3MO0A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e11
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
258
structure length
251
Chain Sequence
RIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
total genus 55
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo0A00
4YNDA 5T5GA 3PDNA 4YPUA 5LSZA 4MI0A 4WUYA 2RFIA 5F6KC 5T0MA 3S8PA 3SW9A 4BUPA 4IJDA 5CCLA 4J7FA 5F6LA 5ARGA 3OXLA 4JLGA 5CCMA 4NVQA 3KMTA 3IHXA 3OXFA 1MUFA 3DB5A 5AYFA 5HQ8A 3F9YA 4YNMA 3MO5A 4O6FA 4JDSA 5JINA 4J83A 3KMJA 5JIYA 2F69A 5F59A 3M55A 3S7BA 3TG5A 4C1QA 3DALA 2IGQA 3S7JA 3N71A 1ZKKA 5JJ0A 3F9XA 2BQZA 1MVXA 4QENA 3OS5A 4O30A 5TTFA 4RZ0A 3M54A 5TEGA 3RU0A 5LSXA 5KJKA 5HI7A 3CBPA 3OXGA 3M59A 3QWPA 3S7FA 3KMAA 1H3IA 1PEGA 3TG4A 3SWCA 2JV0A 4AU7A 2R3AA 3M5AA 4QEPA 2W5ZA 5KJLA 4H12A 3RJWA 3VUZA 3FPDA 3M58A 3M56A 3S7DA 1N6AA 5T0KA 1N6CA 3K5KA 1XQHA 3BO5A 4QEOA 5EX3A 3HNAA 4E47A 3RQ4A 4J8OA 3VV0A 1N3JA 1MVHA 3OPEA 3MO2A 5KJNA 3CBMA 5CPRB 3M57A 4Z4PA 3F9WA 3CBOA 3MEKA 5KJMA 1MT6A 4YNPA 3QWVA 4LDGA 3OOIA 4FMUA 5F5EA 3RAYA 4YPEA 5ARFA 4IJ8A 2O8JA 4J7IA 2G46A 4YPAA 3M53A 3RIBA 2QPWA 3F9ZA 4NJ5A 3MO0A 4I51A 3EP0A 1O9SA 4MI5A 3QWWA 5EX0A 5TH7A 5JHNA 1ML9A 5EG2A 2W5YA
chains in the Genus database with same CATH superfamily
4YNDA 5T5GA 3PDNA 4YPUA 5LSZA 4MI0A 4WUYA 2RFIA 5F6KC 5T0MA 3S8PA 3SW9A 4BUPA 4IJDA 5CCLA 4J7FA 5F6LA 5ARGA 3OXLA 4JLGA 5CCMA 4NVQA 3KMTA 3IHXA 3OXFA 1MUFA 3DB5A 5AYFA 5HQ8A 3F9YA 4YNMA 3MO5A 4O6FA 4JDSA 5JINA 4J83A 3KMJA 5JIYA 2F69A 5F59A 3M55A 3S7BA 3TG5A 4C1QA 3DALA 2IGQA 3S7JA 3N71A 1ZKKA 5JJ0A 3F9XA 2BQZA 1MVXA 4QENA 3OS5A 4O30A 5TTFA 4RZ0A 3M54A 5TEGA 3RU0A 5LSXA 5KJKA 5HI7A 3CBPA 3OXGA 3M59A 3QWPA 3S7FA 3KMAA 1H3IA 1PEGA 3TG4A 3SWCA 2JV0A 4AU7A 2R3AA 3M5AA 4QEPA 2W5ZA 5KJLA 4H12A 3RJWA 3VUZA 3FPDA 3M58A 3M56A 3S7DA 1N6AA 5T0KA 1N6CA 3K5KA 1XQHA 3BO5A 4QEOA 5EX3A 3HNAA 4E47A 3RQ4A 4J8OA 3VV0A 1N3JA 1MVHA 3OPEA 3MO2A 5KJNA 3CBMA 5CPRB 3M57A 4Z4PA 3F9WA 3CBOA 3MEKA 5KJMA 1MT6A 4YNPA 3QWVA 4LDGA 3OOIA 4FMUA 5F5EA 3RAYA 4YPEA 5ARFA 4IJ8A 2O8JA 4J7IA 2G46A 4YPAA 3M53A 3RIBA 2QPWA 3F9ZA 4NJ5A 3MO0A 4I51A 3EP0A 1O9SA 4MI5A 3QWWA 5EX0A 5TH7A 5JHNA 1ML9A 5EG2A 2W5YA
chains in the Genus database with same CATH topology
4YNDA 5T5GA 3PDNA 4YPUA 5LSZA 4MI0A 4WUYA 2RFIA 5F6KC 5T0MA 3S8PA 3SW9A 4BUPA 4IJDA 5CCLA 4J7FA 5F6LA 5ARGA 3OXLA 4JLGA 5CCMA 4NVQA 3KMTA 3IHXA 3OXFA 1MUFA 3DB5A 5AYFA 5HQ8A 3F9YA 4YNMA 3MO5A 4O6FA 4JDSA 5JINA 4J83A 3KMJA 5JIYA 2F69A 5F59A 3M55A 3S7BA 3TG5A 4C1QA 3DALA 2IGQA 3S7JA 3N71A 1ZKKA 5JJ0A 3F9XA 2BQZA 1MVXA 4QENA 3OS5A 4O30A 5TTFA 4RZ0A 3M54A 5TEGA 3RU0A 5LSXA 5KJKA 5HI7A 3CBPA 3OXGA 3M59A 3QWPA 3S7FA 3KMAA 1H3IA 1PEGA 3TG4A 3SWCA 2JV0A 4AU7A 2R3AA 3M5AA 4QEPA 2W5ZA 5KJLA 4H12A 3RJWA 3VUZA 3FPDA 3M58A 3M56A 3S7DA 1N6AA 5T0KA 1N6CA 3K5KA 1XQHA 3BO5A 4QEOA 5EX3A 3HNAA 4E47A 3RQ4A 4J8OA 3VV0A 1N3JA 1MVHA 3OPEA 3MO2A 5KJNA 3CBMA 5CPRB 3M57A 4Z4PA 3F9WA 3CBOA 3MEKA 5KJMA 1MT6A 4YNPA 3QWVA 4LDGA 3OOIA 4FMUA 5F5EA 3RAYA 4YPEA 5ARFA 4IJ8A 2O8JA 4J7IA 2G46A 4YPAA 3M53A 3RIBA 2QPWA 3F9ZA 4NJ5A 3MO0A 4I51A 3EP0A 1O9SA 4MI5A 3QWWA 5EX0A 5TH7A 5JHNA 1ML9A 5EG2A 2W5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YND A;  5T5G A;  3PDN A;  4YPU A;  5LSZ A;  4MI0 A;  4WUY A;  2RFI A;  5F6K C;  5T0M A;  3S8P A;  3SW9 A;  4BUP A;  4IJD A;  5CCL A;  4J7F A;  5F6L A;  5ARG A;  3OXL A;  4JLG A;  5CCM A;  4NVQ A;  3KMT A;  3IHX A;  3OXF A;  1MUF A;  3DB5 A;  5AYF A;  5HQ8 A;  3F9Y A;  4YNM A;  3MO5 A;  4O6F A;  4JDS A;  5JIN A;  4J83 A;  3KMJ A;  5JIY A;  2F69 A;  5F59 A;  3M55 A;  3S7B A;  3TG5 A;  4C1Q A;  3DAL A;  2IGQ A;  3S7J A;  3N71 A;  1ZKK A;  5JJ0 A;  3F9X A;  2BQZ A;  1MVX A;  4QEN A;  3OS5 A;  4O30 A;  5TTF A;  4RZ0 A;  3M54 A;  5TEG A;  3RU0 A;  5LSX A;  5KJK A;  5HI7 A;  3CBP A;  3OXG A;  3M59 A;  3QWP A;  3S7F A;  3KMA A;  1H3I A;  1PEG A;  3TG4 A;  3SWC A;  2JV0 A;  4AU7 A;  2R3A A;  3M5A A;  4QEP A;  2W5Z A;  5KJL A;  4H12 A;  3RJW A;  3VUZ A;  3FPD A;  3M58 A;  3M56 A;  3S7D A;  1N6A A;  5T0K A;  1N6C A;  3K5K A;  1XQH A;  3BO5 A;  4QEO A;  5EX3 A;  3HNA A;  4E47 A;  3RQ4 A;  4J8O A;  3VV0 A;  1N3J A;  1MVH A;  3OPE A;  3MO2 A;  5KJN A;  3CBM A;  5CPR B;  3M57 A;  4Z4P A;  3F9W A;  3CBO A;  3MEK A;  5KJM A;  1MT6 A;  4YNP A;  3QWV A;  4LDG A;  3OOI A;  4FMU A;  5F5E A;  3RAY A;  4YPE A;  5ARF A;  4IJ8 A;  2O8J A;  4J7I A;  2G46 A;  4YPA A;  3M53 A;  3RIB A;  2QPW A;  3F9Z A;  4NJ5 A;  3MO0 A;  4I51 A;  3EP0 A;  1O9S A;  4MI5 A;  3QWW A;  5EX0 A;  5TH7 A;  5JHN A;  1ML9 A;  5EG2 A;  2W5Y A; 
#chains in the Genus database with same CATH topology
 4YND A;  5T5G A;  3PDN A;  4YPU A;  5LSZ A;  4MI0 A;  4WUY A;  2RFI A;  5F6K C;  5T0M A;  3S8P A;  3SW9 A;  4BUP A;  4IJD A;  5CCL A;  4J7F A;  5F6L A;  5ARG A;  3OXL A;  4JLG A;  5CCM A;  4NVQ A;  3KMT A;  3IHX A;  3OXF A;  1MUF A;  3DB5 A;  5AYF A;  5HQ8 A;  3F9Y A;  4YNM A;  3MO5 A;  4O6F A;  4JDS A;  5JIN A;  4J83 A;  3KMJ A;  5JIY A;  2F69 A;  5F59 A;  3M55 A;  3S7B A;  3TG5 A;  4C1Q A;  3DAL A;  2IGQ A;  3S7J A;  3N71 A;  1ZKK A;  5JJ0 A;  3F9X A;  2BQZ A;  1MVX A;  4QEN A;  3OS5 A;  4O30 A;  5TTF A;  4RZ0 A;  3M54 A;  5TEG A;  3RU0 A;  5LSX A;  5KJK A;  5HI7 A;  3CBP A;  3OXG A;  3M59 A;  3QWP A;  3S7F A;  3KMA A;  1H3I A;  1PEG A;  3TG4 A;  3SWC A;  2JV0 A;  4AU7 A;  2R3A A;  3M5A A;  4QEP A;  2W5Z A;  5KJL A;  4H12 A;  3RJW A;  3VUZ A;  3FPD A;  3M58 A;  3M56 A;  3S7D A;  1N6A A;  5T0K A;  1N6C A;  3K5K A;  1XQH A;  3BO5 A;  4QEO A;  5EX3 A;  3HNA A;  4E47 A;  3RQ4 A;  4J8O A;  3VV0 A;  1N3J A;  1MVH A;  3OPE A;  3MO2 A;  5KJN A;  3CBM A;  5CPR B;  3M57 A;  4Z4P A;  3F9W A;  3CBO A;  3MEK A;  5KJM A;  1MT6 A;  4YNP A;  3QWV A;  4LDG A;  3OOI A;  4FMU A;  5F5E A;  3RAY A;  4YPE A;  5ARF A;  4IJ8 A;  2O8J A;  4J7I A;  2G46 A;  4YPA A;  3M53 A;  3RIB A;  2QPW A;  3F9Z A;  4NJ5 A;  3MO0 A;  4I51 A;  3EP0 A;  1O9S A;  4MI5 A;  3QWW A;  5EX0 A;  5TH7 A;  5JHN A;  1ML9 A;  5EG2 A;  2W5Y A; 
#chains in the Genus database with same CATH homology
 4YND A;  5T5G A;  3PDN A;  4YPU A;  5LSZ A;  4MI0 A;  4WUY A;  2RFI A;  5F6K C;  5T0M A;  3S8P A;  3SW9 A;  4BUP A;  4IJD A;  5CCL A;  4J7F A;  5F6L A;  5ARG A;  3OXL A;  4JLG A;  5CCM A;  4NVQ A;  3KMT A;  3IHX A;  3OXF A;  1MUF A;  3DB5 A;  5AYF A;  5HQ8 A;  3F9Y A;  4YNM A;  3MO5 A;  4O6F A;  4JDS A;  5JIN A;  4J83 A;  3KMJ A;  5JIY A;  2F69 A;  5F59 A;  3M55 A;  3S7B A;  3TG5 A;  4C1Q A;  3DAL A;  2IGQ A;  3S7J A;  3N71 A;  1ZKK A;  5JJ0 A;  3F9X A;  2BQZ A;  1MVX A;  4QEN A;  3OS5 A;  4O30 A;  5TTF A;  4RZ0 A;  3M54 A;  5TEG A;  3RU0 A;  5LSX A;  5KJK A;  5HI7 A;  3CBP A;  3OXG A;  3M59 A;  3QWP A;  3S7F A;  3KMA A;  1H3I A;  1PEG A;  3TG4 A;  3SWC A;  2JV0 A;  4AU7 A;  2R3A A;  3M5A A;  4QEP A;  2W5Z A;  5KJL A;  4H12 A;  3RJW A;  3VUZ A;  3FPD A;  3M58 A;  3M56 A;  3S7D A;  1N6A A;  5T0K A;  1N6C A;  3K5K A;  1XQH A;  3BO5 A;  4QEO A;  5EX3 A;  3HNA A;  4E47 A;  3RQ4 A;  4J8O A;  3VV0 A;  1N3J A;  1MVH A;  3OPE A;  3MO2 A;  5KJN A;  3CBM A;  5CPR B;  3M57 A;  4Z4P A;  3F9W A;  3CBO A;  3MEK A;  5KJM A;  1MT6 A;  4YNP A;  3QWV A;  4LDG A;  3OOI A;  4FMU A;  5F5E A;  3RAY A;  4YPE A;  5ARF A;  4IJ8 A;  2O8J A;  4J7I A;  2G46 A;  4YPA A;  3M53 A;  3RIB A;  2QPW A;  3F9Z A;  4NJ5 A;  3MO0 A;  4I51 A;  3EP0 A;  1O9S A;  4MI5 A;  3QWW A;  5EX0 A;  5TH7 A;  5JHN A;  1ML9 A;  5EG2 A;  2W5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...