3MO0A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e11
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
258
structure length
251
Chain Sequence
RIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo0A00
1MT6A 3KMJA 3QWPA 3M54A 5HQ8A 3OXFA 3HNAA 3MO0A 5CCLA 4J7IA 3EP0A 4YPUA 3OOIA 2RFIA 3MO5A 5F59A 4QENA 4YNDA 3M58A 2JV0A 3CBPA 5EX3A 3IHXA 2O8JA 4QEPA 5JJ0A 3RU0A 5TEGA 3QWWA 5LSXA 3F9XA 1N3JA 3F9WA 3FPDA 4IJ8A 5EG2A 3S7DA 3K5KA 4JDSA 4MI5A 1O9SA 5F6LA 2W5YA 3RAYA 3OS5A 4O6FA 3M57A 5CCMA 4FMUA 3DB5A 4IJDA 5KJKA 5TH7A 2R3AA 4YNPA 4O30A 5F6KC 3F9YA 5F5EA 3S7FA 4JLGA 2W5ZA 3QWVA 4J7FA 1N6AA 5KJNA 4H12A 3DALA 3M55A 1ZKKA 4QEOA 3MO2A 4WUYA 3TG4A 5JHNA 3PDNA 3F9ZA 4LDGA 5ARFA 5AYFA 3MEKA 3S7JA 2BQZA 3RQ4A 3VUZA 3RIBA 4BUPA 3OXGA 1N6CA 5EX0A 1PEGA 3TG5A 4RZ0A 3N71A 1XQHA 3OXLA 5JINA 5T0MA 3VV0A 3KMTA 3OPEA 3CBMA 4E47A 5JIYA 4YNMA 3RJWA 5HI7A 3SWCA 5LSZA 2IGQA 5T0KA 1H3IA 4AU7A 4J8OA 4YPEA 5T5GA 5KJLA 4I51A 3BO5A 3SW9A 5KJMA 1MVXA 2F69A 4NJ5A 3KMAA 3M53A 3M59A 4NVQA 4C1QA 4MI0A 3M5AA 2G46A 3CBOA 3S7BA 4YPAA 5TTFA 1MVHA 3S8PA 5ARGA 1MUFA 1ML9A 4J83A 2QPWA 5CPRB 3M56A 4Z4PA
chains in the Genus database with same CATH superfamily
1MT6A 3KMJA 3QWPA 3M54A 5HQ8A 3OXFA 3HNAA 3MO0A 5CCLA 4J7IA 3EP0A 4YPUA 3OOIA 2RFIA 3MO5A 5F59A 4QENA 4YNDA 3M58A 2JV0A 3CBPA 5EX3A 3IHXA 2O8JA 4QEPA 5JJ0A 3RU0A 5TEGA 3QWWA 5LSXA 3F9XA 1N3JA 3F9WA 3FPDA 4IJ8A 5EG2A 3S7DA 3K5KA 4JDSA 4MI5A 1O9SA 5F6LA 2W5YA 3RAYA 3OS5A 4O6FA 3M57A 5CCMA 4FMUA 3DB5A 4IJDA 5KJKA 5TH7A 2R3AA 4YNPA 4O30A 5F6KC 3F9YA 5F5EA 3S7FA 4JLGA 2W5ZA 3QWVA 4J7FA 1N6AA 5KJNA 4H12A 3DALA 3M55A 1ZKKA 4QEOA 3MO2A 4WUYA 3TG4A 5JHNA 3PDNA 3F9ZA 4LDGA 5ARFA 5AYFA 3MEKA 3S7JA 2BQZA 3RQ4A 3VUZA 3RIBA 4BUPA 3OXGA 1N6CA 5EX0A 1PEGA 3TG5A 4RZ0A 3N71A 1XQHA 3OXLA 5JINA 5T0MA 3VV0A 3KMTA 3OPEA 3CBMA 4E47A 5JIYA 4YNMA 3RJWA 5HI7A 3SWCA 5LSZA 2IGQA 5T0KA 1H3IA 4AU7A 4J8OA 4YPEA 5T5GA 5KJLA 4I51A 3BO5A 3SW9A 5KJMA 1MVXA 2F69A 4NJ5A 3KMAA 3M53A 3M59A 4NVQA 4C1QA 4MI0A 3M5AA 2G46A 3CBOA 3S7BA 4YPAA 5TTFA 1MVHA 3S8PA 5ARGA 1MUFA 1ML9A 4J83A 2QPWA 5CPRB 3M56A 4Z4PA
chains in the Genus database with same CATH topology
1MT6A 3KMJA 3QWPA 3M54A 5HQ8A 3OXFA 3HNAA 3MO0A 5CCLA 4J7IA 3EP0A 4YPUA 3OOIA 2RFIA 3MO5A 5F59A 4QENA 4YNDA 3M58A 2JV0A 3CBPA 5EX3A 3IHXA 2O8JA 4QEPA 5JJ0A 3RU0A 5TEGA 3QWWA 5LSXA 3F9XA 1N3JA 3F9WA 3FPDA 4IJ8A 5EG2A 3S7DA 3K5KA 4JDSA 4MI5A 1O9SA 5F6LA 2W5YA 3RAYA 3OS5A 4O6FA 3M57A 5CCMA 4FMUA 3DB5A 4IJDA 5KJKA 5TH7A 2R3AA 4YNPA 4O30A 5F6KC 3F9YA 5F5EA 3S7FA 4JLGA 2W5ZA 3QWVA 4J7FA 1N6AA 5KJNA 4H12A 3DALA 3M55A 1ZKKA 4QEOA 3MO2A 4WUYA 3TG4A 5JHNA 3PDNA 3F9ZA 4LDGA 5ARFA 5AYFA 3MEKA 3S7JA 2BQZA 3RQ4A 3VUZA 3RIBA 4BUPA 3OXGA 1N6CA 5EX0A 1PEGA 3TG5A 4RZ0A 3N71A 1XQHA 3OXLA 5JINA 5T0MA 3VV0A 3KMTA 3OPEA 3CBMA 4E47A 5JIYA 4YNMA 3RJWA 5HI7A 3SWCA 5LSZA 2IGQA 5T0KA 1H3IA 4AU7A 4J8OA 4YPEA 5T5GA 5KJLA 4I51A 3BO5A 3SW9A 5KJMA 1MVXA 2F69A 4NJ5A 3KMAA 3M53A 3M59A 4NVQA 4C1QA 4MI0A 3M5AA 2G46A 3CBOA 3S7BA 4YPAA 5TTFA 1MVHA 3S8PA 5ARGA 1MUFA 1ML9A 4J83A 2QPWA 5CPRB 3M56A 4Z4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MT6 A;  3KMJ A;  3QWP A;  3M54 A;  5HQ8 A;  3OXF A;  3HNA A;  3MO0 A;  5CCL A;  4J7I A;  3EP0 A;  4YPU A;  3OOI A;  2RFI A;  3MO5 A;  5F59 A;  4QEN A;  4YND A;  3M58 A;  2JV0 A;  3CBP A;  5EX3 A;  3IHX A;  2O8J A;  4QEP A;  5JJ0 A;  3RU0 A;  5TEG A;  3QWW A;  5LSX A;  3F9X A;  1N3J A;  3F9W A;  3FPD A;  4IJ8 A;  5EG2 A;  3S7D A;  3K5K A;  4JDS A;  4MI5 A;  1O9S A;  5F6L A;  2W5Y A;  3RAY A;  3OS5 A;  4O6F A;  3M57 A;  5CCM A;  4FMU A;  3DB5 A;  4IJD A;  5KJK A;  5TH7 A;  2R3A A;  4YNP A;  4O30 A;  5F6K C;  3F9Y A;  5F5E A;  3S7F A;  4JLG A;  2W5Z A;  3QWV A;  4J7F A;  1N6A A;  5KJN A;  4H12 A;  3DAL A;  3M55 A;  1ZKK A;  4QEO A;  3MO2 A;  4WUY A;  3TG4 A;  5JHN A;  3PDN A;  3F9Z A;  4LDG A;  5ARF A;  5AYF A;  3MEK A;  3S7J A;  2BQZ A;  3RQ4 A;  3VUZ A;  3RIB A;  4BUP A;  3OXG A;  1N6C A;  5EX0 A;  1PEG A;  3TG5 A;  4RZ0 A;  3N71 A;  1XQH A;  3OXL A;  5JIN A;  5T0M A;  3VV0 A;  3KMT A;  3OPE A;  3CBM A;  4E47 A;  5JIY A;  4YNM A;  3RJW A;  5HI7 A;  3SWC A;  5LSZ A;  2IGQ A;  5T0K A;  1H3I A;  4AU7 A;  4J8O A;  4YPE A;  5T5G A;  5KJL A;  4I51 A;  3BO5 A;  3SW9 A;  5KJM A;  1MVX A;  2F69 A;  4NJ5 A;  3KMA A;  3M53 A;  3M59 A;  4NVQ A;  4C1Q A;  4MI0 A;  3M5A A;  2G46 A;  3CBO A;  3S7B A;  4YPA A;  5TTF A;  1MVH A;  3S8P A;  5ARG A;  1MUF A;  1ML9 A;  4J83 A;  2QPW A;  5CPR B;  3M56 A;  4Z4P A; 
#chains in the Genus database with same CATH topology
 1MT6 A;  3KMJ A;  3QWP A;  3M54 A;  5HQ8 A;  3OXF A;  3HNA A;  3MO0 A;  5CCL A;  4J7I A;  3EP0 A;  4YPU A;  3OOI A;  2RFI A;  3MO5 A;  5F59 A;  4QEN A;  4YND A;  3M58 A;  2JV0 A;  3CBP A;  5EX3 A;  3IHX A;  2O8J A;  4QEP A;  5JJ0 A;  3RU0 A;  5TEG A;  3QWW A;  5LSX A;  3F9X A;  1N3J A;  3F9W A;  3FPD A;  4IJ8 A;  5EG2 A;  3S7D A;  3K5K A;  4JDS A;  4MI5 A;  1O9S A;  5F6L A;  2W5Y A;  3RAY A;  3OS5 A;  4O6F A;  3M57 A;  5CCM A;  4FMU A;  3DB5 A;  4IJD A;  5KJK A;  5TH7 A;  2R3A A;  4YNP A;  4O30 A;  5F6K C;  3F9Y A;  5F5E A;  3S7F A;  4JLG A;  2W5Z A;  3QWV A;  4J7F A;  1N6A A;  5KJN A;  4H12 A;  3DAL A;  3M55 A;  1ZKK A;  4QEO A;  3MO2 A;  4WUY A;  3TG4 A;  5JHN A;  3PDN A;  3F9Z A;  4LDG A;  5ARF A;  5AYF A;  3MEK A;  3S7J A;  2BQZ A;  3RQ4 A;  3VUZ A;  3RIB A;  4BUP A;  3OXG A;  1N6C A;  5EX0 A;  1PEG A;  3TG5 A;  4RZ0 A;  3N71 A;  1XQH A;  3OXL A;  5JIN A;  5T0M A;  3VV0 A;  3KMT A;  3OPE A;  3CBM A;  4E47 A;  5JIY A;  4YNM A;  3RJW A;  5HI7 A;  3SWC A;  5LSZ A;  2IGQ A;  5T0K A;  1H3I A;  4AU7 A;  4J8O A;  4YPE A;  5T5G A;  5KJL A;  4I51 A;  3BO5 A;  3SW9 A;  5KJM A;  1MVX A;  2F69 A;  4NJ5 A;  3KMA A;  3M53 A;  3M59 A;  4NVQ A;  4C1Q A;  4MI0 A;  3M5A A;  2G46 A;  3CBO A;  3S7B A;  4YPA A;  5TTF A;  1MVH A;  3S8P A;  5ARG A;  1MUF A;  1ML9 A;  4J83 A;  2QPW A;  5CPR B;  3M56 A;  4Z4P A; 
#chains in the Genus database with same CATH homology
 1MT6 A;  3KMJ A;  3QWP A;  3M54 A;  5HQ8 A;  3OXF A;  3HNA A;  3MO0 A;  5CCL A;  4J7I A;  3EP0 A;  4YPU A;  3OOI A;  2RFI A;  3MO5 A;  5F59 A;  4QEN A;  4YND A;  3M58 A;  2JV0 A;  3CBP A;  5EX3 A;  3IHX A;  2O8J A;  4QEP A;  5JJ0 A;  3RU0 A;  5TEG A;  3QWW A;  5LSX A;  3F9X A;  1N3J A;  3F9W A;  3FPD A;  4IJ8 A;  5EG2 A;  3S7D A;  3K5K A;  4JDS A;  4MI5 A;  1O9S A;  5F6L A;  2W5Y A;  3RAY A;  3OS5 A;  4O6F A;  3M57 A;  5CCM A;  4FMU A;  3DB5 A;  4IJD A;  5KJK A;  5TH7 A;  2R3A A;  4YNP A;  4O30 A;  5F6K C;  3F9Y A;  5F5E A;  3S7F A;  4JLG A;  2W5Z A;  3QWV A;  4J7F A;  1N6A A;  5KJN A;  4H12 A;  3DAL A;  3M55 A;  1ZKK A;  4QEO A;  3MO2 A;  4WUY A;  3TG4 A;  5JHN A;  3PDN A;  3F9Z A;  4LDG A;  5ARF A;  5AYF A;  3MEK A;  3S7J A;  2BQZ A;  3RQ4 A;  3VUZ A;  3RIB A;  4BUP A;  3OXG A;  1N6C A;  5EX0 A;  1PEG A;  3TG5 A;  4RZ0 A;  3N71 A;  1XQH A;  3OXL A;  5JIN A;  5T0M A;  3VV0 A;  3KMT A;  3OPE A;  3CBM A;  4E47 A;  5JIY A;  4YNM A;  3RJW A;  5HI7 A;  3SWC A;  5LSZ A;  2IGQ A;  5T0K A;  1H3I A;  4AU7 A;  4J8O A;  4YPE A;  5T5G A;  5KJL A;  4I51 A;  3BO5 A;  3SW9 A;  5KJM A;  1MVX A;  2F69 A;  4NJ5 A;  3KMA A;  3M53 A;  3M59 A;  4NVQ A;  4C1Q A;  4MI0 A;  3M5A A;  2G46 A;  3CBO A;  3S7B A;  4YPA A;  5TTF A;  1MVH A;  3S8P A;  5ARG A;  1MUF A;  1ML9 A;  4J83 A;  2QPW A;  5CPR B;  3M56 A;  4Z4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...