3MO0A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e11
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
258
structure length
251
Chain Sequence
RIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo0A00
2R3AA 3MO5A 5T5GA 3M57A 3TG4A 3DALA 5KJNA 3S7DA 5F6LA 5ARGA 5AYFA 5TEGA 3F9XA 3F9YA 4I51A 3M54A 3KMAA 2QPWA 1MT6A 2W5YA 4IJDA 5F5EA 3M53A 1N6AA 3OOIA 3BO5A 5LSXA 4LDGA 4QEPA 3M56A 4QENA 4Z4PA 4O30A 4QEOA 3SW9A 5F59A 3M5AA 4YNPA 3M59A 3F9WA 5CCLA 4YNMA 4MI5A 4E47A 3DB5A 3MO0A 1ML9A 5T0MA 3MEKA 3QWWA 4RZ0A 4H12A 3M55A 4YPEA 3VUZA 5EX0A 5JINA 3RAYA 5TTFA 3VV0A 3PDNA 3FPDA 5F6KC 4J8OA 4NJ5A 3QWVA 1ZKKA 3OXLA 4YPAA 3KMJA 5CCMA 2W5ZA 3S8PA 3K5KA 3RU0A 3CBOA 5EG2A 4IJ8A 1N3JA 1PEGA 2JV0A 3M58A 3RIBA 3N71A 5JJ0A 3CBPA 1O9SA 4J7IA 1H3IA 4YPUA 1XQHA 5EX3A 3S7BA 4MI0A 5TH7A 1MVHA 5JHNA 1N6CA 5HQ8A 3KMTA 5CPRB 2G46A 5KJKA 4JLGA 3OXGA 5LSZA 5KJMA 1MUFA 5HI7A 3IHXA 4C1QA 4NVQA 5ARFA 3RQ4A 1MVXA 4J83A 4O6FA 4J7FA 4JDSA 3QWPA 5T0KA 4AU7A 5KJLA 4YNDA 3OXFA 3MO2A 2F69A 3OS5A 3RJWA 3EP0A 3SWCA 3S7FA 3HNAA 3CBMA 3TG5A 4WUYA 5JIYA 4FMUA 3F9ZA 2BQZA 4BUPA 2O8JA 3S7JA 3OPEA 2RFIA 2IGQA
chains in the Genus database with same CATH superfamily
2R3AA 3MO5A 5T5GA 3M57A 3TG4A 3DALA 5KJNA 3S7DA 5F6LA 5ARGA 5AYFA 5TEGA 3F9XA 3F9YA 4I51A 3M54A 3KMAA 2QPWA 1MT6A 2W5YA 4IJDA 5F5EA 3M53A 1N6AA 3OOIA 3BO5A 5LSXA 4LDGA 4QEPA 3M56A 4QENA 4Z4PA 4O30A 4QEOA 3SW9A 5F59A 3M5AA 4YNPA 3M59A 3F9WA 5CCLA 4YNMA 4MI5A 4E47A 3DB5A 3MO0A 1ML9A 5T0MA 3MEKA 3QWWA 4RZ0A 4H12A 3M55A 4YPEA 3VUZA 5EX0A 5JINA 3RAYA 5TTFA 3VV0A 3PDNA 3FPDA 5F6KC 4J8OA 4NJ5A 3QWVA 1ZKKA 3OXLA 4YPAA 3KMJA 5CCMA 2W5ZA 3S8PA 3K5KA 3RU0A 3CBOA 5EG2A 4IJ8A 1N3JA 1PEGA 2JV0A 3M58A 3RIBA 3N71A 5JJ0A 3CBPA 1O9SA 4J7IA 1H3IA 4YPUA 1XQHA 5EX3A 3S7BA 4MI0A 5TH7A 1MVHA 5JHNA 1N6CA 5HQ8A 3KMTA 5CPRB 2G46A 5KJKA 4JLGA 3OXGA 5LSZA 5KJMA 1MUFA 5HI7A 3IHXA 4C1QA 4NVQA 5ARFA 3RQ4A 1MVXA 4J83A 4O6FA 4J7FA 4JDSA 3QWPA 5T0KA 4AU7A 5KJLA 4YNDA 3OXFA 3MO2A 2F69A 3OS5A 3RJWA 3EP0A 3SWCA 3S7FA 3HNAA 3CBMA 3TG5A 4WUYA 5JIYA 4FMUA 3F9ZA 2BQZA 4BUPA 2O8JA 3S7JA 3OPEA 2RFIA 2IGQA
chains in the Genus database with same CATH topology
2R3AA 3MO5A 5T5GA 3M57A 3TG4A 3DALA 5KJNA 3S7DA 5F6LA 5ARGA 5AYFA 5TEGA 3F9XA 3F9YA 4I51A 3M54A 3KMAA 2QPWA 1MT6A 2W5YA 4IJDA 5F5EA 3M53A 1N6AA 3OOIA 3BO5A 5LSXA 4LDGA 4QEPA 3M56A 4QENA 4Z4PA 4O30A 4QEOA 3SW9A 5F59A 3M5AA 4YNPA 3M59A 3F9WA 5CCLA 4YNMA 4MI5A 4E47A 3DB5A 3MO0A 1ML9A 5T0MA 3MEKA 3QWWA 4RZ0A 4H12A 3M55A 4YPEA 3VUZA 5EX0A 5JINA 3RAYA 5TTFA 3VV0A 3PDNA 3FPDA 5F6KC 4J8OA 4NJ5A 3QWVA 1ZKKA 3OXLA 4YPAA 3KMJA 5CCMA 2W5ZA 3S8PA 3K5KA 3RU0A 3CBOA 5EG2A 4IJ8A 1N3JA 1PEGA 2JV0A 3M58A 3RIBA 3N71A 5JJ0A 3CBPA 1O9SA 4J7IA 1H3IA 4YPUA 1XQHA 5EX3A 3S7BA 4MI0A 5TH7A 1MVHA 5JHNA 1N6CA 5HQ8A 3KMTA 5CPRB 2G46A 5KJKA 4JLGA 3OXGA 5LSZA 5KJMA 1MUFA 5HI7A 3IHXA 4C1QA 4NVQA 5ARFA 3RQ4A 1MVXA 4J83A 4O6FA 4J7FA 4JDSA 3QWPA 5T0KA 4AU7A 5KJLA 4YNDA 3OXFA 3MO2A 2F69A 3OS5A 3RJWA 3EP0A 3SWCA 3S7FA 3HNAA 3CBMA 3TG5A 4WUYA 5JIYA 4FMUA 3F9ZA 2BQZA 4BUPA 2O8JA 3S7JA 3OPEA 2RFIA 2IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R3A A;  3MO5 A;  5T5G A;  3M57 A;  3TG4 A;  3DAL A;  5KJN A;  3S7D A;  5F6L A;  5ARG A;  5AYF A;  5TEG A;  3F9X A;  3F9Y A;  4I51 A;  3M54 A;  3KMA A;  2QPW A;  1MT6 A;  2W5Y A;  4IJD A;  5F5E A;  3M53 A;  1N6A A;  3OOI A;  3BO5 A;  5LSX A;  4LDG A;  4QEP A;  3M56 A;  4QEN A;  4Z4P A;  4O30 A;  4QEO A;  3SW9 A;  5F59 A;  3M5A A;  4YNP A;  3M59 A;  3F9W A;  5CCL A;  4YNM A;  4MI5 A;  4E47 A;  3DB5 A;  3MO0 A;  1ML9 A;  5T0M A;  3MEK A;  3QWW A;  4RZ0 A;  4H12 A;  3M55 A;  4YPE A;  3VUZ A;  5EX0 A;  5JIN A;  3RAY A;  5TTF A;  3VV0 A;  3PDN A;  3FPD A;  5F6K C;  4J8O A;  4NJ5 A;  3QWV A;  1ZKK A;  3OXL A;  4YPA A;  3KMJ A;  5CCM A;  2W5Z A;  3S8P A;  3K5K A;  3RU0 A;  3CBO A;  5EG2 A;  4IJ8 A;  1N3J A;  1PEG A;  2JV0 A;  3M58 A;  3RIB A;  3N71 A;  5JJ0 A;  3CBP A;  1O9S A;  4J7I A;  1H3I A;  4YPU A;  1XQH A;  5EX3 A;  3S7B A;  4MI0 A;  5TH7 A;  1MVH A;  5JHN A;  1N6C A;  5HQ8 A;  3KMT A;  5CPR B;  2G46 A;  5KJK A;  4JLG A;  3OXG A;  5LSZ A;  5KJM A;  1MUF A;  5HI7 A;  3IHX A;  4C1Q A;  4NVQ A;  5ARF A;  3RQ4 A;  1MVX A;  4J83 A;  4O6F A;  4J7F A;  4JDS A;  3QWP A;  5T0K A;  4AU7 A;  5KJL A;  4YND A;  3OXF A;  3MO2 A;  2F69 A;  3OS5 A;  3RJW A;  3EP0 A;  3SWC A;  3S7F A;  3HNA A;  3CBM A;  3TG5 A;  4WUY A;  5JIY A;  4FMU A;  3F9Z A;  2BQZ A;  4BUP A;  2O8J A;  3S7J A;  3OPE A;  2RFI A;  2IGQ A; 
#chains in the Genus database with same CATH topology
 2R3A A;  3MO5 A;  5T5G A;  3M57 A;  3TG4 A;  3DAL A;  5KJN A;  3S7D A;  5F6L A;  5ARG A;  5AYF A;  5TEG A;  3F9X A;  3F9Y A;  4I51 A;  3M54 A;  3KMA A;  2QPW A;  1MT6 A;  2W5Y A;  4IJD A;  5F5E A;  3M53 A;  1N6A A;  3OOI A;  3BO5 A;  5LSX A;  4LDG A;  4QEP A;  3M56 A;  4QEN A;  4Z4P A;  4O30 A;  4QEO A;  3SW9 A;  5F59 A;  3M5A A;  4YNP A;  3M59 A;  3F9W A;  5CCL A;  4YNM A;  4MI5 A;  4E47 A;  3DB5 A;  3MO0 A;  1ML9 A;  5T0M A;  3MEK A;  3QWW A;  4RZ0 A;  4H12 A;  3M55 A;  4YPE A;  3VUZ A;  5EX0 A;  5JIN A;  3RAY A;  5TTF A;  3VV0 A;  3PDN A;  3FPD A;  5F6K C;  4J8O A;  4NJ5 A;  3QWV A;  1ZKK A;  3OXL A;  4YPA A;  3KMJ A;  5CCM A;  2W5Z A;  3S8P A;  3K5K A;  3RU0 A;  3CBO A;  5EG2 A;  4IJ8 A;  1N3J A;  1PEG A;  2JV0 A;  3M58 A;  3RIB A;  3N71 A;  5JJ0 A;  3CBP A;  1O9S A;  4J7I A;  1H3I A;  4YPU A;  1XQH A;  5EX3 A;  3S7B A;  4MI0 A;  5TH7 A;  1MVH A;  5JHN A;  1N6C A;  5HQ8 A;  3KMT A;  5CPR B;  2G46 A;  5KJK A;  4JLG A;  3OXG A;  5LSZ A;  5KJM A;  1MUF A;  5HI7 A;  3IHX A;  4C1Q A;  4NVQ A;  5ARF A;  3RQ4 A;  1MVX A;  4J83 A;  4O6F A;  4J7F A;  4JDS A;  3QWP A;  5T0K A;  4AU7 A;  5KJL A;  4YND A;  3OXF A;  3MO2 A;  2F69 A;  3OS5 A;  3RJW A;  3EP0 A;  3SWC A;  3S7F A;  3HNA A;  3CBM A;  3TG5 A;  4WUY A;  5JIY A;  4FMU A;  3F9Z A;  2BQZ A;  4BUP A;  2O8J A;  3S7J A;  3OPE A;  2RFI A;  2IGQ A; 
#chains in the Genus database with same CATH homology
 2R3A A;  3MO5 A;  5T5G A;  3M57 A;  3TG4 A;  3DAL A;  5KJN A;  3S7D A;  5F6L A;  5ARG A;  5AYF A;  5TEG A;  3F9X A;  3F9Y A;  4I51 A;  3M54 A;  3KMA A;  2QPW A;  1MT6 A;  2W5Y A;  4IJD A;  5F5E A;  3M53 A;  1N6A A;  3OOI A;  3BO5 A;  5LSX A;  4LDG A;  4QEP A;  3M56 A;  4QEN A;  4Z4P A;  4O30 A;  4QEO A;  3SW9 A;  5F59 A;  3M5A A;  4YNP A;  3M59 A;  3F9W A;  5CCL A;  4YNM A;  4MI5 A;  4E47 A;  3DB5 A;  3MO0 A;  1ML9 A;  5T0M A;  3MEK A;  3QWW A;  4RZ0 A;  4H12 A;  3M55 A;  4YPE A;  3VUZ A;  5EX0 A;  5JIN A;  3RAY A;  5TTF A;  3VV0 A;  3PDN A;  3FPD A;  5F6K C;  4J8O A;  4NJ5 A;  3QWV A;  1ZKK A;  3OXL A;  4YPA A;  3KMJ A;  5CCM A;  2W5Z A;  3S8P A;  3K5K A;  3RU0 A;  3CBO A;  5EG2 A;  4IJ8 A;  1N3J A;  1PEG A;  2JV0 A;  3M58 A;  3RIB A;  3N71 A;  5JJ0 A;  3CBP A;  1O9S A;  4J7I A;  1H3I A;  4YPU A;  1XQH A;  5EX3 A;  3S7B A;  4MI0 A;  5TH7 A;  1MVH A;  5JHN A;  1N6C A;  5HQ8 A;  3KMT A;  5CPR B;  2G46 A;  5KJK A;  4JLG A;  3OXG A;  5LSZ A;  5KJM A;  1MUF A;  5HI7 A;  3IHX A;  4C1Q A;  4NVQ A;  5ARF A;  3RQ4 A;  1MVX A;  4J83 A;  4O6F A;  4J7F A;  4JDS A;  3QWP A;  5T0K A;  4AU7 A;  5KJL A;  4YND A;  3OXF A;  3MO2 A;  2F69 A;  3OS5 A;  3RJW A;  3EP0 A;  3SWC A;  3S7F A;  3HNA A;  3CBM A;  3TG5 A;  4WUY A;  5JIY A;  4FMU A;  3F9Z A;  2BQZ A;  4BUP A;  2O8J A;  3S7J A;  3OPE A;  2RFI A;  2IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...