4QEPA

Crystal structure of kryptonite in complex with mchg dna and sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
526
structure length
467
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
total genus 118
structure length 467
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qepA03
2O8JA 3M56A 3OXLA 4QEPA 2G46A 1ML9A 3VV0A 3OPEA 4JDSA 5F59A 3N71A 4YPEA 5ARFA 4QEOA 3KMTA 5EG2A 4AU7A 5KJKA 3TG4A 3OS5A 3M54A 5KJNA 2JV0A 4YPUA 5KJMA 3IHXA 4IJDA 3MO0A 4I51A 3CBPA 3M55A 3KMJA 4JLGA 5CCLA 2R3AA 5EX0A 4FMUA 3EP0A 1H3IA 3RU0A 1ZKKA 4IJ8A 3RAYA 3FPDA 4YNMA 4LDGA 4RZ0A 4MI0A 2QPWA 4O6FA 4QENA 5F5EA 5CCMA 5JIYA 3RIBA 5JINA 4NJ5A 1XQHA 5TH7A 4NVQA 5CPRB 3S7FA 1O9SA 3F9XA 5KJLA 3HNAA 3DALA 3S8PA 3M53A 3F9YA 1PEGA 3KMAA 5T0KA 3PDNA 5TEGA 2W5YA 3S7BA 4YPAA 3RJWA 4O30A 4J7IA 3M5AA 3M58A 2IGQA 4J8OA 3F9ZA 3S7JA 3M59A 3QWPA 5F6KC 5JJ0A 1MVHA 1N6AA 3MEKA 3MO2A 3RQ4A 5LSXA 5TTFA 5F6LA 5AYFA 3SW9A 2W5ZA 5JHNA 4C1QA 1N6CA 4BUPA 4J83A 3CBOA 3TG5A 5EX3A 1MUFA 4YNDA 4H12A 5LSZA 3QWWA 5HQ8A 2BQZA 3CBMA 3OOIA 5HI7A 3BO5A 2RFIA 3S7DA 4E47A 4WUYA 3MO5A 3F9WA 2F69A 3VUZA 4J7FA 1N3JA 3SWCA 3M57A 5T0MA 3OXFA 1MVXA 4MI5A 4YNPA 5ARGA 5T5GA 3OXGA 3DB5A 1MT6A 3K5KA 3QWVA 4Z4PA
chains in the Genus database with same CATH superfamily
2O8JA 3M56A 3OXLA 4QEPA 2G46A 1ML9A 3VV0A 3OPEA 4JDSA 5F59A 3N71A 4YPEA 5ARFA 4QEOA 3KMTA 5EG2A 4AU7A 5KJKA 3TG4A 3OS5A 3M54A 5KJNA 2JV0A 4YPUA 5KJMA 3IHXA 4IJDA 3MO0A 4I51A 3CBPA 3M55A 3KMJA 4JLGA 5CCLA 2R3AA 5EX0A 4FMUA 3EP0A 1H3IA 3RU0A 1ZKKA 4IJ8A 3RAYA 3FPDA 4YNMA 4LDGA 4RZ0A 4MI0A 2QPWA 4O6FA 4QENA 5F5EA 5CCMA 5JIYA 3RIBA 5JINA 4NJ5A 1XQHA 5TH7A 4NVQA 5CPRB 3S7FA 1O9SA 3F9XA 5KJLA 3HNAA 3DALA 3S8PA 3M53A 3F9YA 1PEGA 3KMAA 5T0KA 3PDNA 5TEGA 2W5YA 3S7BA 4YPAA 3RJWA 4O30A 4J7IA 3M5AA 3M58A 2IGQA 4J8OA 3F9ZA 3S7JA 3M59A 3QWPA 5F6KC 5JJ0A 1MVHA 1N6AA 3MEKA 3MO2A 3RQ4A 5LSXA 5TTFA 5F6LA 5AYFA 3SW9A 2W5ZA 5JHNA 4C1QA 1N6CA 4BUPA 4J83A 3CBOA 3TG5A 5EX3A 1MUFA 4YNDA 4H12A 5LSZA 3QWWA 5HQ8A 2BQZA 3CBMA 3OOIA 5HI7A 3BO5A 2RFIA 3S7DA 4E47A 4WUYA 3MO5A 3F9WA 2F69A 3VUZA 4J7FA 1N3JA 3SWCA 3M57A 5T0MA 3OXFA 1MVXA 4MI5A 4YNPA 5ARGA 5T5GA 3OXGA 3DB5A 1MT6A 3K5KA 3QWVA 4Z4PA
chains in the Genus database with same CATH topology
2O8JA 3M56A 3OXLA 4QEPA 2G46A 1ML9A 3VV0A 3OPEA 4JDSA 5F59A 3N71A 4YPEA 5ARFA 4QEOA 3KMTA 5EG2A 4AU7A 5KJKA 3TG4A 3OS5A 3M54A 5KJNA 2JV0A 4YPUA 5KJMA 3IHXA 4IJDA 3MO0A 4I51A 3CBPA 3M55A 3KMJA 4JLGA 5CCLA 2R3AA 5EX0A 4FMUA 3EP0A 1H3IA 3RU0A 1ZKKA 4IJ8A 3RAYA 3FPDA 4YNMA 4LDGA 4RZ0A 4MI0A 2QPWA 4O6FA 4QENA 5F5EA 5CCMA 5JIYA 3RIBA 5JINA 4NJ5A 1XQHA 5TH7A 4NVQA 5CPRB 3S7FA 1O9SA 3F9XA 5KJLA 3HNAA 3DALA 3S8PA 3M53A 3F9YA 1PEGA 3KMAA 5T0KA 3PDNA 5TEGA 2W5YA 3S7BA 4YPAA 3RJWA 4O30A 4J7IA 3M5AA 3M58A 2IGQA 4J8OA 3F9ZA 3S7JA 3M59A 3QWPA 5F6KC 5JJ0A 1MVHA 1N6AA 3MEKA 3MO2A 3RQ4A 5LSXA 5TTFA 5F6LA 5AYFA 3SW9A 2W5ZA 5JHNA 4C1QA 1N6CA 4BUPA 4J83A 3CBOA 3TG5A 5EX3A 1MUFA 4YNDA 4H12A 5LSZA 3QWWA 5HQ8A 2BQZA 3CBMA 3OOIA 5HI7A 3BO5A 2RFIA 3S7DA 4E47A 4WUYA 3MO5A 3F9WA 2F69A 3VUZA 4J7FA 1N3JA 3SWCA 3M57A 5T0MA 3OXFA 1MVXA 4MI5A 4YNPA 5ARGA 5T5GA 3OXGA 3DB5A 1MT6A 3K5KA 3QWVA 4Z4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O8J A;  3M56 A;  3OXL A;  4QEP A;  2G46 A;  1ML9 A;  3VV0 A;  3OPE A;  4JDS A;  5F59 A;  3N71 A;  4YPE A;  5ARF A;  4QEO A;  3KMT A;  5EG2 A;  4AU7 A;  5KJK A;  3TG4 A;  3OS5 A;  3M54 A;  5KJN A;  2JV0 A;  4YPU A;  5KJM A;  3IHX A;  4IJD A;  3MO0 A;  4I51 A;  3CBP A;  3M55 A;  3KMJ A;  4JLG A;  5CCL A;  2R3A A;  5EX0 A;  4FMU A;  3EP0 A;  1H3I A;  3RU0 A;  1ZKK A;  4IJ8 A;  3RAY A;  3FPD A;  4YNM A;  4LDG A;  4RZ0 A;  4MI0 A;  2QPW A;  4O6F A;  4QEN A;  5F5E A;  5CCM A;  5JIY A;  3RIB A;  5JIN A;  4NJ5 A;  1XQH A;  5TH7 A;  4NVQ A;  5CPR B;  3S7F A;  1O9S A;  3F9X A;  5KJL A;  3HNA A;  3DAL A;  3S8P A;  3M53 A;  3F9Y A;  1PEG A;  3KMA A;  5T0K A;  3PDN A;  5TEG A;  2W5Y A;  3S7B A;  4YPA A;  3RJW A;  4O30 A;  4J7I A;  3M5A A;  3M58 A;  2IGQ A;  4J8O A;  3F9Z A;  3S7J A;  3M59 A;  3QWP A;  5F6K C;  5JJ0 A;  1MVH A;  1N6A A;  3MEK A;  3MO2 A;  3RQ4 A;  5LSX A;  5TTF A;  5F6L A;  5AYF A;  3SW9 A;  2W5Z A;  5JHN A;  4C1Q A;  1N6C A;  4BUP A;  4J83 A;  3CBO A;  3TG5 A;  5EX3 A;  1MUF A;  4YND A;  4H12 A;  5LSZ A;  3QWW A;  5HQ8 A;  2BQZ A;  3CBM A;  3OOI A;  5HI7 A;  3BO5 A;  2RFI A;  3S7D A;  4E47 A;  4WUY A;  3MO5 A;  3F9W A;  2F69 A;  3VUZ A;  4J7F A;  1N3J A;  3SWC A;  3M57 A;  5T0M A;  3OXF A;  1MVX A;  4MI5 A;  4YNP A;  5ARG A;  5T5G A;  3OXG A;  3DB5 A;  1MT6 A;  3K5K A;  3QWV A;  4Z4P A; 
#chains in the Genus database with same CATH topology
 2O8J A;  3M56 A;  3OXL A;  4QEP A;  2G46 A;  1ML9 A;  3VV0 A;  3OPE A;  4JDS A;  5F59 A;  3N71 A;  4YPE A;  5ARF A;  4QEO A;  3KMT A;  5EG2 A;  4AU7 A;  5KJK A;  3TG4 A;  3OS5 A;  3M54 A;  5KJN A;  2JV0 A;  4YPU A;  5KJM A;  3IHX A;  4IJD A;  3MO0 A;  4I51 A;  3CBP A;  3M55 A;  3KMJ A;  4JLG A;  5CCL A;  2R3A A;  5EX0 A;  4FMU A;  3EP0 A;  1H3I A;  3RU0 A;  1ZKK A;  4IJ8 A;  3RAY A;  3FPD A;  4YNM A;  4LDG A;  4RZ0 A;  4MI0 A;  2QPW A;  4O6F A;  4QEN A;  5F5E A;  5CCM A;  5JIY A;  3RIB A;  5JIN A;  4NJ5 A;  1XQH A;  5TH7 A;  4NVQ A;  5CPR B;  3S7F A;  1O9S A;  3F9X A;  5KJL A;  3HNA A;  3DAL A;  3S8P A;  3M53 A;  3F9Y A;  1PEG A;  3KMA A;  5T0K A;  3PDN A;  5TEG A;  2W5Y A;  3S7B A;  4YPA A;  3RJW A;  4O30 A;  4J7I A;  3M5A A;  3M58 A;  2IGQ A;  4J8O A;  3F9Z A;  3S7J A;  3M59 A;  3QWP A;  5F6K C;  5JJ0 A;  1MVH A;  1N6A A;  3MEK A;  3MO2 A;  3RQ4 A;  5LSX A;  5TTF A;  5F6L A;  5AYF A;  3SW9 A;  2W5Z A;  5JHN A;  4C1Q A;  1N6C A;  4BUP A;  4J83 A;  3CBO A;  3TG5 A;  5EX3 A;  1MUF A;  4YND A;  4H12 A;  5LSZ A;  3QWW A;  5HQ8 A;  2BQZ A;  3CBM A;  3OOI A;  5HI7 A;  3BO5 A;  2RFI A;  3S7D A;  4E47 A;  4WUY A;  3MO5 A;  3F9W A;  2F69 A;  3VUZ A;  4J7F A;  1N3J A;  3SWC A;  3M57 A;  5T0M A;  3OXF A;  1MVX A;  4MI5 A;  4YNP A;  5ARG A;  5T5G A;  3OXG A;  3DB5 A;  1MT6 A;  3K5K A;  3QWV A;  4Z4P A; 
#chains in the Genus database with same CATH homology
 2O8J A;  3M56 A;  3OXL A;  4QEP A;  2G46 A;  1ML9 A;  3VV0 A;  3OPE A;  4JDS A;  5F59 A;  3N71 A;  4YPE A;  5ARF A;  4QEO A;  3KMT A;  5EG2 A;  4AU7 A;  5KJK A;  3TG4 A;  3OS5 A;  3M54 A;  5KJN A;  2JV0 A;  4YPU A;  5KJM A;  3IHX A;  4IJD A;  3MO0 A;  4I51 A;  3CBP A;  3M55 A;  3KMJ A;  4JLG A;  5CCL A;  2R3A A;  5EX0 A;  4FMU A;  3EP0 A;  1H3I A;  3RU0 A;  1ZKK A;  4IJ8 A;  3RAY A;  3FPD A;  4YNM A;  4LDG A;  4RZ0 A;  4MI0 A;  2QPW A;  4O6F A;  4QEN A;  5F5E A;  5CCM A;  5JIY A;  3RIB A;  5JIN A;  4NJ5 A;  1XQH A;  5TH7 A;  4NVQ A;  5CPR B;  3S7F A;  1O9S A;  3F9X A;  5KJL A;  3HNA A;  3DAL A;  3S8P A;  3M53 A;  3F9Y A;  1PEG A;  3KMA A;  5T0K A;  3PDN A;  5TEG A;  2W5Y A;  3S7B A;  4YPA A;  3RJW A;  4O30 A;  4J7I A;  3M5A A;  3M58 A;  2IGQ A;  4J8O A;  3F9Z A;  3S7J A;  3M59 A;  3QWP A;  5F6K C;  5JJ0 A;  1MVH A;  1N6A A;  3MEK A;  3MO2 A;  3RQ4 A;  5LSX A;  5TTF A;  5F6L A;  5AYF A;  3SW9 A;  2W5Z A;  5JHN A;  4C1Q A;  1N6C A;  4BUP A;  4J83 A;  3CBO A;  3TG5 A;  5EX3 A;  1MUF A;  4YND A;  4H12 A;  5LSZ A;  3QWW A;  5HQ8 A;  2BQZ A;  3CBM A;  3OOI A;  5HI7 A;  3BO5 A;  2RFI A;  3S7D A;  4E47 A;  4WUY A;  3MO5 A;  3F9W A;  2F69 A;  3VUZ A;  4J7F A;  1N3J A;  3SWC A;  3M57 A;  5T0M A;  3OXF A;  1MVX A;  4MI5 A;  4YNP A;  5ARG A;  5T5G A;  3OXG A;  3DB5 A;  1MT6 A;  3K5K A;  3QWV A;  4Z4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...