMA 2YQ8A 3C98A 2GW1A 1N52A 3ASOE 2IQCA 4L9PA 5B3SE 3HVEB 3F9YA 3GZ1A 4AIFA 3PNTB 4HI8A 4DRXE 4TV3A 3APDA 3S7DA 2JLBA 2VQ2A 3SFZA 4BERA 3ZHEA 4HOSA 1IXVA 3IBEA 1BU9A 4LNBA 4FHJA 1N9AA 3MX3A 3CR3A 1WY6A 2VSOE 1E8WA 3KD7A 3IHYA 3SY2A 3GYZA 3FH8A 3TWUA 1HH8A 3EHQA 4KZ0A 4ACKA 2Y4TA 4RVBA 3HXFA 3SFYA 3D9HA 1LTXA 4GA0A 2MRIA 4C0EA 1KT0A 3QOUA 3I3NA 4U8VD 1TYQG 1UN8A 2XPZA 1E8YA 4HFGA 4N3CA 1UW4B 3PREA 2OVBA 4I2ZA 2I2OA 5FINA 3AG3E 3B7BA 5KJKA 1TN8A 3CHQA 1H2VC 3DRAA 1N4RA 3EHMA 3LVRE 1MVXA 3DB5A 3FH5A 2LAHA 3MKQA 4RSYA 5ENNA 5JJ7A 4M3OA 3V31A 3MA5A 1QQEA 4FJZA 3QNKA 2CG3A 3E30A 5G04J 4Z68A 3P1UA 1HFAA 3CSTA 4U07A 4EQFA 5IY5E 3CVLA 3JQ1A 1HF8A 3TWTA 2CHZA 4MI0A 3APFA 3WG7E 3ASNE 1OXJA 2MYOA 3VTYA 1YCSB 2LXMA 3BUAA 3HXBA 4Y6WA 3RU0A 3ZKJA 2XCCA 3FTWA 4O30A 4UWLA 4G8LA 5JINA 2YHCA 2VGYA 4BTBA 1OWLA 1V55E 3UTMA 3LXUX 4WWOA 2DYSE 2PZIA 2QY7A 4KXKB 4KZCA 5CBNA 3T5XA 3CHSA 3DSUA 3Q73A 1Y6IA 4G26A 3CEQA 4UQXA 1N4PA 2DVWA 3ABKE 1E7VA 4ATZD 3LJNA 5D0QD 3KSQA 3TWWA 2PM7A 1PC2A 4HOQA 3UT7A 4JC8A 5KJLA 1ELRA 2H6FA 3SI5A 4ABNA 3ZPJA 2ZIRA 1YMPA 4HLEA 5AQ9A 3V79K 3DSSA 1OWPA 3ASHA 5KWDA 1ZB1A 3MGBA 1OWOA 2P9IG 3VLFA 4MBGA 2BKGA 1X81A 2XGSA 4B89A 2QYUA 3O4ZA 3T8MA 5FTPA 3AS5A 1NP7A 1INZA 1LF8A 4JHKA 2WMNA 4GTVA 3SBTB 4RZ0A 2I9CA 2P9KG 2B0OE 4KT6B 1HO8A 1WAO1 3AG1E 2KM4A 3B7RL 5EX3A 1BI8B 4GCNA 2KZTB 2WQ6A 4Z4PA 2ZISA 4B8AA 4HVBA 3PE4A 3EP0A 3ZVVA 2RG8A 3ZEFA 4AJWA 5M72A 3N71A 3D9MA 3U3WA 2VTBB 5TH7A 3DPDA 3ASFA 2DIWA 2WMOA 3AJIA 2V4HC 4DX6D 2F37A 3K9IA 4BFRA 2RFIA 4GTPA 5FZRA 5BW8C 2B6CA 3HNAA 2W5YA 5CRVA 3UXGA 4CYMD 4HNAD 3M59A 3FPDA 1N6AA 4U0ZA 2DWZA 4I1OB 4LCTA 3BQOA 5LSXA 1QNFA 4LNUD 4XE0A 3RO3A 3APCA 4GTOA 2IY0C 1SZAA 3ULYA 2IFUA 3QKYA 1TNOA 4BT9A 2CHWA 1EPUA 1U3DA 4G25A 1MVHA 1PAQA 2WXPA 4YVQC 1XNFA 4NQ0A 5BXOA 2RKKA 3FUDA 3HVEA 4GZ6A 4F3VA 3GZSA 3Q9UC 2VSYA 2M63A 5FQ7A 3VLEA 3FUJA 4JD2G 1MX2A 2IU1A 3FU6A 4AU7A 4KBQA 5T8IA 3B13A 3DBSA 1DC2A 4DX2A 2XGOA 2J07A 3RQ4A 3ONLA 3VLDA 5BT1A 5J08A 1BPOA 2C0LA 4MKTA 2NSZA 2ZGGA 5KNGA 3TGOA 3RRMB 4CDRA 4I17A 3LY8A 4APFA 3KEZA 3DXMG 4G11A 5AENA 1TN7A 2IO3C 4URKA 3JUIA 3OS5A 4J83A 3OXFA 3OXGA 1NI1A 2AXUA 3PUJA 2FULA 3LS8A 5JJ6A 5BPPA 1OUVA 4JHRA 2Y0BG 3D9LA 5D66A 4AV7A 3JXIA 3URZA 1H0AA 1U2VG 4GYOA 5LOZA 1MJ0A 4X8QA 4FLBA 3Q79A 2KATA 5E76A 4YNPA 3BO5A 5G2NA 3CBPA 4N3BA 5HRYA 3ZYLA 3ZXSA 1LD7A 5BUZA 3FUNA 4KYOB 5EYPF 5T0MA 4LSZE 2LUHA 1O1RA 4HOTA 1LD8A 2R03A 4G1TA 4F7AA 1N11A 4PS8A 4AXHA 3PNLB 4GTTA 4G2VA 2UY1B 3OXLA 5FZSA 4I51A 2R5SA 3PS6A 4L23A 1H6KA 2WXOA 4JEHA 2R05A 4A63B 1HXIA 4K03A 2MHKA 1FPPA 1SZ9A 4DPRA 4DI3A 3I5PA 3MV2B 4JPSA 5F6LA 2Q7FA 4EZJA 3Q9NC 4MLPA 4JW1A 4A3VA 3F9WA 1SA4A 2R3AA 1OWNA 4CT4A 4BESA 2DYRE 2IEJA 3HXCA 3SHFA 3KAEA 3SZ7A 2QC9A 4JLGA 5LCWC 1E96B 5FZQA 1IHGA 2F8XK 5CHEE 3EIJA 1SQMA 2A5EA 4AM9A 3U66A 2P9LG 3TWRA 4W9RA 4L7TA 3ML8A 1TEZA 3MJWA 4QFVA 4GPMA 3ZFWA 1N4SA 2EINE 5E75A 2XGMA 3SO8A 2AJAA 3KMAA 3CBOA 2ETBA 3V2OA 4XKCA 4GZDA 3NOGD 4GPKA 4AVXA 3LYAA 4I6JA 2LNIA 4I6EA 3S7BA 3IKOB 3FU3A 4K5AB 3D9KA 5EIDA 4Q96A 3JCKC 1N54A 1H6PA 5EILA 3IHXA 3FEXA 3L13A 3F9ZA 3TAXA 3PZ3A 4ANWA 5AQ7A 4GTMA 4K5BA 4B93B 2HE0A 5D2MC 2ILRA 4CDNA 3W9FA 4QENA 4I9CA 2G46A 4UWFA 2WB2A 2BQZA 3GW4A 1RZ4A 5EN5D 5KJNA 1QZ2A 2KZTA 4GYWA 1WDYA 2I1JA 4RG9A 3V30A 4GMLA 3FH7A 3UMVA 2J8SD 3DSTA 4PS7A 4D10C 5AIJA 4CGVA 3MCXA 2YHEA 3S8PA 1SA5A 3C5RA 2VTBA 4GTRA 2XCBA 3UINC 1K1BA 4MI5A 3E34A 5ENRD 2DZNA 4C0MA 3ZRHA 3B7UX 5EX0A 5B1BE 1MX6A 1MQSA 3E32A 4LG6A 4YPUA 2E2EA 3W9GA 3M56A 5A6CA 1TNUA 3FU5A 2XEVA 3G2VA 4RQIA 3RJWA 4EECA 3JYSA 1OCRE 5LSZA 2L6JA 4JZYA 1KLXA 3K5KA 3TXNA 4U04A 4IJ8A 5ENOD 1HG2A 2GRLA 2V4LA 2WXJA 3M5AA 3E33A 2FO7A 3CV0A 2WXGA 3EU9A 3L9TA 3CK9A 2GRRB 3DSWA 2J4DA 3QARA 5LFAA 2KCKA 1S70B 1S64A 1O1TA 5CERB 3FEYA 1V54E 2BF0X 3MKRA 2H6HA 3EHNA 4GA1A 2IF4A 1BI7B 1FVHA 2V8SE 4C9BB 5EIBE 3SWCA 3DEPA 4YPAA 2F0YA 3LY7A 5C2YA 3SF4A 2R02A 1D8EA 3RAYA 3UQ3A 2LSUA 2WVIA 1H3IA 1PEGA 5F6KC 5ARFA 2WM9A 1FT2A 4JA9A 3UKRG 5ENQD 2CG2A 1UOHA 4JHJA 2RFMA 5FWQA 2X6HA 4DX1A 3NZSA 3DSXA 5JHBA 3ASDA 2W5ZA 2LSVA 4Q69A 3HXDA 3Q7AA 4OAUC 4FC8A 4A55A 2P9UG 3FUMA 2O8JA 4CDMA 2YINA 3CGHA 4EZKA 3D9PA 3UT4A 4L2LA 2GRNB 4N5CA 5JIYA 3RKVA 3AS8A 3UUXA 1ZKKA 5G05C 2V0PA 3I4GA 2WPVA 3HIZA 4J7WA 3EJNA 4GMRA 3E4BA 1MYOA 4O6FA 1TNBA 5T0KA 1Z6TA 4LERA 4UI9C 4GU5A 3ONKA 1Z3YA 5JHNA 4YPEA 1IKND 2WXHA 1MZCA 4EPZA 2VJ8A 2R2LA 3DALA 4Q94A 4JA7A 1ZU2A 3BEEA 4IULA 1A5EA 4RG6A 3TG4A 2HR2A 3F9XA 1OCOE 5F59A 2UY1A 1JCSA 4B0ZA 4I43A 3PVLA 4XI9A 2L0TB 3TG5A 3TWSA 3UPVA 4HI9A 3FTUA 1UJJA 1E8ZA 4UI9J 2F69A 4N2QA 3CK8A 1UG3A 3HYMB 4QEPA 2JV0A 5HS0A 4EBAG 4H12A 3FULA 5FT9A 2QPWA 4GTQA 4NACA 4F6RD 1N95A 2R17C 2XENA 2X6FA 4GTSA 3SD5A 4BWRA 5EG2A 2KBXA 5TEGA 3UM3A 2P9NG 2JEKA 4G8KA 3TWQA 4LUNU 3QAQA 2XS8A 3NB2A 5T5GA 3CVPA 4OYSA 1HG5A 4C1QA 5FQ6A 3FTYA 4TXPA 5CECB 4BETA 4J7FA 1OY3D 5CMYA 4HB5A 2A5UA 3FP3A 2P58C 3ZW3A 3JXJA 4H7XA 2WQHA 3UX4A 3FUHA 2J09A 4FU3A 1WM5A 1S63A 3QJZA 4ANXA 2EIME 3KMJA 4YDYA 2BKKB 1FT1A 3TXMA 3VUZA 2RD0A 2IO2C 3DSVA 4PH4B 3LVQE 4XIFA 3Q49B 4DLQA 3OAWA 4UQZA 1YYHA 1TR4A 1NL4A 2OCCE 3U64A 1K1AA 4HORA 4IYPA 2QYJA 2GRMA 3LJ3A 1IHBA 1DCQA 3EDTB 2LO6A 1OWMA 3KSLA 4ACLA 3FUKA 1B89A 3R7RA 1QYMA 2X3MA 3MO0A 2KCLA 4CT0A 2AXZA 2IOLA 4BX8A 3ZN3A 5ARGA 4NRHB 4FMUA 4AP2A 3MZLB 4AEZC 1N4QA 4DX5D 2QZAA 3FUEA 4PUCA 3D9IA 2WXIA 4V3IA 5EKQD 1Y8MA 4WNGA 2V5QC 1EF1C 2XHEA 1K3ZD 2NXPA 2XRYA 4NVQA 2WXKA 3EHRA 5AAOA 1SW6A 3AG2E 3FHEA 3BG0B 4HRNA 4UWHA 2AXVA 2BEDA 3DXKG 3EU5A 4HBDA 4C48B 4U0SA 4L1BA 1HU3A 3CK7A 4U8YD 4OVUA 4U7EB 3JQ0A 3S2AA 4MS6A 3PEUB 2VGXA 3KEAA 4GAAA 1KZOA 1N94A 3L08A 2YNQA 5HQ8A 4CRWA 2OEWA 4TXQA 1ELWA 1VDYA 4WWPA 3FFLA 2FBNA 4YDOA 3L16A 4HOUA 1Z5SC 1GW6A 3PZDA 3CKCA 4LDGA 5FQ8A 3AG4E 3R7QA 3ZU7B 4HRMB 4U96D 2P2CP 1JUQA 1D8DA 5FIOA 5D0OD 2E0IA 4BTAA 3NOCD 2XEEA 2J08A 4LNGA 5HI7A 3UKUG 3J5QB 1JPLA 5DBKA 3PRZA 3ZYKA 5J90A 4MRUA 1DNPA 1JWGA 3L54A 3FUIA 4U0UA 2UWJG 5BXUA 1NA0A 2HO1A 4EHMA 4E47A 5BV0A 3ENEA 5A7DB 2A4ZA 4GMJA 2CHXA 4DX7D 2PL2A 3G2UA 4XKBA 4GA2A 1HE8A 3IHVA 5CEDB 3FWVA 3ZIMA 2GRQB 5AARA 5ANRA 3NF1A 4FULA 4DLOA 4YDEA 3ZXPA 3C72A 5AYFA 3IV0A 4J8EA 1H6OA 1O9SA 4J7IA 2IONA 2OVFA 4ANUA 3E37A 5AQBA 4WNFA 5LCWJ 5HKPA 1K8KG 1A17A 3BU8A 3DEOA 3AU5A 4J0UA 4O60A 4TUUA 3Q4AB 3TL5A 2EIKE 3EIQC 3L17A 5FQ4A 4WUYA 3R9AB 1PY1A 3RK6A 2QFCA 1OCCE 5AJDA 3PZ2A 1XGWA 5TTFA 3WXXA 3QC1A 4R7LA 3QK0A 3FU0A 2F8YA 2FF4A 4FLHA 5KCMA 3CHRA 4J6IA 3AAAC 5FJYA 3M57A 3NBNB 3Q75A 3RO2A 1Q2ZA 3G2TA 3GZ2A 4J8SA 3FY4A 5LX8A 2L6BA 3FTVA 4A1SA 5KJMA 4KMOA 4F1SA 3CQCB 3LKUA 3CVUA 5CCLA 1H2UA 3C3OA 3PH0C 5KBAA 3I4RB 2WXMA 4YNMA 3UM1A 3O48A 2EQXA 3UT8A 5G55A 2H6IA 4NJ5A 3HRAA 3FTSA 4FJYA 4HQDA 3CVQA 4EBAA 3RIBA 3RJVA 3LDZA 2ONDA 3S7JA 4JXTA 4JEUA 2L0IA 3Q7FA 2DCPA 2VGXB 4AY5A 3UM2A 2XZDG 4UWKA 4FADA 1SVXA 1IYGA 4IN3B 2H6GA 1MHQA 4B8CB 2WXNA 3MEKA 2L9BA 4F53A 1N0RA 3L6AA 2XS1A 5AYWD 4I2WA 3RRNB 1AP7A 2WXQA 3ASGA 5G04C 3CVVA 3RRUA 1FVFA 4N3AA 2X6IA 5ANLA 1E7UA 5JJ0A 3S7FA 4ATGA 2C0MA 3C3RA 3CKBA 3ZYMA 3CSFA 3QDNA 3UI2A 1E90A 1TN6A 4K5CA 3LEWA 4UI9K 3T5VA 3NZUA 3FDHA 2FO1E 3UIOC 1HZ4A 3ML9A 3QWVA 4G23A 1ELKA 4J8FA 4DK5A 4ZFHA 4YVOA 5ENSD 3TWVA 4LEUA 4F1PA 2CFUA 4APOA 3QWWA 1WG0A 5KNHD 1L5JA 4BSZB 5ENPD 2BUGA 5EDSA 5JA4D 2LAIA 4XX5A 4I1AA 4CEMA 3Q47B 4AY6A 2FI7A 3CVXA 1ZBPA 2X6KA 4GZ3A 4U63A 4XEIG 3D9OA 4I6GA 3NQPA 4TRQA 5A23A 1OT8A 3SGHA 2C2LA 1JCQA 4WNEA 1JCRA 4M7CA 2HM8A 4TUMA 5CMWA 3CQGB 4NURA 1X5BA 3T9KA 3LY9A 2XPIA 3LCAA 4N2SA 3CVYA 2OOEA 4PDXA 4JB8P 3CVNA 2GRPB 1NFIE 2AVPA 4IRUA 3PUKA 3V2XA 4ILGA 1FCHA 1EDUA 4I1MA 5CBOA 2CFZA 5AN8A 3ESLA 1P5QA 5EYLA 3VV0A 3SNXA 3SQVA 2IGQA 2V5FA 3CIAA 3P2BA 5G05J 4QEOA 2J4BA 3DPYA 4CZ2D 1TNZA 1YA0A 4DUIA 4GYYA 3Q15A 5AJLA 4I9EA 4H7YA 4GCOA 5C1DA 2BTDA 4JL0A 4E6HA 2Y4UA 4GZ5A 1Z3XA 1RW2A 4ZHBA 1QBQA 1NZNA 3DWLG 2I1KA 5CPRB 3U9WA 3B7SA 3KMTA 1TNYA 3NAWA 5BV1A 2PQNA 5BNWA 2VSXE 2WXFA 1UJKA 3U4TA 2PM6A 1N0QA 1IQRA 3ZGQA 1D9SA 3PE3A 4P29A 3TWXA 3ZHEB 4GZCA 2WXLA 4BY6A 3SBSA 1G3NB 2ZGDA 3MO2A 4KVMA 5ENTD 2VYIA 3MYVA 2WXRA 2X38A 3EUVA 3B95A
chains in the Genus database with same CATH topology
1W3BA 3RU0A 2ILRA 3L16A 4CDNA 4HXIA 4HOUA 4Y6CA 2XCCA 3FTWA 4QENA 1GW6A 4O30A 4I9CA 2G46A 4XZ4A 4UWFA 2OV8A 4JVSA 3PZDA 3AS4A 3CKCA 4UWLA 2WB2A 4LDGA 4CCAA 2BQZA 5JINA 5FQ8A 2IJGX 3R7QA 3GW4A 2YHCA 2VGYA 4BTBA 1OWLA 1JUQA 5KJNA 3CVWA 3LXUX 4WWOA 5D0OD 1QZ2A 3D9NA 2E0IA 4BTAA 2KZTA 3M54A 2J08A 4GYWA 2I1JA 1TJFA 2PZIA 2QY7A 3B7TA 4A1GA 4KXKB 4KZCA 5HI7A 3G2WA 4HS2A 1JPLA 4RG9A 3PRZA 5DBKA 3ZYKA 5J90A 4GMLA 3FH7A 4MRUA 2MOWA 3UMVA 1DNPA 4PS7A 4BSXA 4D10C 3T5XA 3CHSA 5AIJA 4CGVA 1JWGA 3MCXA 2YHEA 3S8PA 4XI0A 3L54A 4WNDA 1H2TC 1Y6IA 4BT8A 1MT6A 3FUIA 3CEQA 4G26A 4UQXA 3VTXA 2VTBA 4YNDA 1E7VA 4WAFA 2XCBA 4U0UA 5D0QD 2UWJG 1NA0A 2HO1A 4MI5A 4C0MA 3ZRHA 4E47A 5BV0A 2PM7A 3B7UX 5EX0A 1PC2A 4HOQA 4L2YA 1MQSA 3UT7A 3ENEA 5A7DB 4JC8A 5KJLA 1ELRA 3CHOA 2A4ZA 4GMJA 3G2SA 4YPUA 3MKQB 3M55A 2E2EA 4CGWA 3SI5A 2CHXA 3M56A 2PL2A 4ABNA 3G2UA 4XKBA 3ZPJA 5A6CA 2X6JA 4GA2A 2ZU6B 1HE8A 1TJCA 3IHVA 4HLEA 4EZLA 3CHPA 3FU5A 2XEVA 3BG1B 3G2VA 1OWPA 3RJWA 3ASHA 4EECA 3JYSA 4ME2A 3FWVA 3ZIMA 5LSZA 2L6JA 4JZYA 1KLXA 3K5KA 3TXNA 4U04A 4U8HA 4IJ8A 1HG2A 4DJAA 3MGBA 2GRLA 2V4LA 1OWOA 2WXJA 5ANRA 3M5AA 3NF1A 3VLFA 4FULA 2FO7A 2XGSA 4B89A 4DLOA 3CV0A 2WXGA 5AYFA 2DBAA 3IV0A 4J8EA 3O4ZA 3T8MA 5FTPA 3CK9A 3AS5A 1NP7A 1O9SA 4J7IA 1INZA 1LF8A 2IONA 4JHKA 2OVFA 4G24A 4ANUA 2WMNA 4E85A 4WNFA 1DVPA 5LCWJ 2J49A 3SBTB 2J4DA 3QARA 3CLJA 4RZ0A 2I9CA 5LFAA 1N6CA 4KT6B 1A17A 2KCKA 1HO8A 1WAO1 2KM4A 3B7RL 3FEYA 5EX3A 2BF0X 3MKRA 3AU5A 4GCNA 2KZTB 4K0RA 4J0UA 2WQ6A 1N3JA 1UN9A 4TUUA 4Z4PA 3EHNA 3Q4AB 2IF4A 4GA1A 3TL5A 4GB9A 4B8AA 4HVBA 1FVHA 2NC9A 2V8SE 3PE4A 4KVOA 4C9BB 3SWCA 3MV3B 3EIQC 3L17A 4YPAA 3EP0A 3M58A 3LY7A 5C2YA 5FQ4A 3QWPA 3SF4A 4WUYA 3ZVVA 3R9AB 1PY1A 3RAYA 3UQ3A 2RG8A 2LSUA 3ZEFA 2WVIA 1H3IA 2IOSA 1PEGA 5F6KC 4IJDA 2AW6A 3BO5A 3RK6A 2QFCA 5ARFA 1EYHA 4AJWA 5AJDA 5M72A 2WM9A 4JA9A 1XGWA 3N71A 3D9MA 3U3WA 2VTBB 3ZYQA 5TH7A 5TTFA 2KCVA 3WXXA 3QC1A 4R7LA 2J9QA 3QK0A 3FU0A 2CG2A 4JHJA 4OVVA 2R59A 3DPDA 2FF4A 3ASFA 2DIWA 4FA6A 5FWQA 2X6HA 4FLHA 2WMOA 2XQ0A 4ILHB 5KCMA 4AOFA 3CHRA 4J6IA 2I6HA 3K9IA 3NZSA 5FJYA 4BFRA 5JHBA 2RFIA 3M57A 3ASDA 5FZRA 2W5ZA 5BW8C 3RO2A 3VUZA 2LSVA 3G2TA 4A3TA 1NA3A 3HNAA 3GZ2A 4Q69A 2GGFA 3CBMA 3PDNA 2W5YA 4J8SA 3MO5A 3FY4A 4FC8A 4A55A 3FUMA 3ULQA 5LX8A 3FTVA 2O8JA 4WWNA 4A1SA 3M59A 5KJMA 4CDMA 2YINA 4KMOA 4UWGA 4PS3A 3CGHA 1MUFA 4F1SA 4EZKA 5DIZA 1N6AA 2KC7A 4U0ZA 4B94A 2XRZA 3D9PA 3UT4A 3CQCB 5F5EA 2XPYA 4L2LA 3LKUA 4FHKA 4ANVA 3CVUA 4FMUA 5CCLA 4I1OB 1H2UA 3HDXA 4LCTA 4N5CA 3PH0C 5JIYA 3I4RB 2WXMA 5LSXA 1QNFA 3RKVA 3AS8A 4XE0A 3UUXA 3RO3A 4BX9A 1ZKKA 4YNMA 3FTXA 5G05C 2V0PA 3APCA 2WQ7A 3I4GA 1HX8A 3OOIA 2WPVA 3HIZA 1SZAA 2IFUA 2FEZA 3EJNA 3O48A 3QKYA 2EQXA 3UT8A 5G55A 3FPDA 3E4BA 3AU4A 4O6FA 4NJ5A 3D9JA 3FTSA 4FJYA 4BT9A 5T0KA 1Z6TA 2CHWA 4ILIA 4LERA 1EPUA 1U3DA 3CVQA 4GU5A 4UI9C 4EBAA 3ONKA 3RIBA 1Z3YA 3PEVB 1PAQA 2WXPA 4G25A 3RJVA 3LDZA 1MVHA 4YVQC 2ONDA 3S7JA 4JXTA 4JEUA 5JHNA 1XNFA 4YPEA 5CCMA 4NQ0A 2L0IA 4DI4A 2WXHA 2DCPA 4JDSA 3M53A 4EPZA 2VGXB 4AY5A 3FUDA 3HVEA 3KS2A 4GZ6A 2VJ8A 3D3MA 4UWKA 4FADA 4F3VA 1IYGA 4IN3B 3DALA 3GZSA 2VSYA 2M63A 4Q94A 4JA7A 1ZU2A 1MHQA 3BEEA 4IULA 5FQ7A 4RG6A 3TG4A 3VLEA 2HR2A 2WXNA 3FUJA 4B8CB 3F9XA 2AWIA 5F59A 3ESKA 1S0PA 2IU1A 3FU6A 5JHAA 3OPEA 4AU7A 3MEKA 2L9BA 1IQUA 4F53A 4KBQA 2UY1A 3L6AA 4B0ZA 5T8IA 4I43A 2PQRA 3B13A 1H19A 5AYWD 3DBSA 4I2WA 3PVLA 3RRNB 2WXQA 4XI9A 2XGOA 2L0TB 2J07A 3RQ4A 3ASGA 3ONLA 3LPZA 3Q5MA 5G04C 3VLDA 5BT1A 3TG5A 5J08A 4BUPA 1BPOA 2C0LA 4MKTA 5JJTA 3UPVA 3CVVA 2NSZA 3RRUA 1FVFA 3CHMA 3RRMB 3TGOA 3FTUA 4LRZA 4N3AA 2X6IA 1UJJA 1E8ZA 4UI9J 5ANLA 4CDRA 2F69A 4N2QA 1E7UA 3CK8A 1UG3A 3HYMB 4I17A 3S7FA 5T4YA 2JV0A 4QEPA 5T3RA 1ML9A 3LY8A 4ATGA 4EBAG 2C0MA 4H12A 4APFA 3L22A 3CKBA 3ZYMA 1U3CA 3TJPA 3CSFA 3KEZA 2HYZA 2Y3AA 3FULA 3QDNA 5FT9A 4J8OA 1E90A 4G11A 2QPWA 4N39A 3LEWA 4NACA 5AENA 1JWFA 3SW9A 4URKA 3JUIA 3OS5A 3QB2A 4UI9K 4J83A 3OXFA 4FP7A 3OTNA 3T5VA 3OXGA 1KT1A 2R17C 3NZUA 2AXUA 3FDHA 2X6FA 4AY6A 1XQHA 3SD5A 1HZ4A 4BWRA 5EG2A 3PUJA 5TEGA 1E8XA 3ML9A 3QWVA 4G23A 1ELKA 2FULA 4J8FA 4DK5A 3LS8A 2JEKA 2VSNA 5JJ6A 4LUNU 5BPPA 3QAQA 1OUVA 3FTZA 4JHRA 4YVOA 5T5GA 3D9LA 4LEUA 3CVPA 4OYSA 4AV7A 2CFUA 4APOA 3QWWA 4UQYA 1HG5A 1L5JA 1H0AA 5FQ6A 3URZA 4C1QA 4GYOA 5LOZA 2BUGA 1HS6A 4FLBA 3FTYA 5LP0A 5EDSA 4J8DA 2KATA 5E76A 2LAIA 4XX5A 4J7FA 3FUFA 4I1AA 5CMYA 2A5UA 3FP3A 4YNPA 3IEGA 2P58C 3HHMA 4CEMA 3Q47B 2YQ8A 5G2NA 3C98A 2FI7A 2GW1A 1N52A 1ZBPA 3CVXA 2X6KA 4GZ3A 4N3BA 2IQCA 4U63A 3ZYLA 3D9OA 4I6GA 3ZW3A 3NQPA 3HVEB 4H7XA 3ZXSA 2WQHA 5BUZA 3FUNA 4KYOB 3UX4A 3F9YA 5T0MA 4TRQA 3GZ1A 3FUHA 4AIFA 5A23A 2J09A 4HOTA 4FU3A 3SGHA 1WM5A 2C2LA 3PNTB 3QJZA 4G1TA 4F7AA 4ANXA 4WNEA 4PS8A 4AXHA 3KMJA 3PNLB 4TV3A 4G2VA 2UY1B 3OXLA 3TXMA 5FZSA 4I51A 2HM8A 2R5SA 2RD0A 3PS6A 3APDA 4L23A 5CMWA 1H6KA 4PH4B 3S7DA 2JLBA 2WXOA 3CQGB 2VQ2A 4JEHA 4NURA 1X5BA 3SFZA 3LY9A 2XPIA 3LVQE 1HXIA 4K03A 3ZHEA 4HOSA 2MHKA 3IBEA 3LCAA 4N2SA 4XIFA 3Q49B 3CVYA 2OOEA 4DLQA 4PDXA 1SZ9A 4DPRA 4DI3A 3CVNA 3I5PA 2AVPA 3MV2B 3OAWA 4UQZA 4JPSA 4FHJA 2Q7FA 4IRUA 5F6LA 3PUKA 4ILGA 3MX3A 1FCHA 1EDUA 4I1MA 3CR3A 1WY6A 2CFZA 2VSOE 4EZJA 3ESLA 4MLPA 1P5QA 4JW1A 4A3VA 3F9WA 2R3AA 3VV0A 1OWNA 4CT4A 3SNXA 3U64A 2IGQA 1E8WA 3KD7A 3IHYA 3SHFA 4HORA 3KAEA 4IYPA 3SZ7A 5JJ0A 2GRMA 4JLGA 2V5FA 3LJ3A 3GYZA 3EDTB 2LO6A 1OWMA 5LCWC 4ACLA 3FH8A 3CIAA 1E96B 3FUKA 1B89A 1IHGA 5FZQA 5CHEE 1HH8A 3P2BA 3R7RA 3EIJA 1SQMA 2X3MA 5G05J 4KZ0A 4ACKA 4QEOA 2J4BA 3MO0A 2Y4TA 2KCLA 4RVBA 4CT0A 2AXZA 2IOLA 4AM9A 4BX8A 3U66A 3ZN3A 4W9RA 4L7TA 5ARGA 3ML8A 4NRHB 1YA0A 4GA0A 2MRIA 4GYYA 4C0EA 3Q15A 1TEZA 1KT0A 3MJWA 3QOUA 4AP2A 3MZLB 4QFVA 4AEZC 3I3NA 5AJLA 4I9EA 4H7YA 1UN8A 3FUEA 3ZFWA 4PUCA 2XPZA 4GCOA 1E8YA 5C1DA 2BTDA 3D9IA 4HFGA 2WXIA 1UW4B 4N3CA 2XGMA 4V3IA 5E75A 4JL0A 5EKQD 3PREA 2OVBA 4I2ZA 1Y8MA 2Y4UA 4E6HA 2I2OA 4GZ5A 4WNGA 3CBOA 3KMAA 1EF1C 1Z3XA 2XHEA 2NXPA 2XRYA 4NVQA 1NZNA 5KJKA 2WXKA 3CHQA 1H2VC 2I1KA 5CPRB 4XKCA 4GZDA 3U9WA 3FHEA 4GPKA 3BG0B 3B7SA 4AVXA 3LYAA 4UWHA 3KMTA 4I6JA 2LNIA 5BV1A 4I6EA 2AXVA 2PQNA 3S7BA 3IKOB 2VSXE 5BNWA 3EHMA 3CBPA 2WXFA 1UJKA 3LVRE 3FU3A 1MVXA 3DB5A 2PM6A 3D9KA 4U0SA 3FH5A 4L1BA 1IQRA 3U4TA 1HU3A 2LAHA 3CK7A 3MKQA 3ZGQA 4RSYA 4OVUA 3S2AA 3JQ0A 3PE3A 4Q96A 5ENNA 5JJ7A 4M3OA 3MA5A 1QQEA 4FJZA 3JCKC 3QNKA 4P29A 4MS6A 1N54A 3ZHEB 2CG3A 3PEUB 3IHXA 2VGXA 2WXLA 3FEXA 3L13A 4GZCA 5G04J 4BY6A 3F9ZA 3P1UA 3SBSA 1HFAA 4GAAA 3TAXA 3CSTA 4U07A 4EQFA 3MO2A 4KVMA 3L08A 3CVLA 2YNQA 3JQ1A 5HQ8A 1HF8A 4ANWA 4CRWA 2CHZA 2VYIA 4MI0A 3APFA 3MYVA 2WXRA 2X38A 1ELWA 1VDYA 3VTYA 4Y6WA 4WWPA 3FFLA 2FBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3B A;  3RU0 A;  4HOU A;  4Y6C A;  2XCC A;  4QEN A;  4O30 A;  4I9C A;  2G46 A;  3AS4 A;  3CKC A;  4LDG A;  2BQZ A;  5JIN A;  3GW4 A;  2YHC A;  2VGY A;  4BTB A;  5KJN A;  5D0O D;  1QZ2 A;  4BTA A;  3M54 A;  4GYW A;  2PZI A;  4KXK B;  5HI7 A;  5DBK A;  4RG9 A;  4CGV A;  3S8P A;  4XI0 A;  4WND A;  4BT8 A;  1MT6 A;  4G26 A;  3CEQ A;  4UQX A;  3VTX A;  4YND A;  2XCB A;  4U0U A;  5D0Q D;  2UWJ G;  1NA0 A;  2HO1 A;  4MI5 A;  4E47 A;  5EX0 A;  1PC2 A;  4HOQ A;  5A7D B;  5KJL A;  1ELR A;  4YPU A;  3M55 A;  2E2E A;  4CGW A;  3M56 A;  2PL2 A;  4ABN A;  3ZPJ A;  5A6C A;  4GA2 A;  1TJC A;  2XEV A;  3RJW A;  3ASH A;  3JYS A;  4ME2 A;  3FWV A;  5LSZ A;  2L6J A;  1KLX A;  3K5K A;  4U04 A;  4IJ8 A;  3M5A A;  3NF1 A;  2FO7 A;  2XGS A;  3CV0 A;  5AYF A;  2DBA A;  4J8E A;  5FTP A;  3CK9 A;  3AS5 A;  1O9S A;  4J7I A;  4G24 A;  4WNF A;  5LCW J;  4RZ0 A;  1N6C A;  1A17 A;  2KCK A;  1WAO 1;  5EX3 A;  3MKR A;  4GCN A;  1N3J A;  4Z4P A;  4J0U A;  3Q4A B;  4GA1 A;  2IF4 A;  2NC9 A;  3PE4 A;  3SWC A;  3MV3 B;  4YPA A;  3EP0 A;  3M58 A;  3LY7 A;  3SF4 A;  3QWP A;  4WUY A;  3R9A B;  3RAY A;  3UQ3 A;  2LSU A;  1H3I A;  1PEG A;  5F6K C;  4IJD A;  2QFC A;  5ARF A;  5M72 A;  4JA9 A;  3N71 A;  3U3W A;  5TH7 A;  5TTF A;  2KCV A;  3WXX A;  2J9Q A;  2FF4 A;  3ASF A;  2I6H A;  3K9I A;  5FJY A;  2RFI A;  3M57 A;  3ASD A;  5FZR A;  2W5Z A;  5BW8 C;  3RO2 A;  2LSV A;  1NA3 A;  3HNA A;  3GZ2 A;  3CBM A;  3PDN A;  2W5Y A;  3MO5 A;  3ULQ A;  2O8J A;  4A1S A;  3M59 A;  5KJM A;  3FPD A;  1MUF A;  1N6A A;  5DIZ A;  2KC7 A;  4U0Z A;  4B94 A;  5F5E A;  3LKU A;  5CCL A;  4N5C A;  5JIY A;  5LSX A;  3RKV A;  3AS8 A;  3UUX A;  1ZKK A;  3RO3 A;  4YNM A;  5G05 C;  3OOI A;  2WPV A;  2IFU A;  2FEZ A;  3O48 A;  3QKY A;  3E4B A;  4O6F A;  4NJ5 A;  4BT9 A;  5T0K A;  4UI9 C;  3CVQ A;  3RIB A;  4G25 A;  1MVH A;  3RJV A;  4YVQ C;  2OND A;  3S7J A;  5JHN A;  1XNF A;  4YPE A;  5CCM A;  4NQ0 A;  4JDS A;  3M53 A;  2VGX B;  4AY5 A;  3KS2 A;  4GZ6 A;  4F3V A;  1IYG A;  4IN3 B;  3DAL A;  2VSY A;  4JA7 A;  1ZU2 A;  3BEE A;  4RG6 A;  3TG4 A;  2HR2 A;  3F9X A;  5F59 A;  3ESK A;  3OPE A;  4AU7 A;  3MEK A;  4KBQ A;  2UY1 A;  2PQR A;  5AYW D;  4I2W A;  4XI9 A;  2XGO A;  3RQ4 A;  3ASG A;  3Q5M A;  3LPZ A;  5G04 C;  5BT1 A;  3TG5 A;  4BUP A;  5JJT A;  2C0L A;  3UPV A;  3TGO A;  4N3A A;  4UI9 J;  2F69 A;  4CDR A;  4N2Q A;  3CK8 A;  5JJ0 A;  3HYM B;  4I17 A;  3S7F A;  4QEP A;  2JV0 A;  1ML9 A;  3LY8 A;  2C0M A;  4H12 A;  3CKB A;  2HYZ A;  3QDN A;  4J8O A;  5FT9 A;  2QPW A;  4N39 A;  3SW9 A;  3OS5 A;  4UI9 K;  4J83 A;  3OXF A;  3OXG A;  1KT1 A;  1XQH A;  1HZ4 A;  4BWR A;  5EG2 A;  5TEG A;  3QWV A;  4G23 A;  4J8F A;  2VSN A;  5JJ6 A;  1OUV A;  4JHR A;  4YVO A;  5T5G A;  4LEU A;  3CVP A;  4APO A;  3QWW A;  4UQY A;  3URZ A;  4C1Q A;  4GYO A;  2BUG A;  4J8D A;  2KAT A;  4J7F A;  4I1A A;  3FP3 A;  4YNP A;  3IEG A;  2P58 C;  3Q47 B;  2YQ8 A;  4AY6 A;  2FI7 A;  2GW1 A;  3BO5 A;  1ZBP A;  3CBP A;  4N3B A;  4GZ3 A;  4H7X A;  2WQH A;  4KYO B;  5T0M A;  3F9Y A;  3GZ1 A;  4AIF A;  4HOT A;  1WM5 A;  2C2L A;  4G1T A;  4WNE A;  3KMJ A;  4G2V A;  2UY1 B;  3OXL A;  3VUZ A;  5FZS A;  4I51 A;  2R5S A;  3S7D A;  2JLB A;  2VQ2 A;  3LY9 A;  2XPI A;  1HXI A;  3ZHE A;  4HOS A;  2MHK A;  3LCA A;  4N2S A;  4XIF A;  3Q49 B;  2OOE A;  3CVN A;  2AVP A;  3MV2 B;  4UQZ A;  5F6L A;  2Q7F A;  1FCH A;  1P5Q A;  3F9W A;  2R3A A;  3VV0 A;  2IGQ A;  3KD7 A;  4HOR A;  3KAE A;  3SZ7 A;  4JLG A;  2V5F A;  3GYZ A;  3EDT B;  5LCW C;  1E96 B;  1B89 A;  1IHG A;  5FZQ A;  5CHE E;  1HH8 A;  5G05 J;  4QEO A;  3MO0 A;  2Y4T A;  2KCL A;  4AM9 A;  3ZN3 A;  4W9R A;  5ARG A;  4NRH B;  1YA0 A;  4GA0 A;  4GYY A;  4FMU A;  3Q15 A;  1KT0 A;  3QOU A;  4I9E A;  4H7Y A;  3ZFW A;  4GCO A;  5C1D A;  4N3C A;  2XGM A;  4JL0 A;  5EKQ D;  3KMA A;  4I2Z A;  1Y8M A;  2Y4U A;  4GZ5 A;  4WNG A;  3CBO A;  4NVQ A;  1NZN A;  5KJK A;  5CPR B;  4GPK A;  3LYA A;  3KMT A;  2LNI A;  2PQN A;  3S7B A;  5BNW A;  1MVX A;  3DB5 A;  3U4T A;  4U0S A;  3CK7 A;  3ZGQ A;  3PE3 A;  5JJ7 A;  3MA5 A;  1QQE A;  3ZHE B;  3IHX A;  2VGX A;  5G04 J;  3F9Z A;  3TAX A;  4U07 A;  4EQF A;  3MO2 A;  3CVL A;  5HQ8 A;  2VYI A;  4MI0 A;  1ELW A;  3VTY A;  4Y6W A;  3FFL A;  2FBN A; 
#chains in the Genus database with same CATH topology
 1W3B A;  4HXI A;  3UIP C;  4Y6C A;  4XZ4 A;  2OV8 A;  4JVS A;  1O5M A;  3AS4 A;  4CCA A;  2IJG X;  3L82 A;  4NIK A;  3CVW A;  3D9N A;  3M54 A;  1TJF A;  4HRL A;  2VGE A;  3B7T A;  4A1G A;  3G2W A;  4HS2 A;  1BD8 A;  2MOW A;  2Y1L E;  4BSX A;  3X2Q E;  3ZNG A;  4XI0 A;  4BEP A;  4WND A;  1H2T C;  4BT8 A;  1MT6 A;  3VTX A;  4YND A;  4RLY A;  4WAF A;  4L2Y A;  3F6Q A;  2P9S G;  3CHO A;  3G2S A;  3MKQ B;  3M55 A;  4CGW A;  1KZP A;  2PNN A;  4TXR A;  3ISM C;  2X6J A;  2ZU6 B;  1TJC A;  4EZL A;  3CHP A;  2DZO A;  3BG1 B;  3HG0 D;  4ME2 A;  3Q78 A;  3RSE G;  4U8H A;  4DJA A;  2JAB A;  2DBA A;  4HLL A;  3ABM E;  4N5Q A;  3JUE A;  4G24 A;  4E85 A;  3UM0 A;  1DVP A;  2J49 A;  3CLJ A;  1N6C A;  3PZ1 A;  5H7P A;  5JMN D;  2EIJ E;  1N3J A;  4K0R A;  1UN9 A;  4GB9 A;  4KVO A;  2NC9 A;  3MV3 B;  5CRU A;  3M58 A;  2XZT G;  3QWP A;  1O1S A;  2NYJ A;  4J8Y A;  2ZXW E;  2IOS A;  4IJD A;  2AW6 A;  3IXE A;  1EYH A;  4UUC A;  1OCZ E;  3ZYQ A;  2KCV A;  2J9Q A;  4OVV A;  2ETA A;  2R59 A;  4FA6 A;  2XQ0 A;  4ILH B;  4AOF A;  2I6H A;  2ETC A;  3J5P A;  2Y69 E;  4A3T A;  1NA3 A;  2GGF A;  3ULE G;  3CBM A;  3PDN A;  3MO5 A;  5ITZ F;  2KXP C;  3ULQ A;  4WWN A;  4UWG A;  4OAV B;  4PS3 A;  1MUF A;  5DIZ A;  2KC7 A;  4B94 A;  2XRZ A;  5F5E A;  2XPY A;  4FHK A;  4ANV A;  3HDX A;  4YDW A;  4BX9 A;  1BLX B;  3RAU A;  3FTX A;  3PZ4 A;  2WQ7 A;  1HX8 A;  3OOI A;  3ABL E;  5CEA A;  2FEZ A;  3AU4 A;  3D9J A;  4ILI A;  3PEV B;  2EIL E;  2LXL A;  3ZUV B;  1MX4 A;  5CCM A;  4QQI A;  4DI4 A;  4JDS A;  3M53 A;  3KS2 A;  3D3M A;  2GRO B;  1DCE A;  3R9M A;  2AWI A;  3C3Q A;  3ESK A;  1S0P A;  5JHA A;  3OPE A;  1IQU A;  2PQR A;  1H19 A;  2RFA A;  3Q5M A;  3LPZ A;  4BUP A;  5JJT A;  3CHM A;  4LRZ A;  4O1P A;  3T8K A;  5T4Y A;  5T3R A;  1ML9 A;  3L22 A;  5B1A E;  3HXE A;  1U3C A;  3TJP A;  2HYZ A;  2Y3A A;  4J8O A;  2OEV A;  2XEH A;  4N39 A;  1JWF A;  3SW9 A;  3QB2 A;  2P9P G;  4FP7 A;  3OTN A;  1KT1 A;  1XQH A;  3SFX A;  4O1O A;  1E8X A;  5AQA A;  2VSN A;  1KPS B;  3FTZ A;  4UQY A;  1AWC B;  1HS6 A;  5LP0 A;  4U95 D;  4J8D A;  3FUF A;  3IEG A;  3HHM A;  2YQ8 A;  3C98 A;  2GW1 A;  1N52 A;  3ASO E;  2IQC A;  4L9P A;  5B3S E;  3HVE B;  3F9Y A;  3GZ1 A;  4AIF A;  3PNT B;  4HI8 A;  4DRX E;  4TV3 A;  3APD A;  3S7D A;  2JLB A;  2VQ2 A;  3SFZ A;  4BER A;  3ZHE A;  4HOS A;  1IXV A;  3IBE A;  1BU9 A;  4LNB A;  4FHJ A;  1N9A A;  3MX3 A;  3CR3 A;  1WY6 A;  2VSO E;  1E8W A;  3KD7 A;  3IHY A;  3SY2 A;  3GYZ A;  3FH8 A;  3TWU A;  1HH8 A;  3EHQ A;  4KZ0 A;  4ACK A;  2Y4T A;  4RVB A;  3HXF A;  3SFY A;  3D9H A;  1LTX A;  4GA0 A;  2MRI A;  4C0E A;  1KT0 A;  3QOU A;  3I3N A;  4U8V D;  1TYQ G;  1UN8 A;  2XPZ A;  1E8Y A;  4HFG A;  4N3C A;  1UW4 B;  3PRE A;  2OVB A;  4I2Z A;  2I2O A;  5FIN A;  3AG3 E;  3B7B A;  5KJK A;  1TN8 A;  3CHQ A;  1H2V C;  3DRA A;  1N4R A;  3EHM A;  3LVR E;  1MVX A;  3DB5 A;  3FH5 A;  2LAH A;  3MKQ A;  4RSY A;  5ENN A;  5JJ7 A;  4M3O A;  3V31 A;  3MA5 A;  1QQE A;  4FJZ A;  3QNK A;  2CG3 A;  3E30 A;  5G04 J;  4Z68 A;  3P1U A;  1HFA A;  3CST A;  4U07 A;  4EQF A;  5IY5 E;  3CVL A;  3JQ1 A;  1HF8 A;  3TWT A;  2CHZ A;  4MI0 A;  3APF A;  3WG7 E;  3ASN E;  1OXJ A;  2MYO A;  3VTY A;  1YCS B;  2LXM A;  3BUA A;  3HXB A;  4Y6W A;  3RU0 A;  3ZKJ A;  2XCC A;  3FTW A;  4O30 A;  4UWL A;  4G8L A;  5JIN A;  2YHC A;  2VGY A;  4BTB A;  1OWL A;  1V55 E;  3UTM A;  3LXU X;  4WWO A;  2DYS E;  2PZI A;  2QY7 A;  4KXK B;  4KZC A;  5CBN A;  3T5X A;  3CHS A;  3DSU A;  3Q73 A;  1Y6I A;  4G26 A;  3CEQ A;  4UQX A;  1N4P A;  2DVW A;  3ABK E;  1E7V A;  4ATZ D;  3LJN A;  5D0Q D;  3KSQ A;  3TWW A;  2PM7 A;  1PC2 A;  4HOQ A;  3UT7 A;  4JC8 A;  5KJL A;  1ELR A;  2H6F A;  3SI5 A;  4ABN A;  3ZPJ A;  2ZIR A;  1YMP A;  4HLE A;  5AQ9 A;  3V79 K;  3DSS A;  1OWP A;  3ASH A;  5KWD A;  1ZB1 A;  3MGB A;  1OWO A;  2P9I G;  3VLF A;  4MBG A;  2BKG A;  1X81 A;  2XGS A;  4B89 A;  2QYU A;  3O4Z A;  3T8M A;  5FTP A;  3AS5 A;  1NP7 A;  1INZ A;  1LF8 A;  4JHK A;  2WMN A;  4GTV A;  3SBT B;  4RZ0 A;  2I9C A;  2P9K G;  2B0O E;  4KT6 B;  1HO8 A;  1WAO 1;  3AG1 E;  2KM4 A;  3B7R L;  5EX3 A;  1BI8 B;  4GCN A;  2KZT B;  2WQ6 A;  4Z4P A;  2ZIS A;  4B8A A;  4HVB A;  3PE4 A;  3EP0 A;  3ZVV A;  2RG8 A;  3ZEF A;  4AJW A;  5M72 A;  3N71 A;  3D9M A;  3U3W A;  2VTB B;  5TH7 A;  3DPD A;  3ASF A;  2DIW A;  2WMO A;  3AJI A;  2V4H C;  4DX6 D;  2F37 A;  3K9I A;  4BFR A;  2RFI A;  4GTP A;  5FZR A;  5BW8 C;  2B6C A;  3HNA A;  2W5Y A;  5CRV A;  3UXG A;  4CYM D;  4HNA D;  3M59 A;  3FPD A;  1N6A A;  4U0Z A;  2DWZ A;  4I1O B;  4LCT A;  3BQO A;  5LSX A;  1QNF A;  4LNU D;  4XE0 A;  3RO3 A;  3APC A;  4GTO A;  2IY0 C;  1SZA A;  3ULY A;  2IFU A;  3QKY A;  1TNO A;  4BT9 A;  2CHW A;  1EPU A;  1U3D A;  4G25 A;  1MVH A;  1PAQ A;  2WXP A;  4YVQ C;  1XNF A;  4NQ0 A;  5BXO A;  2RKK A;  3FUD A;  3HVE A;  4GZ6 A;  4F3V A;  3GZS A;  3Q9U C;  2VSY A;  2M63 A;  5FQ7 A;  3VLE A;  3FUJ A;  4JD2 G;  1MX2 A;  2IU1 A;  3FU6 A;  4AU7 A;  4KBQ A;  5T8I A;  3B13 A;  3DBS A;  1DC2 A;  4DX2 A;  2XGO A;  2J07 A;  3RQ4 A;  3ONL A;  3VLD A;  5BT1 A;  5J08 A;  1BPO A;  2C0L A;  4MKT A;  2NSZ A;  2ZGG A;  5KNG A;  3TGO A;  3RRM B;  4CDR A;  4I17 A;  3LY8 A;  4APF A;  3KEZ A;  3DXM G;  4G11 A;  5AEN A;  1TN7 A;  2IO3 C;  4URK A;  3JUI A;  3OS5 A;  4J83 A;  3OXF A;  3OXG A;  1NI1 A;  2AXU A;  3PUJ A;  2FUL A;  3LS8 A;  5JJ6 A;  5BPP A;  1OUV A;  4JHR A;  2Y0B G;  3D9L A;  5D66 A;  4AV7 A;  3JXI A;  3URZ A;  1H0A A;  1U2V G;  4GYO A;  5LOZ A;  1MJ0 A;  4X8Q A;  4FLB A;  3Q79 A;  2KAT A;  5E76 A;  4YNP A;  3BO5 A;  5G2N A;  3CBP A;  4N3B A;  5HRY A;  3ZYL A;  3ZXS A;  1LD7 A;  5BUZ A;  3FUN A;  4KYO B;  5EYP F;  5T0M A;  4LSZ E;  2LUH A;  1O1R A;  4HOT A;  1LD8 A;  2R03 A;  4G1T A;  4F7A A;  1N11 A;  4PS8 A;  4AXH A;  3PNL B;  4GTT A;  4G2V A;  2UY1 B;  3OXL A;  5FZS A;  4I51 A;  2R5S A;  3PS6 A;  4L23 A;  1H6K A;  2WXO A;  4JEH A;  2R05 A;  4A63 B;  1HXI A;  4K03 A;  2MHK A;  1FPP A;  1SZ9 A;  4DPR A;  4DI3 A;  3I5P A;  3MV2 B;  4JPS A;  5F6L A;  2Q7F A;  4EZJ A;  3Q9N C;  4MLP A;  4JW1 A;  4A3V A;  3F9W A;  1SA4 A;  2R3A A;  1OWN A;  4CT4 A;  4BES A;  2DYR E;  2IEJ A;  3HXC A;  3SHF A;  3KAE A;  3SZ7 A;  2QC9 A;  4JLG A;  5LCW C;  1E96 B;  5FZQ A;  1IHG A;  2F8X K;  5CHE E;  3EIJ A;  1SQM A;  2A5E A;  4AM9 A;  3U66 A;  2P9L G;  3TWR A;  4W9R A;  4L7T A;  3ML8 A;  1TEZ A;  3MJW A;  4QFV A;  4GPM A;  3ZFW A;  1N4S A;  2EIN E;  5E75 A;  2XGM A;  3SO8 A;  2AJA A;  3KMA A;  3CBO A;  2ETB A;  3V2O A;  4XKC A;  4GZD A;  3NOG D;  4GPK A;  4AVX A;  3LYA A;  4I6J A;  2LNI A;  4I6E A;  3S7B A;  3IKO B;  3FU3 A;  4K5A B;  3D9K A;  5EID A;  4Q96 A;  3JCK C;  1N54 A;  1H6P A;  5EIL A;  3IHX A;  3FEX A;  3L13 A;  3F9Z A;  3TAX A;  3PZ3 A;  4ANW A;  5AQ7 A;  4GTM A;  4K5B A;  4B93 B;  2HE0 A;  5D2M C;  2ILR A;  4CDN A;  3W9F A;  4QEN A;  4I9C A;  2G46 A;  4UWF A;  2WB2 A;  2BQZ A;  3GW4 A;  1RZ4 A;  5EN5 D;  5KJN A;  1QZ2 A;  2KZT A;  4GYW A;  1WDY A;  2I1J A;  4RG9 A;  3V30 A;  4GML A;  3FH7 A;  3UMV A;  2J8S D;  3DST A;  4PS7 A;  4D10 C;  5AIJ A;  4CGV A;  3MCX A;  2YHE A;  3S8P A;  1SA5 A;  3C5R A;  2VTB A;  4GTR A;  2XCB A;  3UIN C;  1K1B A;  4MI5 A;  3E34 A;  5ENR D;  2DZN A;  4C0M A;  3ZRH A;  3B7U X;  5EX0 A;  5B1B E;  1MX6 A;  1MQS A;  3E32 A;  4LG6 A;  4YPU A;  2E2E A;  3W9G A;  3M56 A;  5A6C A;  1TNU A;  3FU5 A;  2XEV A;  3G2V A;  4RQI A;  3RJW A;  4EEC A;  3JYS A;  1OCR E;  5LSZ A;  2L6J A;  4JZY A;  1KLX A;  3K5K A;  3TXN A;  4U04 A;  4IJ8 A;  5ENO D;  1HG2 A;  2GRL A;  2V4L A;  2WXJ A;  3M5A A;  3E33 A;  2FO7 A;  3CV0 A;  2WXG A;  3EU9 A;  3L9T A;  3CK9 A;  2GRR B;  3DSW A;  2J4D A;  3QAR A;  5LFA A;  2KCK A;  1S70 B;  1S64 A;  1O1T A;  5CER B;  3FEY A;  1V54 E;  2BF0 X;  3MKR A;  2H6H A;  3EHN A;  4GA1 A;  2IF4 A;  1BI7 B;  1FVH A;  2V8S E;  4C9B B;  5EIB E;  3SWC A;  3DEP A;  4YPA A;  2F0Y A;  3LY7 A;  5C2Y A;  3SF4 A;  2R02 A;  1D8E A;  3RAY A;  3UQ3 A;  2LSU A;  2WVI A;  1H3I A;  1PEG A;  5F6K C;  5ARF A;  2WM9 A;  1FT2 A;  4JA9 A;  3UKR G;  5ENQ D;  2CG2 A;  1UOH A;  4JHJ A;  2RFM A;  5FWQ A;  2X6H A;  4DX1 A;  3NZS A;  3DSX A;  5JHB A;  3ASD A;  2W5Z A;  2LSV A;  4Q69 A;  3HXD A;  3Q7A A;  4OAU C;  4FC8 A;  4A55 A;  2P9U G;  3FUM A;  2O8J A;  4CDM A;  2YIN A;  3CGH A;  4EZK A;  3D9P A;  3UT4 A;  4L2L A;  2GRN B;  4N5C A;  5JIY A;  3RKV A;  3AS8 A;  3UUX A;  1ZKK A;  5G05 C;  2V0P A;  3I4G A;  2WPV A;  3HIZ A;  4J7W A;  3EJN A;  4GMR A;  3E4B A;  1MYO A;  4O6F A;  1TNB A;  5T0K A;  1Z6T A;  4LER A;  4UI9 C;  4GU5 A;  3ONK A;  1Z3Y A;  5JHN A;  4YPE A;  1IKN D;  2WXH A;  1MZC A;  4EPZ A;  2VJ8 A;  2R2L A;  3DAL A;  4Q94 A;  4JA7 A;  1ZU2 A;  3BEE A;  4IUL A;  1A5E A;  4RG6 A;  3TG4 A;  2HR2 A;  3F9X A;  1OCO E;  5F59 A;  2UY1 A;  1JCS A;  4B0Z A;  4I43 A;  3PVL A;  4XI9 A;  2L0T B;  3TG5 A;  3TWS A;  3UPV A;  4HI9 A;  3FTU A;  1UJJ A;  1E8Z A;  4UI9 J;  2F69 A;  4N2Q A;  3CK8 A;  1UG3 A;  3HYM B;  4QEP A;  2JV0 A;  5HS0 A;  4EBA G;  4H12 A;  3FUL A;  5FT9 A;  2QPW A;  4GTQ A;  4NAC A;  4F6R D;  1N95 A;  2R17 C;  2XEN A;  2X6F A;  4GTS A;  3SD5 A;  4BWR A;  5EG2 A;  2KBX A;  5TEG A;  3UM3 A;  2P9N G;  2JEK A;  4G8K A;  3TWQ A;  4LUN U;  3QAQ A;  2XS8 A;  3NB2 A;  5T5G A;  3CVP A;  4OYS A;  1HG5 A;  4C1Q A;  5FQ6 A;  3FTY A;  4TXP A;  5CEC B;  4BET A;  4J7F A;  1OY3 D;  5CMY A;  4HB5 A;  2A5U A;  3FP3 A;  2P58 C;  3ZW3 A;  3JXJ A;  4H7X A;  2WQH A;  3UX4 A;  3FUH A;  2J09 A;  4FU3 A;  1WM5 A;  1S63 A;  3QJZ A;  4ANX A;  2EIM E;  3KMJ A;  4YDY A;  2BKK B;  1FT1 A;  3TXM A;  3VUZ A;  2RD0 A;  2IO2 C;  3DSV A;  4PH4 B;  3LVQ E;  4XIF A;  3Q49 B;  4DLQ A;  3OAW A;  4UQZ A;  1YYH A;  1TR4 A;  1NL4 A;  2OCC E;  3U64 A;  1K1A A;  4HOR A;  4IYP A;  2QYJ A;  2GRM A;  3LJ3 A;  1IHB A;  1DCQ A;  3EDT B;  2LO6 A;  1OWM A;  3KSL A;  4ACL A;  3FUK A;  1B89 A;  3R7R A;  1QYM A;  2X3M A;  3MO0 A;  2KCL A;  4CT0 A;  2AXZ A;  2IOL A;  4BX8 A;  3ZN3 A;  5ARG A;  4NRH B;  4FMU A;  4AP2 A;  3MZL B;  4AEZ C;  1N4Q A;  4DX5 D;  2QZA A;  3FUE A;  4PUC A;  3D9I A;  2WXI A;  4V3I A;  5EKQ D;  1Y8M A;  4WNG A;  2V5Q C;  1EF1 C;  2XHE A;  1K3Z D;  2NXP A;  2XRY A;  4NVQ A;  2WXK A;  3EHR A;  5AAO A;  1SW6 A;  3AG2 E;  3FHE A;  3BG0 B;  4HRN A;  4UWH A;  2AXV A;  2BED A;  3DXK G;  3EU5 A;  4HBD A;  4C48 B;  4U0S A;  4L1B A;  1HU3 A;  3CK7 A;  4U8Y D;  4OVU A;  4U7E B;  3JQ0 A;  3S2A A;  4MS6 A;  3PEU B;  2VGX A;  3KEA A;  4GAA A;  1KZO A;  1N94 A;  3L08 A;  2YNQ A;  5HQ8 A;  4CRW A;  2OEW A;  4TXQ A;  1ELW A;  1VDY A;  4WWP A;  3FFL A;  2FBN A;  4YDO A;  3L16 A;  4HOU A;  1Z5S C;  1GW6 A;  3PZD A;  3CKC A;  4LDG A;  5FQ8 A;  3AG4 E;  3R7Q A;  3ZU7 B;  4HRM B;  4U96 D;  2P2C P;  1JUQ A;  1D8D A;  5FIO A;  5D0O D;  2E0I A;  4BTA A;  3NOC D;  2XEE A;  2J08 A;  4LNG A;  5HI7 A;  3UKU G;  3J5Q B;  1JPL A;  5DBK A;  3PRZ A;  3ZYK A;  5J90 A;  4MRU A;  1DNP A;  1JWG A;  3L54 A;  3FUI A;  4U0U A;  2UWJ G;  5BXU A;  1NA0 A;  2HO1 A;  4EHM A;  4E47 A;  5BV0 A;  3ENE A;  5A7D B;  2A4Z A;  4GMJ A;  2CHX A;  4DX7 D;  2PL2 A;  3G2U A;  4XKB A;  4GA2 A;  1HE8 A;  3IHV A;  5CED B;  3FWV A;  3ZIM A;  2GRQ B;  5AAR A;  5ANR A;  3NF1 A;  4FUL A;  4DLO A;  4YDE A;  3ZXP A;  3C72 A;  5AYF A;  3IV0 A;  4J8E A;  1H6O A;  1O9S A;  4J7I A;  2ION A;  2OVF A;  4ANU A;  3E37 A;  5AQB A;  4WNF A;  5LCW J;  5HKP A;  1K8K G;  1A17 A;  3BU8 A;  3DEO A;  3AU5 A;  4J0U A;  4O60 A;  4TUU A;  3Q4A B;  3TL5 A;  2EIK E;  3EIQ C;  3L17 A;  5FQ4 A;  4WUY A;  3R9A B;  1PY1 A;  3RK6 A;  2QFC A;  1OCC E;  5AJD A;  3PZ2 A;  1XGW A;  5TTF A;  3WXX A;  3QC1 A;  4R7L A;  3QK0 A;  3FU0 A;  2F8Y A;  2FF4 A;  4FLH A;  5KCM A;  3CHR A;  4J6I A;  3AAA C;  5FJY A;  3M57 A;  3NBN B;  3Q75 A;  3RO2 A;  1Q2Z A;  3G2T A;  3GZ2 A;  4J8S A;  3FY4 A;  5LX8 A;  2L6B A;  3FTV A;  4A1S A;  5KJM A;  4KMO A;  4F1S A;  3CQC B;  3LKU A;  3CVU A;  5CCL A;  1H2U A;  3C3O A;  3PH0 C;  5KBA A;  3I4R B;  2WXM A;  4YNM A;  3UM1 A;  3O48 A;  2EQX A;  3UT8 A;  5G55 A;  2H6I A;  4NJ5 A;  3HRA A;  3FTS A;  4FJY A;  4HQD A;  3CVQ A;  4EBA A;  3RIB A;  3RJV A;  3LDZ A;  2OND A;  3S7J A;  4JXT A;  4JEU A;  2L0I A;  3Q7F A;  2DCP A;  2VGX B;  4AY5 A;  3UM2 A;  2XZD G;  4UWK A;  4FAD A;  1SVX A;  1IYG A;  4IN3 B;  2H6G A;  1MHQ A;  4B8C B;  2WXN A;  3MEK A;  2L9B A;  4F53 A;  1N0R A;  3L6A A;  2XS1 A;  5AYW D;  4I2W A;  3RRN B;  1AP7 A;  2WXQ A;  3ASG A;  5G04 C;  3CVV A;  3RRU A;  1FVF A;  4N3A A;  2X6I A;  5ANL A;  1E7U A;  5JJ0 A;  3S7F A;  4ATG A;  2C0M A;  3C3R A;  3CKB A;  3ZYM A;  3CSF A;  3QDN A;  3UI2 A;  1E90 A;  1TN6 A;  4K5C A;  3LEW A;  4UI9 K;  3T5V A;  3NZU A;  3FDH A;  2FO1 E;  3UIO C;  1HZ4 A;  3ML9 A;  3QWV A;  4G23 A;  1ELK A;  4J8F A;  4DK5 A;  4ZFH A;  4YVO A;  5ENS D;  3TWV A;  4LEU A;  4F1P A;  2CFU A;  4APO A;  3QWW A;  1WG0 A;  5KNH D;  1L5J A;  4BSZ B;  5ENP D;  2BUG A;  5EDS A;  5JA4 D;  2LAI A;  4XX5 A;  4I1A A;  4CEM A;  3Q47 B;  4AY6 A;  2FI7 A;  3CVX A;  1ZBP A;  2X6K A;  4GZ3 A;  4U63 A;  4XEI G;  3D9O A;  4I6G A;  3NQP A;  4TRQ A;  5A23 A;  1OT8 A;  3SGH A;  2C2L A;  1JCQ A;  4WNE A;  1JCR A;  4M7C A;  2HM8 A;  4TUM A;  5CMW A;  3CQG B;  4NUR A;  1X5B A;  3T9K A;  3LY9 A;  2XPI A;  3LCA A;  4N2S A;  3CVY A;  2OOE A;  4PDX A;  4JB8 P;  3CVN A;  2GRP B;  1NFI E;  2AVP A;  4IRU A;  3PUK A;  3V2X A;  4ILG A;  1FCH A;  1EDU A;  4I1M A;  5CBO A;  2CFZ A;  5AN8 A;  3ESL A;  1P5Q A;  5EYL A;  3VV0 A;  3SNX A;  3SQV A;  2IGQ A;  2V5F A;  3CIA A;  3P2B A;  5G05 J;  4QEO A;  2J4B A;  3DPY A;  4CZ2 D;  1TNZ A;  1YA0 A;  4DUI A;  4GYY A;  3Q15 A;  5AJL A;  4I9E A;  4H7Y A;  4GCO A;  5C1D A;  2BTD A;  4JL0 A;  4E6H A;  2Y4U A;  4GZ5 A;  1Z3X A;  1RW2 A;  4ZHB A;  1QBQ A;  1NZN A;  3DWL G;  2I1K A;  5CPR B;  3U9W A;  3B7S A;  3KMT A;  1TNY A;  3NAW A;  5BV1 A;  2PQN A;  5BNW A;  2VSX E;  2WXF A;  1UJK A;  3U4T A;  2PM6 A;  1N0Q A;  1IQR A;  3ZGQ A;  1D9S A;  3PE3 A;  4P29 A;  3TWX A;  3ZHE B;  4GZC A;  2WXL A;  4BY6 A;  3SBS A;  1G3N B;  2ZGD A;  3MO2 A;  4KVM A;  5ENT D;  2VYI A;  3MYV A;  2WXR A;  2X38 A;  3EUV A;  3B95 A; 
#chains in the Genus database with same CATH homology
 1W3B A;  3RU0 A;  2ILR A;  3L16 A;  4CDN A;  4HXI A;  4HOU A;  4Y6C A;  2XCC A;  3FTW A;  4QEN A;  1GW6 A;  4O30 A;  4I9C A;  2G46 A;  4XZ4 A;  4UWF A;  2OV8 A;  4JVS A;  3PZD A;  3AS4 A;  3CKC A;  4UWL A;  2WB2 A;  4LDG A;  4CCA A;  2BQZ A;  5JIN A;  5FQ8 A;  2IJG X;  3R7Q A;  3GW4 A;  2YHC A;  2VGY A;  4BTB A;  1OWL A;  1JUQ A;  5KJN A;  3CVW A;  3LXU X;  4WWO A;  5D0O D;  1QZ2 A;  3D9N A;  2E0I A;  4BTA A;  2KZT A;  3M54 A;  2J08 A;  4GYW A;  2I1J A;  1TJF A;  2PZI A;  2QY7 A;  3B7T A;  4A1G A;  4KXK B;  4KZC A;  5HI7 A;  3G2W A;  4HS2 A;  1JPL A;  4RG9 A;  3PRZ A;  5DBK A;  3ZYK A;  5J90 A;  4GML A;  3FH7 A;  4MRU A;  2MOW A;  3UMV A;  1DNP A;  4PS7 A;  4BSX A;  4D10 C;  3T5X A;  3CHS A;  5AIJ A;  4CGV A;  1JWG A;  3MCX A;  2YHE A;  3S8P A;  4XI0 A;  3L54 A;  4WND A;  1H2T C;  1Y6I A;  4BT8 A;  1MT6 A;  3FUI A;  3CEQ A;  4G26 A;  4UQX A;  3VTX A;  2VTB A;  4YND A;  1E7V A;  4WAF A;  2XCB A;  4U0U A;  5D0Q D;  2UWJ G;  1NA0 A;  2HO1 A;  4MI5 A;  4C0M A;  3ZRH A;  4E47 A;  5BV0 A;  2PM7 A;  3B7U X;  5EX0 A;  1PC2 A;  4HOQ A;  4L2Y A;  1MQS A;  3UT7 A;  3ENE A;  5A7D B;  4JC8 A;  5KJL A;  1ELR A;  3CHO A;  2A4Z A;  4GMJ A;  3G2S A;  4YPU A;  3MKQ B;  3M55 A;  2E2E A;  4CGW A;  3SI5 A;  2CHX A;  3M56 A;  2PL2 A;  4ABN A;  3G2U A;  4XKB A;  3ZPJ A;  5A6C A;  2X6J A;  4GA2 A;  2ZU6 B;  1HE8 A;  1TJC A;  3IHV A;  4HLE A;  4EZL A;  3CHP A;  3FU5 A;  2XEV A;  3BG1 B;  3G2V A;  1OWP A;  3RJW A;  3ASH A;  4EEC A;  3JYS A;  4ME2 A;  3FWV A;  3ZIM A;  5LSZ A;  2L6J A;  4JZY A;  1KLX A;  3K5K A;  3TXN A;  4U04 A;  4U8H A;  4IJ8 A;  1HG2 A;  4DJA A;  3MGB A;  2GRL A;  2V4L A;  1OWO A;  2WXJ A;  5ANR A;  3M5A A;  3NF1 A;  3VLF A;  4FUL A;  2FO7 A;  2XGS A;  4B89 A;  4DLO A;  3CV0 A;  2WXG A;  5AYF A;  2DBA A;  3IV0 A;  4J8E A;  3O4Z A;  3T8M A;  5FTP A;  3CK9 A;  3AS5 A;  1NP7 A;  1O9S A;  4J7I A;  1INZ A;  1LF8 A;  2ION A;  4JHK A;  2OVF A;  4G24 A;  4ANU A;  2WMN A;  4E85 A;  4WNF A;  1DVP A;  5LCW J;  2J49 A;  3SBT B;  2J4D A;  3QAR A;  3CLJ A;  4RZ0 A;  2I9C A;  5LFA A;  1N6C A;  4KT6 B;  1A17 A;  2KCK A;  1HO8 A;  1WAO 1;  2KM4 A;  3B7R L;  3FEY A;  5EX3 A;  2BF0 X;  3MKR A;  3AU5 A;  4GCN A;  2KZT B;  4K0R A;  4J0U A;  2WQ6 A;  1N3J A;  1UN9 A;  4TUU A;  4Z4P A;  3EHN A;  3Q4A B;  2IF4 A;  4GA1 A;  3TL5 A;  4GB9 A;  4B8A A;  4HVB A;  1FVH A;  2NC9 A;  2V8S E;  3PE4 A;  4KVO A;  4C9B B;  3SWC A;  3MV3 B;  3EIQ C;  3L17 A;  4YPA A;  3EP0 A;  3M58 A;  3LY7 A;  5C2Y A;  5FQ4 A;  3QWP A;  3SF4 A;  4WUY A;  3ZVV A;  3R9A B;  1PY1 A;  3RAY A;  3UQ3 A;  2RG8 A;  2LSU A;  3ZEF A;  2WVI A;  1H3I A;  2IOS A;  1PEG A;  5F6K C;  4IJD A;  2AW6 A;  3BO5 A;  3RK6 A;  2QFC A;  5ARF A;  1EYH A;  4AJW A;  5AJD A;  5M72 A;  2WM9 A;  4JA9 A;  1XGW A;  3N71 A;  3D9M A;  3U3W A;  2VTB B;  3ZYQ A;  5TH7 A;  5TTF A;  2KCV A;  3WXX A;  3QC1 A;  4R7L A;  2J9Q A;  3QK0 A;  3FU0 A;  2CG2 A;  4JHJ A;  4OVV A;  2R59 A;  3DPD A;  2FF4 A;  3ASF A;  2DIW A;  4FA6 A;  5FWQ A;  2X6H A;  4FLH A;  2WMO A;  2XQ0 A;  4ILH B;  5KCM A;  4AOF A;  3CHR A;  4J6I A;  2I6H A;  3K9I A;  3NZS A;  5FJY A;  4BFR A;  5JHB A;  2RFI A;  3M57 A;  3ASD A;  5FZR A;  2W5Z A;  5BW8 C;  3RO2 A;  3VUZ A;  2LSV A;  3G2T A;  4A3T A;  1NA3 A;  3HNA A;  3GZ2 A;  4Q69 A;  2GGF A;  3CBM A;  3PDN A;  2W5Y A;  4J8S A;  3MO5 A;  3FY4 A;  4FC8 A;  4A55 A;  3FUM A;  3ULQ A;  5LX8 A;  3FTV A;  2O8J A;  4WWN A;  4A1S A;  3M59 A;  5KJM A;  4CDM A;  2YIN A;  4KMO A;  4UWG A;  4PS3 A;  3CGH A;  1MUF A;  4F1S A;  4EZK A;  5DIZ A;  1N6A A;  2KC7 A;  4U0Z A;  4B94 A;  2XRZ A;  3D9P A;  3UT4 A;  3CQC B;  5F5E A;  2XPY A;  4L2L A;  3LKU A;  4FHK A;  4ANV A;  3CVU A;  4FMU A;  5CCL A;  4I1O B;  1H2U A;  3HDX A;  4LCT A;  4N5C A;  3PH0 C;  5JIY A;  3I4R B;  2WXM A;  5LSX A;  1QNF A;  3RKV A;  3AS8 A;  4XE0 A;  3UUX A;  3RO3 A;  4BX9 A;  1ZKK A;  4YNM A;  3FTX A;  5G05 C;  2V0P A;  3APC A;  2WQ7 A;  3I4G A;  1HX8 A;  3OOI A;  2WPV A;  3HIZ A;  1SZA A;  2IFU A;  2FEZ A;  3EJN A;  3O48 A;  3QKY A;  2EQX A;  3UT8 A;  5G55 A;  3FPD A;  3E4B A;  3AU4 A;  4O6F A;  4NJ5 A;  3D9J A;  3FTS A;  4FJY A;  4BT9 A;  5T0K A;  1Z6T A;  2CHW A;  4ILI A;  4LER A;  1EPU A;  1U3D A;  3CVQ A;  4GU5 A;  4UI9 C;  4EBA A;  3ONK A;  3RIB A;  1Z3Y A;  3PEV B;  1PAQ A;  2WXP A;  4G25 A;  3RJV A;  3LDZ A;  1MVH A;  4YVQ C;  2OND A;  3S7J A;  4JXT A;  4JEU A;  5JHN A;  1XNF A;  4YPE A;  5CCM A;  4NQ0 A;  2L0I A;  4DI4 A;  2WXH A;  2DCP A;  4JDS A;  3M53 A;  4EPZ A;  2VGX B;  4AY5 A;  3FUD A;  3HVE A;  3KS2 A;  4GZ6 A;  2VJ8 A;  3D3M A;  4UWK A;  4FAD A;  4F3V A;  1IYG A;  4IN3 B;  3DAL A;  3GZS A;  2VSY A;  2M63 A;  4Q94 A;  4JA7 A;  1ZU2 A;  1MHQ A;  3BEE A;  4IUL A;  5FQ7 A;  4RG6 A;  3TG4 A;  3VLE A;  2HR2 A;  2WXN A;  3FUJ A;  4B8C B;  3F9X A;  2AWI A;  5F59 A;  3ESK A;  1S0P A;  2IU1 A;  3FU6 A;  5JHA A;  3OPE A;  4AU7 A;  3MEK A;  2L9B A;  1IQU A;  4F53 A;  4KBQ A;  2UY1 A;  3L6A A;  4B0Z A;  5T8I A;  4I43 A;  2PQR A;  3B13 A;  1H19 A;  5AYW D;  3DBS A;  4I2W A;  3PVL A;  3RRN B;  2WXQ A;  4XI9 A;  2XGO A;  2L0T B;  2J07 A;  3RQ4 A;  3ASG A;  3ONL A;  3LPZ A;  3Q5M A;  5G04 C;  3VLD A;  5BT1 A;  3TG5 A;  5J08 A;  4BUP A;  1BPO A;  2C0L A;  4MKT A;  5JJT A;  3UPV A;  3CVV A;  2NSZ A;  3RRU A;  1FVF A;  3CHM A;  3RRM B;  3TGO A;  3FTU A;  4LRZ A;  4N3A A;  2X6I A;  1UJJ A;  1E8Z A;  4UI9 J;  5ANL A;  4CDR A;  2F69 A;  4N2Q A;  1E7U A;  3CK8 A;  1UG3 A;  3HYM B;  4I17 A;  3S7F A;  5T4Y A;  2JV0 A;  4QEP A;  5T3R A;  1ML9 A;  3LY8 A;  4ATG A;  4EBA G;  2C0M A;  4H12 A;  4APF A;  3L22 A;  3CKB A;  3ZYM A;  1U3C A;  3TJP A;  3CSF A;  3KEZ A;  2HYZ A;  2Y3A A;  3FUL A;  3QDN A;  5FT9 A;  4J8O A;  1E90 A;  4G11 A;  2QPW A;  4N39 A;  3LEW A;  4NAC A;  5AEN A;  1JWF A;  3SW9 A;  4URK A;  3JUI A;  3OS5 A;  3QB2 A;  4UI9 K;  4J83 A;  3OXF A;  4FP7 A;  3OTN A;  3T5V A;  3OXG A;  1KT1 A;  2R17 C;  3NZU A;  2AXU A;  3FDH A;  2X6F A;  4AY6 A;  1XQH A;  3SD5 A;  1HZ4 A;  4BWR A;  5EG2 A;  3PUJ A;  5TEG A;  1E8X A;  3ML9 A;  3QWV A;  4G23 A;  1ELK A;  2FUL A;  4J8F A;  4DK5 A;  3LS8 A;  2JEK A;  2VSN A;  5JJ6 A;  4LUN U;  5BPP A;  3QAQ A;  1OUV A;  3FTZ A;  4JHR A;  4YVO A;  5T5G A;  3D9L A;  4LEU A;  3CVP A;  4OYS A;  4AV7 A;  2CFU A;  4APO A;  3QWW A;  4UQY A;  1HG5 A;  1L5J A;  1H0A A;  5FQ6 A;  3URZ A;  4C1Q A;  4GYO A;  5LOZ A;  2BUG A;  1HS6 A;  4FLB A;  3FTY A;  5LP0 A;  5EDS A;  4J8D A;  2KAT A;  5E76 A;  2LAI A;  4XX5 A;  4J7F A;  3FUF A;  4I1A A;  5CMY A;  2A5U A;  3FP3 A;  4YNP A;  3IEG A;  2P58 C;  3HHM A;  4CEM A;  3Q47 B;  2YQ8 A;  5G2N A;  3C98 A;  2FI7 A;  2GW1 A;  1N52 A;  1ZBP A;  3CVX A;  2X6K A;  4GZ3 A;  4N3B A;  2IQC A;  4U63 A;  3ZYL A;  3D9O A;  4I6G A;  3ZW3 A;  3NQP A;  3HVE B;  4H7X A;  3ZXS A;  2WQH A;  5BUZ A;  3FUN A;  4KYO B;  3UX4 A;  3F9Y A;  5T0M A;  4TRQ A;  3GZ1 A;  3FUH A;  4AIF A;  5A23 A;  2J09 A;  4HOT A;  4FU3 A;  3SGH A;  1WM5 A;  2C2L A;  3PNT B;  3QJZ A;  4G1T A;  4F7A A;  4ANX A;  4WNE A;  4PS8 A;  4AXH A;  3KMJ A;  3PNL B;  4TV3 A;  4G2V A;  2UY1 B;  3OXL A;  3TXM A;  5FZS A;  4I51 A;  2HM8 A;  2R5S A;  2RD0 A;  3PS6 A;  3APD A;  4L23 A;  5CMW A;  1H6K A;  4PH4 B;  3S7D A;  2JLB A;  2WXO A;  3CQG B;  2VQ2 A;  4JEH A;  4NUR A;  1X5B A;  3SFZ A;  3LY9 A;  2XPI A;  3LVQ E;  1HXI A;  4K03 A;  3ZHE A;  4HOS A;  2MHK A;  3IBE A;  3LCA A;  4N2S A;  4XIF A;  3Q49 B;  3CVY A;  2OOE A;  4DLQ A;  4PDX A;  1SZ9 A;  4DPR A;  4DI3 A;  3CVN A;  3I5P A;  2AVP A;  3MV2 B;  3OAW A;  4UQZ A;  4JPS A;  4FHJ A;  2Q7F A;  4IRU A;  5F6L A;  3PUK A;  4ILG A;  3MX3 A;  1FCH A;  1EDU A;  4I1M A;  3CR3 A;  1WY6 A;  2CFZ A;  2VSO E;  4EZJ A;  3ESL A;  4MLP A;  1P5Q A;  4JW1 A;  4A3V A;  3F9W A;  2R3A A;  3VV0 A;  1OWN A;  4CT4 A;  3SNX A;  3U64 A;  2IGQ A;  1E8W A;  3KD7 A;  3IHY A;  3SHF A;  4HOR A;  3KAE A;  4IYP A;  3SZ7 A;  5JJ0 A;  2GRM A;  4JLG A;  2V5F A;  3LJ3 A;  3GYZ A;  3EDT B;  2LO6 A;  1OWM A;  5LCW C;  4ACL A;  3FH8 A;  3CIA A;  1E96 B;  3FUK A;  1B89 A;  1IHG A;  5FZQ A;  5CHE E;  1HH8 A;  3P2B A;  3R7R A;  3EIJ A;  1SQM A;  2X3M A;  5G05 J;  4KZ0 A;  4ACK A;  4QEO A;  2J4B A;  3MO0 A;  2Y4T A;  2KCL A;  4RVB A;  4CT0 A;  2AXZ A;  2IOL A;  4AM9 A;  4BX8 A;  3U66 A;  3ZN3 A;  4W9R A;  4L7T A;  5ARG A;  3ML8 A;  4NRH B;  1YA0 A;  4GA0 A;  2MRI A;  4GYY A;  4C0E A;  3Q15 A;  1TEZ A;  1KT0 A;  3MJW A;  3QOU A;  4AP2 A;  3MZL B;  4QFV A;  4AEZ C;  3I3N A;  5AJL A;  4I9E A;  4H7Y A;  1UN8 A;  3FUE A;  3ZFW A;  4PUC A;  2XPZ A;  4GCO A;  1E8Y A;  5C1D A;  2BTD A;  3D9I A;  4HFG A;  2WXI A;  1UW4 B;  4N3C A;  2XGM A;  4V3I A;  5E75 A;  4JL0 A;  5EKQ D;  3PRE A;  2OVB A;  4I2Z A;  1Y8M A;  2Y4U A;  4E6H A;  2I2O A;  4GZ5 A;  4WNG A;  3CBO A;  3KMA A;  1EF1 C;  1Z3X A;  2XHE A;  2NXP A;  2XRY A;  4NVQ A;  1NZN A;  5KJK A;  2WXK A;  3CHQ A;  1H2V C;  2I1K A;  5CPR B;  4XKC A;  4GZD A;  3U9W A;  3FHE A;  4GPK A;  3BG0 B;  3B7S A;  4AVX A;  3LYA A;  4UWH A;  3KMT A;  4I6J A;  2LNI A;  5BV1 A;  4I6E A;  2AXV A;  2PQN A;  3S7B A;  3IKO B;  2VSX E;  5BNW A;  3EHM A;  3CBP A;  2WXF A;  1UJK A;  3LVR E;  3FU3 A;  1MVX A;  3DB5 A;  2PM6 A;  3D9K A;  4U0S A;  3FH5 A;  4L1B A;  1IQR A;  3U4T A;  1HU3 A;  2LAH A;  3CK7 A;  3MKQ A;  3ZGQ A;  4RSY A;  4OVU A;  3S2A A;  3JQ0 A;  3PE3 A;  4Q96 A;  5ENN A;  5JJ7 A;  4M3O A;  3MA5 A;  1QQE A;  4FJZ A;  3JCK C;  3QNK A;  4P29 A;  4MS6 A;  1N54 A;  3ZHE B;  2CG3 A;  3PEU B;  3IHX A;  2VGX A;  2WXL A;  3FEX A;  3L13 A;  4GZC A;  5G04 J;  4BY6 A;  3F9Z A;  3P1U A;  3SBS A;  1HFA A;  4GAA A;  3TAX A;  3CST A;  4U07 A;  4EQF A;  3MO2 A;  4KVM A;  3L08 A;  3CVL A;  2YNQ A;  3JQ1 A;  5HQ8 A;  1HF8 A;  4ANW A;  4CRW A;  2CHZ A;  2VYI A;  4MI0 A;  3APF A;  3MYV A;  2WXR A;  2X38 A;  1ELW A;  1VDY A;  3VTY A;  4Y6W A;  4WWP A;  3FFL A;  2FBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...