4O6FA

Structural basis of estrogen receptor alpha methylation mediated by histone methyltransferase smyd2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
430
structure length
430
Chain Sequence
AEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Insights into Estrogen Receptor alpha Methylation by Histone Methyltransferase SMYD2, a Cellular Event Implicated in Estrogen Signaling Regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 145
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4o6fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4o6fA01
3LY7A 4ABNA 3M56A 3BEEA 2FF4A 2IFUA 4YPAA 3QKYA 2VGYA 3PE3A 3TGOA 4GPKA 3Q15A 4WNDA 3OXLA 2MHKA 5G05C 2PZIA 5T5GA 4H12A 1W3BA 3Q5MA 4XIFA 3KMJA 1A17A 3LCAA 1FCHA 3M53A 2KATA 1QQEA 2XGOA 2IF4A 3E4BA 4QEPA 2R5SA 2UY1B 4QENA 2PQNA 4GZ5A 4CGVA 2XPIA 4JDSA 3CKBA 3KD7A 2FI7A 2WQHA 3SWCA 4JLGA 3SW9A 4J8FA 4HOTA 1ELWA 4J83A 4HOQA 3F9ZA 4WUYA 5HI7A 2VSYA 1PEGA 3QWVA 2OOEA 1OUVA 4GYYA 4JHRA 2Q7FA 3EDTB 4UQZA 5KJKA 4IJ8A 3LY9A 2W5ZA 3F9WA 4YNPA 2ONDA 4I51A 3M54A 4N39A 3FPDA 4AM9A 3VTXA 5A7DB 4NJ5A 4N3BA 5BNWA 4G1TA 5EKQD 4IJDA 1E96B 1NZNA 3UUXA 3VV0A 1WM5A 3MO5A 4GA1A 4CDRA 1P5QA 5ARFA 3F9XA 5KJNA 4J8DA 1IYGA 4RG6A 4JL0A 3N71A 3ZHEA 4F3VA 1QZ2A 3LY8A 4RZ0A 3KMTA 3TAXA 4MI0A 3ZHEB 1MT6A 3M58A 5LSZA 1N6CA 4I1AA 3MV3B 3ASDA 4RG9A 4KXKB 3S7FA 3ZFWA 2C0LA 3CVPA 1YA0A 4A1SA 4O30A 3CK7A 5JJ7A 3CV0A 4BTBA 2XCCA 3MA5A 2XGSA 4AY5A 2KCKA 3ASGA 5G05J 4JA7A 4UQYA 4H7YA 4UI9K 4YPUA 3Q49B 3RU0A 2FO7A 3CBPA 3OOIA 5FJYA 3QWPA 2O8JA 2AVPA 5EX0A 3UQ3A 3MEKA 3OXGA 4UI9C 3ASHA 3Q47B 3JYSA 1NA3A 3GYZA 1NA0A 3MO2A 4G26A 3MV2B 4NRHB 4J7IA 3ZN3A 3GZ2A 5FZRA 3S7DA 3K9IA 2JLBA 3NF1A 5AYWD 3RQ4A 4YVQC 2UWJG 3LKUA 3M5AA 3RO2A 4N3AA 1TJCA 5FTPA 4I9EA 3HNAA 3ULQA 5LSXA 5A6CA 4U0ZA 3CKCA 2YQ8A 3QWWA 3LYAA 3GW4A 4G24A 3BO5A 3LPZA 1MVXA 3VUZA 4ME2A 4HOSA 4EQFA 3RAYA 4YVOA 4WNGA 4GYWA 4N2QA 4U0SA 5DIZA 2E2EA 1H3IA 3O48A 3U3WA 2HR2A 5M72A 5EX3A 2BUGA 4GCNA 2P58C 4G2VA 4BTAA 3UPVA 5KJMA 4CGWA 5KJLA 3OS5A 5BW8C 2XCBA 4IN3B 1KLXA 2XGMA 5DBKA 3CBOA 2BQZA 3RJWA 3DALA 3DB5A 5CPRB 1WAO1 3U4TA 3AS8A 1HZ4A 1ZBPA 4J7FA 3ZPJA 3AS4A 4W9RA 3FWVA 4GYOA 5CHEE 3TG4A 4GZ6A 2FBNA 3ASFA 5D0QD 5T0KA 5JJ6A 4I2WA 3CVLA 2VYIA 4UQXA 4YNDA 4G23A 2DBAA 4AIFA 3M57A 5JJTA 4BUPA 4C1QA 2Y4TA 4YPEA 3QDNA 4WNFA 2KCLA 2I6HA 4J0UA 3OXFA 4UI9J 3VTYA 1O9SA 3S8PA 3SF4A 4G25A 3ZGQA 1HH8A 3RJVA 2WPVA 4YNMA 3TG5A 4LEUA 4GCOA 5JINA 4KYOB 2KCVA 4I17A 3AS5A 3URZA 3S7BA 1ZKKA 3KMAA 2QPWA 3M55A 4LDGA 4E47A 4KBQA 4Z4PA 3PDNA 5ARGA 1B89A 3M59A 5F59A 4J8OA 5CCLA 2C2LA 2RFIA 2FEZA 2VQ2A 1KT0A 3MKRA 5LCWC 2HO1A 5AYFA 3KS2A 5F6LA 3CVQA 3CVNA 2Y4UA 4HOUA 4BT9A 2UY1A 4FMUA 5JJ0A 5JIYA 2LSVA 5JHNA 5FZSA 1N3JA 3S7JA 5C1DA 3WXXA 4H7XA 1ELRA 2YHCA 3IHXA 1ML9A 4GA2A 4J8EA 4XI9A 5TTFA 2PQRA 3MO0A 3CK8A 3GZ1A 3KAEA 3R9AB 1MUFA 1IHGA 4GA0A 5FZQA 2F69A 4QEOA 2XEVA 1KT1A 4AY6A 1HXIA 4AU7A 2PL2A 3OPEA 3IEGA 3RO3A 5TH7A 3FFLA 5TEGA 3RIBA 2J9QA 5BT1A 1ZU2A 5F5EA 5T0MA 5CCMA 2LNIA 4O6FA 3K5KA 3CK9A 2GW1A 4U04A 3ESKA 4U0UA 4XI0A 4NVQA 5FT9A 5EG2A 4N2SA 3RKVA 4B94A 1MVHA 2KC7A 1N6AA 1XNFA 2QFCA 2JV0A 4I9CA 5G04J 3CEQA 5D0OD 4MI5A 4U07A 3CBMA 3HYMB 2C0MA 4HORA 4Y6CA 2R3AA 3Q4AB 3FP3A 3QOUA 4BWRA 2VGXA 4APOA 2VSNA 4N3CA 4GZ3A 3SZ7A 4I2ZA 1Y8MA 1PC2A 2LSUA 5G04C 4NQ0A 2G46A 2IGQA 3EP0A 2NC9A 2VGXB 4N5CA 2V5FA 4WNEA 5LCWJ 4Y6WA 3F9YA 4JA9A 2W5YA 1XQHA 2HYZA 2L6JA 4BT8A 3PE4A 5F6KC 5HQ8A
chains in the Genus database with same CATH superfamily
4LCTA 4ABNA 2XQ0A 3M56A 4BSXA 3RK6A 3TGOA 1TN6A 3OXLA 4PS8A 1PY1A 5CERB 4JC8A 3FH8A 4L9PA 3HHMA 3T5VA 3UM2A 1JCSA 3RSEG 4HS2A 3M53A 2ETBA 2X38A 2IF4A 4LNUD 5KWDA 4DX1A 5EIBE 4QENA 1MX4A 3I4GA 4CT4A 4JB8P 4JDSA 3CKBA 2WQHA 2F8YA 1HFAA 1INZA 3HXFA 3PVLA 4UWLA 2OOEA 2LUHA 4TXPA 4TUMA 3LY9A 2W5ZA 5CEAA 2GRQB 4AV7A 4AM9A 3VTXA 3FTZA 2AJAA 4G1TA 4L2LA 3C5RA 3CVVA 3IKOB 5BXUA 3VV0A 1WM5A 3KSQA 5H7PA 3D9OA 2XPYA 1P5QA 4O60A 2WVIA 3V31A 3L08A 4JL0A 2XRZA 3ZHEA 3SQVA 1E8ZA 4F6RD 3C98A 4F3VA 1QZ2A 4U8VD 3LJNA 4A3TA 2XHEA 3QARA 1E7VA 3UIPC 4KXKB 3S7FA 3ZFWA 3CVPA 3D9PA 4A1SA 4O30A 2J8SD 3CK7A 2EIJE 3D9NA 4I6GA 1G3NB 4AY5A 4ANXA 2A4ZA 3C3RA 1NP7A 3NAWA 5CBOA 4UWHA 4UQYA 5G05J 1FPPA 2ZXWE 1O1RA 2DYRE 3OOIA 5CMYA 3B7UX 5FJYA 1A5EA 2X6JA 5D66A 3UQ3A 1FVHA 4UI9C 4KVMA 3D9JA 3JYSA 3GYZA 3BUAA 1DCEA 4YDOA 1TN7A 4HVBA 3DSUA 4NRHB 2P9UG 3CHPA 3HXBA 3GZ2A 4B8CB 2V0PA 3X2QE 3APDA 4A63B 2JLBA 4DRXE 4YVQC 2UWJG 4BSZB 4JHJA 3RO2A 3CVUA 3DPDA 2R02A 2YQ8A 3UI2A 3VLEA 3G2UA 1OWPA 4G24A 3BO5A 3PH0C 2I9CA 1MVXA 3CHOA 1TNOA 4ME2A 4HOSA 3P1UA 1MX6A 4U0SA 5DIZA 1K1BA 3U3WA 5EN5D 1N0RA 2HR2A 3E33A 5IY5E 1UN9A 5EX3A 1KPSB 3FULA 3AAAC 4LSZE 3UINC 2P58C 3UPVA 5KJMA 2JEKA 1FVFA 3OS5A 5EILA 3FU6A 2WXHA 3RJWA 5CPRB 4NACA 1OWLA 3F6QA 2R05A 3E30A 3ONLA 1U3DA 4DLOA 3NQPA 4LNGA 4A3VA 3ZPJA 3L16A 3AS4A 3L22A 2XENA 3TG4A 2DIWA 5HRYA 1RW2A 4I2WA 4YNDA 2DBAA 5JJTA 2R03A 1H2UA 3CHQA 2P9KG 4YPEA 3BG1B 1IQUA 2KCLA 4KZCA 5AQ9A 1H2VC 3PZ2A 4GTSA 4FJZA 4FLHA 3RJVA 4L1BA 3E34A 3TG5A 3DXKG 1MQSA 3GZSA 4JEHA 3L13A 3OTNA 3S7BA 1TJFA 4GTVA 3NB2A 5CEDB 4LDGA 1EPUA 2WXMA 3ZNGA 3PUJA 3MJWA 5CMWA 2RFMA 4KBQA 3FUKA 4MBGA 1DCQA 1B89A 4J8SA 4Q96A 2C2LA 3MKRA 5KNHD 5AYFA 3KS2A 3UM1A 5F6LA 4GTTA 4ILGA 5HS0A 2Y4UA 4HOUA 1IHBA 4FMUA 1KZOA 3UMVA 4O1PA 5JHNA 5FZSA 4DX6D 4B89A 4H7XA 4GTRA 3PZ1A 1JWGA 4YDYA 2YHCA 3TWSA 2V5QC 2PQRA 3WG7E 4HXIA 3CK8A 1U2VG 2OVFA 3KAEA 1MUFA 1IHGA 2V4LA 2HE0A 4GA0A 3TL5A 2PM6A 3UKUG 1DNPA 2PM7A 5ENOD 4GAAA 3Q75A 4AY6A 4JZYA 3LVRE 1RZ4A 2PL2A 4CRWA 3IEGA 3RO3A 2MRIA 2CG3A 5BT1A 1ZU2A 2ZISA 3JXJA 5FQ8A 3HVEB 1YCSB 3CIAA 2GW1A 3UX4A 3ESKA 5FWQA 4XI0A 3BG0B 3ZYQA 1N4QA 3ZKJA 2KC7A 4I6EA 3PS6A 2GROB 4MI5A 1N9AA 5FQ6A 3CBMA 1D8DA 5EDSA 2VGEA 3Q4AB 4APOA 4GZ3A 3SZ7A 3PZ4A 1PC2A 4J8YA 1TYQG 4NQ0A 3PREA 4N5CA 3LDZA 4WNEA 3FDHA 2W5YA 1XQHA 2HYZA 2L6JA 3ZIMA 2EINE 2XEEA 4YPAA 3B7SA 2CHXA 3FUHA 2RD0A 4WNDA 4U8YD 5G05C 1W3BA 4LG6A 2WXRA 3AG4E 2X3MA 4ATZD 3KMJA 3CSFA 1A17A 3LCAA 1N4RA 1XGWA 1D9SA 1FCHA 4ZHBA 2J09A 2WB2A 1QQEA 3ULYA 2WXQA 2R5SA 2PQNA 1UW4B 3AG2E 4CGVA 2XPIA 2KM4A 4K0RA 2FI7A 4HBDA 4NIKA 4J8FA 3D3MA 1BLXB 4X8QA 4HOQA 3F9ZA 3UXGA 1JWFA 3HXCA 3EHMA 5JMND 3L82A 4JHRA 4EBAA 2Q7FA 4UQZA 4BESA 4IJ8A 3FH5A 4I51A 5A7DB 4NJ5A 5BNWA 3SFYA 3TWWA 5B1BE 2NSZA 1NZNA 3ENEA 3UUXA 1X5BA 3MO5A 4KT6B 5ANLA 5LOZA 1HX8A 3HDXA 4J8DA 5AARA 4DUIA 3FTVA 1HO8A 4QFVA 3ZEFA 3KSLA 3KMTA 4MI0A 4G11A 1N6CA 4WWPA 2AXVA 3DSVA 3ZUVB 4FJYA 3EJNA 3ZU7B 3CHMA 1DVPA 4BTBA 2XCCA 2XGSA 2ZU6B 3ONKA 3DEPA 3ZXSA 5HKPA 3U66A 3FTYA 4K5CA 4YPUA 1OCZE 3CGHA 3RU0A 1HS6A 5FQ4A 4MRUA 3CBPA 1O5MA 4XKBA 3AU5A 3QWPA 4U96D 2F8XK 2AVPA 3EHRA 1BI7B 3UTMA 1MX2A 1X81A 3Q47B 2QC9A 1OY3D 2NYJA 3RRUA 4F7AA 3MV2B 3TWRA 2IO2C 5FZRA 3ZVVA 3S7DA 2X6KA 3UM3A 3SBSA 3SBTB 3NF1A 3ASNE 4DK5A 2WXLA 3CR3A 3QJZA 4GMJA 1E90A 4I9EA 3ULQA 2CHZA 5BXOA 5A6CA 4U0ZA 2QY7A 3CKCA 3LYAA 3GW4A 3JQ1A 2RG8A 4NURA 3ISMC 4C9BB 2J08A 2P9LG 1EF1C 4YVOA 5BV1A 4AJWA 4PS7A 1H3IA 2E2EA 4LERA 2XPZA 2F37A 5M72A 3QAQA 3ZYMA 2OEWA 3T9KA 4EZJA 4G2VA 2WXOA 3BQOA 1NFIE 5BW8C 2XCBA 1HE8A 5DBKA 3CBOA 2BQZA 2ZIRA 4FA6A 1WAO1 4HRMB 2B6CA 5ENPD 1DC2A 3L54A 4J7FA 4CDNA 1BU9A 5E75A 4J7WA 3U9WA 4Q69A 4W9RA 5AAOA 1OWNA 5CHEE 4HB5A 2FBNA 4GPMA 4FHKA 2CG2A 2P9IG 5D0QD 5T0KA 2ZGDA 3DEOA 3SI5A 5J08A 3B7BA 1IXVA 4BEPA 3JQ0A 3OXFA 4HRLA 4G25A 3RAUA 3L9TA 1HH8A 3EUVA 4ATGA 2WPVA 5D2MC 2XS8A 3ZYKA 2R2LA 2IOSA 2VTBB 3KEAA 4GCOA 2LAIA 2WMNA 4KYOB 3G2SA 1MHQA 4DJAA 2AWIA 3KMAA 3LS8A 4L23A 4DX2A 2ETCA 1N52A 4RLYA 4E47A 4IYPA 4DX7D 1D8EA 3PDNA 5ARGA 2WXNA 4WWOA 4PS3A 2FEZA 1KT0A 3CVQA 1O1SA 1MJ0A 2IY0C 4GTMA 1NI1A 2J4BA 5JJ0A 5JIYA 4FADA 5C1DA 3JCKC 5E76A 3IHXA 2Y0BG 1ML9A 3FUDA 4J8EA 4LUNU 4ZFHA 4XI9A 2H6GA 3NBNB 3O4ZA 3DXMG 2F0YA 4YDEA 5FZQA 4OVUA 4QEOA 4AU7A 2GGFA 3FY4A 1TNUA 2J9QA 1H2TC 3PEUB 5ENNA 1SVXA 3B95A 5A23A 2KZTA 2WXPA 4NVQA 5FT9A 5EG2A 3RKVA 3HXEA 3EIJA 4OAUC 1TEZA 3PRZA 4I9CA 5G04J 5D0OD 4U07A 4XX5A 3G2WA 1JCRA 3PZ3A 3ZYLA 4FC8A 4RSYA 2R3AA 3QOUA 2ETAA 2VGXA 1WY6A 3TWQA 2ZGGA 4N3CA 3NZSA 1Y8MA 2LSUA 2EIKE 3L6AA 2YINA 2IGQA 4DI4A 2GRPB 2I1KA 5JA4D 3F9YA 4ACLA 4BT8A 3PE4A 5T3RA 5EYLA 2XRYA 2X6HA 5CRUA 3BEEA 1BI8B 2P2CP 5KNGA 2VGYA 3FUNA 3PE3A 4GPKA 3Q15A 2IJGX 2AXZA 1H0AA 2BEDA 2MHKA 4KZ0A 4HNAD 5T5GA 4BX8A 4XIFA 5ENSD 1N94A 3I5PA 3FH7A 4XEIG 4ILIA 2XGOA 4QEPA 2WXKA 5B3SE 4GZ5A 1O1TA 5EYPF 1E8XA 3SWCA 1GW6A 3SW9A 3UT7A 3UIOC 1ELWA 3DSSA 3ML8A 4WUYA 5HI7A 4B8AA 3QWVA 2H6FA 4IULA 1OUVA 1SA5A 4V3IA 4RQIA 3OAWA 4DPRA 3AG1E 4YNPA 1N4PA 2ONDA 3FTWA 3KEZA 3T8KA 4N39A 4GMLA 4N3BA 1IQRA 5EKQD 1E96B 4LRZA 4BFRA 5CBNA 4CDRA 2H6HA 3IHYA 3C3QA 4JVSA 5ARFA 3F9XA 2DWZA 2Y3AA 2RKKA 5KJNA 2MOWA 3E37A 2DVWA 3N71A 5BPPA 3NOGD 3PNLB 3ULEG 4RZ0A 3IV0A 3EU5A 2OV8A 4LNBA 3TAXA 1SZ9A 4PH4B 1S70B 3ZHEB 5LSZA 3UT8A 3FTXA 1H6KA 1IKND 2I2OA 2VTBA 3LVQE 4TRQA 4GU5A 4PDXA 2EQXA 3SNXA 2P9SG 1E7UA 1UG3A 4H7YA 3Q49B 5FINA 3RRNB 2FO7A 3SD5A 1SZAA 2CFZA 3FU5A 2O8JA 5CRVA 1NL4A 3OXGA 3ZW3A 3ASHA 1NA0A 5G55A 3DSWA 4P29A 2J49A 1JUQA 5ITZF 4XZ4A 3CSTA 2WXIA 4EBAG 2JABA 4U63A 2GRMA 4BERA 2WXFA 5AYWD 3RQ4A 3LKUA 3M5AA 4EZLA 1E8YA 4N3AA 1TJCA 4EHMA 3HNAA 3CVWA 2QYJA 3QWWA 4DX5D 4F1PA 2BF0X 1HG2A 4K03A 4O1OA 3ASOE 1Q2ZA 3VUZA 4JW1A 2WXJA 1OXJA 3RAYA 4GYWA 4FHJA 2YNQA 2NXPA 3O48A 4U8HA 1N95A 3EHNA 4JPSA 4BTAA 3FEXA 2WM9A 4CGWA 3CQGB 1E8WA 5KJLA 2V8SE 1KLXA 2J07A 2CHWA 3Q7FA 3RRMB 1HZ4A 1ZBPA 4DLQA 4L2YA 2X6IA 4OAVB 2GRRB 2B0OE 3J5PA 2QZAA 3MKQB 1TR4A 1Z3XA 3VLDA 4GZ6A 4FULA 1LTXA 5KCMA 2VYIA 4UQXA 4AIFA 3M57A 4BUPA 2EIME 3QDNA 4WNFA 3TWTA 2I6HA 2H6IA 2A5EA 3VTYA 3FEYA 3QNKA 4HLLA 4G8LA 3R9MA 1ELKA 3Q9NC 1K8KG 4YNMA 4LEUA 2KCVA 3G2VA 3NOCD 3TJPA 1V54E 3TXNA 3AS5A 3URZA 5BUZA 4JHKA 3TWXA 2Y1LE 5LFAA 2LXMA 2QPWA 4M7CA 1V55E 3M55A 1UJKA 4A1GA 4HFGA 4I43A 1Z6TA 1OWMA 5JHAA 1TNYA 4GZCA 3M59A 4MKTA 4TV3A 3Q78A 2R59A 2RFIA 4UWFA 3FTUA 1HF8A 4DI3A 3DWLG 4HLEA 4JXTA 2LSVA 1OCRE 1UJJA 1JCQA 2AXUA 2IU1A 4FU3A 4GA2A 5TTFA 1BPOA 5EIDA 2XZTG 3R9AB 3W9GA 2X6FA 4F1SA 2XEVA 1KT1A 2VSXE 2Y69E 3HVEA 3OPEA 3R7QA 4EZKA 1K3ZD 5TH7A 2GRNB 3FFLA 1N11A 3FUEA 3RIBA 3QK0A 3AG3E 4ILHB 4WAFA 3V2OA 3CHSA 3K5KA 3C72A 4U04A 3I3NA 3JUIA 3SFXA 4U0UA 4FP7A 2GRLA 3D9LA 1MVHA 4EECA 1XNFA 4CDMA 3HG0D 4HRNA 3PZDA 2HM8A 3HYMB 4I6JA 2C0MA 4Y6CA 1SW6A 3FP3A 4BWRA 3E32A 4I2ZA 4U95D 3V79K 2G46A 2NC9A 4I1OB 4C0EA 5LCWJ 4JA9A 1LD8A 3TXMA 1U3CA 1SA4A 4AEZC 4UWKA 5F6KC 3MGBA 2DCPA 3IXEA 3LY7A 3SHFA 2V4HC 2FF4A 3G2TA 2IFUA 4UUCA 3QKYA 2FO1E 1MYOA 3ESLA 4K5BA 3B7TA 2YHEA 2LO6A 2PZIA 5FIOA 4H12A 2XEHA 2VSOE 3Q5MA 3Q79A 4CCAA 4AXHA 2KATA 1AP7A 3L17A 3E4BA 4TUUA 2UY1B 1H6PA 3KD7A 2PNNA 4JLGA 5LP0A 4HI9A 4HOTA 4J83A 3UKRG 2VSYA 1PEGA 4HI8A 4OYSA 4GYYA 1JPLA 3EDTB 5KJKA 2OCCE 1SQMA 3F9WA 1WG0A 1HU3A 3M54A 3PEVB 4N5QA 3HIZA 3DSXA 3FPDA 4IJDA 2IONA 4PUCA 3PUKA 4GA1A 3HRAA 4KMOA 1YYHA 4M3OA 4E85A 1IYGA 4RG6A 2I1JA 3CQCB 3B7RL 3ZXPA 5AQBA 3MKQA 5AJLA 4QQIA 1Z3YA 3LY8A 5T8IA 4RVBA 4FLBA 5LX8A 1MT6A 4BX9A 3M58A 4I1AA 3MV3B 3ASDA 3MYVA 4RG9A 4BETA 2C0LA 1YA0A 3Q7AA 1BD8A 5AIJA 5JJ7A 4J6IA 4C48B 3CV0A 3MA5A 4K5AB 3S2AA 4APFA 5ENTD 1OCOE 2KCKA 2DZOA 3ASGA 2CFUA 4JA7A 4UI9K 3I4RB 4URKA 4MLPA 3CLJA 4WWNA 4CT0A 5EX0A 2OVBA 5CECB 2R17C 3ABLE 3MEKA 3T5XA 3D9IA 1AWCB 4CYMD 3LEWA 2DZNA 3MO2A 1NA3A 1QBQA 2IEJA 3FUIA 3Q9UC 4G26A 2AW6A 3LXUX 4A55A 4J7IA 3ZN3A 5C2YA 4HQDA 2KXPC 3K9IA 1FT1A 3MZLB 2WMOA 1EYHA 4Z68A 4BY6A 5FQ7A 3T8MA 5FTPA 3MCXA 5LSXA 3NZUA 2BKKB 1L5JA 4IRUA 2KBXA 3AJIA 3LPZA 3EHQA 4B0ZA 1H6OA 4EQFA 2IQCA 4ANWA 4WNGA 3ML9A 2L9BA 4EPZA 4N2QA 5T4YA 1UN8A 1UOHA 2L0TB 3FUJA 3IHVA 2BUGA 2XS1A 4GCNA 4U7EB 1S64A 2WQ6A 4IN3B 2XGMA 4GMRA 2L0IA 3SGHA 2J4DA 1FT2A 3UT4A 4ACKA 3DALA 3DB5A 1S63A 2L6BA 4ANVA 3U4TA 3AS8A 1PAQA 5ENRD 3TWUA 1Z5SC 3FHEA 4C0MA 3FWVA 4GYOA 3SO8A 3JXIA 3W9FA 2EILE 3ASFA 5JJ6A 1N54A 3CVLA 3U64A 4G23A 5AQAA 2BKGA 4C1QA 2RFAA 2Y4TA 2QYUA 4J0UA 4UI9J 1O9SA 3S8PA 3SF4A 3LJ3A 3ZGQA 4OVVA 2LXLA 1Y6IA 4AOFA 1N4SA 1TNBA 4JEUA 5JHBA 2VJ8A 5JINA 3VLFA 1LF8A 2MYOA 4I17A 4XKCA 1WDYA 3QB2A 4AP2A 1ZKKA 3DRAA 3ABME 3PNTB 3ABKE 4KVOA 3TWVA 4ANUA 4GTQA 2BTDA 3SY2A 4CZ2D 1LD7A 3DPYA 4Z4PA 1YMPA 2WQ7A 5AN8A 4GZDA 1OWOA 3V2XA 3APCA 4TXQA 5F59A 4J8OA 5CCLA 1QNFA 5BV0A 2VQ2A 5ANRA 5LCWC 2HO1A 3CVNA 3D9MA 1OCCE 4L7TA 4BT9A 2UY1A 3V30A 4R7LA 3EIQC 1VDYA 3EU9A 4UWGA 2IO3C 2DYSE 1ZB1A 1N3JA 3S7JA 3C3OA 3WXXA 4I1MA 3MX3A 1ELRA 2P9PG 4CEMA 4TXRA 2A5UA 3CVXA 3FU3A 4AVXA 3MO0A 3GZ1A 1H19A 4GTOA 2F69A 3CVYA 3FUFA 3HXDA 3Q73A 4G8KA 4D10C 1HXIA 3BU8A 2IOLA 3IBEA 3SFZA 2OEVA 5TEGA 3JUEA 5F5EA 1K1AA 4YDWA 5T0MA 5AQ7A 5CCMA 1TN8A 3D9KA 2LNIA 3FTSA 4O6FA 3R7RA 3DBSA 3CK9A 1QYMA 5B1AE 3ZRHA 2M63A 3APFA 5AENA 1S0PA 5J90A 3QC1A 4GB9A 3FUMA 4F53A 2XZDG 4N2SA 4B94A 1N6AA 1OT8A 5G2NA 2QFCA 2JV0A 5ENQD 3CEQA 1KZPA 2ILRA 3J5QB 5AJDA 2KZTB 3P2BA 2E0IA 3DSTA 4HORA 3B13A 4MS6A 2WXGA 2VSNA 3FU0A 1MZCA 4JD2G 3D9HA 4B93B 1N0QA 3AU4A 5G04C 4XE0A 2P9NG 1HG5A 3EP0A 1TNZA 2VGXB 2LAHA 3UM0A 4E6HA 2V5FA 2FULA 1EDUA 4Y6WA 4Q94A 3CHRA 4GTPA 5HQ8A 5KBAA
chains in the Genus database with same CATH topology
2DCPA 2XRYA 4LCTA 3LY7A 3ZIMA 4ABNA 2X6HA 2XQ0A 3SHFA 3M56A 3BEEA 4BSXA 2FF4A 3G2TA 2IFUA 3RK6A 4YPAA 3QKYA 2VGYA 3FUNA 3PE3A 3B7SA 3TGOA 2CHXA 3FUHA 3Q15A 2RD0A 4WNDA 3ESLA 4GPKA 3OXLA 2IJGX 4PS8A 2AXZA 1PY1A 3B7TA 2YHEA 1H0AA 2MHKA 2LO6A 5G05C 4KZ0A 2PZIA 4JC8A 5T5GA 4H12A 3FH8A 2VSOE 1W3BA 3HHMA 4BX8A 2WXRA 3T5VA 3Q5MA 4XIFA 2X3MA 4CCAA 3KMJA 3CSFA 1A17A 3LCAA 3I5PA 1XGWA 1FCHA 3FH7A 4HS2A 2J09A 4AXHA 2KATA 2WB2A 1QQEA 2X38A 4ILIA 3M53A 2XGOA 2IF4A 3L17A 3E4BA 2WXQA 2R5SA 4QEPA 4TUUA 2UY1B 2WXKA 2PQNA 1UW4B 4QENA 4GZ5A 3I4GA 4CT4A 2XPIA 4CGVA 2KM4A 3CKBA 1E8XA 2FI7A 2WQHA 3KD7A 4K0RA 4JDSA 1HFAA 1INZA 3SWCA 4JLGA 1GW6A 5LP0A 3UT7A 4J8FA 3SW9A 3D3MA 4HOTA 1ELWA 4J83A 4HOQA 3F9ZA 3ML8A 4WUYA 5HI7A 3PVLA 2VSYA 1PEGA 1JWFA 3QWVA 4B8AA 4OYSA 4UWLA 4IULA 2OOEA 1OUVA 3EHMA 4GYYA 4V3IA 1JPLA 3OAWA 4JHRA 4EBAA 2Q7FA 4DPRA 3EDTB 4UQZA 5KJKA 4IJ8A 3LY9A 2W5ZA 1SQMA 3F9WA 4YNPA 3FH5A 1HU3A 2ONDA 4I51A 3FTWA 3M54A 3KEZA 3PEVB 3HIZA 4N39A 4AV7A 3FPDA 4GMLA 4AM9A 3VTXA 5A7DB 3FTZA 4N3BA 4NJ5A 5BNWA 4G1TA 1IQRA 4L2LA 5EKQD 4IJDA 2IONA 4PUCA 3PUKA 1E96B 2NSZA 3CVVA 1NZNA 3IKOB 3ENEA 3UUXA 4LRZA 4BFRA 3VV0A 1X5BA 1WM5A 3MO5A 4GA1A 4KT6B 4CDRA 4KMOA 5ANLA 3IHYA 3D9OA 2XPYA 1P5QA 5LOZA 4JVSA 5ARFA 3F9XA 4M3OA 1HX8A 2Y3AA 3HDXA 4J8DA 4E85A 5KJNA 1IYGA 2MOWA 2WVIA 4RG6A 3L08A 4JL0A 2I1JA 3CQCB 3B7RL 3N71A 3ZHEA 2XRZA 3FTVA 5BPPA 1E8ZA 3PNLB 3C98A 3MKQA 5AJLA 1HO8A 4F3VA 1QZ2A 4QFVA 1Z3YA 3LY8A 3ZEFA 4RZ0A 3IV0A 2OV8A 5T8IA 3KMTA 3TAXA 4MI0A 1SZ9A 4PH4B 4RVBA 4A3TA 2XHEA 4FLBA 3QARA 4G11A 3ZHEB 4BX9A 1E7VA 5LX8A 1MT6A 3M58A 1N6CA 5LSZA 4WWPA 2AXVA 4I1AA 3MV3B 5HQ8A 3ASDA 3MYVA 3UT8A 4RG9A 4KXKB 3S7FA 3FTXA 3ZFWA 4FJYA 3EJNA 2C0LA 3CVPA 1YA0A 3D9PA 4A1SA 4O30A 3CK7A 5AIJA 1H6KA 3D9NA 5JJ7A 4I6GA 3CHMA 4J6IA 1DVPA 2I2OA 3CV0A 4BTBA 2XCCA 3MA5A 2XGSA 2ZU6B 4AY5A 3ONKA 4ANXA 2A4ZA 2VTBA 3LVQE 3S2AA 4APFA 1NP7A 4TRQA 3ZXSA 4GU5A 2KCKA 3ASGA 4PDXA 2EQXA 3U66A 3SNXA 1E7UA 1UG3A 2CFUA 3FTYA 4UWHA 4JA7A 4UQYA 5G05J 4H7YA 3I4RB 4UI9K 4URKA 4YPUA 3CGHA 3Q49B 4MLPA 3RRNB 3RU0A 1HS6A 2FO7A 5FQ4A 3SD5A 4MRUA 3CBPA 4XKBA 3CLJA 4WWNA 5CMYA 3B7UX 3OOIA 5FJYA 3AU5A 3QWPA 1SZAA 2CFZA 2X6JA 3FU5A 2O8JA 4CT0A 2AVPA 5EX0A 2OVBA 3UQ3A 1FVHA 2R17C 3MEKA 3OXGA 4UI9C 3D9IA 3T5XA 3ZW3A 4KVMA 3ASHA 3Q47B 3D9JA 3LEWA 3JYSA 1NA3A 3GYZA 1NA0A 5G55A 3MO2A 4P29A 3FUIA 3RRUA 2J49A 1JUQA 4F7AA 4G26A 3MV2B 4XZ4A 4HVBA 2AW6A 3LXUX 4NRHB 3CSTA 2WXIA 4A55A 3CHPA 4EBAG 4J7IA 3ZN3A 3GZ2A 4U63A 4B8CB 5FZRA 2GRMA 3ZVVA 5C2YA 2V0PA 3S7DA 2X6KA 3APDA 3K9IA 3CVUA 3MZLB 2WXFA 3SBSA 3SBTB 2JLBA 3NF1A 2WMOA 5AYWD 3RQ4A 1EYHA 4YVQC 2UWJG 3LKUA 4BY6A 3M5AA 4DK5A 4EZLA 1E8YA 2WXLA 3CR3A 3QJZA 4GMJA 4JHJA 4N3AA 5FQ7A 1TJCA 3RO2A 5FTPA 1E90A 4I9EA 3ULQA 3MCXA 3CVWA 3HNAA 5LSXA 2CHZA 3DPDA 3NZUA 5A6CA 1L5JA 2QY7A 3CKCA 4U0ZA 2YQ8A 3VLEA 3QWWA 3G2UA 3LYAA 2BF0X 3GW4A 4IRUA 1OWPA 1HG2A 3JQ1A 5EG2A 4G24A 3BO5A 3PH0C 2RG8A 4K03A 3LPZA 4NURA 2I9CA 1MVXA 3CHOA 3VUZA 4C9BB 4ME2A 2J08A 4JW1A 4HOSA 4B0ZA 2WXJA 4EQFA 2IQCA 3P1UA 4ANWA 3RAYA 1EF1C 4YVOA 5BV1A 4WNGA 4GYWA 3ML9A 2L9BA 4AJWA 4EPZA 4N2QA 4FHJA 2YNQA 2NXPA 4PS7A 4U0SA 2E2EA 4LERA 5DIZA 3O48A 1H3IA 4U8HA 5T4YA 3U3WA 3T8MA 2XPZA 2HR2A 1UN8A 2L0TB 3FUJA 5M72A 1UN9A 3EHNA 3IHVA 3QAQA 4JPSA 5EX3A 3ZYMA 2BUGA 3FULA 4EZJA 4GCNA 2P58C 4G2VA 4BTAA 3FEXA 3UPVA 2WXOA 5KJMA 2WM9A 4CGWA 2JEKA 1FVFA 3CQGB 1E8WA 5KJLA 3OS5A 2WQ6A 5BW8C 2V8SE 3FU6A 2XCBA 4IN3B 1KLXA 2WXHA 2XGMA 1HE8A 2L0IA 5DBKA 2J4DA 2J07A 2CHWA 3SGHA 2BQZA 3CBOA 3RJWA 3UT4A 4ACKA 4FA6A 3DALA 3DB5A 5CPRB 4NACA 1OWLA 3RRMB 1WAO1 3U4TA 3AS8A 4ANVA 1HZ4A 1ZBPA 1PAQA 4DLQA 4L2YA 2X6IA 3ONLA 1U3DA 4DLOA 3NQPA 3FHEA 3L54A 4A3VA 4CDNA 4J7FA 3ZPJA 4C0MA 5E75A 3L16A 3AS4A 3U9WA 4Q69A 3L22A 4W9RA 3FWVA 3MKQB 4GYOA 1OWNA 1Z3XA 5CHEE 3TG4A 3VLDA 4GZ6A 2DIWA 2FBNA 3ASFA 4FHKA 2CG2A 4FULA 5KCMA 5D0QD 5T0KA 5JJ6A 4I2WA 1N54A 3CVLA 3U64A 2VYIA 4UQXA 4YNDA 4G23A 2DBAA 3SI5A 4AIFA 5J08A 5JJTA 3M57A 4BUPA 4C1QA 1H2UA 3CHQA 2Y4TA 4YPEA 3QDNA 4WNFA 3BG1B 1IQUA 2KCLA 2I6HA 4KZCA 1H2VC 4J0UA 3JQ0A 3OXFA 4UI9J 3VTYA 1O9SA 3S8PA 3SF4A 3LJ3A 4G25A 3ZGQA 4FJZA 4FLHA 1HH8A 3FEYA 4OVVA 3QNKA 3RJVA 2WPVA 4ATGA 1Y6IA 1ELKA 3ZYKA 4L1BA 4AOFA 2IOSA 4JEUA 2VTBB 4YNMA 3TG5A 5JHBA 4LEUA 1MQSA 2VJ8A 4GCOA 3GZSA 5JINA 2LAIA 2WMNA 3VLFA 1LF8A 4KYOB 2KCVA 3G2VA 3G2SA 4JEHA 3TJPA 1MHQA 4I17A 4XKCA 4DJAA 3TXNA 3L13A 3QB2A 3AS5A 3OTNA 3URZA 5BUZA 4JHKA 3S7BA 4AP2A 5LFAA 2AWIA 1ZKKA 3KMAA 1TJFA 2QPWA 3LS8A 4L23A 3PNTB 3M55A 1UJKA 4KVOA 4A1GA 4LDGA 4ANUA 1N52A 1EPUA 2WXMA 3PUJA 3MJWA 4HFGA 2BTDA 4IYPA 4KBQA 5CMWA 4I43A 4E47A 1Z6TA 4Z4PA 3FUKA 1OWMA 5JHAA 3PDNA 5ARGA 4GZDA 1B89A 4GZCA 2WQ7A 1OWOA 3M59A 4MKTA 4J8SA 3APCA 4TV3A 5F59A 2R59A 4J8OA 4Q96A 2WXNA 4WWOA 5CCLA 1QNFA 2C2LA 2FEZA 4PS3A 2RFIA 4UWFA 5BV0A 2VQ2A 1KT0A 3MKRA 5ANRA 2HO1A 5LCWC 5AYFA 3KS2A 5F6LA 3CVQA 3CVNA 4ILGA 3D9MA 2Y4UA 4HOUA 4L7TA 4BT9A 2UY1A 2J4BA 4FMUA 5JJ0A 4R7LA 3FTUA 1HF8A 3EIQC 5JIYA 1VDYA 4DI3A 3UMVA 4FADA 4HLEA 4JXTA 2LSVA 4UWGA 5JHNA 5FZSA 1N3JA 1UJJA 4B89A 3S7JA 5C1DA 3WXXA 2AXUA 4H7XA 2IU1A 1JWGA 4I1MA 3MX3A 1ELRA 3JCKC 5E76A 2YHCA 4CEMA 3IHXA 1ML9A 4FU3A 3FUDA 4GA2A 4J8EA 2A5UA 4LUNU 3CVXA 4XI9A 3FU3A 5TTFA 1BPOA 2PQRA 4AVXA 3MO0A 4HXIA 3CK8A 3GZ1A 3O4ZA 1H19A 2OVFA 3KAEA 3R9AB 1MUFA 1IHGA 2V4LA 4GA0A 3TL5A 5FZQA 4F1SA 2X6FA 2F69A 2PM6A 4OVUA 1DNPA 3CVYA 4QEOA 2XEVA 3FUFA 2PM7A 1KT1A 2VSXE 4GAAA 4AY6A 4JZYA 4D10C 1HXIA 4AU7A 2GGFA 3FY4A 3HVEA 3LVRE 2PL2A 4CRWA 3OPEA 2IOLA 3R7QA 3IEGA 3IBEA 2MRIA 3RO3A 3SFZA 4EZKA 5TH7A 3FFLA 5TEGA 3FUEA 3RIBA 2CG3A 2J9QA 5BT1A 4ILHB 1ZU2A 5F5EA 1H2TC 4WAFA 5T0MA 5CCMA 3D9KA 5FQ8A 3HVEB 2LNIA 3CHSA 3FTSA 3PEUB 4O6FA 3R7RA 3K5KA 5ENNA 3CIAA 3DBSA 3CK9A 2GW1A 4U04A 3UX4A 3ZRHA 3I3NA 2M63A 3APFA 3ESKA 3JUIA 5A23A 4U0UA 5FWQA 1S0PA 4XI0A 2KZTA 2WXPA 3BG0B 5AENA 3QC1A 4FP7A 4GB9A 5FT9A 2GRLA 3FUMA 3ZYQA 4F53A 5J90A 4NVQA 4N2SA 3RKVA 4B94A 3D9LA 3EIJA 2KC7A 4EECA 1MVHA 1N6AA 1XNFA 4I6EA 1TEZA 4CDMA 3PS6A 2QFCA 5G2NA 3PRZA 2JV0A 4I9CA 5G04J 3CEQA 5D0OD 3PZDA 2ILRA 5AJDA 4MI5A 2KZTB 3P2BA 4U07A 5FQ6A 3CBMA 2HM8A 3G2WA 4XX5A 2E0IA 3ZYLA 3HYMB 4FC8A 4I6JA 2C0MA 4RSYA 5EDSA 4HORA 4Y6CA 2R3AA 3Q4AB 3FP3A 3QOUA 4BWRA 2VGXA 3B13A 4MS6A 1WY6A 2WXGA 4APOA 2VSNA 3FU0A 4N3CA 4GZ3A 3SZ7A 3NZSA 4I2ZA 1Y8MA 1PC2A 2LSUA 3AU4A 3L6AA 5G04C 4NQ0A 2YINA 4XE0A 1HG5A 2G46A 2IGQA 3PREA 2NC9A 4DI4A 2VGXB 2LAHA 4N5CA 3EP0A 3LDZA 2I1KA 4E6HA 2V5FA 2FULA 1EDUA 4I1OB 4WNEA 4C0EA 5LCWJ 4Y6WA 3F9YA 3FDHA 4JA9A 4Q94A 1XQHA 3TXMA 2W5YA 1U3CA 2HYZA 2L6JA 3CHRA 4ACLA 4AEZC 3PE4A 4BT8A 4UWKA 5T3RA 3QK0A 5F6KC 3MGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LY7 A;  4ABN A;  3M56 A;  3BEE A;  2FF4 A;  2IFU A;  4YPA A;  3QKY A;  2VGY A;  3PE3 A;  3TGO A;  4GPK A;  3Q15 A;  4WND A;  3OXL A;  2MHK A;  5G05 C;  2PZI A;  5T5G A;  4H12 A;  1W3B A;  3Q5M A;  4XIF A;  3KMJ A;  1A17 A;  3LCA A;  1FCH A;  3M53 A;  2KAT A;  1QQE A;  2XGO A;  2IF4 A;  3E4B A;  4QEP A;  2R5S A;  2UY1 B;  4QEN A;  2PQN A;  4GZ5 A;  4CGV A;  2XPI A;  4JDS A;  3CKB A;  3KD7 A;  2FI7 A;  2WQH A;  3SWC A;  4JLG A;  3SW9 A;  4J8F A;  4HOT A;  1ELW A;  4J83 A;  4HOQ A;  3F9Z A;  4WUY A;  5HI7 A;  2VSY A;  1PEG A;  3QWV A;  2OOE A;  1OUV A;  4GYY A;  4JHR A;  2Q7F A;  3EDT B;  4UQZ A;  5KJK A;  4IJ8 A;  3LY9 A;  2W5Z A;  3F9W A;  4YNP A;  2OND A;  4I51 A;  3M54 A;  4N39 A;  3FPD A;  4AM9 A;  3VTX A;  5A7D B;  4NJ5 A;  4N3B A;  5BNW A;  4G1T A;  5EKQ D;  4IJD A;  1E96 B;  1NZN A;  3UUX A;  3VV0 A;  1WM5 A;  3MO5 A;  4GA1 A;  4CDR A;  1P5Q A;  5ARF A;  3F9X A;  5KJN A;  4J8D A;  1IYG A;  4RG6 A;  4JL0 A;  3N71 A;  3ZHE A;  4F3V A;  1QZ2 A;  3LY8 A;  4RZ0 A;  3KMT A;  3TAX A;  4MI0 A;  3ZHE B;  1MT6 A;  3M58 A;  5LSZ A;  1N6C A;  4I1A A;  3MV3 B;  3ASD A;  4RG9 A;  4KXK B;  3S7F A;  3ZFW A;  2C0L A;  3CVP A;  1YA0 A;  4A1S A;  4O30 A;  3CK7 A;  5JJ7 A;  3CV0 A;  4BTB A;  2XCC A;  3MA5 A;  2XGS A;  4AY5 A;  2KCK A;  3ASG A;  5G05 J;  4JA7 A;  4UQY A;  4H7Y A;  4UI9 K;  4YPU A;  3Q49 B;  3RU0 A;  2FO7 A;  3CBP A;  3OOI A;  5FJY A;  3QWP A;  2O8J A;  2AVP A;  5EX0 A;  3UQ3 A;  3MEK A;  3OXG A;  4UI9 C;  3ASH A;  3Q47 B;  3JYS A;  1NA3 A;  3GYZ A;  1NA0 A;  3MO2 A;  4G26 A;  3MV2 B;  4NRH B;  4J7I A;  3ZN3 A;  3GZ2 A;  5FZR A;  3S7D A;  3K9I A;  2JLB A;  3NF1 A;  5AYW D;  3RQ4 A;  4YVQ C;  2UWJ G;  3LKU A;  3M5A A;  3RO2 A;  4N3A A;  1TJC A;  5FTP A;  4I9E A;  3HNA A;  3ULQ A;  5LSX A;  5A6C A;  4U0Z A;  3CKC A;  2YQ8 A;  3QWW A;  3LYA A;  3GW4 A;  4G24 A;  3BO5 A;  3LPZ A;  1MVX A;  3VUZ A;  4ME2 A;  4HOS A;  4EQF A;  3RAY A;  4YVO A;  4WNG A;  4GYW A;  4N2Q A;  4U0S A;  5DIZ A;  2E2E A;  1H3I A;  3O48 A;  3U3W A;  2HR2 A;  5M72 A;  5EX3 A;  2BUG A;  4GCN A;  2P58 C;  4G2V A;  4BTA A;  3UPV A;  5KJM A;  4CGW A;  5KJL A;  3OS5 A;  5BW8 C;  2XCB A;  4IN3 B;  1KLX A;  2XGM A;  5DBK A;  3CBO A;  2BQZ A;  3RJW A;  3DAL A;  3DB5 A;  5CPR B;  1WAO 1;  3U4T A;  3AS8 A;  1HZ4 A;  1ZBP A;  4J7F A;  3ZPJ A;  3AS4 A;  4W9R A;  3FWV A;  4GYO A;  5CHE E;  3TG4 A;  4GZ6 A;  2FBN A;  3ASF A;  5D0Q D;  5T0K A;  5JJ6 A;  4I2W A;  3CVL A;  2VYI A;  4UQX A;  4YND A;  4G23 A;  2DBA A;  4AIF A;  3M57 A;  5JJT A;  4BUP A;  4C1Q A;  2Y4T A;  4YPE A;  3QDN A;  4WNF A;  2KCL A;  2I6H A;  4J0U A;  3OXF A;  4UI9 J;  3VTY A;  1O9S A;  3S8P A;  3SF4 A;  4G25 A;  3ZGQ A;  1HH8 A;  3RJV A;  2WPV A;  4YNM A;  3TG5 A;  4LEU A;  4GCO A;  5JIN A;  4KYO B;  2KCV A;  4I17 A;  3AS5 A;  3URZ A;  3S7B A;  1ZKK A;  3KMA A;  2QPW A;  3M55 A;  4LDG A;  4E47 A;  4KBQ A;  4Z4P A;  3PDN A;  5ARG A;  1B89 A;  3M59 A;  5F59 A;  4J8O A;  5CCL A;  2C2L A;  2RFI A;  2FEZ A;  2VQ2 A;  1KT0 A;  3MKR A;  5LCW C;  2HO1 A;  5AYF A;  3KS2 A;  5F6L A;  3CVQ A;  3CVN A;  2Y4U A;  4HOU A;  4BT9 A;  2UY1 A;  4FMU A;  5JJ0 A;  5JIY A;  2LSV A;  5JHN A;  5FZS A;  1N3J A;  3S7J A;  5C1D A;  3WXX A;  4H7X A;  1ELR A;  2YHC A;  3IHX A;  1ML9 A;  4GA2 A;  4J8E A;  4XI9 A;  5TTF A;  2PQR A;  3MO0 A;  3CK8 A;  3GZ1 A;  3KAE A;  3R9A B;  1MUF A;  1IHG A;  4GA0 A;  5FZQ A;  2F69 A;  4QEO A;  2XEV A;  1KT1 A;  4AY6 A;  1HXI A;  4AU7 A;  2PL2 A;  3OPE A;  3IEG A;  3RO3 A;  5TH7 A;  3FFL A;  5TEG A;  3RIB A;  2J9Q A;  5BT1 A;  1ZU2 A;  5F5E A;  5T0M A;  5CCM A;  2LNI A;  4O6F A;  3K5K A;  3CK9 A;  2GW1 A;  4U04 A;  3ESK A;  4U0U A;  4XI0 A;  4NVQ A;  5FT9 A;  5EG2 A;  4N2S A;  3RKV A;  4B94 A;  1MVH A;  2KC7 A;  1N6A A;  1XNF A;  2QFC A;  2JV0 A;  4I9C A;  5G04 J;  3CEQ A;  5D0O D;  4MI5 A;  4U07 A;  3CBM A;  3HYM B;  2C0M A;  4HOR A;  4Y6C A;  2R3A A;  3Q4A B;  3FP3 A;  3QOU A;  4BWR A;  2VGX A;  4APO A;  2VSN A;  4N3C A;  4GZ3 A;  3SZ7 A;  4I2Z A;  1Y8M A;  1PC2 A;  2LSU A;  5G04 C;  4NQ0 A;  2G46 A;  2IGQ A;  3EP0 A;  2NC9 A;  2VGX B;  4N5C A;  2V5F A;  4WNE A;  5LCW J;  4Y6W A;  3F9Y A;  4JA9 A;  2W5Y A;  1XQH A;  2HYZ A;  2L6J A;  4BT8 A;  3PE4 A;  5F6K C;  5HQ8 A; 
#chains in the Genus database with same CATH topology
 4LCT A;  4ABN A;  2XQ0 A;  3M56 A;  4BSX A;  3RK6 A;  3TGO A;  1TN6 A;  3OXL A;  4PS8 A;  1PY1 A;  5CER B;  4JC8 A;  3FH8 A;  4L9P A;  3HHM A;  3T5V A;  3UM2 A;  1JCS A;  3RSE G;  4HS2 A;  3M53 A;  2ETB A;  2X38 A;  2IF4 A;  4LNU D;  5KWD A;  4DX1 A;  5EIB E;  4QEN A;  1MX4 A;  3I4G A;  4CT4 A;  4JB8 P;  4JDS A;  3CKB A;  2WQH A;  2F8Y A;  1HFA A;  1INZ A;  3HXF A;  3PVL A;  4UWL A;  2OOE A;  2LUH A;  4TXP A;  4TUM A;  3LY9 A;  2W5Z A;  5CEA A;  2GRQ B;  4AV7 A;  4AM9 A;  3VTX A;  3FTZ A;  2AJA A;  4G1T A;  4L2L A;  3C5R A;  3CVV A;  3IKO B;  5BXU A;  3VV0 A;  1WM5 A;  3KSQ A;  5H7P A;  3D9O A;  2XPY A;  1P5Q A;  4O60 A;  2WVI A;  3V31 A;  3L08 A;  4JL0 A;  2XRZ A;  3ZHE A;  3SQV A;  1E8Z A;  4F6R D;  3C98 A;  4F3V A;  1QZ2 A;  4U8V D;  3LJN A;  4A3T A;  2XHE A;  3QAR A;  1E7V A;  3UIP C;  4KXK B;  3S7F A;  3ZFW A;  3CVP A;  3D9P A;  4A1S A;  4O30 A;  2J8S D;  3CK7 A;  2EIJ E;  3D9N A;  4I6G A;  1G3N B;  4AY5 A;  4ANX A;  2A4Z A;  3C3R A;  1NP7 A;  3NAW A;  5CBO A;  4UWH A;  4UQY A;  5G05 J;  1FPP A;  2ZXW E;  1O1R A;  2DYR E;  3OOI A;  5CMY A;  3B7U X;  5FJY A;  1A5E A;  2X6J A;  5D66 A;  3UQ3 A;  1FVH A;  4UI9 C;  4KVM A;  3D9J A;  3JYS A;  3GYZ A;  3BUA A;  1DCE A;  4YDO A;  1TN7 A;  4HVB A;  3DSU A;  4NRH B;  2P9U G;  3CHP A;  3HXB A;  3GZ2 A;  4B8C B;  2V0P A;  3X2Q E;  3APD A;  4A63 B;  2JLB A;  4DRX E;  4YVQ C;  2UWJ G;  4BSZ B;  4JHJ A;  3RO2 A;  3CVU A;  3DPD A;  2R02 A;  2YQ8 A;  3UI2 A;  3VLE A;  3G2U A;  1OWP A;  4G24 A;  3BO5 A;  3PH0 C;  2I9C A;  1MVX A;  3CHO A;  1TNO A;  4ME2 A;  4HOS A;  3P1U A;  1MX6 A;  4U0S A;  5DIZ A;  1K1B A;  3U3W A;  5EN5 D;  1N0R A;  2HR2 A;  3E33 A;  5IY5 E;  1UN9 A;  5EX3 A;  1KPS B;  3FUL A;  3AAA C;  4LSZ E;  3UIN C;  2P58 C;  3UPV A;  5KJM A;  2JEK A;  1FVF A;  3OS5 A;  5EIL A;  3FU6 A;  2WXH A;  3RJW A;  5CPR B;  4NAC A;  1OWL A;  3F6Q A;  2R05 A;  3E30 A;  3ONL A;  1U3D A;  4DLO A;  3NQP A;  4LNG A;  4A3V A;  3ZPJ A;  3L16 A;  3AS4 A;  3L22 A;  2XEN A;  3TG4 A;  2DIW A;  5HRY A;  1RW2 A;  4I2W A;  4YND A;  2DBA A;  5JJT A;  2R03 A;  1H2U A;  3CHQ A;  2P9K G;  4YPE A;  3BG1 B;  1IQU A;  2KCL A;  4KZC A;  5AQ9 A;  1H2V C;  3PZ2 A;  4GTS A;  4FJZ A;  4FLH A;  3RJV A;  4L1B A;  3E34 A;  3TG5 A;  3DXK G;  1MQS A;  3GZS A;  4JEH A;  3L13 A;  3OTN A;  3S7B A;  1TJF A;  4GTV A;  3NB2 A;  5CED B;  4LDG A;  1EPU A;  2WXM A;  3ZNG A;  3PUJ A;  3MJW A;  5CMW A;  2RFM A;  4KBQ A;  3FUK A;  4MBG A;  1DCQ A;  1B89 A;  4J8S A;  4Q96 A;  2C2L A;  3MKR A;  5KNH D;  5AYF A;  3KS2 A;  3UM1 A;  5F6L A;  4GTT A;  4ILG A;  5HS0 A;  2Y4U A;  4HOU A;  1IHB A;  4FMU A;  1KZO A;  3UMV A;  4O1P A;  5JHN A;  5FZS A;  4DX6 D;  4B89 A;  4H7X A;  4GTR A;  3PZ1 A;  1JWG A;  4YDY A;  2YHC A;  3TWS A;  2V5Q C;  2PQR A;  3WG7 E;  4HXI A;  3CK8 A;  1U2V G;  2OVF A;  3KAE A;  1MUF A;  1IHG A;  2V4L A;  2HE0 A;  4GA0 A;  3TL5 A;  2PM6 A;  3UKU G;  1DNP A;  2PM7 A;  5ENO D;  4GAA A;  3Q75 A;  4AY6 A;  4JZY A;  3LVR E;  1RZ4 A;  2PL2 A;  4CRW A;  3IEG A;  3RO3 A;  2MRI A;  2CG3 A;  5BT1 A;  1ZU2 A;  2ZIS A;  3JXJ A;  5FQ8 A;  3HVE B;  1YCS B;  3CIA A;  2GW1 A;  3UX4 A;  3ESK A;  5FWQ A;  4XI0 A;  3BG0 B;  3ZYQ A;  1N4Q A;  3ZKJ A;  2KC7 A;  4I6E A;  3PS6 A;  2GRO B;  4MI5 A;  1N9A A;  5FQ6 A;  3CBM A;  1D8D A;  5EDS A;  2VGE A;  3Q4A B;  4APO A;  4GZ3 A;  3SZ7 A;  3PZ4 A;  1PC2 A;  4J8Y A;  1TYQ G;  4NQ0 A;  3PRE A;  4N5C A;  3LDZ A;  4WNE A;  3FDH A;  2W5Y A;  1XQH A;  2HYZ A;  2L6J A;  3ZIM A;  2EIN E;  2XEE A;  4YPA A;  3B7S A;  2CHX A;  3FUH A;  2RD0 A;  4WND A;  4U8Y D;  5G05 C;  1W3B A;  4LG6 A;  2WXR A;  3AG4 E;  2X3M A;  4ATZ D;  3KMJ A;  3CSF A;  1A17 A;  3LCA A;  1N4R A;  1XGW A;  1D9S A;  1FCH A;  4ZHB A;  2J09 A;  2WB2 A;  1QQE A;  3ULY A;  2WXQ A;  2R5S A;  2PQN A;  1UW4 B;  3AG2 E;  4CGV A;  2XPI A;  2KM4 A;  4K0R A;  2FI7 A;  4HBD A;  4NIK A;  4J8F A;  3D3M A;  1BLX B;  4X8Q A;  4HOQ A;  3F9Z A;  3UXG A;  1JWF A;  3HXC A;  3EHM A;  5JMN D;  3L82 A;  4JHR A;  4EBA A;  2Q7F A;  4UQZ A;  4BES A;  4IJ8 A;  3FH5 A;  4I51 A;  5A7D B;  4NJ5 A;  5BNW A;  3SFY A;  3TWW A;  5B1B E;  2NSZ A;  1NZN A;  3ENE A;  3UUX A;  1X5B A;  3MO5 A;  4KT6 B;  5ANL A;  5LOZ A;  1HX8 A;  3HDX A;  4J8D A;  5AAR A;  4DUI A;  3FTV A;  1HO8 A;  4QFV A;  3ZEF A;  3KSL A;  3KMT A;  4MI0 A;  4G11 A;  1N6C A;  4WWP A;  2AXV A;  3DSV A;  3ZUV B;  4FJY A;  3EJN A;  3ZU7 B;  3CHM A;  1DVP A;  4BTB A;  2XCC A;  2XGS A;  2ZU6 B;  3ONK A;  3DEP A;  3ZXS A;  5HKP A;  3U66 A;  3FTY A;  4K5C A;  4YPU A;  1OCZ E;  3CGH A;  3RU0 A;  1HS6 A;  5FQ4 A;  4MRU A;  3CBP A;  1O5M A;  4XKB A;  3AU5 A;  3QWP A;  4U96 D;  2F8X K;  2AVP A;  3EHR A;  1BI7 B;  3UTM A;  1MX2 A;  1X81 A;  3Q47 B;  2QC9 A;  1OY3 D;  2NYJ A;  3RRU A;  4F7A A;  3MV2 B;  3TWR A;  2IO2 C;  5FZR A;  3ZVV A;  3S7D A;  2X6K A;  3UM3 A;  3SBS A;  3SBT B;  3NF1 A;  3ASN E;  4DK5 A;  2WXL A;  3CR3 A;  3QJZ A;  4GMJ A;  1E90 A;  4I9E A;  3ULQ A;  2CHZ A;  5BXO A;  5A6C A;  4U0Z A;  2QY7 A;  3CKC A;  3LYA A;  3GW4 A;  3JQ1 A;  2RG8 A;  4NUR A;  3ISM C;  4C9B B;  2J08 A;  2P9L G;  1EF1 C;  4YVO A;  5BV1 A;  4AJW A;  4PS7 A;  1H3I A;  2E2E A;  4LER A;  2XPZ A;  2F37 A;  5M72 A;  3QAQ A;  3ZYM A;  2OEW A;  3T9K A;  4EZJ A;  4G2V A;  2WXO A;  3BQO A;  1NFI E;  5BW8 C;  2XCB A;  1HE8 A;  5DBK A;  3CBO A;  2BQZ A;  2ZIR A;  4FA6 A;  1WAO 1;  4HRM B;  2B6C A;  5ENP D;  1DC2 A;  3L54 A;  4J7F A;  4CDN A;  1BU9 A;  5E75 A;  4J7W A;  3U9W A;  4Q69 A;  4W9R A;  5AAO A;  1OWN A;  5CHE E;  4HB5 A;  2FBN A;  4GPM A;  4FHK A;  2CG2 A;  2P9I G;  5D0Q D;  5T0K A;  2ZGD A;  3DEO A;  3SI5 A;  5J08 A;  3B7B A;  1IXV A;  4BEP A;  3JQ0 A;  3OXF A;  4HRL A;  4G25 A;  3RAU A;  3L9T A;  1HH8 A;  3EUV A;  4ATG A;  2WPV A;  5D2M C;  2XS8 A;  3ZYK A;  2R2L A;  2IOS A;  2VTB B;  3KEA A;  4GCO A;  2LAI A;  2WMN A;  4KYO B;  3G2S A;  1MHQ A;  4DJA A;  2AWI A;  3KMA A;  3LS8 A;  4L23 A;  4DX2 A;  2ETC A;  1N52 A;  4RLY A;  4E47 A;  4IYP A;  4DX7 D;  1D8E A;  3PDN A;  5ARG A;  2WXN A;  4WWO A;  4PS3 A;  2FEZ A;  1KT0 A;  3CVQ A;  1O1S A;  1MJ0 A;  2IY0 C;  4GTM A;  1NI1 A;  2J4B A;  5JJ0 A;  5JIY A;  4FAD A;  5C1D A;  3JCK C;  5E76 A;  3IHX A;  2Y0B G;  1ML9 A;  3FUD A;  4J8E A;  4LUN U;  4ZFH A;  4XI9 A;  2H6G A;  3NBN B;  3O4Z A;  3DXM G;  2F0Y A;  4YDE A;  5FZQ A;  4OVU A;  4QEO A;  4AU7 A;  2GGF A;  3FY4 A;  1TNU A;  2J9Q A;  1H2T C;  3PEU B;  5ENN A;  1SVX A;  3B95 A;  5A23 A;  2KZT A;  2WXP A;  4NVQ A;  5FT9 A;  5EG2 A;  3RKV A;  3HXE A;  3EIJ A;  4OAU C;  1TEZ A;  3PRZ A;  4I9C A;  5G04 J;  5D0O D;  4U07 A;  4XX5 A;  3G2W A;  1JCR A;  3PZ3 A;  3ZYL A;  4FC8 A;  4RSY A;  2R3A A;  3QOU A;  2ETA A;  2VGX A;  1WY6 A;  3TWQ A;  2ZGG A;  4N3C A;  3NZS A;  1Y8M A;  2LSU A;  2EIK E;  3L6A A;  2YIN A;  2IGQ A;  4DI4 A;  2GRP B;  2I1K A;  5JA4 D;  3F9Y A;  4ACL A;  4BT8 A;  3PE4 A;  5T3R A;  5EYL A;  2XRY A;  2X6H A;  5CRU A;  3BEE A;  1BI8 B;  2P2C P;  5KNG A;  2VGY A;  3FUN A;  3PE3 A;  4GPK A;  3Q15 A;  2IJG X;  2AXZ A;  1H0A A;  2BED A;  2MHK A;  4KZ0 A;  4HNA D;  5T5G A;  4BX8 A;  4XIF A;  5ENS D;  1N94 A;  3I5P A;  3FH7 A;  4XEI G;  4ILI A;  2XGO A;  4QEP A;  2WXK A;  5B3S E;  4GZ5 A;  1O1T A;  5EYP F;  1E8X A;  3SWC A;  1GW6 A;  3SW9 A;  3UT7 A;  3UIO C;  1ELW A;  3DSS A;  3ML8 A;  4WUY A;  5HI7 A;  4B8A A;  3QWV A;  2H6F A;  4IUL A;  1OUV A;  1SA5 A;  4V3I A;  4RQI A;  3OAW A;  4DPR A;  3AG1 E;  4YNP A;  1N4P A;  2OND A;  3FTW A;  3KEZ A;  3T8K A;  4N39 A;  4GML A;  4N3B A;  1IQR A;  5EKQ D;  1E96 B;  4LRZ A;  4BFR A;  5CBN A;  4CDR A;  2H6H A;  3IHY A;  3C3Q A;  4JVS A;  5ARF A;  3F9X A;  2DWZ A;  2Y3A A;  2RKK A;  5KJN A;  2MOW A;  3E37 A;  2DVW A;  3N71 A;  5BPP A;  3NOG D;  3PNL B;  3ULE G;  4RZ0 A;  3IV0 A;  3EU5 A;  2OV8 A;  4LNB A;  3TAX A;  1SZ9 A;  4PH4 B;  1S70 B;  3ZHE B;  5LSZ A;  3UT8 A;  3FTX A;  1H6K A;  1IKN D;  2I2O A;  2VTB A;  3LVQ E;  4TRQ A;  4GU5 A;  4PDX A;  2EQX A;  3SNX A;  2P9S G;  1E7U A;  1UG3 A;  4H7Y A;  3Q49 B;  5FIN A;  3RRN B;  2FO7 A;  3SD5 A;  1SZA A;  2CFZ A;  3FU5 A;  2O8J A;  5CRV A;  1NL4 A;  3OXG A;  3ZW3 A;  3ASH A;  1NA0 A;  5G55 A;  3DSW A;  4P29 A;  2J49 A;  1JUQ A;  5ITZ F;  4XZ4 A;  3CST A;  2WXI A;  4EBA G;  2JAB A;  4U63 A;  2GRM A;  4BER A;  2WXF A;  5AYW D;  3RQ4 A;  3LKU A;  3M5A A;  4EZL A;  1E8Y A;  4N3A A;  1TJC A;  4EHM A;  3HNA A;  3CVW A;  2QYJ A;  3QWW A;  4DX5 D;  4F1P A;  2BF0 X;  1HG2 A;  4K03 A;  4O1O A;  3ASO E;  1Q2Z A;  3VUZ A;  4JW1 A;  2WXJ A;  1OXJ A;  3RAY A;  4GYW A;  4FHJ A;  2YNQ A;  2NXP A;  3O48 A;  4U8H A;  1N95 A;  3EHN A;  4JPS A;  4BTA A;  3FEX A;  2WM9 A;  4CGW A;  3CQG B;  1E8W A;  5KJL A;  2V8S E;  1KLX A;  2J07 A;  2CHW A;  3Q7F A;  3RRM B;  1HZ4 A;  1ZBP A;  4DLQ A;  4L2Y A;  2X6I A;  4OAV B;  2GRR B;  2B0O E;  3J5P A;  2QZA A;  3MKQ B;  1TR4 A;  1Z3X A;  3VLD A;  4GZ6 A;  4FUL A;  1LTX A;  5KCM A;  2VYI A;  4UQX A;  4AIF A;  3M57 A;  4BUP A;  2EIM E;  3QDN A;  4WNF A;  3TWT A;  2I6H A;  2H6I A;  2A5E A;  3VTY A;  3FEY A;  3QNK A;  4HLL A;  4G8L A;  3R9M A;  1ELK A;  3Q9N C;  1K8K G;  4YNM A;  4LEU A;  2KCV A;  3G2V A;  3NOC D;  3TJP A;  1V54 E;  3TXN A;  3AS5 A;  3URZ A;  5BUZ A;  4JHK A;  3TWX A;  2Y1L E;  5LFA A;  2LXM A;  2QPW A;  4M7C A;  1V55 E;  3M55 A;  1UJK A;  4A1G A;  4HFG A;  4I43 A;  1Z6T A;  1OWM A;  5JHA A;  1TNY A;  4GZC A;  3M59 A;  4MKT A;  4TV3 A;  3Q78 A;  2R59 A;  2RFI A;  4UWF A;  3FTU A;  1HF8 A;  4DI3 A;  3DWL G;  4HLE A;  4JXT A;  2LSV A;  1OCR E;  1UJJ A;  1JCQ A;  2AXU A;  2IU1 A;  4FU3 A;  4GA2 A;  5TTF A;  1BPO A;  5EID A;  2XZT G;  3R9A B;  3W9G A;  2X6F A;  4F1S A;  2XEV A;  1KT1 A;  2VSX E;  2Y69 E;  3HVE A;  3OPE A;  3R7Q A;  4EZK A;  1K3Z D;  5TH7 A;  2GRN B;  3FFL A;  1N11 A;  3FUE A;  3RIB A;  3QK0 A;  3AG3 E;  4ILH B;  4WAF A;  3V2O A;  3CHS A;  3K5K A;  3C72 A;  4U04 A;  3I3N A;  3JUI A;  3SFX A;  4U0U A;  4FP7 A;  2GRL A;  3D9L A;  1MVH A;  4EEC A;  1XNF A;  4CDM A;  3HG0 D;  4HRN A;  3PZD A;  2HM8 A;  3HYM B;  4I6J A;  2C0M A;  4Y6C A;  1SW6 A;  3FP3 A;  4BWR A;  3E32 A;  4I2Z A;  4U95 D;  3V79 K;  2G46 A;  2NC9 A;  4I1O B;  4C0E A;  5LCW J;  4JA9 A;  1LD8 A;  3TXM A;  1U3C A;  1SA4 A;  4AEZ C;  4UWK A;  5F6K C;  3MGB A;  2DCP A;  3IXE A;  3LY7 A;  3SHF A;  2V4H C;  2FF4 A;  3G2T A;  2IFU A;  4UUC A;  3QKY A;  2FO1 E;  1MYO A;  3ESL A;  4K5B A;  3B7T A;  2YHE A;  2LO6 A;  2PZI A;  5FIO A;  4H12 A;  2XEH A;  2VSO E;  3Q5M A;  3Q79 A;  4CCA A;  4AXH A;  2KAT A;  1AP7 A;  3L17 A;  3E4B A;  4TUU A;  2UY1 B;  1H6P A;  3KD7 A;  2PNN A;  4JLG A;  5LP0 A;  4HI9 A;  4HOT A;  4J83 A;  3UKR G;  2VSY A;  1PEG A;  4HI8 A;  4OYS A;  4GYY A;  1JPL A;  3EDT B;  5KJK A;  2OCC E;  1SQM A;  3F9W A;  1WG0 A;  1HU3 A;  3M54 A;  3PEV B;  4N5Q A;  3HIZ A;  3DSX A;  3FPD A;  4IJD A;  2ION A;  4PUC A;  3PUK A;  4GA1 A;  3HRA A;  4KMO A;  1YYH A;  4M3O A;  4E85 A;  1IYG A;  4RG6 A;  2I1J A;  3CQC B;  3B7R L;  3ZXP A;  5AQB A;  3MKQ A;  5AJL A;  4QQI A;  1Z3Y A;  3LY8 A;  5T8I A;  4RVB A;  4FLB A;  5LX8 A;  1MT6 A;  4BX9 A;  3M58 A;  4I1A A;  3MV3 B;  3ASD A;  3MYV A;  4RG9 A;  4BET A;  2C0L A;  1YA0 A;  3Q7A A;  1BD8 A;  5AIJ A;  5JJ7 A;  4J6I A;  4C48 B;  3CV0 A;  3MA5 A;  4K5A B;  3S2A A;  4APF A;  5ENT D;  1OCO E;  2KCK A;  2DZO A;  3ASG A;  2CFU A;  4JA7 A;  4UI9 K;  3I4R B;  4URK A;  4MLP A;  3CLJ A;  4WWN A;  4CT0 A;  5EX0 A;  2OVB A;  5CEC B;  2R17 C;  3ABL E;  3MEK A;  3T5X A;  3D9I A;  1AWC B;  4CYM D;  3LEW A;  2DZN A;  3MO2 A;  1NA3 A;  1QBQ A;  2IEJ A;  3FUI A;  3Q9U C;  4G26 A;  2AW6 A;  3LXU X;  4A55 A;  4J7I A;  3ZN3 A;  5C2Y A;  4HQD A;  2KXP C;  3K9I A;  1FT1 A;  3MZL B;  2WMO A;  1EYH A;  4Z68 A;  4BY6 A;  5FQ7 A;  3T8M A;  5FTP A;  3MCX A;  5LSX A;  3NZU A;  2BKK B;  1L5J A;  4IRU A;  2KBX A;  3AJI A;  3LPZ A;  3EHQ A;  4B0Z A;  1H6O A;  4EQF A;  2IQC A;  4ANW A;  4WNG A;  3ML9 A;  2L9B A;  4EPZ A;  4N2Q A;  5T4Y A;  1UN8 A;  1UOH A;  2L0T B;  3FUJ A;  3IHV A;  2BUG A;  2XS1 A;  4GCN A;  4U7E B;  1S64 A;  2WQ6 A;  4IN3 B;  2XGM A;  4GMR A;  2L0I A;  3SGH A;  2J4D A;  1FT2 A;  3UT4 A;  4ACK A;  3DAL A;  3DB5 A;  1S63 A;  2L6B A;  4ANV A;  3U4T A;  3AS8 A;  1PAQ A;  5ENR D;  3TWU A;  1Z5S C;  3FHE A;  4C0M A;  3FWV A;  4GYO A;  3SO8 A;  3JXI A;  3W9F A;  2EIL E;  3ASF A;  5JJ6 A;  1N54 A;  3CVL A;  3U64 A;  4G23 A;  5AQA A;  2BKG A;  4C1Q A;  2RFA A;  2Y4T A;  2QYU A;  4J0U A;  4UI9 J;  1O9S A;  3S8P A;  3SF4 A;  3LJ3 A;  3ZGQ A;  4OVV A;  2LXL A;  1Y6I A;  4AOF A;  1N4S A;  1TNB A;  4JEU A;  5JHB A;  2VJ8 A;  5JIN A;  3VLF A;  1LF8 A;  2MYO A;  4I17 A;  4XKC A;  1WDY A;  3QB2 A;  4AP2 A;  1ZKK A;  3DRA A;  3ABM E;  3PNT B;  3ABK E;  4KVO A;  3TWV A;  4ANU A;  4GTQ A;  2BTD A;  3SY2 A;  4CZ2 D;  1LD7 A;  3DPY A;  4Z4P A;  1YMP A;  2WQ7 A;  5AN8 A;  4GZD A;  1OWO A;  3V2X A;  3APC A;  4TXQ A;  5F59 A;  4J8O A;  5CCL A;  1QNF A;  5BV0 A;  2VQ2 A;  5ANR A;  5LCW C;  2HO1 A;  3CVN A;  3D9M A;  1OCC E;  4L7T A;  4BT9 A;  2UY1 A;  3V30 A;  4R7L A;  3EIQ C;  1VDY A;  3EU9 A;  4UWG A;  2IO3 C;  2DYS E;  1ZB1 A;  1N3J A;  3S7J A;  3C3O A;  3WXX A;  4I1M A;  3MX3 A;  1ELR A;  2P9P G;  4CEM A;  4TXR A;  2A5U A;  3CVX A;  3FU3 A;  4AVX A;  3MO0 A;  3GZ1 A;  1H19 A;  4GTO A;  2F69 A;  3CVY A;  3FUF A;  3HXD A;  3Q73 A;  4G8K A;  4D10 C;  1HXI A;  3BU8 A;  2IOL A;  3IBE A;  3SFZ A;  2OEV A;  5TEG A;  3JUE A;  5F5E A;  1K1A A;  4YDW A;  5T0M A;  5AQ7 A;  5CCM A;  1TN8 A;  3D9K A;  2LNI A;  3FTS A;  4O6F A;  3R7R A;  3DBS A;  3CK9 A;  1QYM A;  5B1A E;  3ZRH A;  2M63 A;  3APF A;  5AEN A;  1S0P A;  5J90 A;  3QC1 A;  4GB9 A;  3FUM A;  4F53 A;  2XZD G;  4N2S A;  4B94 A;  1N6A A;  1OT8 A;  5G2N A;  2QFC A;  2JV0 A;  5ENQ D;  3CEQ A;  1KZP A;  2ILR A;  3J5Q B;  5AJD A;  2KZT B;  3P2B A;  2E0I A;  3DST A;  4HOR A;  3B13 A;  4MS6 A;  2WXG A;  2VSN A;  3FU0 A;  1MZC A;  4JD2 G;  3D9H A;  4B93 B;  1N0Q A;  3AU4 A;  5G04 C;  4XE0 A;  2P9N G;  1HG5 A;  3EP0 A;  1TNZ A;  2VGX B;  2LAH A;  3UM0 A;  4E6H A;  2V5F A;  2FUL A;  1EDU A;  4Y6W A;  4Q94 A;  3CHR A;  4GTP A;  5HQ8 A;  5KBA A; 
#chains in the Genus database with same CATH homology
 2DCP A;  2XRY A;  4LCT A;  3LY7 A;  3ZIM A;  4ABN A;  2X6H A;  2XQ0 A;  3SHF A;  3M56 A;  3BEE A;  4BSX A;  2FF4 A;  3G2T A;  2IFU A;  3RK6 A;  4YPA A;  3QKY A;  2VGY A;  3FUN A;  3PE3 A;  3B7S A;  3TGO A;  2CHX A;  3FUH A;  3Q15 A;  2RD0 A;  4WND A;  3ESL A;  4GPK A;  3OXL A;  2IJG X;  4PS8 A;  2AXZ A;  1PY1 A;  3B7T A;  2YHE A;  1H0A A;  2MHK A;  2LO6 A;  5G05 C;  4KZ0 A;  2PZI A;  4JC8 A;  5T5G A;  4H12 A;  3FH8 A;  2VSO E;  1W3B A;  3HHM A;  4BX8 A;  2WXR A;  3T5V A;  3Q5M A;  4XIF A;  2X3M A;  4CCA A;  3KMJ A;  3CSF A;  1A17 A;  3LCA A;  3I5P A;  1XGW A;  1FCH A;  3FH7 A;  4HS2 A;  2J09 A;  4AXH A;  2KAT A;  2WB2 A;  1QQE A;  2X38 A;  4ILI A;  3M53 A;  2XGO A;  2IF4 A;  3L17 A;  3E4B A;  2WXQ A;  2R5S A;  4QEP A;  4TUU A;  2UY1 B;  2WXK A;  2PQN A;  1UW4 B;  4QEN A;  4GZ5 A;  3I4G A;  4CT4 A;  2XPI A;  4CGV A;  2KM4 A;  3CKB A;  1E8X A;  2FI7 A;  2WQH A;  3KD7 A;  4K0R A;  4JDS A;  1HFA A;  1INZ A;  3SWC A;  4JLG A;  1GW6 A;  5LP0 A;  3UT7 A;  4J8F A;  3SW9 A;  3D3M A;  4HOT A;  1ELW A;  4J83 A;  4HOQ A;  3F9Z A;  3ML8 A;  4WUY A;  5HI7 A;  3PVL A;  2VSY A;  1PEG A;  1JWF A;  3QWV A;  4B8A A;  4OYS A;  4UWL A;  4IUL A;  2OOE A;  1OUV A;  3EHM A;  4GYY A;  4V3I A;  1JPL A;  3OAW A;  4JHR A;  4EBA A;  2Q7F A;  4DPR A;  3EDT B;  4UQZ A;  5KJK A;  4IJ8 A;  3LY9 A;  2W5Z A;  1SQM A;  3F9W A;  4YNP A;  3FH5 A;  1HU3 A;  2OND A;  4I51 A;  3FTW A;  3M54 A;  3KEZ A;  3PEV B;  3HIZ A;  4N39 A;  4AV7 A;  3FPD A;  4GML A;  4AM9 A;  3VTX A;  5A7D B;  3FTZ A;  4N3B A;  4NJ5 A;  5BNW A;  4G1T A;  1IQR A;  4L2L A;  5EKQ D;  4IJD A;  2ION A;  4PUC A;  3PUK A;  1E96 B;  2NSZ A;  3CVV A;  1NZN A;  3IKO B;  3ENE A;  3UUX A;  4LRZ A;  4BFR A;  3VV0 A;  1X5B A;  1WM5 A;  3MO5 A;  4GA1 A;  4KT6 B;  4CDR A;  4KMO A;  5ANL A;  3IHY A;  3D9O A;  2XPY A;  1P5Q A;  5LOZ A;  4JVS A;  5ARF A;  3F9X A;  4M3O A;  1HX8 A;  2Y3A A;  3HDX A;  4J8D A;  4E85 A;  5KJN A;  1IYG A;  2MOW A;  2WVI A;  4RG6 A;  3L08 A;  4JL0 A;  2I1J A;  3CQC B;  3B7R L;  3N71 A;  3ZHE A;  2XRZ A;  3FTV A;  5BPP A;  1E8Z A;  3PNL B;  3C98 A;  3MKQ A;  5AJL A;  1HO8 A;  4F3V A;  1QZ2 A;  4QFV A;  1Z3Y A;  3LY8 A;  3ZEF A;  4RZ0 A;  3IV0 A;  2OV8 A;  5T8I A;  3KMT A;  3TAX A;  4MI0 A;  1SZ9 A;  4PH4 B;  4RVB A;  4A3T A;  2XHE A;  4FLB A;  3QAR A;  4G11 A;  3ZHE B;  4BX9 A;  1E7V A;  5LX8 A;  1MT6 A;  3M58 A;  1N6C A;  5LSZ A;  4WWP A;  2AXV A;  4I1A A;  3MV3 B;  5HQ8 A;  3ASD A;  3MYV A;  3UT8 A;  4RG9 A;  4KXK B;  3S7F A;  3FTX A;  3ZFW A;  4FJY A;  3EJN A;  2C0L A;  3CVP A;  1YA0 A;  3D9P A;  4A1S A;  4O30 A;  3CK7 A;  5AIJ A;  1H6K A;  3D9N A;  5JJ7 A;  4I6G A;  3CHM A;  4J6I A;  1DVP A;  2I2O A;  3CV0 A;  4BTB A;  2XCC A;  3MA5 A;  2XGS A;  2ZU6 B;  4AY5 A;  3ONK A;  4ANX A;  2A4Z A;  2VTB A;  3LVQ E;  3S2A A;  4APF A;  1NP7 A;  4TRQ A;  3ZXS A;  4GU5 A;  2KCK A;  3ASG A;  4PDX A;  2EQX A;  3U66 A;  3SNX A;  1E7U A;  1UG3 A;  2CFU A;  3FTY A;  4UWH A;  4JA7 A;  4UQY A;  5G05 J;  4H7Y A;  3I4R B;  4UI9 K;  4URK A;  4YPU A;  3CGH A;  3Q49 B;  4MLP A;  3RRN B;  3RU0 A;  1HS6 A;  2FO7 A;  5FQ4 A;  3SD5 A;  4MRU A;  3CBP A;  4XKB A;  3CLJ A;  4WWN A;  5CMY A;  3B7U X;  3OOI A;  5FJY A;  3AU5 A;  3QWP A;  1SZA A;  2CFZ A;  2X6J A;  3FU5 A;  2O8J A;  4CT0 A;  2AVP A;  5EX0 A;  2OVB A;  3UQ3 A;  1FVH A;  2R17 C;  3MEK A;  3OXG A;  4UI9 C;  3D9I A;  3T5X A;  3ZW3 A;  4KVM A;  3ASH A;  3Q47 B;  3D9J A;  3LEW A;  3JYS A;  1NA3 A;  3GYZ A;  1NA0 A;  5G55 A;  3MO2 A;  4P29 A;  3FUI A;  3RRU A;  2J49 A;  1JUQ A;  4F7A A;  4G26 A;  3MV2 B;  4XZ4 A;  4HVB A;  2AW6 A;  3LXU X;  4NRH B;  3CST A;  2WXI A;  4A55 A;  3CHP A;  4EBA G;  4J7I A;  3ZN3 A;  3GZ2 A;  4U63 A;  4B8C B;  5FZR A;  2GRM A;  3ZVV A;  5C2Y A;  2V0P A;  3S7D A;  2X6K A;  3APD A;  3K9I A;  3CVU A;  3MZL B;  2WXF A;  3SBS A;  3SBT B;  2JLB A;  3NF1 A;  2WMO A;  5AYW D;  3RQ4 A;  1EYH A;  4YVQ C;  2UWJ G;  3LKU A;  4BY6 A;  3M5A A;  4DK5 A;  4EZL A;  1E8Y A;  2WXL A;  3CR3 A;  3QJZ A;  4GMJ A;  4JHJ A;  4N3A A;  5FQ7 A;  1TJC A;  3RO2 A;  5FTP A;  1E90 A;  4I9E A;  3ULQ A;  3MCX A;  3CVW A;  3HNA A;  5LSX A;  2CHZ A;  3DPD A;  3NZU A;  5A6C A;  1L5J A;  2QY7 A;  3CKC A;  4U0Z A;  2YQ8 A;  3VLE A;  3QWW A;  3G2U A;  3LYA A;  2BF0 X;  3GW4 A;  4IRU A;  1OWP A;  1HG2 A;  3JQ1 A;  5EG2 A;  4G24 A;  3BO5 A;  3PH0 C;  2RG8 A;  4K03 A;  3LPZ A;  4NUR A;  2I9C A;  1MVX A;  3CHO A;  3VUZ A;  4C9B B;  4ME2 A;  2J08 A;  4JW1 A;  4HOS A;  4B0Z A;  2WXJ A;  4EQF A;  2IQC A;  3P1U A;  4ANW A;  3RAY A;  1EF1 C;  4YVO A;  5BV1 A;  4WNG A;  4GYW A;  3ML9 A;  2L9B A;  4AJW A;  4EPZ A;  4N2Q A;  4FHJ A;  2YNQ A;  2NXP A;  4PS7 A;  4U0S A;  2E2E A;  4LER A;  5DIZ A;  3O48 A;  1H3I A;  4U8H A;  5T4Y A;  3U3W A;  3T8M A;  2XPZ A;  2HR2 A;  1UN8 A;  2L0T B;  3FUJ A;  5M72 A;  1UN9 A;  3EHN A;  3IHV A;  3QAQ A;  4JPS A;  5EX3 A;  3ZYM A;  2BUG A;  3FUL A;  4EZJ A;  4GCN A;  2P58 C;  4G2V A;  4BTA A;  3FEX A;  3UPV A;  2WXO A;  5KJM A;  2WM9 A;  4CGW A;  2JEK A;  1FVF A;  3CQG B;  1E8W A;  5KJL A;  3OS5 A;  2WQ6 A;  5BW8 C;  2V8S E;  3FU6 A;  2XCB A;  4IN3 B;  1KLX A;  2WXH A;  2XGM A;  1HE8 A;  2L0I A;  5DBK A;  2J4D A;  2J07 A;  2CHW A;  3SGH A;  2BQZ A;  3CBO A;  3RJW A;  3UT4 A;  4ACK A;  4FA6 A;  3DAL A;  3DB5 A;  5CPR B;  4NAC A;  1OWL A;  3RRM B;  1WAO 1;  3U4T A;  3AS8 A;  4ANV A;  1HZ4 A;  1ZBP A;  1PAQ A;  4DLQ A;  4L2Y A;  2X6I A;  3ONL A;  1U3D A;  4DLO A;  3NQP A;  3FHE A;  3L54 A;  4A3V A;  4CDN A;  4J7F A;  3ZPJ A;  4C0M A;  5E75 A;  3L16 A;  3AS4 A;  3U9W A;  4Q69 A;  3L22 A;  4W9R A;  3FWV A;  3MKQ B;  4GYO A;  1OWN A;  1Z3X A;  5CHE E;  3TG4 A;  3VLD A;  4GZ6 A;  2DIW A;  2FBN A;  3ASF A;  4FHK A;  2CG2 A;  4FUL A;  5KCM A;  5D0Q D;  5T0K A;  5JJ6 A;  4I2W A;  1N54 A;  3CVL A;  3U64 A;  2VYI A;  4UQX A;  4YND A;  4G23 A;  2DBA A;  3SI5 A;  4AIF A;  5J08 A;  5JJT A;  3M57 A;  4BUP A;  4C1Q A;  1H2U A;  3CHQ A;  2Y4T A;  4YPE A;  3QDN A;  4WNF A;  3BG1 B;  1IQU A;  2KCL A;  2I6H A;  4KZC A;  1H2V C;  4J0U A;  3JQ0 A;  3OXF A;  4UI9 J;  3VTY A;  1O9S A;  3S8P A;  3SF4 A;  3LJ3 A;  4G25 A;  3ZGQ A;  4FJZ A;  4FLH A;  1HH8 A;  3FEY A;  4OVV A;  3QNK A;  3RJV A;  2WPV A;  4ATG A;  1Y6I A;  1ELK A;  3ZYK A;  4L1B A;  4AOF A;  2IOS A;  4JEU A;  2VTB B;  4YNM A;  3TG5 A;  5JHB A;  4LEU A;  1MQS A;  2VJ8 A;  4GCO A;  3GZS A;  5JIN A;  2LAI A;  2WMN A;  3VLF A;  1LF8 A;  4KYO B;  2KCV A;  3G2V A;  3G2S A;  4JEH A;  3TJP A;  1MHQ A;  4I17 A;  4XKC A;  4DJA A;  3TXN A;  3L13 A;  3QB2 A;  3AS5 A;  3OTN A;  3URZ A;  5BUZ A;  4JHK A;  3S7B A;  4AP2 A;  5LFA A;  2AWI A;  1ZKK A;  3KMA A;  1TJF A;  2QPW A;  3LS8 A;  4L23 A;  3PNT B;  3M55 A;  1UJK A;  4KVO A;  4A1G A;  4LDG A;  4ANU A;  1N52 A;  1EPU A;  2WXM A;  3PUJ A;  3MJW A;  4HFG A;  2BTD A;  4IYP A;  4KBQ A;  5CMW A;  4I43 A;  4E47 A;  1Z6T A;  4Z4P A;  3FUK A;  1OWM A;  5JHA A;  3PDN A;  5ARG A;  4GZD A;  1B89 A;  4GZC A;  2WQ7 A;  1OWO A;  3M59 A;  4MKT A;  4J8S A;  3APC A;  4TV3 A;  5F59 A;  2R59 A;  4J8O A;  4Q96 A;  2WXN A;  4WWO A;  5CCL A;  1QNF A;  2C2L A;  2FEZ A;  4PS3 A;  2RFI A;  4UWF A;  5BV0 A;  2VQ2 A;  1KT0 A;  3MKR A;  5ANR A;  2HO1 A;  5LCW C;  5AYF A;  3KS2 A;  5F6L A;  3CVQ A;  3CVN A;  4ILG A;  3D9M A;  2Y4U A;  4HOU A;  4L7T A;  4BT9 A;  2UY1 A;  2J4B A;  4FMU A;  5JJ0 A;  4R7L A;  3FTU A;  1HF8 A;  3EIQ C;  5JIY A;  1VDY A;  4DI3 A;  3UMV A;  4FAD A;  4HLE A;  4JXT A;  2LSV A;  4UWG A;  5JHN A;  5FZS A;  1N3J A;  1UJJ A;  4B89 A;  3S7J A;  5C1D A;  3WXX A;  2AXU A;  4H7X A;  2IU1 A;  1JWG A;  4I1M A;  3MX3 A;  1ELR A;  3JCK C;  5E76 A;  2YHC A;  4CEM A;  3IHX A;  1ML9 A;  4FU3 A;  3FUD A;  4GA2 A;  4J8E A;  2A5U A;  4LUN U;  3CVX A;  4XI9 A;  3FU3 A;  5TTF A;  1BPO A;  2PQR A;  4AVX A;  3MO0 A;  4HXI A;  3CK8 A;  3GZ1 A;  3O4Z A;  1H19 A;  2OVF A;  3KAE A;  3R9A B;  1MUF A;  1IHG A;  2V4L A;  4GA0 A;  3TL5 A;  5FZQ A;  4F1S A;  2X6F A;  2F69 A;  2PM6 A;  4OVU A;  1DNP A;  3CVY A;  4QEO A;  2XEV A;  3FUF A;  2PM7 A;  1KT1 A;  2VSX E;  4GAA A;  4AY6 A;  4JZY A;  4D10 C;  1HXI A;  4AU7 A;  2GGF A;  3FY4 A;  3HVE A;  3LVR E;  2PL2 A;  4CRW A;  3OPE A;  2IOL A;  3R7Q A;  3IEG A;  3IBE A;  2MRI A;  3RO3 A;  3SFZ A;  4EZK A;  5TH7 A;  3FFL A;  5TEG A;  3FUE A;  3RIB A;  2CG3 A;  2J9Q A;  5BT1 A;  4ILH B;  1ZU2 A;  5F5E A;  1H2T C;  4WAF A;  5T0M A;  5CCM A;  3D9K A;  5FQ8 A;  3HVE B;  2LNI A;  3CHS A;  3FTS A;  3PEU B;  4O6F A;  3R7R A;  3K5K A;  5ENN A;  3CIA A;  3DBS A;  3CK9 A;  2GW1 A;  4U04 A;  3UX4 A;  3ZRH A;  3I3N A;  2M63 A;  3APF A;  3ESK A;  3JUI A;  5A23 A;  4U0U A;  5FWQ A;  1S0P A;  4XI0 A;  2KZT A;  2WXP A;  3BG0 B;  5AEN A;  3QC1 A;  4FP7 A;  4GB9 A;  5FT9 A;  2GRL A;  3FUM A;  3ZYQ A;  4F53 A;  5J90 A;  4NVQ A;  4N2S A;  3RKV A;  4B94 A;  3D9L A;  3EIJ A;  2KC7 A;  4EEC A;  1MVH A;  1N6A A;  1XNF A;  4I6E A;  1TEZ A;  4CDM A;  3PS6 A;  2QFC A;  5G2N A;  3PRZ A;  2JV0 A;  4I9C A;  5G04 J;  3CEQ A;  5D0O D;  3PZD A;  2ILR A;  5AJD A;  4MI5 A;  2KZT B;  3P2B A;  4U07 A;  5FQ6 A;  3CBM A;  2HM8 A;  3G2W A;  4XX5 A;  2E0I A;  3ZYL A;  3HYM B;  4FC8 A;  4I6J A;  2C0M A;  4RSY A;  5EDS A;  4HOR A;  4Y6C A;  2R3A A;  3Q4A B;  3FP3 A;  3QOU A;  4BWR A;  2VGX A;  3B13 A;  4MS6 A;  1WY6 A;  2WXG A;  4APO A;  2VSN A;  3FU0 A;  4N3C A;  4GZ3 A;  3SZ7 A;  3NZS A;  4I2Z A;  1Y8M A;  1PC2 A;  2LSU A;  3AU4 A;  3L6A A;  5G04 C;  4NQ0 A;  2YIN A;  4XE0 A;  1HG5 A;  2G46 A;  2IGQ A;  3PRE A;  2NC9 A;  4DI4 A;  2VGX B;  2LAH A;  4N5C A;  3EP0 A;  3LDZ A;  2I1K A;  4E6H A;  2V5F A;  2FUL A;  1EDU A;  4I1O B;  4WNE A;  4C0E A;  5LCW J;  4Y6W A;  3F9Y A;  3FDH A;  4JA9 A;  4Q94 A;  1XQH A;  3TXM A;  2W5Y A;  1U3C A;  2HYZ A;  2L6J A;  3CHR A;  4ACL A;  4AEZ C;  3PE4 A;  4BT8 A;  4UWK A;  5T3R A;  3QK0 A;  5F6K C;  3MGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...