4O6FA

Structural basis of estrogen receptor alpha methylation mediated by histone methyltransferase smyd2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
430
structure length
430
Chain Sequence
AEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Insights into Estrogen Receptor alpha Methylation by Histone Methyltransferase SMYD2, a Cellular Event Implicated in Estrogen Signaling Regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 145
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4o6fA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4o6fA01
1HXIA 4W9RA 4EQFA 5EKQD 2LNIA 3QWVA 4RG9A 4JLGA 2C2LA 3CBMA 3K5KA 3Q5MA 3ULQA 4O30A 3F9WA 4XIFA 5FJYA 4QEOA 2PQRA 1IYGA 2JV0A 2UWJG 5G04C 3K9IA 4NJ5A 5EX3A 2RFIA 3OS5A 3RJWA 2QPWA 2VSYA 4CDRA 1FCHA 2R5SA 4GCOA 1H3IA 5T5GA 2PZIA 3AS5A 4Z4PA 3CK9A 3AS4A 4UQYA 4G2VA 2XGOA 3TAXA 1Y8MA 3QWWA 4N3CA 2BQZA 1ZBPA 5DBKA 4YPAA 2W5ZA 3EP0A 3PE4A 2KCVA 3LKUA 5KJKA 2XCCA 4GYWA 4AY6A 3RO3A 5JINA 2MHKA 2Q7FA 2Y4UA 4I17A 3LCAA 4J8FA 2OOEA 5EX0A 3RJVA 3ASHA 3S7JA 2JLBA 4GZ5A 4J8OA 4N39A 1NA0A 3E4BA 2W5YA 5TTFA 3S8PA 2QFCA 5HQ8A 2YHCA 3AS8A 2KCKA 3CKBA 1ZU2A 1B89A 4N3BA 2P58C 3FP3A 4KYOB 3QWPA 5EG2A 5KJNA 4HOUA 3SWCA 1MUFA 3S7FA 2UY1B 4YPEA 3ZHEB 2IF4A 2C0LA 2AVPA 3PDNA 4U07A 2F69A 4GA1A 1ML9A 2FEZA 4JL0A 4UI9C 3SW9A 3TGOA 4XI9A 4HOTA 2FO7A 4ABNA 4E47A 2KCLA 3SF4A 4JA9A 5KJMA 1W3BA 4WNGA 5T0KA 3MV2B 3KMAA 4J83A 3GYZA 5T0MA 4NVQA 4UI9J 5LCWC 3F9YA 2XGSA 2C0MA 3LY9A 4H12A 1PEGA 3CK8A 5JIYA 2HO1A 3DB5A 3QKYA 5BNWA 3Q49B 5JJTA 3LYAA 4WUYA 4JA7A 4HOQA 3PE3A 1WAO1 1YA0A 3M54A 5CHEE 3M57A 1XNFA 3RKVA 4U0SA 3JYSA 1A17A 3UUXA 1HZ4A 3CVNA 1OUVA 5ARFA 3KAEA 1P5QA 4H7YA 2KC7A 4WNEA 2PL2A 4G24A 3SZ7A 3N71A 4A1SA 4I9CA 3EDTB 4G1TA 5DIZA 3CVPA 3CBOA 3QOUA 4Y6WA 4IJ8A 4QENA 4UQXA 5BT1A 4YVQC 5FZQA 3FFLA 3URZA 3ZGQA 3S7BA 4BUPA 4GYOA 4MI5A 4J7FA 1O9SA 5KJLA 2VGXB 3BO5A 3HYMB 4BTBA 3RO2A 4U04A 4IN3B 5FT9A 4J0UA 2O8JA 1MT6A 4G23A 4J8DA 2XPIA 2Y4TA 4APOA 2IGQA 4MI0A 2G46A 4J8EA 2VQ2A 3Q47B 1PC2A 4AU7A 4BTAA 3NF1A 5G05J 3MKRA 5HI7A 4UQZA 3MV3B 2BUGA 3Q4AB 2VYIA 5F6LA 5F6KC 3RAYA 1MVHA 3ASGA 5LSZA 4I2ZA 5FZSA 3GZ1A 2FBNA 2I6HA 4O6FA 4I2WA 3F9ZA 3VTYA 4GCNA 3CV0A 4YVOA 3CK7A 3KMJA 5D0QD 3LY8A 4YPUA 1N6CA 1NZNA 4KBQA 3DALA 3BEEA 2HR2A 3WXXA 4B94A 3TG5A 4FMUA 3O48A 3R9AB 1E96B 1WM5A 3ASFA 5CPRB 3CVQA 3Q15A 3M5AA 4N2SA 4HOSA 5A6CA 1QQEA 2DBAA 4C1QA 4NRHB 4YNDA 5JJ7A 2VSNA 3RIBA 1KT0A 5AYFA 4CGWA 2XEVA 5ARGA 3MA5A 2UY1A 2LSUA 3ZHEA 3QDNA 4GA2A 4J7IA 5A7DB 4GA0A 4BT8A 5F5EA 4GPKA 2R3AA 5FTPA 3FPDA 3LY7A 3MO0A 4I1AA 2J9QA 3CBPA 2LSVA 2WQHA 2FI7A 3MO5A 4LEUA 2VGYA 4U0UA 3ZN3A 4JDSA 4WNDA 1QZ2A 3ZPJA 4UI9K 2PQNA 1KT1A 3RU0A 3IHXA 2YQ8A 3M53A 2E2EA 3LPZA 2FF4A 5JJ0A 1ELWA 3ASDA 4GYYA 2KATA 4JHRA 3HNAA 2ONDA 4YNMA 2IFUA 3VTXA 4G25A 3ESKA 5G04J 5F59A 2WPVA 4ME2A 4IJDA 4RZ0A 3S7DA 3CKCA 4F3VA 3UPVA 5JJ6A 5G05C 1N3JA 1MVXA 4AIFA 4YNPA 1KLXA 5BW8C 3U3WA 3KMTA 4N5CA 3FWVA 3UQ3A 3CVLA 3KS2A 3U4TA 3MO2A 3ZFWA 3CEQA 5LSXA 4KXKB 2XCBA 3MEKA 4AY5A 3OXFA 4I9EA 3OXLA 4AM9A 1NA3A 4HORA 1TJCA 5CCLA 2GW1A 5AYWD 5FZRA 3IEGA 4H7XA 1N6AA 5TEGA 3OOIA 4I51A 4XI0A 4Y6CA 4CGVA 2NC9A 4GZ6A 4U0ZA 3VUZA 4LDGA 2V5FA 5TH7A 3M59A 3F9XA 4G26A 2VGXA 4BWRA 3KD7A 1ZKKA 4N3AA 4RG6A 3OPEA 3VV0A 3M55A 4NQ0A 1ELRA 2L6JA 1IHGA 3GW4A 4BT9A 3OXGA 5CCMA 5JHNA 3RQ4A 3TG4A 1XQHA 2HYZA 5D0OD 4QEPA 2XGMA 3M58A 3M56A 5LCWJ 3GZ2A 4WNFA 5C1DA 4GZ3A 4N2QA 1HH8A 5M72A
chains in the Genus database with same CATH superfamily
5BV0A 4U8YD 5EKQD 4UUCA 3ULYA 3TWTA 1EYHA 5FJYA 5T4YA 3PNLB 4AJWA 2JV0A 4JEUA 5G04C 1SZ9A 3K9IA 4MRUA 3DSXA 4HVBA 2XQ0A 1FVHA 2QPWA 4JHKA 3AS4A 4GAAA 1N9AA 4UQYA 2X6IA 4G2VA 2EILE 1N54A 1UJKA 3FUIA 3PE4A 3TJPA 1JPLA 2Y4UA 1IHBA 3SHFA 4JZYA 3RJVA 3ASHA 4JB8P 4GZ5A 4J8OA 3CHPA 4RQIA 3T8MA 4AXHA 5HQ8A 4O60A 3FH5A 3CHSA 3JCKC 1DCEA 3TWWA 1B89A 3UM0A 1H6KA 1N95A 3EHNA 4KT6B 5EG2A 3EIJA 5D2MC 1UN8A 2F8XK 3S7FA 3ZW3A 1LTXA 3PDNA 2WXFA 4GA1A 1V55E 2FEZA 2YHEA 3G2SA 4UI9C 1Q2ZA 1A5EA 3E30A 3B7UX 4ABNA 4E47A 2WVIA 1UOHA 4FADA 3SF4A 2P9SG 5AN8A 2X6KA 3MV2B 4J83A 3S2AA 5CBOA 5HKPA 2ZIRA 3DSVA 5LCWC 3F9YA 5JA4D 2XGSA 3LVRE 4H12A 1H2UA 3UTMA 3ZNGA 5JIYA 3R7QA 3DB5A 2OV8A 3AG4E 3Q49B 5AQ9A 5LP0A 3T8KA 1E8WA 4ILIA 1JCSA 3BG0B 2Y0BG 4BSXA 2M63A 3FUDA 3TWQA 1HZ4A 3CVNA 3BU8A 5J08A 2VTBB 4HLEA 3DXMG 4YDWA 3N71A 4A1SA 3SFXA 4HNAD 5KNGA 2LAIA 3CVUA 4C9BB 2P9PG 3CBOA 3QJZA 4AVXA 3RK6A 2XEHA 4LRZA 2J08A 2CFZA 5J90A 4BFRA 3URZA 4NIKA 2GRMA 3FU5A 4HXIA 4TXQA 2AW6A 3AG3E 4J6IA 4ANXA 4MS6A 1BPOA 4ANVA 4LNBA 2V4LA 2R2LA 3UXGA 1S70B 3CLJA 3LVQE 5LOZA 2O8JA 2A5EA 4G23A 3FEXA 4D10C 4BESA 3U64A 3Q75A 2XS1A 1S0PA 4DUIA 3DXKG 2P2CP 4EBAG 4L2LA 3P1UA 5F6LA 4JC8A 1E7VA 4HRLA 3AG2E 3GZSA 5AQAA 3AJIA 3O4ZA 4O6FA 2HE0A 3QNKA 3KSQA 1NFIE 1OT8A 3C3RA 5KBAA 5FINA 4PS7A 5D0QD 3JUEA 3EU5A 3FTXA 2HR2A 3WXXA 1K1BA 4YDOA 1SVXA 4UWHA 2LUHA 2ZGGA 1QQEA 3UX4A 5JJ7A 2J07A 3UT4A 4ILHB 1KT0A 2LAHA 3ZYKA 4FHJA 5ARGA 4CGWA 3MA5A 2UY1A 4XX5A 3ZHEA 1OWNA 4GA0A 4GPKA 2BEDA 3MO0A 5AQ7A 2LXMA 3E33A 3MO5A 3FH7A 5CBNA 1G3NB 4JDSA 1KZPA 4HRNA 2Y1LE 3L6AA 1KT1A 4CDNA 3RU0A 3M53A 5JJ0A 4I43A 1ELWA 3FH8A 4GYYA 1K8KG 1JWFA 5H7PA 4YNMA 5B1BE 3FTYA 5G04J 4IJDA 2X6JA 1N4RA 2DZNA 4OVVA 1KLXA 3JXJA 3U3WA 3KMTA 3C98A 3UQ3A 3CVLA 2DCPA 4HI9A 2MOWA 3MO2A 2J09A 4FU3A 3SBTB 5LSXA 5EILA 3IXEA 2WXHA 3MEKA 3PVLA 4I9EA 4KZ0A 3PRZA 4CYMD 3V2XA 4FLBA 4GMJA 3Q7FA 4CDMA 3CIAA 4AEZC 4U7EB 2QYUA 4FLHA 4K5BA 2Y69E 4Y6CA 1TEZA 3PEUB 4CGVA 3CVYA 3U66A 1O1RA 5AIJA 1L5JA 5FWQA 5AENA 1ELKA 4UWKA 4G26A 2VGXA 3ZXSA 3ONLA 2ZISA 1ZKKA 1N94A 3CGHA 4A55A 2X6HA 1ELRA 4J8YA 1IKND 3DEPA 4BT9A 3FUEA 3CHRA 3APDA 1U2VG 3UKUG 3PZ4A 3RQ4A 3TWVA 1OWLA 2HYZA 2EIKE 3M58A 1HU3A 4CZ2D 5LCWJ 4WNFA 4N2QA 1HH8A 1TJFA 3W9FA 4W9RA 2CFUA 3QAQA 4EZKA 4RG9A 3CBMA 1JUQA 2ETAA 2QZAA 1H2VC 3L54A 3SQVA 5G55A 4BSZB 4ACKA 4QEOA 4U8VD 4J7WA 1IXVA 4K5AB 4GB9A 4ACLA 2VSYA 3IBEA 1FCHA 2PZIA 1OY3D 2I1JA 3QWWA 3LS8A 4YPAA 3PZ1A 4BX8A 3EP0A 4ZFHA 1TNBA 1U3DA 2Q7FA 2J8SD 2OOEA 4WWOA 3S7JA 3FEYA 2OEWA 5TTFA 5G2NA 1TN8A 3Q9UC 3D9LA 1BI8B 3AS8A 1VDYA 3CKBA 1ZU2A 3FUHA 3J5PA 3QWPA 3NQPA 5KWDA 1TNUA 1RZ4A 3DSTA 1K1AA 1FT1A 1Z3YA 4U07A 2F69A 3SW9A 3TGOA 3JQ0A 2WMNA 4DK5A 2KCLA 2OCCE 5AARA 5KJMA 4RSYA 3MGBA 4Q94A 2AJAA 1GW6A 3GYZA 2X6FA 4A63B 1HX8A 4GTTA 3UM2A 2C0MA 3ABKE 3LY9A 4JHJA 2IONA 3L22A 3AU5A 3QARA 4BERA 2XHEA 3QKYA 3ZUVB 2BTDA 2WM9A 4JA7A 3D9JA 4HOQA 2F37A 3D9NA 3M54A 3M57A 1N52A 4GTMA 3D9IA 4WWPA 4G8LA 3MJWA 5ANRA 5ARFA 1D9SA 4L9PA 4Z68A 3CVVA 3EU9A 4GTPA 3EDTB 2WXLA 4G1TA 4F1SA 1HFAA 4IJ8A 3RRUA 4QENA 2MYOA 3ABLE 3HVEA 2R02A 3DRAA 3LXUX 1H6OA 5FZQA 1FVFA 3SI5A 3S7BA 4I6GA 4BUPA 5ITZF 2ILRA 1OCCE 5HRYA 2AWIA 4J7FA 4YDYA 1LD8A 1IQUA 3BO5A 2BKGA 4BTBA 5AAOA 3CHMA 3C5RA 2CHWA 3L13A 2WQ6A 3HXDA 4XZ4A 3LJNA 2XPIA 5BV1A 1JWGA 3PNTB 3R9MA 3NBNB 2RFAA 5ENPD 1PC2A 2QYJA 3SY2A 4BTAA 5BXUA 4Q96A 4UQZA 3Q4AB 3ZKJA 3LEWA 3FUKA 4CCAA 3SFYA 4A3VA 2PM6A 2LO6A 4OAUC 1S64A 4YVOA 4IRUA 3LY8A 4YPUA 3D9OA 1N6CA 1NZNA 3DALA 4B94A 4IYPA 4FMUA 1E96B 2LXLA 1WM5A 5CPRB 3Q15A 3MYVA 3M5AA 3ABME 3PUJA 4HOSA 2Y3AA 2DBAA 4NRHB 3T5XA 2VSNA 4DX6D 1AP7A 3L82A 2L6BA 1YMPA 2XEVA 4LSZE 3QDNA 2P9IG 3G2WA 4BT8A 3ML8A 2R3AA 3LY7A 3I4GA 5JHAA 1SW6A 4ANUA 3T5VA 2XRZA 2FI7A 4DLQA 2WXRA 2XZDG 1ZB1A 4TXRA 4B93B 2VGYA 3ZN3A 5B1AE 3IHYA 2GGFA 3P2BA 4GMRA 4WNDA 3UT8A 1E8XA 4MBGA 3W9GA 4XKBA 5ANLA 2KATA 3MX3A 2ONDA 3RRNB 1WG0A 3B7SA 3SO8A 3ESKA 3L08A 4FP7A 2F0YA 3CKCA 3ONKA 3HDXA 3UPVA 2GRLA 1N3JA 4LUNU 3EIQC 4AIFA 3RAUA 2EQXA 3LJ3A 5BW8C 4DX1A 5JHBA 2GRNB 3KS2A 4G11A 5BPPA 3X2QE 2PM7A 2XCBA 1TNZA 3U9WA 4AY5A 4ZHBA 2CG3A 2ZU6B 3FUMA 3OXLA 1TJCA 2X3MA 4G8KA 1TR4A 2ETBA 5EN5D 5D66A 5IY5E 4GU5A 4EECA 5ENSD 3PEVB 1N4SA 4QFVA 4EHMA 3TXMA 4PS8A 2JABA 1H2TC 2NC9A 3OAWA 2V0PA 4LDGA 3ZIMA 2V5FA 3F9XA 2RFMA 3FDHA 3PZDA 2R59A 3KD7A 3RRMB 4N3AA 4RG6A 3OPEA 3M55A 3OXGA 4K03A 5CCMA 2AXUA 3DEOA 2J4BA 5JHNA 2P9NG 3HXBA 5D0OD 2F8YA 2L0TB 3HRAA 2L9BA 4KVOA 1HXIA 3CHOA 2LNIA 3QWVA 4JLGA 2C2LA 3K5KA 3J5QB 4JPSA 3Q5MA 3ULQA 4FC8A 3DSUA 4URKA 3FUJA 4LERA 4XIFA 4JW1A 5CMWA 2UWJG 2IEJA 1LD7A 4A3TA 3OS5A 1H3IA 4MKTA 1H19A 4GTSA 2I1KA 2XGOA 5AQBA 1OCZE 3CR3A 2HM8A 3PH0C 3V79K 2W5ZA 1V54E 5KJKA 3LKUA 1UN9A 3RO3A 5JINA 3I5PA 4TUUA 4J8FA 3LCAA 1WY6A 3PS6A 2DYRE 1NA0A 1UG3A 3E4BA 3Q78A 4X8QA 3S8PA 4U96D 2XZTG 2YHCA 3IV0A 2KCKA 1RW2A 3C3QA 4N3BA 2P58C 4KYOB 3QB2A 5EIBE 2WXJA 4MLPA 3SWCA 1MUFA 2UY1B 2WXMA 3D9MA 3ZHEB 3FHEA 2IF4A 2AVPA 1NI1A 3ULEG 3NZUA 1ML9A 3VLEA 4XI9A 4I1MA 3AAAC 4DPRA 5ENNA 2J49A 3KEZA 2WB2A 3Q73A 4WAFA 3ZYMA 4UWLA 4JA9A 2IJGX 5E76A 4WNGA 3KMAA 4L7TA 3L9TA 3MCXA 4ANWA 3B7RL 5BUZA 4UI9J 1SA5A 3TXNA 1PEGA 3CK8A 3FUNA 4DX2A 4V3IA 2DVWA 3MKQA 1MX6A 2XRYA 5JJTA 3LYAA 4WUYA 3G2VA 3PE3A 1WAO1 1E8ZA 2V8SE 1YA0A 1BD8A 2BKKB 2L0IA 5T3RA 1FT2A 2IU1A 1XNFA 2ETCA 1TNOA 4FULA 4C0EA 3FTZA 3RKVA 4U0SA 3JYSA 4CT4A 2H6FA 4E6HA 1A17A 3UUXA 4DLOA 1MJ0A 1P5QA 4H7YA 1JCQA 3FY4A 3VLDA 4G24A 3SZ7A 2OVBA 3HHMA 5DIZA 3CVPA 3FTUA 4PH4B 3ZYQA 1TNYA 2WMOA 2DYSE 3DWLG 4UQXA 2KZTA 2P9KG 1OWPA 2JEKA 3FFLA 3ZGQA 4HI8A 4BETA 3NZSA 4GYOA 4FJZA 3APCA 1NL4A 3EHMA 5KJLA 2VGXB 3BUAA 2B0OE 4PS3A 3HYMB 5AJDA 3ZXPA 3RO2A 4I6EA 4U04A 4TV3A 4A1GA 3T9KA 4J0UA 3CVWA 5EYLA 3SNXA 2WXKA 1DC2A 1DCQA 1MT6A 2R05A 1O5MA 4J8DA 4K0RA 3MKQB 4I6JA 4B0ZA 4APOA 2V4HC 4CT0A 2IGQA 4MI0A 5ENTD 4F53A 2G46A 3ZU7B 2VSXE 1N4PA 3FU3A 2VQ2A 2VJ8A 3Q47B 3NF1A 2H6GA 3MV3B 2BUGA 3L17A 3EUVA 4UWFA 5F6KC 3DPDA 1MVHA 3SD5A 3PREA 3ASGA 3D9HA 4PUCA 2I6HA 1N4QA 4I1OB 3F9ZA 3KSLA 2GRRB 1Z3XA 3VTYA 4GCNA 3CV0A 4WWNA 3WG7E 3KMJA 4KBQA 3CVXA 5FIOA 3O48A 2XEEA 4JVSA 4NURA 4N2SA 3BG1B 4C0MA 3ML9A 1IQRA 1PAQA 4JEHA 4YNDA 4HFGA 4LG6A 5ENQD 4DX7D 5AYFA 3FU6A 3ISMC 2LSUA 5ENRD 4GA2A 4OYSA 5F5EA 1DVPA 4I1AA 4RVBA 3FTWA 3CBPA 1N0RA 4U95D 2WXQA 1S63A 1FPPA 2I2OA 2VGEA 2EIJE 3AU4A 4U0UA 3FUFA 3UIPC 1QZ2A 3ZPJA 1QYMA 4UI9K 1HO8A 4JXTA 2PQNA 1JCRA 3IHXA 4NACA 2CHZA 2E2EA 5FQ8A 4CEMA 2P9UG 2WXNA 4GZDA 5CEDB 3HNAA 2EINE 3CSFA 2IFUA 4KZCA 2NYJA 3E37A 4ME2A 4RZ0A 4F3VA 2VSOE 5EIDA 5G05C 5JJ6A 4BEPA 2R17C 5CECB 3ZEFA 4YNPA 2AXVA 4ATZD 4OAVB 1MYOA 3ZFWA 2VTBA 4KXKB 1XGWA 4EZJA 4GTRA 4HQDA 3OXFA 2KM4A 3ASNE 3D9KA 4LNGA 4DI4A 3JQ1A 2GW1A 3LDZA 5AYWD 4C48B 5FZRA 5CMYA 1X81A 1MX4A 2WXGA 1YYHA 4GPMA 3EHRA 4AOFA 3UIOC 1N6AA 3OOIA 1NP7A 3NOGD 2AXZA 3HVEB 4U0ZA 3SBSA 3DSSA 5TH7A 2MRIA 4BWRA 1UW4B 3B95A 5C2YA 2KBXA 2IOLA 1KZOA 2L6JA 1E7UA 1SA4A 1IHGA 3GW4A 1LF8A 1INZA 3V30A 1MHQA 3JXIA 3TG4A 1HG5A 1XQHA 3TWXA 2QY7A 1TYQG 1OCOE 1WDYA 3GZ2A 5C1DA 4GZ3A 5AJLA 3V2OA 5ENOD 3D9PA 4KVMA 4EQFA 3F6QA 5KCMA 1E8YA 3TWRA 4M3OA 4O30A 3F9WA 2PQRA 1IYGA 2H6IA 4O1PA 4NJ5A 3SGHA 3UT7A 2IQCA 3DSWA 5EX3A 4F7AA 2RFIA 5A23A 2DWZA 3RJWA 4CDRA 2R5SA 4GCOA 5T5GA 3SFZA 3AS5A 4Z4PA 3CK9A 3VLFA 3G2UA 1Y6IA 2WXPA 1AWCB 4BX9A 5T8IA 1D8DA 3HXEA 5FQ7A 3TAXA 1Y8MA 4N3CA 2BQZA 1ZBPA 5CRUA 2IO3C 5DBKA 4L23A 2KCVA 3HXFA 2DIWA 2XCCA 4GYWA 4AY6A 4HRMB 2MHKA 4TRQA 4I17A 4JD2G 5EX0A 2JLBA 4N39A 3UINC 3NOCD 2W5YA 3TL5A 2QFCA 4HBDA 4P29A 3ENEA 1EDUA 2FULA 3FP3A 1U3CA 4U63A 5E75A 5KJNA 3Q7AA 4TUMA 2NSZA 4HOUA 3EJNA 4DI3A 5JMND 4GMLA 4YPEA 4LNUD 2ZGDA 2C0LA 1BU9A 1Z6TA 1OCRE 3ZYLA 1O1TA 3C3OA 4EZLA 3I3NA 4JL0A 4HOTA 2FO7A 2DZOA 2BF0X 4B8AA 2IY0C 1W3BA 5T0KA 2RD0A 2CG2A 5T0MA 2ZXWE 4NVQA 3HXCA 2WXOA 4PDXA 2HO1A 5BNWA 2I9CA 4GTQA 1H0AA 4N5QA 1TN7A 5CHEE 1OWMA 3PUKA 1MZCA 3UM1A 1OWOA 1MX2A 2GRQB 2J4DA 1OUVA 4WNEA 3KAEA 2KC7A 2V5QC 4EPZA 4OVUA 3HIZA 3QC1A 2PL2A 3HG0D 2B6CA 3RSEG 2XENA 2RG8A 3EHQA 4I9CA 4FJYA 3NAWA 3QOUA 3I4RB 4Y6WA 4YDEA 5BT1A 3KEAA 4YVQC 1Z5SC 4AP2A 4XEIG 4E85A 4MI5A 2NXPA 3Q79A 2YINA 2XPYA 4BY6A 1O9SA 1OXJA 3TWSA 1X5BA 3NB2A 4CRWA 3JUIA 2FO1E 4IN3B 5FT9A 4HLLA 4R7LA 2Y4TA 1QNFA 4J8EA 3R7RA 4U8HA 2OEVA 4XE0A 4AU7A 4ILGA 3TWUA 3Q9NC 5G05J 3MKRA 5HI7A 2IO2C 2VYIA 3B13A 5KNHD 1DNPA 3RAYA 1N11A 1TN6A 3BQOA 3IKOB 4J8SA 1BI7B 5LSZA 4I2ZA 5FZSA 1D8EA 3GZ1A 2FBNA 3APFA 4GTVA 4I2WA 4F1PA 1UJJA 3CK7A 3CSTA 3E32A 3DBSA 5EDSA 2IOSA 4FA6A 3ZRHA 4HB5A 4B89A 4AV7A 3BEEA 3UI2A 4ATGA 5BXOA 3TG5A 2OVFA 3R9AB 3C72A 3B7TA 3ASFA 3CVQA 1SZAA 1YCSB 5A6CA 1EPUA 2P9LG 2KXPC 4C1QA 4DRXE 5CEAA 3RIBA 4DX5D 4RLYA 4Q69A 5HS0A 2CHXA 1KPSB 3CHQA 4J7IA 5A7DB 4K5CA 5CRVA 5B3SE 4FHKA 5FTPA 3FPDA 1MQSA 3AG1E 2J9QA 1EF1C 3OTNA 3ZVVA 5FQ6A 2A5UA 2R03A 4IULA 4F6RD 3E34A 2LSVA 1E90A 2WQHA 4LEUA 4EBAA 3FU0A 4XKCA 3G2TA 2E0IA 1BLXB 2X38A 2XPZA 4M7CA 2PNNA 2YQ8A 3LPZA 4B8CB 2FF4A 4DJAA 3ASDA 1HG2A 2GROB 4JHRA 3VTXA 4G25A 3L16A 4O1OA 5F59A 2WPVA 2WQ7A 1QBQA 3S7DA 2A4ZA 1MVXA 3QK0A 1SQMA 3ASOE 1H6PA 3PZ3A 2EIME 1O1SA 3CQCB 4N5CA 3FWVA 5FQ4A 3U4TA 1HE8A 3CEQA 2H6HA 1HF8A 4GZCA 1PY1A 2XS8A 3PZ2A 3IHVA 4AM9A 1N0QA 1NA3A 4L1BA 4HORA 5CCLA 4LCTA 3IEGA 3FULA 3DPYA 3V31A 3D3MA 4H7XA 1HS6A 5TEGA 4I51A 4GTOA 4XI0A 4QQIA 2RKKA 4KMOA 2GRPB 4GZ6A 2KZTB 3VUZA 3FTVA 3M59A 3CQGB 4APFA 4L2YA 4UWGA 3UM3A 2YNQA 3FTSA 5LX8A 3VV0A 4NQ0A 2WXIA 3UMVA 1K3ZD 3UKRG 3MZLB 5CERB 4TXPA 5EYPF 4HS2A 2QC9A 4QEPA 2XGMA 3B7BA 5LFAA 3M56A 3ESLA 5M72A
chains in the Genus database with same CATH topology
4KVMA 1HXIA 1TJFA 5BV0A 4W9RA 4EQFA 3CHOA 5EKQD 2CFUA 3QAQA 4EZKA 2LNIA 3QWVA 4RG9A 4JLGA 2C2LA 3CBMA 1JUQA 5KCMA 1E8YA 3K5KA 1EYHA 1H2VC 4JPSA 3Q5MA 4M3OA 3ULQA 3L54A 4FC8A 4URKA 3FUJA 4O30A 4LERA 3F9WA 4XIFA 5FJYA 5G55A 5T4YA 4ACKA 4QEOA 2PQRA 3PNLB 4JW1A 4AJWA 1IYGA 5CMWA 2JV0A 4JEUA 2UWJG 5G04C 1SZ9A 3K9IA 4MRUA 4NJ5A 3SGHA 3UT7A 2IQCA 4HVBA 5EX3A 4A3TA 2XQ0A 4F7AA 5A23A 2RFIA 4GB9A 3OS5A 1FVHA 4ACLA 2VSYA 3IBEA 1FCHA 2R5SA 4GCOA 4MKTA 4CDRA 1H3IA 2QPWA 2PZIA 1H19A 3SFZA 3AS5A 5T5GA 4JHKA 4Z4PA 3CK9A 3VLFA 3AS4A 4GAAA 2I1KA 1Y6IA 2WXPA 3G2UA 2X6IA 4UQYA 4BX9A 4G2VA 5T8IA 2XGOA 5FQ7A 3TAXA 2I1JA 3CR3A 1Y8MA 3QWWA 3LS8A 4N3CA 2BQZA 1ZBPA 2HM8A 3PH0C 5DBKA 4YPAA 1N54A 4BX8A 2W5ZA 1UJKA 3FUIA 3EP0A 3PE4A 4L23A 3TJPA 2KCVA 3LKUA 5KJKA 1U3DA 2DIWA 1JPLA 2XCCA 1UN9A 4GYWA 3RO3A 4AY6A 5JINA 2MHKA 4TRQA 3I5PA 4TUUA 2Q7FA 2Y4UA 4I17A 3LCAA 1WY6A 4J8FA 2OOEA 5EX0A 3SHFA 4JZYA 3RJVA 3ASHA 3PS6A 4WWOA 3S7JA 2JLBA 3FEYA 4GZ5A 4J8OA 4N39A 3CHPA 1NA0A 1UG3A 3E4BA 3TL5A 2W5YA 3T8MA 5TTFA 4AXHA 3S8PA 2QFCA 5HQ8A 5G2NA 3FH5A 3CHSA 3D9LA 2YHCA 3JCKC 1HH8A 3IV0A 3AS8A 1VDYA 2KCKA 3CKBA 3ENEA 4P29A 1ZU2A 1EDUA 1B89A 3FUHA 4N3BA 2FULA 2P58C 1H6KA 3FP3A 4KYOB 3QWPA 3QB2A 1U3CA 4U63A 3EHNA 3NQPA 5E75A 2WXJA 4KT6B 4MLPA 5EG2A 3EIJA 5KJNA 1UN8A 2NSZA 4HOUA 3EJNA 3SWCA 4DI3A 1MUFA 3S7FA 4GMLA 2UY1B 3ZW3A 2WXMA 3D9MA 3ZHEB 3FHEA 4YPEA 2IF4A 2AVPA 2C0LA 3PDNA 1Z3YA 1Z6TA 2WXFA 4U07A 3ZYLA 3NZUA 2F69A 4GA1A 1ML9A 2FEZA 2YHEA 4EZLA 3G2SA 3I3NA 4JL0A 4UI9C 3VLEA 3TGOA 4XI9A 4HOTA 3SW9A 3JQ0A 3B7UX 2FO7A 4I1MA 4ABNA 4DPRA 4E47A 2WMNA 2WVIA 5ENNA 2J49A 3KEZA 4DK5A 4FADA 2WB2A 2BF0X 2KCLA 3ZYMA 4WAFA 4UWLA 3SF4A 4JA9A 2IJGX 4B8AA 5E76A 5KJMA 2X6KA 1W3BA 4RSYA 3MGBA 4Q94A 4WNGA 5T0KA 3MV2B 2RD0A 3KMAA 4L7TA 1GW6A 4J83A 3GYZA 2CG2A 3MCXA 4ANWA 2X6FA 3S2AA 1HX8A 3B7RL 5T0MA 4NVQA 5BUZA 4UI9J 5LCWC 3F9YA 2XGSA 2C0MA 3LVRE 3LY9A 4H12A 4JHJA 1H2UA 2WXOA 3TXNA 1PEGA 2IONA 3L22A 3AU5A 3QARA 3CK8A 4PDXA 5JIYA 2HO1A 3FUNA 3R7QA 2XHEA 3DB5A 4V3IA 2OV8A 3QKYA 3MKQA 5BNWA 2I9CA 2BTDA 3Q49B 2XRYA 2WM9A 5JJTA 1H0AA 3LYAA 4WUYA 3G2VA 4JA7A 3D9JA 4HOQA 3PE3A 1WAO1 1E8ZA 3D9NA 5LP0A 2V8SE 1YA0A 3M54A 2L0IA 1E8WA 4ILIA 5CHEE 2IU1A 1OWMA 5T3RA 3M57A 1XNFA 1N52A 3PUKA 4FULA 3BG0B 4C0EA 3D9IA 4WWPA 3FTZA 3RKVA 1OWOA 4U0SA 4BSXA 3JYSA 2M63A 4CT4A 3FUDA 1A17A 4E6HA 3MJWA 3UUXA 4DLOA 1HZ4A 3CVNA 2J4DA 5J08A 5ANRA 1OUVA 4WNEA 3KAEA 1P5QA 4H7YA 2KC7A 5ARFA 2VTBB 4HLEA 4EPZA 3FY4A 4OVUA 3HIZA 3QC1A 3VLDA 2PL2A 4G24A 3CVVA 3SZ7A 3N71A 2OVBA 4A1SA 2RG8A 4I9CA 2LAIA 3EDTB 2WXLA 3HHMA 4G1TA 3CVUA 4FJYA 5DIZA 4C9BB 3CVPA 3FTUA 3CBOA 3QOUA 3I4RB 4PH4B 4Y6WA 4F1SA 3ZYQA 3QJZA 1HFAA 3RK6A 4AVXA 4IJ8A 3RRUA 4QENA 4LRZA 2J08A 2WMOA 3HVEA 4UQXA 2CFZA 2KZTA 5BT1A 5J90A 4YVQC 3LXUX 1OWPA 2JEKA 5FZQA 1FVFA 4BFRA 3SI5A 3FFLA 3URZA 3ZGQA 4AP2A 3S7BA 4I6GA 4BUPA 4E85A 3NZSA 2ILRA 4GYOA 4MI5A 2GRMA 4FJZA 2NXPA 3APCA 3FU5A 4HXIA 2AWIA 2AW6A 4ANXA 4J6IA 4J7FA 2YINA 4MS6A 1BPOA 2XPYA 4BY6A 1O9SA 3EHMA 1IQUA 5KJLA 2VGXB 4PS3A 4ANVA 3BO5A 3HYMB 4BTBA 5AJDA 1X5BA 4CRWA 3JUIA 2V4LA 4I6EA 3RO2A 3CHMA 4U04A 4IN3B 4TV3A 4A1GA 5FT9A 4J0UA 3CVWA 3SNXA 3CLJA 2WXKA 3LVQE 5LOZA 2CHWA 3L13A 2O8JA 4R7LA 2WQ6A 1MT6A 4G23A 4J8DA 3FEXA 4K0RA 4XZ4A 3MKQB 4I6JA 2XPIA 2Y4TA 4B0ZA 4APOA 4D10C 5BV1A 4CT0A 1JWGA 1QNFA 2IGQA 3PNTB 4MI0A 2G46A 4F53A 3U64A 4J8EA 3R7RA 2VSXE 4U8HA 3FU3A 2VQ2A 2VJ8A 3Q47B 1PC2A 1S0PA 4ILGA 4XE0A 4AU7A 4BTAA 3NF1A 4Q96A 5G05J 3MKRA 4EBAG 4L2LA 5HI7A 3P1UA 4UQZA 3MV3B 2BUGA 3L17A 3Q4AB 2VYIA 5F6LA 3B13A 4UWFA 5F6KC 3LEWA 4JC8A 1E7VA 1DNPA 3DPDA 3RAYA 3FUKA 3IKOB 4J8SA 1MVHA 3SD5A 4CCAA 3GZSA 3PREA 4A3VA 3ASGA 5LSZA 4I2ZA 5FZSA 3GZ1A 2FBNA 4PUCA 2PM6A 3O4ZA 2I6HA 4O6FA 3APFA 4I1OB 2LO6A 3QNKA 4I2WA 3F9ZA 1Z3XA 3VTYA 4GCNA 3CV0A 4IRUA 4WWNA 4YVOA 1UJJA 3CK7A 3CSTA 4PS7A 5D0QD 3DBSA 3LY8A 3KMJA 5EDSA 4YPUA 3D9OA 2IOSA 4FA6A 3ZRHA 1N6CA 1NZNA 4KBQA 4B89A 3CVXA 4AV7A 3DALA 3BEEA 3FTXA 2HR2A 3WXXA 4B94A 4ATGA 3TG5A 4IYPA 2OVFA 4FMUA 3O48A 3R9AB 1E96B 1WM5A 3B7TA 4UWHA 3ASFA 5CPRB 3CVQA 3Q15A 4JVSA 3MYVA 3M5AA 4NURA 1SZAA 4N2SA 3PUJA 5A6CA 4HOSA 1QQEA 3BG1B 4C0MA 3UX4A 1EPUA 2Y3AA 3ML9A 1IQRA 1PAQA 4JEHA 2DBAA 4C1QA 4NRHB 3T5XA 4YNDA 5JJ7A 2VSNA 2J07A 4HFGA 3RIBA 3UT4A 4ILHB 4Q69A 1KT0A 5AYFA 2LAHA 3ZYKA 2XEVA 3FU6A 4FHJA 2CHXA 3MA5A 5ARGA 2UY1A 4CGWA 2LSUA 4XX5A 3ZHEA 1OWNA 3QDNA 3CHQA 4GA2A 3G2WA 4J7IA 5A7DB 4OYSA 4GA0A 4BT8A 5F5EA 4GPKA 3ML8A 1DVPA 4FHKA 2R3AA 5FTPA 3FPDA 1MQSA 3LY7A 3MO0A 4I1AA 2J9QA 3I4GA 5JHAA 1EF1C 3OTNA 3ZVVA 5FQ6A 2A5UA 4ANUA 4RVBA 3T5VA 3FTWA 2XRZA 3CBPA 4IULA 2LSVA 2WXQA 1E90A 2FI7A 2WQHA 4DLQA 3MO5A 2WXRA 4LEUA 3FH7A 2I2OA 4EBAA 3FU0A 4XKCA 3G2TA 2E0IA 3AU4A 2VGYA 4U0UA 3ZN3A 2X38A 2XPZA 3FUFA 2GGFA 3IHYA 1QZ2A 3P2BA 4WNDA 3ZPJA 4JDSA 3RJWA 4UI9K 1HO8A 3L6AA 4JXTA 2PQNA 1KT1A 4CDNA 3RU0A 3UT8A 3IHXA 2YQ8A 4NACA 2CHZA 1E8XA 2E2EA 3LPZA 4B8CB 3M53A 2FF4A 5FQ8A 4CEMA 5JJ0A 4I43A 1ELWA 4DJAA 3FH8A 3ASDA 2WXNA 1HG2A 4GZDA 4XKBA 5ANLA 4GYYA 2KATA 3MX3A 4JHRA 3HNAA 2ONDA 3CSFA 1JWFA 3RRNB 4YNMA 2IFUA 3B7SA 4G25A 3VTXA 3FTYA 3L16A 3ESKA 4KZCA 5G04J 5F59A 3L08A 2WPVA 2WQ7A 4FP7A 4ME2A 4IJDA 4RZ0A 3S7DA 3CKCA 2X6JA 3ONKA 3HDXA 4F3VA 2GRLA 2VSOE 5G05C 5JJ6A 2A4ZA 3EIQC 4LUNU 3UPVA 1MVXA 1N3JA 3QK0A 1SQMA 4AIFA 2R17C 2EQXA 3LJ3A 4OVVA 3ZEFA 1KLXA 5BW8C 4YNPA 5JHBA 3U3WA 3CQCB 2AXVA 3KMTA 3C98A 4N5CA 3FWVA 3UQ3A 5FQ4A 3CVLA 2DCPA 3KS2A 2MOWA 3U4TA 1HE8A 3ZFWA 2J09A 2VTBA 4G11A 3CEQA 3MO2A 4FU3A 1HF8A 4GZCA 4KXKB 1XGWA 3SBTB 5BPPA 5LSXA 2PM7A 4EZJA 1PY1A 2XCBA 3U9WA 2WXHA 3MEKA 4AY5A 3OXFA 3PVLA 2KM4A 2CG3A 2ZU6B 3D9KA 4I9EA 4KZ0A 3FUMA 3IHVA 3OXLA 3PRZA 4AM9A 1NA3A 4L1BA 4DI4A 1TJCA 4HORA 2X3MA 5CCLA 3JQ1A 2GW1A 3LDZA 4FLBA 4GMJA 5AYWD 5FZRA 5CMYA 4CDMA 4LCTA 3CIAA 3IEGA 4AEZC 2WXGA 3FULA 5M72A 3D3MA 4GU5A 4FLHA 4EECA 4AOFA 4H7XA 3PEVB 1HS6A 1N6AA 5TEGA 4QFVA 3OOIA 1NP7A 4I51A 3TXMA 4PS8A 4XI0A 4Y6CA 1TEZA 3PEUB 4CGVA 2AXZA 3CVYA 1H2TC 4KMOA 3U66A 2NC9A 3HVEB 3OAWA 4GZ6A 4U0ZA 5AIJA 1L5JA 2KZTB 5FWQA 3SBSA 2V0PA 1ELKA 5AENA 4LDGA 3VUZA 3FTVA 3ZIMA 4UWKA 2V5FA 5TH7A 3M59A 3F9XA 4G26A 3CQGB 4APFA 3FDHA 2MRIA 2VGXA 3PZDA 4L2YA 3ONLA 3ZXSA 4BWRA 2R59A 4UWGA 3KD7A 3RRMB 4N3AA 1ZKKA 1UW4B 2YNQA 3FTSA 5C2YA 4RG6A 3OPEA 5LX8A 3CGHA 3VV0A 2IOLA 4A55A 2X6HA 4NQ0A 1ELRA 3M55A 2L6JA 1E7UA 1IHGA 3GW4A 4BT9A 3OXGA 2WXIA 3FUEA 4K03A 5CCMA 1LF8A 2AXUA 3CHRA 1INZA 3APDA 3UMVA 1MHQA 3MZLB 2J4BA 5JHNA 3RQ4A 4HS2A 1HG5A 1OWLA 3TG4A 1XQHA 2HYZA 2QY7A 5D0OD 4QEPA 2XGMA 5LFAA 3M58A 1HU3A 5LCWJ 3M56A 3GZ2A 2L0TB 4WNFA 5C1DA 4GZ3A 4N2QA 3ESLA 5AJLA 2L9BA 4KVOA 3D9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXI A;  4W9R A;  4EQF A;  5EKQ D;  2LNI A;  3QWV A;  4RG9 A;  4JLG A;  2C2L A;  3CBM A;  3K5K A;  3Q5M A;  3ULQ A;  4O30 A;  3F9W A;  4XIF A;  5FJY A;  4QEO A;  2PQR A;  1IYG A;  2JV0 A;  2UWJ G;  5G04 C;  3K9I A;  4NJ5 A;  5EX3 A;  2RFI A;  3OS5 A;  3RJW A;  2QPW A;  2VSY A;  4CDR A;  1FCH A;  2R5S A;  4GCO A;  1H3I A;  5T5G A;  2PZI A;  3AS5 A;  4Z4P A;  3CK9 A;  3AS4 A;  4UQY A;  4G2V A;  2XGO A;  3TAX A;  1Y8M A;  3QWW A;  4N3C A;  2BQZ A;  1ZBP A;  5DBK A;  4YPA A;  2W5Z A;  3EP0 A;  3PE4 A;  2KCV A;  3LKU A;  5KJK A;  2XCC A;  4GYW A;  4AY6 A;  3RO3 A;  5JIN A;  2MHK A;  2Q7F A;  2Y4U A;  4I17 A;  3LCA A;  4J8F A;  2OOE A;  5EX0 A;  3RJV A;  3ASH A;  3S7J A;  2JLB A;  4GZ5 A;  4J8O A;  4N39 A;  1NA0 A;  3E4B A;  2W5Y A;  5TTF A;  3S8P A;  2QFC A;  5HQ8 A;  2YHC A;  3AS8 A;  2KCK A;  3CKB A;  1ZU2 A;  1B89 A;  4N3B A;  2P58 C;  3FP3 A;  4KYO B;  3QWP A;  5EG2 A;  5KJN A;  4HOU A;  3SWC A;  1MUF A;  3S7F A;  2UY1 B;  4YPE A;  3ZHE B;  2IF4 A;  2C0L A;  2AVP A;  3PDN A;  4U07 A;  2F69 A;  4GA1 A;  1ML9 A;  2FEZ A;  4JL0 A;  4UI9 C;  3SW9 A;  3TGO A;  4XI9 A;  4HOT A;  2FO7 A;  4ABN A;  4E47 A;  2KCL A;  3SF4 A;  4JA9 A;  5KJM A;  1W3B A;  4WNG A;  5T0K A;  3MV2 B;  3KMA A;  4J83 A;  3GYZ A;  5T0M A;  4NVQ A;  4UI9 J;  5LCW C;  3F9Y A;  2XGS A;  2C0M A;  3LY9 A;  4H12 A;  1PEG A;  3CK8 A;  5JIY A;  2HO1 A;  3DB5 A;  3QKY A;  5BNW A;  3Q49 B;  5JJT A;  3LYA A;  4WUY A;  4JA7 A;  4HOQ A;  3PE3 A;  1WAO 1;  1YA0 A;  3M54 A;  5CHE E;  3M57 A;  1XNF A;  3RKV A;  4U0S A;  3JYS A;  1A17 A;  3UUX A;  1HZ4 A;  3CVN A;  1OUV A;  5ARF A;  3KAE A;  1P5Q A;  4H7Y A;  2KC7 A;  4WNE A;  2PL2 A;  4G24 A;  3SZ7 A;  3N71 A;  4A1S A;  4I9C A;  3EDT B;  4G1T A;  5DIZ A;  3CVP A;  3CBO A;  3QOU A;  4Y6W A;  4IJ8 A;  4QEN A;  4UQX A;  5BT1 A;  4YVQ C;  5FZQ A;  3FFL A;  3URZ A;  3ZGQ A;  3S7B A;  4BUP A;  4GYO A;  4MI5 A;  4J7F A;  1O9S A;  5KJL A;  2VGX B;  3BO5 A;  3HYM B;  4BTB A;  3RO2 A;  4U04 A;  4IN3 B;  5FT9 A;  4J0U A;  2O8J A;  1MT6 A;  4G23 A;  4J8D A;  2XPI A;  2Y4T A;  4APO A;  2IGQ A;  4MI0 A;  2G46 A;  4J8E A;  2VQ2 A;  3Q47 B;  1PC2 A;  4AU7 A;  4BTA A;  3NF1 A;  5G05 J;  3MKR A;  5HI7 A;  4UQZ A;  3MV3 B;  2BUG A;  3Q4A B;  2VYI A;  5F6L A;  5F6K C;  3RAY A;  1MVH A;  3ASG A;  5LSZ A;  4I2Z A;  5FZS A;  3GZ1 A;  2FBN A;  2I6H A;  4O6F A;  4I2W A;  3F9Z A;  3VTY A;  4GCN A;  3CV0 A;  4YVO A;  3CK7 A;  3KMJ A;  5D0Q D;  3LY8 A;  4YPU A;  1N6C A;  1NZN A;  4KBQ A;  3DAL A;  3BEE A;  2HR2 A;  3WXX A;  4B94 A;  3TG5 A;  4FMU A;  3O48 A;  3R9A B;  1E96 B;  1WM5 A;  3ASF A;  5CPR B;  3CVQ A;  3Q15 A;  3M5A A;  4N2S A;  4HOS A;  5A6C A;  1QQE A;  2DBA A;  4C1Q A;  4NRH B;  4YND A;  5JJ7 A;  2VSN A;  3RIB A;  1KT0 A;  5AYF A;  4CGW A;  2XEV A;  5ARG A;  3MA5 A;  2UY1 A;  2LSU A;  3ZHE A;  3QDN A;  4GA2 A;  4J7I A;  5A7D B;  4GA0 A;  4BT8 A;  5F5E A;  4GPK A;  2R3A A;  5FTP A;  3FPD A;  3LY7 A;  3MO0 A;  4I1A A;  2J9Q A;  3CBP A;  2LSV A;  2WQH A;  2FI7 A;  3MO5 A;  4LEU A;  2VGY A;  4U0U A;  3ZN3 A;  4JDS A;  4WND A;  1QZ2 A;  3ZPJ A;  4UI9 K;  2PQN A;  1KT1 A;  3RU0 A;  3IHX A;  2YQ8 A;  3M53 A;  2E2E A;  3LPZ A;  2FF4 A;  5JJ0 A;  1ELW A;  3ASD A;  4GYY A;  2KAT A;  4JHR A;  3HNA A;  2OND A;  4YNM A;  2IFU A;  3VTX A;  4G25 A;  3ESK A;  5G04 J;  5F59 A;  2WPV A;  4ME2 A;  4IJD A;  4RZ0 A;  3S7D A;  3CKC A;  4F3V A;  3UPV A;  5JJ6 A;  5G05 C;  1N3J A;  1MVX A;  4AIF A;  4YNP A;  1KLX A;  5BW8 C;  3U3W A;  3KMT A;  4N5C A;  3FWV A;  3UQ3 A;  3CVL A;  3KS2 A;  3U4T A;  3MO2 A;  3ZFW A;  3CEQ A;  5LSX A;  4KXK B;  2XCB A;  3MEK A;  4AY5 A;  3OXF A;  4I9E A;  3OXL A;  4AM9 A;  1NA3 A;  4HOR A;  1TJC A;  5CCL A;  2GW1 A;  5AYW D;  5FZR A;  3IEG A;  4H7X A;  1N6A A;  5TEG A;  3OOI A;  4I51 A;  4XI0 A;  4Y6C A;  4CGV A;  2NC9 A;  4GZ6 A;  4U0Z A;  3VUZ A;  4LDG A;  2V5F A;  5TH7 A;  3M59 A;  3F9X A;  4G26 A;  2VGX A;  4BWR A;  3KD7 A;  1ZKK A;  4N3A A;  4RG6 A;  3OPE A;  3VV0 A;  3M55 A;  4NQ0 A;  1ELR A;  2L6J A;  1IHG A;  3GW4 A;  4BT9 A;  3OXG A;  5CCM A;  5JHN A;  3RQ4 A;  3TG4 A;  1XQH A;  2HYZ A;  5D0O D;  4QEP A;  2XGM A;  3M58 A;  3M56 A;  5LCW J;  3GZ2 A;  4WNF A;  5C1D A;  4GZ3 A;  4N2Q A;  1HH8 A;  5M72 A; 
#chains in the Genus database with same CATH topology
 5BV0 A;  4U8Y D;  5EKQ D;  4UUC A;  3ULY A;  3TWT A;  1EYH A;  5FJY A;  5T4Y A;  3PNL B;  4AJW A;  2JV0 A;  4JEU A;  5G04 C;  1SZ9 A;  3K9I A;  4MRU A;  3DSX A;  4HVB A;  2XQ0 A;  1FVH A;  2QPW A;  4JHK A;  3AS4 A;  4GAA A;  1N9A A;  4UQY A;  2X6I A;  4G2V A;  2EIL E;  1N54 A;  1UJK A;  3FUI A;  3PE4 A;  3TJP A;  1JPL A;  2Y4U A;  1IHB A;  3SHF A;  4JZY A;  3RJV A;  3ASH A;  4JB8 P;  4GZ5 A;  4J8O A;  3CHP A;  4RQI A;  3T8M A;  4AXH A;  5HQ8 A;  4O60 A;  3FH5 A;  3CHS A;  3JCK C;  1DCE A;  3TWW A;  1B89 A;  3UM0 A;  1H6K A;  1N95 A;  3EHN A;  4KT6 B;  5EG2 A;  3EIJ A;  5D2M C;  1UN8 A;  2F8X K;  3S7F A;  3ZW3 A;  1LTX A;  3PDN A;  2WXF A;  4GA1 A;  1V55 E;  2FEZ A;  2YHE A;  3G2S A;  4UI9 C;  1Q2Z A;  1A5E A;  3E30 A;  3B7U X;  4ABN A;  4E47 A;  2WVI A;  1UOH A;  4FAD A;  3SF4 A;  2P9S G;  5AN8 A;  2X6K A;  3MV2 B;  4J83 A;  3S2A A;  5CBO A;  5HKP A;  2ZIR A;  3DSV A;  5LCW C;  3F9Y A;  5JA4 D;  2XGS A;  3LVR E;  4H12 A;  1H2U A;  3UTM A;  3ZNG A;  5JIY A;  3R7Q A;  3DB5 A;  2OV8 A;  3AG4 E;  3Q49 B;  5AQ9 A;  5LP0 A;  3T8K A;  1E8W A;  4ILI A;  1JCS A;  3BG0 B;  2Y0B G;  4BSX A;  2M63 A;  3FUD A;  3TWQ A;  1HZ4 A;  3CVN A;  3BU8 A;  5J08 A;  2VTB B;  4HLE A;  3DXM G;  4YDW A;  3N71 A;  4A1S A;  3SFX A;  4HNA D;  5KNG A;  2LAI A;  3CVU A;  4C9B B;  2P9P G;  3CBO A;  3QJZ A;  4AVX A;  3RK6 A;  2XEH A;  4LRZ A;  2J08 A;  2CFZ A;  5J90 A;  4BFR A;  3URZ A;  4NIK A;  2GRM A;  3FU5 A;  4HXI A;  4TXQ A;  2AW6 A;  3AG3 E;  4J6I A;  4ANX A;  4MS6 A;  1BPO A;  4ANV A;  4LNB A;  2V4L A;  2R2L A;  3UXG A;  1S70 B;  3CLJ A;  3LVQ E;  5LOZ A;  2O8J A;  2A5E A;  4G23 A;  3FEX A;  4D10 C;  4BES A;  3U64 A;  3Q75 A;  2XS1 A;  1S0P A;  4DUI A;  3DXK G;  2P2C P;  4EBA G;  4L2L A;  3P1U A;  5F6L A;  4JC8 A;  1E7V A;  4HRL A;  3AG2 E;  3GZS A;  5AQA A;  3AJI A;  3O4Z A;  4O6F A;  2HE0 A;  3QNK A;  3KSQ A;  1NFI E;  1OT8 A;  3C3R A;  5KBA A;  5FIN A;  4PS7 A;  5D0Q D;  3JUE A;  3EU5 A;  3FTX A;  2HR2 A;  3WXX A;  1K1B A;  4YDO A;  1SVX A;  4UWH A;  2LUH A;  2ZGG A;  1QQE A;  3UX4 A;  5JJ7 A;  2J07 A;  3UT4 A;  4ILH B;  1KT0 A;  2LAH A;  3ZYK A;  4FHJ A;  5ARG A;  4CGW A;  3MA5 A;  2UY1 A;  4XX5 A;  3ZHE A;  1OWN A;  4GA0 A;  4GPK A;  2BED A;  3MO0 A;  5AQ7 A;  2LXM A;  3E33 A;  3MO5 A;  3FH7 A;  5CBN A;  1G3N B;  4JDS A;  1KZP A;  4HRN A;  2Y1L E;  3L6A A;  1KT1 A;  4CDN A;  3RU0 A;  3M53 A;  5JJ0 A;  4I43 A;  1ELW A;  3FH8 A;  4GYY A;  1K8K G;  1JWF A;  5H7P A;  4YNM A;  5B1B E;  3FTY A;  5G04 J;  4IJD A;  2X6J A;  1N4R A;  2DZN A;  4OVV A;  1KLX A;  3JXJ A;  3U3W A;  3KMT A;  3C98 A;  3UQ3 A;  3CVL A;  2DCP A;  4HI9 A;  2MOW A;  3MO2 A;  2J09 A;  4FU3 A;  3SBT B;  5LSX A;  5EIL A;  3IXE A;  2WXH A;  3MEK A;  3PVL A;  4I9E A;  4KZ0 A;  3PRZ A;  4CYM D;  3V2X A;  4FLB A;  4GMJ A;  3Q7F A;  4CDM A;  3CIA A;  4AEZ C;  4U7E B;  2QYU A;  4FLH A;  4K5B A;  2Y69 E;  4Y6C A;  1TEZ A;  3PEU B;  4CGV A;  3CVY A;  3U66 A;  1O1R A;  5AIJ A;  1L5J A;  5FWQ A;  5AEN A;  1ELK A;  4UWK A;  4G26 A;  2VGX A;  3ZXS A;  3ONL A;  2ZIS A;  1ZKK A;  1N94 A;  3CGH A;  4A55 A;  2X6H A;  1ELR A;  4J8Y A;  1IKN D;  3DEP A;  4BT9 A;  3FUE A;  3CHR A;  3APD A;  1U2V G;  3UKU G;  3PZ4 A;  3RQ4 A;  3TWV A;  1OWL A;  2HYZ A;  2EIK E;  3M58 A;  1HU3 A;  4CZ2 D;  5LCW J;  4WNF A;  4N2Q A;  1HH8 A;  1TJF A;  3W9F A;  4W9R A;  2CFU A;  3QAQ A;  4EZK A;  4RG9 A;  3CBM A;  1JUQ A;  2ETA A;  2QZA A;  1H2V C;  3L54 A;  3SQV A;  5G55 A;  4BSZ B;  4ACK A;  4QEO A;  4U8V D;  4J7W A;  1IXV A;  4K5A B;  4GB9 A;  4ACL A;  2VSY A;  3IBE A;  1FCH A;  2PZI A;  1OY3 D;  2I1J A;  3QWW A;  3LS8 A;  4YPA A;  3PZ1 A;  4BX8 A;  3EP0 A;  4ZFH A;  1TNB A;  1U3D A;  2Q7F A;  2J8S D;  2OOE A;  4WWO A;  3S7J A;  3FEY A;  2OEW A;  5TTF A;  5G2N A;  1TN8 A;  3Q9U C;  3D9L A;  1BI8 B;  3AS8 A;  1VDY A;  3CKB A;  1ZU2 A;  3FUH A;  3J5P A;  3QWP A;  3NQP A;  5KWD A;  1TNU A;  1RZ4 A;  3DST A;  1K1A A;  1FT1 A;  1Z3Y A;  4U07 A;  2F69 A;  3SW9 A;  3TGO A;  3JQ0 A;  2WMN A;  4DK5 A;  2KCL A;  2OCC E;  5AAR A;  5KJM A;  4RSY A;  3MGB A;  4Q94 A;  2AJA A;  1GW6 A;  3GYZ A;  2X6F A;  4A63 B;  1HX8 A;  4GTT A;  3UM2 A;  2C0M A;  3ABK E;  3LY9 A;  4JHJ A;  2ION A;  3L22 A;  3AU5 A;  3QAR A;  4BER A;  2XHE A;  3QKY A;  3ZUV B;  2BTD A;  2WM9 A;  4JA7 A;  3D9J A;  4HOQ A;  2F37 A;  3D9N A;  3M54 A;  3M57 A;  1N52 A;  4GTM A;  3D9I A;  4WWP A;  4G8L A;  3MJW A;  5ANR A;  5ARF A;  1D9S A;  4L9P A;  4Z68 A;  3CVV A;  3EU9 A;  4GTP A;  3EDT B;  2WXL A;  4G1T A;  4F1S A;  1HFA A;  4IJ8 A;  3RRU A;  4QEN A;  2MYO A;  3ABL E;  3HVE A;  2R02 A;  3DRA A;  3LXU X;  1H6O A;  5FZQ A;  1FVF A;  3SI5 A;  3S7B A;  4I6G A;  4BUP A;  5ITZ F;  2ILR A;  1OCC E;  5HRY A;  2AWI A;  4J7F A;  4YDY A;  1LD8 A;  1IQU A;  3BO5 A;  2BKG A;  4BTB A;  5AAO A;  3CHM A;  3C5R A;  2CHW A;  3L13 A;  2WQ6 A;  3HXD A;  4XZ4 A;  3LJN A;  2XPI A;  5BV1 A;  1JWG A;  3PNT B;  3R9M A;  3NBN B;  2RFA A;  5ENP D;  1PC2 A;  2QYJ A;  3SY2 A;  4BTA A;  5BXU A;  4Q96 A;  4UQZ A;  3Q4A B;  3ZKJ A;  3LEW A;  3FUK A;  4CCA A;  3SFY A;  4A3V A;  2PM6 A;  2LO6 A;  4OAU C;  1S64 A;  4YVO A;  4IRU A;  3LY8 A;  4YPU A;  3D9O A;  1N6C A;  1NZN A;  3DAL A;  4B94 A;  4IYP A;  4FMU A;  1E96 B;  2LXL A;  1WM5 A;  5CPR B;  3Q15 A;  3MYV A;  3M5A A;  3ABM E;  3PUJ A;  4HOS A;  2Y3A A;  2DBA A;  4NRH B;  3T5X A;  2VSN A;  4DX6 D;  1AP7 A;  3L82 A;  2L6B A;  1YMP A;  2XEV A;  4LSZ E;  3QDN A;  2P9I G;  3G2W A;  4BT8 A;  3ML8 A;  2R3A A;  3LY7 A;  3I4G A;  5JHA A;  1SW6 A;  4ANU A;  3T5V A;  2XRZ A;  2FI7 A;  4DLQ A;  2WXR A;  2XZD G;  1ZB1 A;  4TXR A;  4B93 B;  2VGY A;  3ZN3 A;  5B1A E;  3IHY A;  2GGF A;  3P2B A;  4GMR A;  4WND A;  3UT8 A;  1E8X A;  4MBG A;  3W9G A;  4XKB A;  5ANL A;  2KAT A;  3MX3 A;  2OND A;  3RRN B;  1WG0 A;  3B7S A;  3SO8 A;  3ESK A;  3L08 A;  4FP7 A;  2F0Y A;  3CKC A;  3ONK A;  3HDX A;  3UPV A;  2GRL A;  1N3J A;  4LUN U;  3EIQ C;  4AIF A;  3RAU A;  2EQX A;  3LJ3 A;  5BW8 C;  4DX1 A;  5JHB A;  2GRN B;  3KS2 A;  4G11 A;  5BPP A;  3X2Q E;  2PM7 A;  2XCB A;  1TNZ A;  3U9W A;  4AY5 A;  4ZHB A;  2CG3 A;  2ZU6 B;  3FUM A;  3OXL A;  1TJC A;  2X3M A;  4G8K A;  1TR4 A;  2ETB A;  5EN5 D;  5D66 A;  5IY5 E;  4GU5 A;  4EEC A;  5ENS D;  3PEV B;  1N4S A;  4QFV A;  4EHM A;  3TXM A;  4PS8 A;  2JAB A;  1H2T C;  2NC9 A;  3OAW A;  2V0P A;  4LDG A;  3ZIM A;  2V5F A;  3F9X A;  2RFM A;  3FDH A;  3PZD A;  2R59 A;  3KD7 A;  3RRM B;  4N3A A;  4RG6 A;  3OPE A;  3M55 A;  3OXG A;  4K03 A;  5CCM A;  2AXU A;  3DEO A;  2J4B A;  5JHN A;  2P9N G;  3HXB A;  5D0O D;  2F8Y A;  2L0T B;  3HRA A;  2L9B A;  4KVO A;  1HXI A;  3CHO A;  2LNI A;  3QWV A;  4JLG A;  2C2L A;  3K5K A;  3J5Q B;  4JPS A;  3Q5M A;  3ULQ A;  4FC8 A;  3DSU A;  4URK A;  3FUJ A;  4LER A;  4XIF A;  4JW1 A;  5CMW A;  2UWJ G;  2IEJ A;  1LD7 A;  4A3T A;  3OS5 A;  1H3I A;  4MKT A;  1H19 A;  4GTS A;  2I1K A;  2XGO A;  5AQB A;  1OCZ E;  3CR3 A;  2HM8 A;  3PH0 C;  3V79 K;  2W5Z A;  1V54 E;  5KJK A;  3LKU A;  1UN9 A;  3RO3 A;  5JIN A;  3I5P A;  4TUU A;  4J8F A;  3LCA A;  1WY6 A;  3PS6 A;  2DYR E;  1NA0 A;  1UG3 A;  3E4B A;  3Q78 A;  4X8Q A;  3S8P A;  4U96 D;  2XZT G;  2YHC A;  3IV0 A;  2KCK A;  1RW2 A;  3C3Q A;  4N3B A;  2P58 C;  4KYO B;  3QB2 A;  5EIB E;  2WXJ A;  4MLP A;  3SWC A;  1MUF A;  2UY1 B;  2WXM A;  3D9M A;  3ZHE B;  3FHE A;  2IF4 A;  2AVP A;  1NI1 A;  3ULE G;  3NZU A;  1ML9 A;  3VLE A;  4XI9 A;  4I1M A;  3AAA C;  4DPR A;  5ENN A;  2J49 A;  3KEZ A;  2WB2 A;  3Q73 A;  4WAF A;  3ZYM A;  4UWL A;  4JA9 A;  2IJG X;  5E76 A;  4WNG A;  3KMA A;  4L7T A;  3L9T A;  3MCX A;  4ANW A;  3B7R L;  5BUZ A;  4UI9 J;  1SA5 A;  3TXN A;  1PEG A;  3CK8 A;  3FUN A;  4DX2 A;  4V3I A;  2DVW A;  3MKQ A;  1MX6 A;  2XRY A;  5JJT A;  3LYA A;  4WUY A;  3G2V A;  3PE3 A;  1WAO 1;  1E8Z A;  2V8S E;  1YA0 A;  1BD8 A;  2BKK B;  2L0I A;  5T3R A;  1FT2 A;  2IU1 A;  1XNF A;  2ETC A;  1TNO A;  4FUL A;  4C0E A;  3FTZ A;  3RKV A;  4U0S A;  3JYS A;  4CT4 A;  2H6F A;  4E6H A;  1A17 A;  3UUX A;  4DLO A;  1MJ0 A;  1P5Q A;  4H7Y A;  1JCQ A;  3FY4 A;  3VLD A;  4G24 A;  3SZ7 A;  2OVB A;  3HHM A;  5DIZ A;  3CVP A;  3FTU A;  4PH4 B;  3ZYQ A;  1TNY A;  2WMO A;  2DYS E;  3DWL G;  4UQX A;  2KZT A;  2P9K G;  1OWP A;  2JEK A;  3FFL A;  3ZGQ A;  4HI8 A;  4BET A;  3NZS A;  4GYO A;  4FJZ A;  3APC A;  1NL4 A;  3EHM A;  5KJL A;  2VGX B;  3BUA A;  2B0O E;  4PS3 A;  3HYM B;  5AJD A;  3ZXP A;  3RO2 A;  4I6E A;  4U04 A;  4TV3 A;  4A1G A;  3T9K A;  4J0U A;  3CVW A;  5EYL A;  3SNX A;  2WXK A;  1DC2 A;  1DCQ A;  1MT6 A;  2R05 A;  1O5M A;  4J8D A;  4K0R A;  3MKQ B;  4I6J A;  4B0Z A;  4APO A;  2V4H C;  4CT0 A;  2IGQ A;  4MI0 A;  5ENT D;  4F53 A;  2G46 A;  3ZU7 B;  2VSX E;  1N4P A;  3FU3 A;  2VQ2 A;  2VJ8 A;  3Q47 B;  3NF1 A;  2H6G A;  3MV3 B;  2BUG A;  3L17 A;  3EUV A;  4UWF A;  5F6K C;  3DPD A;  1MVH A;  3SD5 A;  3PRE A;  3ASG A;  3D9H A;  4PUC A;  2I6H A;  1N4Q A;  4I1O B;  3F9Z A;  3KSL A;  2GRR B;  1Z3X A;  3VTY A;  4GCN A;  3CV0 A;  4WWN A;  3WG7 E;  3KMJ A;  4KBQ A;  3CVX A;  5FIO A;  3O48 A;  2XEE A;  4JVS A;  4NUR A;  4N2S A;  3BG1 B;  4C0M A;  3ML9 A;  1IQR A;  1PAQ A;  4JEH A;  4YND A;  4HFG A;  4LG6 A;  5ENQ D;  4DX7 D;  5AYF A;  3FU6 A;  3ISM C;  2LSU A;  5ENR D;  4GA2 A;  4OYS A;  5F5E A;  1DVP A;  4I1A A;  4RVB A;  3FTW A;  3CBP A;  1N0R A;  4U95 D;  2WXQ A;  1S63 A;  1FPP A;  2I2O A;  2VGE A;  2EIJ E;  3AU4 A;  4U0U A;  3FUF A;  3UIP C;  1QZ2 A;  3ZPJ A;  1QYM A;  4UI9 K;  1HO8 A;  4JXT A;  2PQN A;  1JCR A;  3IHX A;  4NAC A;  2CHZ A;  2E2E A;  5FQ8 A;  4CEM A;  2P9U G;  2WXN A;  4GZD A;  5CED B;  3HNA A;  2EIN E;  3CSF A;  2IFU A;  4KZC A;  2NYJ A;  3E37 A;  4ME2 A;  4RZ0 A;  4F3V A;  2VSO E;  5EID A;  5G05 C;  5JJ6 A;  4BEP A;  2R17 C;  5CEC B;  3ZEF A;  4YNP A;  2AXV A;  4ATZ D;  4OAV B;  1MYO A;  3ZFW A;  2VTB A;  4KXK B;  1XGW A;  4EZJ A;  4GTR A;  4HQD A;  3OXF A;  2KM4 A;  3ASN E;  3D9K A;  4LNG A;  4DI4 A;  3JQ1 A;  2GW1 A;  3LDZ A;  5AYW D;  4C48 B;  5FZR A;  5CMY A;  1X81 A;  1MX4 A;  2WXG A;  1YYH A;  4GPM A;  3EHR A;  4AOF A;  3UIO C;  1N6A A;  3OOI A;  1NP7 A;  3NOG D;  2AXZ A;  3HVE B;  4U0Z A;  3SBS A;  3DSS A;  5TH7 A;  2MRI A;  4BWR A;  1UW4 B;  3B95 A;  5C2Y A;  2KBX A;  2IOL A;  1KZO A;  2L6J A;  1E7U A;  1SA4 A;  1IHG A;  3GW4 A;  1LF8 A;  1INZ A;  3V30 A;  1MHQ A;  3JXI A;  3TG4 A;  1HG5 A;  1XQH A;  3TWX A;  2QY7 A;  1TYQ G;  1OCO E;  1WDY A;  3GZ2 A;  5C1D A;  4GZ3 A;  5AJL A;  3V2O A;  5ENO D;  3D9P A;  4KVM A;  4EQF A;  3F6Q A;  5KCM A;  1E8Y A;  3TWR A;  4M3O A;  4O30 A;  3F9W A;  2PQR A;  1IYG A;  2H6I A;  4O1P A;  4NJ5 A;  3SGH A;  3UT7 A;  2IQC A;  3DSW A;  5EX3 A;  4F7A A;  2RFI A;  5A23 A;  2DWZ A;  3RJW A;  4CDR A;  2R5S A;  4GCO A;  5T5G A;  3SFZ A;  3AS5 A;  4Z4P A;  3CK9 A;  3VLF A;  3G2U A;  1Y6I A;  2WXP A;  1AWC B;  4BX9 A;  5T8I A;  1D8D A;  3HXE A;  5FQ7 A;  3TAX A;  1Y8M A;  4N3C A;  2BQZ A;  1ZBP A;  5CRU A;  2IO3 C;  5DBK A;  4L23 A;  2KCV A;  3HXF A;  2DIW A;  2XCC A;  4GYW A;  4AY6 A;  4HRM B;  2MHK A;  4TRQ A;  4I17 A;  4JD2 G;  5EX0 A;  2JLB A;  4N39 A;  3UIN C;  3NOC D;  2W5Y A;  3TL5 A;  2QFC A;  4HBD A;  4P29 A;  3ENE A;  1EDU A;  2FUL A;  3FP3 A;  1U3C A;  4U63 A;  5E75 A;  5KJN A;  3Q7A A;  4TUM A;  2NSZ A;  4HOU A;  3EJN A;  4DI3 A;  5JMN D;  4GML A;  4YPE A;  4LNU D;  2ZGD A;  2C0L A;  1BU9 A;  1Z6T A;  1OCR E;  3ZYL A;  1O1T A;  3C3O A;  4EZL A;  3I3N A;  4JL0 A;  4HOT A;  2FO7 A;  2DZO A;  2BF0 X;  4B8A A;  2IY0 C;  1W3B A;  5T0K A;  2RD0 A;  2CG2 A;  5T0M A;  2ZXW E;  4NVQ A;  3HXC A;  2WXO A;  4PDX A;  2HO1 A;  5BNW A;  2I9C A;  4GTQ A;  1H0A A;  4N5Q A;  1TN7 A;  5CHE E;  1OWM A;  3PUK A;  1MZC A;  3UM1 A;  1OWO A;  1MX2 A;  2GRQ B;  2J4D A;  1OUV A;  4WNE A;  3KAE A;  2KC7 A;  2V5Q C;  4EPZ A;  4OVU A;  3HIZ A;  3QC1 A;  2PL2 A;  3HG0 D;  2B6C A;  3RSE G;  2XEN A;  2RG8 A;  3EHQ A;  4I9C A;  4FJY A;  3NAW A;  3QOU A;  3I4R B;  4Y6W A;  4YDE A;  5BT1 A;  3KEA A;  4YVQ C;  1Z5S C;  4AP2 A;  4XEI G;  4E85 A;  4MI5 A;  2NXP A;  3Q79 A;  2YIN A;  2XPY A;  4BY6 A;  1O9S A;  1OXJ A;  3TWS A;  1X5B A;  3NB2 A;  4CRW A;  3JUI A;  2FO1 E;  4IN3 B;  5FT9 A;  4HLL A;  4R7L A;  2Y4T A;  1QNF A;  4J8E A;  3R7R A;  4U8H A;  2OEV A;  4XE0 A;  4AU7 A;  4ILG A;  3TWU A;  3Q9N C;  5G05 J;  3MKR A;  5HI7 A;  2IO2 C;  2VYI A;  3B13 A;  5KNH D;  1DNP A;  3RAY A;  1N11 A;  1TN6 A;  3BQO A;  3IKO B;  4J8S A;  1BI7 B;  5LSZ A;  4I2Z A;  5FZS A;  1D8E A;  3GZ1 A;  2FBN A;  3APF A;  4GTV A;  4I2W A;  4F1P A;  1UJJ A;  3CK7 A;  3CST A;  3E32 A;  3DBS A;  5EDS A;  2IOS A;  4FA6 A;  3ZRH A;  4HB5 A;  4B89 A;  4AV7 A;  3BEE A;  3UI2 A;  4ATG A;  5BXO A;  3TG5 A;  2OVF A;  3R9A B;  3C72 A;  3B7T A;  3ASF A;  3CVQ A;  1SZA A;  1YCS B;  5A6C A;  1EPU A;  2P9L G;  2KXP C;  4C1Q A;  4DRX E;  5CEA A;  3RIB A;  4DX5 D;  4RLY A;  4Q69 A;  5HS0 A;  2CHX A;  1KPS B;  3CHQ A;  4J7I A;  5A7D B;  4K5C A;  5CRV A;  5B3S E;  4FHK A;  5FTP A;  3FPD A;  1MQS A;  3AG1 E;  2J9Q A;  1EF1 C;  3OTN A;  3ZVV A;  5FQ6 A;  2A5U A;  2R03 A;  4IUL A;  4F6R D;  3E34 A;  2LSV A;  1E90 A;  2WQH A;  4LEU A;  4EBA A;  3FU0 A;  4XKC A;  3G2T A;  2E0I A;  1BLX B;  2X38 A;  2XPZ A;  4M7C A;  2PNN A;  2YQ8 A;  3LPZ A;  4B8C B;  2FF4 A;  4DJA A;  3ASD A;  1HG2 A;  2GRO B;  4JHR A;  3VTX A;  4G25 A;  3L16 A;  4O1O A;  5F59 A;  2WPV A;  2WQ7 A;  1QBQ A;  3S7D A;  2A4Z A;  1MVX A;  3QK0 A;  1SQM A;  3ASO E;  1H6P A;  3PZ3 A;  2EIM E;  1O1S A;  3CQC B;  4N5C A;  3FWV A;  5FQ4 A;  3U4T A;  1HE8 A;  3CEQ A;  2H6H A;  1HF8 A;  4GZC A;  1PY1 A;  2XS8 A;  3PZ2 A;  3IHV A;  4AM9 A;  1N0Q A;  1NA3 A;  4L1B A;  4HOR A;  5CCL A;  4LCT A;  3IEG A;  3FUL A;  3DPY A;  3V31 A;  3D3M A;  4H7X A;  1HS6 A;  5TEG A;  4I51 A;  4GTO A;  4XI0 A;  4QQI A;  2RKK A;  4KMO A;  2GRP B;  4GZ6 A;  2KZT B;  3VUZ A;  3FTV A;  3M59 A;  3CQG B;  4APF A;  4L2Y A;  4UWG A;  3UM3 A;  2YNQ A;  3FTS A;  5LX8 A;  3VV0 A;  4NQ0 A;  2WXI A;  3UMV A;  1K3Z D;  3UKR G;  3MZL B;  5CER B;  4TXP A;  5EYP F;  4HS2 A;  2QC9 A;  4QEP A;  2XGM A;  3B7B A;  5LFA A;  3M56 A;  3ESL A;  5M72 A; 
#chains in the Genus database with same CATH homology
 4KVM A;  1HXI A;  1TJF A;  5BV0 A;  4W9R A;  4EQF A;  3CHO A;  5EKQ D;  2CFU A;  3QAQ A;  4EZK A;  2LNI A;  3QWV A;  4RG9 A;  4JLG A;  2C2L A;  3CBM A;  1JUQ A;  5KCM A;  1E8Y A;  3K5K A;  1EYH A;  1H2V C;  4JPS A;  3Q5M A;  4M3O A;  3ULQ A;  3L54 A;  4FC8 A;  4URK A;  3FUJ A;  4O30 A;  4LER A;  3F9W A;  4XIF A;  5FJY A;  5G55 A;  5T4Y A;  4ACK A;  4QEO A;  2PQR A;  3PNL B;  4JW1 A;  4AJW A;  1IYG A;  5CMW A;  2JV0 A;  4JEU A;  2UWJ G;  5G04 C;  1SZ9 A;  3K9I A;  4MRU A;  4NJ5 A;  3SGH A;  3UT7 A;  2IQC A;  4HVB A;  5EX3 A;  4A3T A;  2XQ0 A;  4F7A A;  5A23 A;  2RFI A;  4GB9 A;  3OS5 A;  1FVH A;  4ACL A;  2VSY A;  3IBE A;  1FCH A;  2R5S A;  4GCO A;  4MKT A;  4CDR A;  1H3I A;  2QPW A;  2PZI A;  1H19 A;  3SFZ A;  3AS5 A;  5T5G A;  4JHK A;  4Z4P A;  3CK9 A;  3VLF A;  3AS4 A;  4GAA A;  2I1K A;  1Y6I A;  2WXP A;  3G2U A;  2X6I A;  4UQY A;  4BX9 A;  4G2V A;  5T8I A;  2XGO A;  5FQ7 A;  3TAX A;  2I1J A;  3CR3 A;  1Y8M A;  3QWW A;  3LS8 A;  4N3C A;  2BQZ A;  1ZBP A;  2HM8 A;  3PH0 C;  5DBK A;  4YPA A;  1N54 A;  4BX8 A;  2W5Z A;  1UJK A;  3FUI A;  3EP0 A;  3PE4 A;  4L23 A;  3TJP A;  2KCV A;  3LKU A;  5KJK A;  1U3D A;  2DIW A;  1JPL A;  2XCC A;  1UN9 A;  4GYW A;  3RO3 A;  4AY6 A;  5JIN A;  2MHK A;  4TRQ A;  3I5P A;  4TUU A;  2Q7F A;  2Y4U A;  4I17 A;  3LCA A;  1WY6 A;  4J8F A;  2OOE A;  5EX0 A;  3SHF A;  4JZY A;  3RJV A;  3ASH A;  3PS6 A;  4WWO A;  3S7J A;  2JLB A;  3FEY A;  4GZ5 A;  4J8O A;  4N39 A;  3CHP A;  1NA0 A;  1UG3 A;  3E4B A;  3TL5 A;  2W5Y A;  3T8M A;  5TTF A;  4AXH A;  3S8P A;  2QFC A;  5HQ8 A;  5G2N A;  3FH5 A;  3CHS A;  3D9L A;  2YHC A;  3JCK C;  1HH8 A;  3IV0 A;  3AS8 A;  1VDY A;  2KCK A;  3CKB A;  3ENE A;  4P29 A;  1ZU2 A;  1EDU A;  1B89 A;  3FUH A;  4N3B A;  2FUL A;  2P58 C;  1H6K A;  3FP3 A;  4KYO B;  3QWP A;  3QB2 A;  1U3C A;  4U63 A;  3EHN A;  3NQP A;  5E75 A;  2WXJ A;  4KT6 B;  4MLP A;  5EG2 A;  3EIJ A;  5KJN A;  1UN8 A;  2NSZ A;  4HOU A;  3EJN A;  3SWC A;  4DI3 A;  1MUF A;  3S7F A;  4GML A;  2UY1 B;  3ZW3 A;  2WXM A;  3D9M A;  3ZHE B;  3FHE A;  4YPE A;  2IF4 A;  2AVP A;  2C0L A;  3PDN A;  1Z3Y A;  1Z6T A;  2WXF A;  4U07 A;  3ZYL A;  3NZU A;  2F69 A;  4GA1 A;  1ML9 A;  2FEZ A;  2YHE A;  4EZL A;  3G2S A;  3I3N A;  4JL0 A;  4UI9 C;  3VLE A;  3TGO A;  4XI9 A;  4HOT A;  3SW9 A;  3JQ0 A;  3B7U X;  2FO7 A;  4I1M A;  4ABN A;  4DPR A;  4E47 A;  2WMN A;  2WVI A;  5ENN A;  2J49 A;  3KEZ A;  4DK5 A;  4FAD A;  2WB2 A;  2BF0 X;  2KCL A;  3ZYM A;  4WAF A;  4UWL A;  3SF4 A;  4JA9 A;  2IJG X;  4B8A A;  5E76 A;  5KJM A;  2X6K A;  1W3B A;  4RSY A;  3MGB A;  4Q94 A;  4WNG A;  5T0K A;  3MV2 B;  2RD0 A;  3KMA A;  4L7T A;  1GW6 A;  4J83 A;  3GYZ A;  2CG2 A;  3MCX A;  4ANW A;  2X6F A;  3S2A A;  1HX8 A;  3B7R L;  5T0M A;  4NVQ A;  5BUZ A;  4UI9 J;  5LCW C;  3F9Y A;  2XGS A;  2C0M A;  3LVR E;  3LY9 A;  4H12 A;  4JHJ A;  1H2U A;  2WXO A;  3TXN A;  1PEG A;  2ION A;  3L22 A;  3AU5 A;  3QAR A;  3CK8 A;  4PDX A;  5JIY A;  2HO1 A;  3FUN A;  3R7Q A;  2XHE A;  3DB5 A;  4V3I A;  2OV8 A;  3QKY A;  3MKQ A;  5BNW A;  2I9C A;  2BTD A;  3Q49 B;  2XRY A;  2WM9 A;  5JJT A;  1H0A A;  3LYA A;  4WUY A;  3G2V A;  4JA7 A;  3D9J A;  4HOQ A;  3PE3 A;  1WAO 1;  1E8Z A;  3D9N A;  5LP0 A;  2V8S E;  1YA0 A;  3M54 A;  2L0I A;  1E8W A;  4ILI A;  5CHE E;  2IU1 A;  1OWM A;  5T3R A;  3M57 A;  1XNF A;  1N52 A;  3PUK A;  4FUL A;  3BG0 B;  4C0E A;  3D9I A;  4WWP A;  3FTZ A;  3RKV A;  1OWO A;  4U0S A;  4BSX A;  3JYS A;  2M63 A;  4CT4 A;  3FUD A;  1A17 A;  4E6H A;  3MJW A;  3UUX A;  4DLO A;  1HZ4 A;  3CVN A;  2J4D A;  5J08 A;  5ANR A;  1OUV A;  4WNE A;  3KAE A;  1P5Q A;  4H7Y A;  2KC7 A;  5ARF A;  2VTB B;  4HLE A;  4EPZ A;  3FY4 A;  4OVU A;  3HIZ A;  3QC1 A;  3VLD A;  2PL2 A;  4G24 A;  3CVV A;  3SZ7 A;  3N71 A;  2OVB A;  4A1S A;  2RG8 A;  4I9C A;  2LAI A;  3EDT B;  2WXL A;  3HHM A;  4G1T A;  3CVU A;  4FJY A;  5DIZ A;  4C9B B;  3CVP A;  3FTU A;  3CBO A;  3QOU A;  3I4R B;  4PH4 B;  4Y6W A;  4F1S A;  3ZYQ A;  3QJZ A;  1HFA A;  3RK6 A;  4AVX A;  4IJ8 A;  3RRU A;  4QEN A;  4LRZ A;  2J08 A;  2WMO A;  3HVE A;  4UQX A;  2CFZ A;  2KZT A;  5BT1 A;  5J90 A;  4YVQ C;  3LXU X;  1OWP A;  2JEK A;  5FZQ A;  1FVF A;  4BFR A;  3SI5 A;  3FFL A;  3URZ A;  3ZGQ A;  4AP2 A;  3S7B A;  4I6G A;  4BUP A;  4E85 A;  3NZS A;  2ILR A;  4GYO A;  4MI5 A;  2GRM A;  4FJZ A;  2NXP A;  3APC A;  3FU5 A;  4HXI A;  2AWI A;  2AW6 A;  4ANX A;  4J6I A;  4J7F A;  2YIN A;  4MS6 A;  1BPO A;  2XPY A;  4BY6 A;  1O9S A;  3EHM A;  1IQU A;  5KJL A;  2VGX B;  4PS3 A;  4ANV A;  3BO5 A;  3HYM B;  4BTB A;  5AJD A;  1X5B A;  4CRW A;  3JUI A;  2V4L A;  4I6E A;  3RO2 A;  3CHM A;  4U04 A;  4IN3 B;  4TV3 A;  4A1G A;  5FT9 A;  4J0U A;  3CVW A;  3SNX A;  3CLJ A;  2WXK A;  3LVQ E;  5LOZ A;  2CHW A;  3L13 A;  2O8J A;  4R7L A;  2WQ6 A;  1MT6 A;  4G23 A;  4J8D A;  3FEX A;  4K0R A;  4XZ4 A;  3MKQ B;  4I6J A;  2XPI A;  2Y4T A;  4B0Z A;  4APO A;  4D10 C;  5BV1 A;  4CT0 A;  1JWG A;  1QNF A;  2IGQ A;  3PNT B;  4MI0 A;  2G46 A;  4F53 A;  3U64 A;  4J8E A;  3R7R A;  2VSX E;  4U8H A;  3FU3 A;  2VQ2 A;  2VJ8 A;  3Q47 B;  1PC2 A;  1S0P A;  4ILG A;  4XE0 A;  4AU7 A;  4BTA A;  3NF1 A;  4Q96 A;  5G05 J;  3MKR A;  4EBA G;  4L2L A;  5HI7 A;  3P1U A;  4UQZ A;  3MV3 B;  2BUG A;  3L17 A;  3Q4A B;  2VYI A;  5F6L A;  3B13 A;  4UWF A;  5F6K C;  3LEW A;  4JC8 A;  1E7V A;  1DNP A;  3DPD A;  3RAY A;  3FUK A;  3IKO B;  4J8S A;  1MVH A;  3SD5 A;  4CCA A;  3GZS A;  3PRE A;  4A3V A;  3ASG A;  5LSZ A;  4I2Z A;  5FZS A;  3GZ1 A;  2FBN A;  4PUC A;  2PM6 A;  3O4Z A;  2I6H A;  4O6F A;  3APF A;  4I1O B;  2LO6 A;  3QNK A;  4I2W A;  3F9Z A;  1Z3X A;  3VTY A;  4GCN A;  3CV0 A;  4IRU A;  4WWN A;  4YVO A;  1UJJ A;  3CK7 A;  3CST A;  4PS7 A;  5D0Q D;  3DBS A;  3LY8 A;  3KMJ A;  5EDS A;  4YPU A;  3D9O A;  2IOS A;  4FA6 A;  3ZRH A;  1N6C A;  1NZN A;  4KBQ A;  4B89 A;  3CVX A;  4AV7 A;  3DAL A;  3BEE A;  3FTX A;  2HR2 A;  3WXX A;  4B94 A;  4ATG A;  3TG5 A;  4IYP A;  2OVF A;  4FMU A;  3O48 A;  3R9A B;  1E96 B;  1WM5 A;  3B7T A;  4UWH A;  3ASF A;  5CPR B;  3CVQ A;  3Q15 A;  4JVS A;  3MYV A;  3M5A A;  4NUR A;  1SZA A;  4N2S A;  3PUJ A;  5A6C A;  4HOS A;  1QQE A;  3BG1 B;  4C0M A;  3UX4 A;  1EPU A;  2Y3A A;  3ML9 A;  1IQR A;  1PAQ A;  4JEH A;  2DBA A;  4C1Q A;  4NRH B;  3T5X A;  4YND A;  5JJ7 A;  2VSN A;  2J07 A;  4HFG A;  3RIB A;  3UT4 A;  4ILH B;  4Q69 A;  1KT0 A;  5AYF A;  2LAH A;  3ZYK A;  2XEV A;  3FU6 A;  4FHJ A;  2CHX A;  3MA5 A;  5ARG A;  2UY1 A;  4CGW A;  2LSU A;  4XX5 A;  3ZHE A;  1OWN A;  3QDN A;  3CHQ A;  4GA2 A;  3G2W A;  4J7I A;  5A7D B;  4OYS A;  4GA0 A;  4BT8 A;  5F5E A;  4GPK A;  3ML8 A;  1DVP A;  4FHK A;  2R3A A;  5FTP A;  3FPD A;  1MQS A;  3LY7 A;  3MO0 A;  4I1A A;  2J9Q A;  3I4G A;  5JHA A;  1EF1 C;  3OTN A;  3ZVV A;  5FQ6 A;  2A5U A;  4ANU A;  4RVB A;  3T5V A;  3FTW A;  2XRZ A;  3CBP A;  4IUL A;  2LSV A;  2WXQ A;  1E90 A;  2FI7 A;  2WQH A;  4DLQ A;  3MO5 A;  2WXR A;  4LEU A;  3FH7 A;  2I2O A;  4EBA A;  3FU0 A;  4XKC A;  3G2T A;  2E0I A;  3AU4 A;  2VGY A;  4U0U A;  3ZN3 A;  2X38 A;  2XPZ A;  3FUF A;  2GGF A;  3IHY A;  1QZ2 A;  3P2B A;  4WND A;  3ZPJ A;  4JDS A;  3RJW A;  4UI9 K;  1HO8 A;  3L6A A;  4JXT A;  2PQN A;  1KT1 A;  4CDN A;  3RU0 A;  3UT8 A;  3IHX A;  2YQ8 A;  4NAC A;  2CHZ A;  1E8X A;  2E2E A;  3LPZ A;  4B8C B;  3M53 A;  2FF4 A;  5FQ8 A;  4CEM A;  5JJ0 A;  4I43 A;  1ELW A;  4DJA A;  3FH8 A;  3ASD A;  2WXN A;  1HG2 A;  4GZD A;  4XKB A;  5ANL A;  4GYY A;  2KAT A;  3MX3 A;  4JHR A;  3HNA A;  2OND A;  3CSF A;  1JWF A;  3RRN B;  4YNM A;  2IFU A;  3B7S A;  4G25 A;  3VTX A;  3FTY A;  3L16 A;  3ESK A;  4KZC A;  5G04 J;  5F59 A;  3L08 A;  2WPV A;  2WQ7 A;  4FP7 A;  4ME2 A;  4IJD A;  4RZ0 A;  3S7D A;  3CKC A;  2X6J A;  3ONK A;  3HDX A;  4F3V A;  2GRL A;  2VSO E;  5G05 C;  5JJ6 A;  2A4Z A;  3EIQ C;  4LUN U;  3UPV A;  1MVX A;  1N3J A;  3QK0 A;  1SQM A;  4AIF A;  2R17 C;  2EQX A;  3LJ3 A;  4OVV A;  3ZEF A;  1KLX A;  5BW8 C;  4YNP A;  5JHB A;  3U3W A;  3CQC B;  2AXV A;  3KMT A;  3C98 A;  4N5C A;  3FWV A;  3UQ3 A;  5FQ4 A;  3CVL A;  2DCP A;  3KS2 A;  2MOW A;  3U4T A;  1HE8 A;  3ZFW A;  2J09 A;  2VTB A;  4G11 A;  3CEQ A;  3MO2 A;  4FU3 A;  1HF8 A;  4GZC A;  4KXK B;  1XGW A;  3SBT B;  5BPP A;  5LSX A;  2PM7 A;  4EZJ A;  1PY1 A;  2XCB A;  3U9W A;  2WXH A;  3MEK A;  4AY5 A;  3OXF A;  3PVL A;  2KM4 A;  2CG3 A;  2ZU6 B;  3D9K A;  4I9E A;  4KZ0 A;  3FUM A;  3IHV A;  3OXL A;  3PRZ A;  4AM9 A;  1NA3 A;  4L1B A;  4DI4 A;  1TJC A;  4HOR A;  2X3M A;  5CCL A;  3JQ1 A;  2GW1 A;  3LDZ A;  4FLB A;  4GMJ A;  5AYW D;  5FZR A;  5CMY A;  4CDM A;  4LCT A;  3CIA A;  3IEG A;  4AEZ C;  2WXG A;  3FUL A;  5M72 A;  3D3M A;  4GU5 A;  4FLH A;  4EEC A;  4AOF A;  4H7X A;  3PEV B;  1HS6 A;  1N6A A;  5TEG A;  4QFV A;  3OOI A;  1NP7 A;  4I51 A;  3TXM A;  4PS8 A;  4XI0 A;  4Y6C A;  1TEZ A;  3PEU B;  4CGV A;  2AXZ A;  3CVY A;  1H2T C;  4KMO A;  3U66 A;  2NC9 A;  3HVE B;  3OAW A;  4GZ6 A;  4U0Z A;  5AIJ A;  1L5J A;  2KZT B;  5FWQ A;  3SBS A;  2V0P A;  1ELK A;  5AEN A;  4LDG A;  3VUZ A;  3FTV A;  3ZIM A;  4UWK A;  2V5F A;  5TH7 A;  3M59 A;  3F9X A;  4G26 A;  3CQG B;  4APF A;  3FDH A;  2MRI A;  2VGX A;  3PZD A;  4L2Y A;  3ONL A;  3ZXS A;  4BWR A;  2R59 A;  4UWG A;  3KD7 A;  3RRM B;  4N3A A;  1ZKK A;  1UW4 B;  2YNQ A;  3FTS A;  5C2Y A;  4RG6 A;  3OPE A;  5LX8 A;  3CGH A;  3VV0 A;  2IOL A;  4A55 A;  2X6H A;  4NQ0 A;  1ELR A;  3M55 A;  2L6J A;  1E7U A;  1IHG A;  3GW4 A;  4BT9 A;  3OXG A;  2WXI A;  3FUE A;  4K03 A;  5CCM A;  1LF8 A;  2AXU A;  3CHR A;  1INZ A;  3APD A;  3UMV A;  1MHQ A;  3MZL B;  2J4B A;  5JHN A;  3RQ4 A;  4HS2 A;  1HG5 A;  1OWL A;  3TG4 A;  1XQH A;  2HYZ A;  2QY7 A;  5D0O D;  4QEP A;  2XGM A;  5LFA A;  3M58 A;  1HU3 A;  5LCW J;  3M56 A;  3GZ2 A;  2L0T B;  4WNF A;  5C1D A;  4GZ3 A;  4N2Q A;  3ESL A;  5AJL A;  2L9B A;  4KVO A;  3D9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...