3MO0A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e11
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
258
structure length
251
Chain Sequence
RIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo0A00
3M53A 3M59A 3FPDA 3N71A 3CBPA 3SWCA 5T0MA 3S7JA 1MUFA 3QWVA 5EX0A 4IJDA 3OXFA 3QWWA 1O9SA 5LSZA 4YPEA 3CBOA 3DALA 1N6AA 4FMUA 5ARGA 4MI0A 5JJ0A 3OPEA 2O8JA 5T0KA 3M54A 5TEGA 5F6LA 5HI7A 3DB5A 2W5ZA 4NVQA 4RZ0A 3MO2A 1MVXA 3F9YA 2IGQA 3EP0A 5JIYA 5KJNA 2F69A 5EG2A 4YPAA 3OXLA 4YNMA 5T5GA 4AU7A 3MO5A 5KJLA 3TG5A 3RJWA 5F5EA 4QEPA 3OS5A 4NJ5A 3BO5A 4MI5A 5CCMA 5ARFA 4YNPA 3CBMA 3F9ZA 3VV0A 4QENA 4Z4PA 3M58A 3M57A 1MVHA 3KMAA 5AYFA 4H12A 3TG4A 2R3AA 3RU0A 1PEGA 5EX3A 4E47A 2QPWA 3RIBA 5LSXA 3KMTA 4J7FA 2W5YA 5TTFA 3S7FA 4BUPA 5HQ8A 3S7DA 1XQHA 4J8OA 1N3JA 1ML9A 5F59A 4J7IA 4JDSA 3OXGA 4I51A 4J83A 4C1QA 3S7BA 3KMJA 5JINA 4LDGA 5JHNA 5CPRB 3VUZA 5KJKA 2RFIA 4JLGA 4YNDA 5TH7A 5F6KC 4QEOA 1H3IA 4O30A 3IHXA 3RQ4A 3F9WA 3HNAA 2JV0A 4WUYA 3F9XA 3MO0A 5KJMA 3M56A 4O6FA 1MT6A 3RAYA 3SW9A 4YPUA 3PDNA 2BQZA 3K5KA 1N6CA 4IJ8A 3OOIA 3M5AA 1ZKKA 3MEKA 3QWPA 5CCLA 3M55A 3S8PA 2G46A
chains in the Genus database with same CATH superfamily
3M53A 3M59A 3FPDA 3N71A 3CBPA 3SWCA 5T0MA 3S7JA 1MUFA 3QWVA 5EX0A 4IJDA 3OXFA 3QWWA 1O9SA 5LSZA 4YPEA 3CBOA 3DALA 1N6AA 4FMUA 5ARGA 4MI0A 5JJ0A 3OPEA 2O8JA 5T0KA 3M54A 5TEGA 5F6LA 5HI7A 3DB5A 2W5ZA 4NVQA 4RZ0A 3MO2A 1MVXA 3F9YA 2IGQA 3EP0A 5JIYA 5KJNA 2F69A 5EG2A 4YPAA 3OXLA 4YNMA 5T5GA 4AU7A 3MO5A 5KJLA 3TG5A 3RJWA 5F5EA 4QEPA 3OS5A 4NJ5A 3BO5A 4MI5A 5CCMA 5ARFA 4YNPA 3CBMA 3F9ZA 3VV0A 4QENA 4Z4PA 3M58A 3M57A 1MVHA 3KMAA 5AYFA 4H12A 3TG4A 2R3AA 3RU0A 1PEGA 5EX3A 4E47A 2QPWA 3RIBA 5LSXA 3KMTA 4J7FA 2W5YA 5TTFA 3S7FA 4BUPA 5HQ8A 3S7DA 1XQHA 4J8OA 1N3JA 1ML9A 5F59A 4J7IA 4JDSA 3OXGA 4I51A 4J83A 4C1QA 3S7BA 3KMJA 5JINA 4LDGA 5JHNA 5CPRB 3VUZA 5KJKA 2RFIA 4JLGA 4YNDA 5TH7A 5F6KC 4QEOA 1H3IA 4O30A 3IHXA 3RQ4A 3F9WA 3HNAA 2JV0A 4WUYA 3F9XA 3MO0A 5KJMA 3M56A 4O6FA 1MT6A 3RAYA 3SW9A 4YPUA 3PDNA 2BQZA 3K5KA 1N6CA 4IJ8A 3OOIA 3M5AA 1ZKKA 3MEKA 3QWPA 5CCLA 3M55A 3S8PA 2G46A
chains in the Genus database with same CATH topology
3M53A 3M59A 3FPDA 3N71A 3CBPA 3SWCA 5T0MA 3S7JA 1MUFA 3QWVA 5EX0A 4IJDA 3OXFA 3QWWA 1O9SA 5LSZA 4YPEA 3CBOA 3DALA 1N6AA 4FMUA 5ARGA 4MI0A 5JJ0A 3OPEA 2O8JA 5T0KA 3M54A 5TEGA 5F6LA 5HI7A 3DB5A 2W5ZA 4NVQA 4RZ0A 3MO2A 1MVXA 3F9YA 2IGQA 3EP0A 5JIYA 5KJNA 2F69A 5EG2A 4YPAA 3OXLA 4YNMA 5T5GA 4AU7A 3MO5A 5KJLA 3TG5A 3RJWA 5F5EA 4QEPA 3OS5A 4NJ5A 3BO5A 4MI5A 5CCMA 5ARFA 4YNPA 3CBMA 3F9ZA 3VV0A 4QENA 4Z4PA 3M58A 3M57A 1MVHA 3KMAA 5AYFA 4H12A 3TG4A 2R3AA 3RU0A 1PEGA 5EX3A 4E47A 2QPWA 3RIBA 5LSXA 3KMTA 4J7FA 2W5YA 5TTFA 3S7FA 4BUPA 5HQ8A 3S7DA 1XQHA 4J8OA 1N3JA 1ML9A 5F59A 4J7IA 4JDSA 3OXGA 4I51A 4J83A 4C1QA 3S7BA 3KMJA 5JINA 4LDGA 5JHNA 5CPRB 3VUZA 5KJKA 2RFIA 4JLGA 4YNDA 5TH7A 5F6KC 4QEOA 1H3IA 4O30A 3IHXA 3RQ4A 3F9WA 3HNAA 2JV0A 4WUYA 3F9XA 3MO0A 5KJMA 3M56A 4O6FA 1MT6A 3RAYA 3SW9A 4YPUA 3PDNA 2BQZA 3K5KA 1N6CA 4IJ8A 3OOIA 3M5AA 1ZKKA 3MEKA 3QWPA 5CCLA 3M55A 3S8PA 2G46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M53 A;  3M59 A;  3FPD A;  3N71 A;  3CBP A;  3SWC A;  5T0M A;  3S7J A;  1MUF A;  3QWV A;  5EX0 A;  4IJD A;  3OXF A;  3QWW A;  1O9S A;  5LSZ A;  4YPE A;  3CBO A;  3DAL A;  1N6A A;  4FMU A;  5ARG A;  4MI0 A;  5JJ0 A;  3OPE A;  2O8J A;  5T0K A;  3M54 A;  5TEG A;  5F6L A;  5HI7 A;  3DB5 A;  2W5Z A;  4NVQ A;  4RZ0 A;  3MO2 A;  1MVX A;  3F9Y A;  2IGQ A;  3EP0 A;  5JIY A;  5KJN A;  2F69 A;  5EG2 A;  4YPA A;  3OXL A;  4YNM A;  5T5G A;  4AU7 A;  3MO5 A;  5KJL A;  3TG5 A;  3RJW A;  5F5E A;  4QEP A;  3OS5 A;  4NJ5 A;  3BO5 A;  4MI5 A;  5CCM A;  5ARF A;  4YNP A;  3CBM A;  3F9Z A;  3VV0 A;  4QEN A;  4Z4P A;  3M58 A;  3M57 A;  1MVH A;  3KMA A;  5AYF A;  4H12 A;  3TG4 A;  2R3A A;  3RU0 A;  1PEG A;  5EX3 A;  4E47 A;  2QPW A;  3RIB A;  5LSX A;  3KMT A;  4J7F A;  2W5Y A;  5TTF A;  3S7F A;  4BUP A;  5HQ8 A;  3S7D A;  1XQH A;  4J8O A;  1N3J A;  1ML9 A;  5F59 A;  4J7I A;  4JDS A;  3OXG A;  4I51 A;  4J83 A;  4C1Q A;  3S7B A;  3KMJ A;  5JIN A;  4LDG A;  5JHN A;  5CPR B;  3VUZ A;  5KJK A;  2RFI A;  4JLG A;  4YND A;  5TH7 A;  5F6K C;  4QEO A;  1H3I A;  4O30 A;  3IHX A;  3RQ4 A;  3F9W A;  3HNA A;  2JV0 A;  4WUY A;  3F9X A;  3MO0 A;  5KJM A;  3M56 A;  4O6F A;  1MT6 A;  3RAY A;  3SW9 A;  4YPU A;  3PDN A;  2BQZ A;  3K5K A;  1N6C A;  4IJ8 A;  3OOI A;  3M5A A;  1ZKK A;  3MEK A;  3QWP A;  5CCL A;  3M55 A;  3S8P A;  2G46 A; 
#chains in the Genus database with same CATH topology
 3M53 A;  3M59 A;  3FPD A;  3N71 A;  3CBP A;  3SWC A;  5T0M A;  3S7J A;  1MUF A;  3QWV A;  5EX0 A;  4IJD A;  3OXF A;  3QWW A;  1O9S A;  5LSZ A;  4YPE A;  3CBO A;  3DAL A;  1N6A A;  4FMU A;  5ARG A;  4MI0 A;  5JJ0 A;  3OPE A;  2O8J A;  5T0K A;  3M54 A;  5TEG A;  5F6L A;  5HI7 A;  3DB5 A;  2W5Z A;  4NVQ A;  4RZ0 A;  3MO2 A;  1MVX A;  3F9Y A;  2IGQ A;  3EP0 A;  5JIY A;  5KJN A;  2F69 A;  5EG2 A;  4YPA A;  3OXL A;  4YNM A;  5T5G A;  4AU7 A;  3MO5 A;  5KJL A;  3TG5 A;  3RJW A;  5F5E A;  4QEP A;  3OS5 A;  4NJ5 A;  3BO5 A;  4MI5 A;  5CCM A;  5ARF A;  4YNP A;  3CBM A;  3F9Z A;  3VV0 A;  4QEN A;  4Z4P A;  3M58 A;  3M57 A;  1MVH A;  3KMA A;  5AYF A;  4H12 A;  3TG4 A;  2R3A A;  3RU0 A;  1PEG A;  5EX3 A;  4E47 A;  2QPW A;  3RIB A;  5LSX A;  3KMT A;  4J7F A;  2W5Y A;  5TTF A;  3S7F A;  4BUP A;  5HQ8 A;  3S7D A;  1XQH A;  4J8O A;  1N3J A;  1ML9 A;  5F59 A;  4J7I A;  4JDS A;  3OXG A;  4I51 A;  4J83 A;  4C1Q A;  3S7B A;  3KMJ A;  5JIN A;  4LDG A;  5JHN A;  5CPR B;  3VUZ A;  5KJK A;  2RFI A;  4JLG A;  4YND A;  5TH7 A;  5F6K C;  4QEO A;  1H3I A;  4O30 A;  3IHX A;  3RQ4 A;  3F9W A;  3HNA A;  2JV0 A;  4WUY A;  3F9X A;  3MO0 A;  5KJM A;  3M56 A;  4O6F A;  1MT6 A;  3RAY A;  3SW9 A;  4YPU A;  3PDN A;  2BQZ A;  3K5K A;  1N6C A;  4IJ8 A;  3OOI A;  3M5A A;  1ZKK A;  3MEK A;  3QWP A;  5CCL A;  3M55 A;  3S8P A;  2G46 A; 
#chains in the Genus database with same CATH homology
 3M53 A;  3M59 A;  3FPD A;  3N71 A;  3CBP A;  3SWC A;  5T0M A;  3S7J A;  1MUF A;  3QWV A;  5EX0 A;  4IJD A;  3OXF A;  3QWW A;  1O9S A;  5LSZ A;  4YPE A;  3CBO A;  3DAL A;  1N6A A;  4FMU A;  5ARG A;  4MI0 A;  5JJ0 A;  3OPE A;  2O8J A;  5T0K A;  3M54 A;  5TEG A;  5F6L A;  5HI7 A;  3DB5 A;  2W5Z A;  4NVQ A;  4RZ0 A;  3MO2 A;  1MVX A;  3F9Y A;  2IGQ A;  3EP0 A;  5JIY A;  5KJN A;  2F69 A;  5EG2 A;  4YPA A;  3OXL A;  4YNM A;  5T5G A;  4AU7 A;  3MO5 A;  5KJL A;  3TG5 A;  3RJW A;  5F5E A;  4QEP A;  3OS5 A;  4NJ5 A;  3BO5 A;  4MI5 A;  5CCM A;  5ARF A;  4YNP A;  3CBM A;  3F9Z A;  3VV0 A;  4QEN A;  4Z4P A;  3M58 A;  3M57 A;  1MVH A;  3KMA A;  5AYF A;  4H12 A;  3TG4 A;  2R3A A;  3RU0 A;  1PEG A;  5EX3 A;  4E47 A;  2QPW A;  3RIB A;  5LSX A;  3KMT A;  4J7F A;  2W5Y A;  5TTF A;  3S7F A;  4BUP A;  5HQ8 A;  3S7D A;  1XQH A;  4J8O A;  1N3J A;  1ML9 A;  5F59 A;  4J7I A;  4JDS A;  3OXG A;  4I51 A;  4J83 A;  4C1Q A;  3S7B A;  3KMJ A;  5JIN A;  4LDG A;  5JHN A;  5CPR B;  3VUZ A;  5KJK A;  2RFI A;  4JLG A;  4YND A;  5TH7 A;  5F6K C;  4QEO A;  1H3I A;  4O30 A;  3IHX A;  3RQ4 A;  3F9W A;  3HNA A;  2JV0 A;  4WUY A;  3F9X A;  3MO0 A;  5KJM A;  3M56 A;  4O6F A;  1MT6 A;  3RAY A;  3SW9 A;  4YPU A;  3PDN A;  2BQZ A;  3K5K A;  1N6C A;  4IJ8 A;  3OOI A;  3M5A A;  1ZKK A;  3MEK A;  3QWP A;  5CCL A;  3M55 A;  3S8P A;  2G46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...