3MO0A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e11
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
258
structure length
251
Chain Sequence
b'RIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
molecule tags Transferase
source organism Homo sapiens
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
total genus 55
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo0A00
3F9XA 5TEGA 3M55A 3OS5A 4QEPA 4E47A 1MVXA 3OXFA 5EG2A 1MUFA 5ARFA 5F59A 5TH7A 3FPDA 3OXGA 3RAYA 5HI7A 4O6FA 4J8OA 5CCMA 4J7IA 5LSXA 4YPEA 3DB5A 3KMAA 3M53A 4LDGA 3M59A 4FMUA 4IJDA 5JHNA 4H12A 4C1QA 5F6KC 2IGQA 3HNAA 3OPEA 5T0KA 1O9SA 5F5EA 4Z4PA 5CPRB 4YNPA 5KJLA 5EX3A 2F69A 5EX0A 3OOIA 3S7JA 5T0MA 5JINA 3VV0A 2QPWA 1ZKKA 3F9YA 4JLGA 4J83A 2W5ZA 3CBPA 5T5GA 5AYFA 5F6LA 4MI0A 2G46A 3QWWA 4YPUA 2RFIA 4MI5A 3TG4A 3DALA 2R3AA 5LSZA 3S7BA 4J7FA 4YNMA 4YPAA 5HQ8A 4BUPA 5JIYA 5KJMA 3RQ4A 3BO5A 3F9WA 3SW9A 3SWCA 5ARGA 4QEOA 3S7DA 3MO5A 3M56A 4YNDA 4AU7A 4JDSA 3EP0A 2W5YA 1N6CA 3S7FA 2JV0A 3CBMA 4NJ5A 5TTFA 4RZ0A 2BQZA 5CCLA 1MT6A 3QWPA 3PDNA 3S8PA 3TG5A 4I51A 3RU0A 2O8JA 5JJ0A 3QWVA 3K5KA 3CBOA 1ML9A 1XQHA 3MO2A 4WUYA 1N3JA 4IJ8A 4QENA 3KMTA 1N6AA 3M57A 1H3IA 5KJKA 3N71A 3RIBA 3IHXA 3MEKA 3RJWA 3KMJA 3M54A 5KJNA 3F9ZA 3OXLA 3M58A 4NVQA 3M5AA 1MVHA 1PEGA 4O30A 3VUZA 3MO0A
chains in the Genus database with same CATH superfamily
3F9XA 5TEGA 3M55A 3OS5A 4QEPA 4E47A 1MVXA 3OXFA 5EG2A 1MUFA 5ARFA 5F59A 5TH7A 3FPDA 3OXGA 3RAYA 5HI7A 4O6FA 4J8OA 5CCMA 4J7IA 5LSXA 4YPEA 3DB5A 3KMAA 3M53A 4LDGA 3M59A 4FMUA 4IJDA 5JHNA 4H12A 4C1QA 5F6KC 2IGQA 3HNAA 3OPEA 5T0KA 1O9SA 5F5EA 4Z4PA 5CPRB 4YNPA 5KJLA 5EX3A 2F69A 5EX0A 3OOIA 3S7JA 5T0MA 5JINA 3VV0A 2QPWA 1ZKKA 3F9YA 4JLGA 4J83A 2W5ZA 3CBPA 5T5GA 5AYFA 5F6LA 4MI0A 2G46A 3QWWA 4YPUA 2RFIA 4MI5A 3TG4A 3DALA 2R3AA 5LSZA 3S7BA 4J7FA 4YNMA 4YPAA 5HQ8A 4BUPA 5JIYA 5KJMA 3RQ4A 3BO5A 3F9WA 3SW9A 3SWCA 5ARGA 4QEOA 3S7DA 3MO5A 3M56A 4YNDA 4AU7A 4JDSA 3EP0A 2W5YA 1N6CA 3S7FA 2JV0A 3CBMA 4NJ5A 5TTFA 4RZ0A 2BQZA 5CCLA 1MT6A 3QWPA 3PDNA 3S8PA 3TG5A 4I51A 3RU0A 2O8JA 5JJ0A 3QWVA 3K5KA 3CBOA 1ML9A 1XQHA 3MO2A 4WUYA 1N3JA 4IJ8A 4QENA 3KMTA 1N6AA 3M57A 1H3IA 5KJKA 3N71A 3RIBA 3IHXA 3MEKA 3RJWA 3KMJA 3M54A 5KJNA 3F9ZA 3OXLA 3M58A 4NVQA 3M5AA 1MVHA 1PEGA 4O30A 3VUZA 3MO0A
chains in the Genus database with same CATH topology
3F9XA 5TEGA 3M55A 3OS5A 4QEPA 4E47A 1MVXA 3OXFA 5EG2A 1MUFA 5ARFA 5F59A 5TH7A 3FPDA 3OXGA 3RAYA 5HI7A 4O6FA 4J8OA 5CCMA 4J7IA 5LSXA 4YPEA 3DB5A 3KMAA 3M53A 4LDGA 3M59A 4FMUA 4IJDA 5JHNA 4H12A 4C1QA 5F6KC 2IGQA 3HNAA 3OPEA 5T0KA 1O9SA 5F5EA 4Z4PA 5CPRB 4YNPA 5KJLA 5EX3A 2F69A 5EX0A 3OOIA 3S7JA 5T0MA 5JINA 3VV0A 2QPWA 1ZKKA 3F9YA 4JLGA 4J83A 2W5ZA 3CBPA 5T5GA 5AYFA 5F6LA 4MI0A 2G46A 3QWWA 4YPUA 2RFIA 4MI5A 3TG4A 3DALA 2R3AA 5LSZA 3S7BA 4J7FA 4YNMA 4YPAA 5HQ8A 4BUPA 5JIYA 5KJMA 3RQ4A 3BO5A 3F9WA 3SW9A 3SWCA 5ARGA 4QEOA 3S7DA 3MO5A 3M56A 4YNDA 4AU7A 4JDSA 3EP0A 2W5YA 1N6CA 3S7FA 2JV0A 3CBMA 4NJ5A 5TTFA 4RZ0A 2BQZA 5CCLA 1MT6A 3QWPA 3PDNA 3S8PA 3TG5A 4I51A 3RU0A 2O8JA 5JJ0A 3QWVA 3K5KA 3CBOA 1ML9A 1XQHA 3MO2A 4WUYA 1N3JA 4IJ8A 4QENA 3KMTA 1N6AA 3M57A 1H3IA 5KJKA 3N71A 3RIBA 3IHXA 3MEKA 3RJWA 3KMJA 3M54A 5KJNA 3F9ZA 3OXLA 3M58A 4NVQA 3M5AA 1MVHA 1PEGA 4O30A 3VUZA 3MO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9X A;  5TEG A;  3M55 A;  3OS5 A;  4QEP A;  4E47 A;  1MVX A;  3OXF A;  5EG2 A;  1MUF A;  5ARF A;  5F59 A;  5TH7 A;  3FPD A;  3OXG A;  3RAY A;  5HI7 A;  4O6F A;  4J8O A;  5CCM A;  4J7I A;  5LSX A;  4YPE A;  3DB5 A;  3KMA A;  3M53 A;  4LDG A;  3M59 A;  4FMU A;  4IJD A;  5JHN A;  4H12 A;  4C1Q A;  5F6K C;  2IGQ A;  3HNA A;  3OPE A;  5T0K A;  1O9S A;  5F5E A;  4Z4P A;  5CPR B;  4YNP A;  5KJL A;  5EX3 A;  2F69 A;  5EX0 A;  3OOI A;  3S7J A;  5T0M A;  5JIN A;  3VV0 A;  2QPW A;  1ZKK A;  3F9Y A;  4JLG A;  4J83 A;  2W5Z A;  3CBP A;  5T5G A;  5AYF A;  5F6L A;  4MI0 A;  2G46 A;  3QWW A;  4YPU A;  2RFI A;  4MI5 A;  3TG4 A;  3DAL A;  2R3A A;  5LSZ A;  3S7B A;  4J7F A;  4YNM A;  4YPA A;  5HQ8 A;  4BUP A;  5JIY A;  5KJM A;  3RQ4 A;  3BO5 A;  3F9W A;  3SW9 A;  3SWC A;  5ARG A;  4QEO A;  3S7D A;  3MO5 A;  3M56 A;  4YND A;  4AU7 A;  4JDS A;  3EP0 A;  2W5Y A;  1N6C A;  3S7F A;  2JV0 A;  3CBM A;  4NJ5 A;  5TTF A;  4RZ0 A;  2BQZ A;  5CCL A;  1MT6 A;  3QWP A;  3PDN A;  3S8P A;  3TG5 A;  4I51 A;  3RU0 A;  2O8J A;  5JJ0 A;  3QWV A;  3K5K A;  3CBO A;  1ML9 A;  1XQH A;  3MO2 A;  4WUY A;  1N3J A;  4IJ8 A;  4QEN A;  3KMT A;  1N6A A;  3M57 A;  1H3I A;  5KJK A;  3N71 A;  3RIB A;  3IHX A;  3MEK A;  3RJW A;  3KMJ A;  3M54 A;  5KJN A;  3F9Z A;  3OXL A;  3M58 A;  4NVQ A;  3M5A A;  1MVH A;  1PEG A;  4O30 A;  3VUZ A;  3MO0 A; 
#chains in the Genus database with same CATH topology
 3F9X A;  5TEG A;  3M55 A;  3OS5 A;  4QEP A;  4E47 A;  1MVX A;  3OXF A;  5EG2 A;  1MUF A;  5ARF A;  5F59 A;  5TH7 A;  3FPD A;  3OXG A;  3RAY A;  5HI7 A;  4O6F A;  4J8O A;  5CCM A;  4J7I A;  5LSX A;  4YPE A;  3DB5 A;  3KMA A;  3M53 A;  4LDG A;  3M59 A;  4FMU A;  4IJD A;  5JHN A;  4H12 A;  4C1Q A;  5F6K C;  2IGQ A;  3HNA A;  3OPE A;  5T0K A;  1O9S A;  5F5E A;  4Z4P A;  5CPR B;  4YNP A;  5KJL A;  5EX3 A;  2F69 A;  5EX0 A;  3OOI A;  3S7J A;  5T0M A;  5JIN A;  3VV0 A;  2QPW A;  1ZKK A;  3F9Y A;  4JLG A;  4J83 A;  2W5Z A;  3CBP A;  5T5G A;  5AYF A;  5F6L A;  4MI0 A;  2G46 A;  3QWW A;  4YPU A;  2RFI A;  4MI5 A;  3TG4 A;  3DAL A;  2R3A A;  5LSZ A;  3S7B A;  4J7F A;  4YNM A;  4YPA A;  5HQ8 A;  4BUP A;  5JIY A;  5KJM A;  3RQ4 A;  3BO5 A;  3F9W A;  3SW9 A;  3SWC A;  5ARG A;  4QEO A;  3S7D A;  3MO5 A;  3M56 A;  4YND A;  4AU7 A;  4JDS A;  3EP0 A;  2W5Y A;  1N6C A;  3S7F A;  2JV0 A;  3CBM A;  4NJ5 A;  5TTF A;  4RZ0 A;  2BQZ A;  5CCL A;  1MT6 A;  3QWP A;  3PDN A;  3S8P A;  3TG5 A;  4I51 A;  3RU0 A;  2O8J A;  5JJ0 A;  3QWV A;  3K5K A;  3CBO A;  1ML9 A;  1XQH A;  3MO2 A;  4WUY A;  1N3J A;  4IJ8 A;  4QEN A;  3KMT A;  1N6A A;  3M57 A;  1H3I A;  5KJK A;  3N71 A;  3RIB A;  3IHX A;  3MEK A;  3RJW A;  3KMJ A;  3M54 A;  5KJN A;  3F9Z A;  3OXL A;  3M58 A;  4NVQ A;  3M5A A;  1MVH A;  1PEG A;  4O30 A;  3VUZ A;  3MO0 A; 
#chains in the Genus database with same CATH homology
 3F9X A;  5TEG A;  3M55 A;  3OS5 A;  4QEP A;  4E47 A;  1MVX A;  3OXF A;  5EG2 A;  1MUF A;  5ARF A;  5F59 A;  5TH7 A;  3FPD A;  3OXG A;  3RAY A;  5HI7 A;  4O6F A;  4J8O A;  5CCM A;  4J7I A;  5LSX A;  4YPE A;  3DB5 A;  3KMA A;  3M53 A;  4LDG A;  3M59 A;  4FMU A;  4IJD A;  5JHN A;  4H12 A;  4C1Q A;  5F6K C;  2IGQ A;  3HNA A;  3OPE A;  5T0K A;  1O9S A;  5F5E A;  4Z4P A;  5CPR B;  4YNP A;  5KJL A;  5EX3 A;  2F69 A;  5EX0 A;  3OOI A;  3S7J A;  5T0M A;  5JIN A;  3VV0 A;  2QPW A;  1ZKK A;  3F9Y A;  4JLG A;  4J83 A;  2W5Z A;  3CBP A;  5T5G A;  5AYF A;  5F6L A;  4MI0 A;  2G46 A;  3QWW A;  4YPU A;  2RFI A;  4MI5 A;  3TG4 A;  3DAL A;  2R3A A;  5LSZ A;  3S7B A;  4J7F A;  4YNM A;  4YPA A;  5HQ8 A;  4BUP A;  5JIY A;  5KJM A;  3RQ4 A;  3BO5 A;  3F9W A;  3SW9 A;  3SWC A;  5ARG A;  4QEO A;  3S7D A;  3MO5 A;  3M56 A;  4YND A;  4AU7 A;  4JDS A;  3EP0 A;  2W5Y A;  1N6C A;  3S7F A;  2JV0 A;  3CBM A;  4NJ5 A;  5TTF A;  4RZ0 A;  2BQZ A;  5CCL A;  1MT6 A;  3QWP A;  3PDN A;  3S8P A;  3TG5 A;  4I51 A;  3RU0 A;  2O8J A;  5JJ0 A;  3QWV A;  3K5K A;  3CBO A;  1ML9 A;  1XQH A;  3MO2 A;  4WUY A;  1N3J A;  4IJ8 A;  4QEN A;  3KMT A;  1N6A A;  3M57 A;  1H3I A;  5KJK A;  3N71 A;  3RIB A;  3IHX A;  3MEK A;  3RJW A;  3KMJ A;  3M54 A;  5KJN A;  3F9Z A;  3OXL A;  3M58 A;  4NVQ A;  3M5A A;  1MVH A;  1PEG A;  4O30 A;  3VUZ A;  3MO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...