4QEPA

Crystal structure of kryptonite in complex with mchg dna and sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
526
structure length
467
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 118
structure length 467
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qepA03
3S7FA 2R3AA 3RAYA 2G46A 4O30A 4YNPA 1PEGA 3OXFA 4BUPA 3F9WA 3QWWA 4QEPA 4RZ0A 3KMTA 3MO2A 4YNMA 2F69A 5JHNA 5EG2A 3CBOA 1MVHA 4FMUA 3M57A 3N71A 5F6KC 2W5YA 3F9YA 5AYFA 5ARFA 1N6CA 1O9SA 3BO5A 5T0KA 3VUZA 4IJ8A 5LSXA 1MVXA 5F6LA 4J83A 3F9XA 4MI5A 4J8OA 4LDGA 3QWPA 3TG4A 3M56A 3S7BA 3FPDA 5T0MA 4QENA 3RQ4A 3S7JA 2O8JA 5EX0A 3M58A 3OPEA 3SW9A 4I51A 1H3IA 5KJMA 4NJ5A 4MI0A 3DB5A 2RFIA 5TEGA 3HNAA 4YPUA 5JIYA 3M53A 4H12A 3OOIA 1MUFA 4NVQA 3CBPA 5HQ8A 2QPWA 4E47A 3F9ZA 3M54A 3KMJA 4YPAA 1ML9A 1N6AA 5F5EA 3RU0A 4JLGA 3TG5A 5TH7A 4YNDA 4J7FA 3QWVA 5KJNA 5CCLA 2BQZA 3OXLA 4AU7A 4O6FA 5EX3A 3SWCA 5TTFA 3MO5A 3M59A 2W5ZA 3IHXA 5LSZA 3PDNA 1N3JA 3OS5A 5T5GA 4C1QA 3DALA 3KMAA 4JDSA 3VV0A 1MT6A 5CPRB 3S8PA 3MEKA 4QEOA 2JV0A 5HI7A 5JINA 1ZKKA 4Z4PA 5F59A 3M55A 1XQHA 3M5AA 3RIBA 4YPEA 4WUYA 3EP0A 5KJLA 5JJ0A 2IGQA 3RJWA 5KJKA 3CBMA 4IJDA 3K5KA 3S7DA 3MO0A 3OXGA 5ARGA 4J7IA 5CCMA
chains in the Genus database with same CATH superfamily
3S7FA 2R3AA 3RAYA 2G46A 4O30A 4YNPA 1PEGA 3OXFA 4BUPA 3F9WA 3QWWA 4QEPA 4RZ0A 3KMTA 3MO2A 4YNMA 2F69A 5JHNA 5EG2A 3CBOA 1MVHA 4FMUA 3M57A 3N71A 5F6KC 2W5YA 3F9YA 5AYFA 5ARFA 1N6CA 1O9SA 3BO5A 5T0KA 3VUZA 4IJ8A 5LSXA 1MVXA 5F6LA 4J83A 3F9XA 4MI5A 4J8OA 4LDGA 3QWPA 3TG4A 3M56A 3S7BA 3FPDA 5T0MA 4QENA 3RQ4A 3S7JA 2O8JA 5EX0A 3M58A 3OPEA 3SW9A 4I51A 1H3IA 5KJMA 4NJ5A 4MI0A 3DB5A 2RFIA 5TEGA 3HNAA 4YPUA 5JIYA 3M53A 4H12A 3OOIA 1MUFA 4NVQA 3CBPA 5HQ8A 2QPWA 4E47A 3F9ZA 3M54A 3KMJA 4YPAA 1ML9A 1N6AA 5F5EA 3RU0A 4JLGA 3TG5A 5TH7A 4YNDA 4J7FA 3QWVA 5KJNA 5CCLA 2BQZA 3OXLA 4AU7A 4O6FA 5EX3A 3SWCA 5TTFA 3MO5A 3M59A 2W5ZA 3IHXA 5LSZA 3PDNA 1N3JA 3OS5A 5T5GA 4C1QA 3DALA 3KMAA 4JDSA 3VV0A 1MT6A 5CPRB 3S8PA 3MEKA 4QEOA 2JV0A 5HI7A 5JINA 1ZKKA 4Z4PA 5F59A 3M55A 1XQHA 3M5AA 3RIBA 4YPEA 4WUYA 3EP0A 5KJLA 5JJ0A 2IGQA 3RJWA 5KJKA 3CBMA 4IJDA 3K5KA 3S7DA 3MO0A 3OXGA 5ARGA 4J7IA 5CCMA
chains in the Genus database with same CATH topology
3S7FA 2R3AA 3RAYA 2G46A 4O30A 4YNPA 1PEGA 3OXFA 4BUPA 3F9WA 3QWWA 4QEPA 4RZ0A 3KMTA 3MO2A 4YNMA 2F69A 5JHNA 5EG2A 3CBOA 1MVHA 4FMUA 3M57A 3N71A 5F6KC 2W5YA 3F9YA 5AYFA 5ARFA 1N6CA 1O9SA 3BO5A 5T0KA 3VUZA 4IJ8A 5LSXA 1MVXA 5F6LA 4J83A 3F9XA 4MI5A 4J8OA 4LDGA 3QWPA 3TG4A 3M56A 3S7BA 3FPDA 5T0MA 4QENA 3RQ4A 3S7JA 2O8JA 5EX0A 3M58A 3OPEA 3SW9A 4I51A 1H3IA 5KJMA 4NJ5A 4MI0A 3DB5A 2RFIA 5TEGA 3HNAA 4YPUA 5JIYA 3M53A 4H12A 3OOIA 1MUFA 4NVQA 3CBPA 5HQ8A 2QPWA 4E47A 3F9ZA 3M54A 3KMJA 4YPAA 1ML9A 1N6AA 5F5EA 3RU0A 4JLGA 3TG5A 5TH7A 4YNDA 4J7FA 3QWVA 5KJNA 5CCLA 2BQZA 3OXLA 4AU7A 4O6FA 5EX3A 3SWCA 5TTFA 3MO5A 3M59A 2W5ZA 3IHXA 5LSZA 3PDNA 1N3JA 3OS5A 5T5GA 4C1QA 3DALA 3KMAA 4JDSA 3VV0A 1MT6A 5CPRB 3S8PA 3MEKA 4QEOA 2JV0A 5HI7A 5JINA 1ZKKA 4Z4PA 5F59A 3M55A 1XQHA 3M5AA 3RIBA 4YPEA 4WUYA 3EP0A 5KJLA 5JJ0A 2IGQA 3RJWA 5KJKA 3CBMA 4IJDA 3K5KA 3S7DA 3MO0A 3OXGA 5ARGA 4J7IA 5CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7F A;  2R3A A;  3RAY A;  2G46 A;  4O30 A;  4YNP A;  1PEG A;  3OXF A;  4BUP A;  3F9W A;  3QWW A;  4QEP A;  4RZ0 A;  3KMT A;  3MO2 A;  4YNM A;  2F69 A;  5JHN A;  5EG2 A;  3CBO A;  1MVH A;  4FMU A;  3M57 A;  3N71 A;  5F6K C;  2W5Y A;  3F9Y A;  5AYF A;  5ARF A;  1N6C A;  1O9S A;  3BO5 A;  5T0K A;  3VUZ A;  4IJ8 A;  5LSX A;  1MVX A;  5F6L A;  4J83 A;  3F9X A;  4MI5 A;  4J8O A;  4LDG A;  3QWP A;  3TG4 A;  3M56 A;  3S7B A;  3FPD A;  5T0M A;  4QEN A;  3RQ4 A;  3S7J A;  2O8J A;  5EX0 A;  3M58 A;  3OPE A;  3SW9 A;  4I51 A;  1H3I A;  5KJM A;  4NJ5 A;  4MI0 A;  3DB5 A;  2RFI A;  5TEG A;  3HNA A;  4YPU A;  5JIY A;  3M53 A;  4H12 A;  3OOI A;  1MUF A;  4NVQ A;  3CBP A;  5HQ8 A;  2QPW A;  4E47 A;  3F9Z A;  3M54 A;  3KMJ A;  4YPA A;  1ML9 A;  1N6A A;  5F5E A;  3RU0 A;  4JLG A;  3TG5 A;  5TH7 A;  4YND A;  4J7F A;  3QWV A;  5KJN A;  5CCL A;  2BQZ A;  3OXL A;  4AU7 A;  4O6F A;  5EX3 A;  3SWC A;  5TTF A;  3MO5 A;  3M59 A;  2W5Z A;  3IHX A;  5LSZ A;  3PDN A;  1N3J A;  3OS5 A;  5T5G A;  4C1Q A;  3DAL A;  3KMA A;  4JDS A;  3VV0 A;  1MT6 A;  5CPR B;  3S8P A;  3MEK A;  4QEO A;  2JV0 A;  5HI7 A;  5JIN A;  1ZKK A;  4Z4P A;  5F59 A;  3M55 A;  1XQH A;  3M5A A;  3RIB A;  4YPE A;  4WUY A;  3EP0 A;  5KJL A;  5JJ0 A;  2IGQ A;  3RJW A;  5KJK A;  3CBM A;  4IJD A;  3K5K A;  3S7D A;  3MO0 A;  3OXG A;  5ARG A;  4J7I A;  5CCM A; 
#chains in the Genus database with same CATH topology
 3S7F A;  2R3A A;  3RAY A;  2G46 A;  4O30 A;  4YNP A;  1PEG A;  3OXF A;  4BUP A;  3F9W A;  3QWW A;  4QEP A;  4RZ0 A;  3KMT A;  3MO2 A;  4YNM A;  2F69 A;  5JHN A;  5EG2 A;  3CBO A;  1MVH A;  4FMU A;  3M57 A;  3N71 A;  5F6K C;  2W5Y A;  3F9Y A;  5AYF A;  5ARF A;  1N6C A;  1O9S A;  3BO5 A;  5T0K A;  3VUZ A;  4IJ8 A;  5LSX A;  1MVX A;  5F6L A;  4J83 A;  3F9X A;  4MI5 A;  4J8O A;  4LDG A;  3QWP A;  3TG4 A;  3M56 A;  3S7B A;  3FPD A;  5T0M A;  4QEN A;  3RQ4 A;  3S7J A;  2O8J A;  5EX0 A;  3M58 A;  3OPE A;  3SW9 A;  4I51 A;  1H3I A;  5KJM A;  4NJ5 A;  4MI0 A;  3DB5 A;  2RFI A;  5TEG A;  3HNA A;  4YPU A;  5JIY A;  3M53 A;  4H12 A;  3OOI A;  1MUF A;  4NVQ A;  3CBP A;  5HQ8 A;  2QPW A;  4E47 A;  3F9Z A;  3M54 A;  3KMJ A;  4YPA A;  1ML9 A;  1N6A A;  5F5E A;  3RU0 A;  4JLG A;  3TG5 A;  5TH7 A;  4YND A;  4J7F A;  3QWV A;  5KJN A;  5CCL A;  2BQZ A;  3OXL A;  4AU7 A;  4O6F A;  5EX3 A;  3SWC A;  5TTF A;  3MO5 A;  3M59 A;  2W5Z A;  3IHX A;  5LSZ A;  3PDN A;  1N3J A;  3OS5 A;  5T5G A;  4C1Q A;  3DAL A;  3KMA A;  4JDS A;  3VV0 A;  1MT6 A;  5CPR B;  3S8P A;  3MEK A;  4QEO A;  2JV0 A;  5HI7 A;  5JIN A;  1ZKK A;  4Z4P A;  5F59 A;  3M55 A;  1XQH A;  3M5A A;  3RIB A;  4YPE A;  4WUY A;  3EP0 A;  5KJL A;  5JJ0 A;  2IGQ A;  3RJW A;  5KJK A;  3CBM A;  4IJD A;  3K5K A;  3S7D A;  3MO0 A;  3OXG A;  5ARG A;  4J7I A;  5CCM A; 
#chains in the Genus database with same CATH homology
 3S7F A;  2R3A A;  3RAY A;  2G46 A;  4O30 A;  4YNP A;  1PEG A;  3OXF A;  4BUP A;  3F9W A;  3QWW A;  4QEP A;  4RZ0 A;  3KMT A;  3MO2 A;  4YNM A;  2F69 A;  5JHN A;  5EG2 A;  3CBO A;  1MVH A;  4FMU A;  3M57 A;  3N71 A;  5F6K C;  2W5Y A;  3F9Y A;  5AYF A;  5ARF A;  1N6C A;  1O9S A;  3BO5 A;  5T0K A;  3VUZ A;  4IJ8 A;  5LSX A;  1MVX A;  5F6L A;  4J83 A;  3F9X A;  4MI5 A;  4J8O A;  4LDG A;  3QWP A;  3TG4 A;  3M56 A;  3S7B A;  3FPD A;  5T0M A;  4QEN A;  3RQ4 A;  3S7J A;  2O8J A;  5EX0 A;  3M58 A;  3OPE A;  3SW9 A;  4I51 A;  1H3I A;  5KJM A;  4NJ5 A;  4MI0 A;  3DB5 A;  2RFI A;  5TEG A;  3HNA A;  4YPU A;  5JIY A;  3M53 A;  4H12 A;  3OOI A;  1MUF A;  4NVQ A;  3CBP A;  5HQ8 A;  2QPW A;  4E47 A;  3F9Z A;  3M54 A;  3KMJ A;  4YPA A;  1ML9 A;  1N6A A;  5F5E A;  3RU0 A;  4JLG A;  3TG5 A;  5TH7 A;  4YND A;  4J7F A;  3QWV A;  5KJN A;  5CCL A;  2BQZ A;  3OXL A;  4AU7 A;  4O6F A;  5EX3 A;  3SWC A;  5TTF A;  3MO5 A;  3M59 A;  2W5Z A;  3IHX A;  5LSZ A;  3PDN A;  1N3J A;  3OS5 A;  5T5G A;  4C1Q A;  3DAL A;  3KMA A;  4JDS A;  3VV0 A;  1MT6 A;  5CPR B;  3S8P A;  3MEK A;  4QEO A;  2JV0 A;  5HI7 A;  5JIN A;  1ZKK A;  4Z4P A;  5F59 A;  3M55 A;  1XQH A;  3M5A A;  3RIB A;  4YPE A;  4WUY A;  3EP0 A;  5KJL A;  5JJ0 A;  2IGQ A;  3RJW A;  5KJK A;  3CBM A;  4IJD A;  3K5K A;  3S7D A;  3MO0 A;  3OXG A;  5ARG A;  4J7I A;  5CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...