4QEPA

Crystal structure of kryptonite in complex with mchg dna and sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
526
structure length
467
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
total genus 118
structure length 467
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qepA03
4J7FA 4YNPA 3S7FA 4QEPA 2R3AA 4WUYA 5F5EA 1MT6A 5HQ8A 4J8OA 4YPAA 3QWVA 1ML9A 3KMJA 2F69A 4NJ5A 5HI7A 4H12A 4I51A 4Z4PA 1MUFA 2RFIA 5CCLA 3CBPA 3OXGA 3S7DA 1XQHA 3RAYA 5TTFA 3VUZA 5TEGA 3RJWA 3F9ZA 3MO2A 3OOIA 1N6CA 4O30A 3MO5A 3VV0A 3DB5A 3S7JA 3SW9A 3QWPA 3OPEA 1MVHA 5EX0A 5EG2A 1ZKKA 2O8JA 4IJ8A 3TG4A 2IGQA 1O9SA 4IJDA 5T0KA 3S7BA 4MI0A 5KJMA 3SWCA 3M56A 1N3JA 5F59A 4AU7A 3KMTA 3BO5A 3MO0A 5CCMA 3FPDA 4RZ0A 5F6KC 3TG5A 5JHNA 4O6FA 5CPRB 2BQZA 4JLGA 5TH7A 3DALA 4BUPA 5LSXA 3F9XA 4MI5A 4NVQA 5AYFA 3RU0A 1PEGA 3K5KA 4C1QA 3KMAA 3RIBA 3IHXA 5T0MA 3CBOA 5ARFA 4YPEA 3HNAA 3M54A 4YNMA 5JINA 2JV0A 3M53A 5KJNA 3MEKA 2W5YA 1N6AA 4LDGA 5F6LA 5T5GA 1MVXA 2G46A 4QEOA 5JJ0A 3M55A 3QWWA 5KJKA 3N71A 3F9WA 3CBMA 4E47A 4YPUA 3M58A 3RQ4A 2W5ZA 4FMUA 3PDNA 5EX3A 5KJLA 5LSZA 3S8PA 3F9YA 4QENA 3M59A 4J7IA 1H3IA 3M5AA 5ARGA 4YNDA 4J83A 2QPWA 3OXFA 4JDSA 3EP0A 3OS5A 5JIYA 3OXLA 3M57A
chains in the Genus database with same CATH superfamily
4J7FA 4YNPA 3S7FA 4QEPA 2R3AA 4WUYA 5F5EA 1MT6A 5HQ8A 4J8OA 4YPAA 3QWVA 1ML9A 3KMJA 2F69A 4NJ5A 5HI7A 4H12A 4I51A 4Z4PA 1MUFA 2RFIA 5CCLA 3CBPA 3OXGA 3S7DA 1XQHA 3RAYA 5TTFA 3VUZA 5TEGA 3RJWA 3F9ZA 3MO2A 3OOIA 1N6CA 4O30A 3MO5A 3VV0A 3DB5A 3S7JA 3SW9A 3QWPA 3OPEA 1MVHA 5EX0A 5EG2A 1ZKKA 2O8JA 4IJ8A 3TG4A 2IGQA 1O9SA 4IJDA 5T0KA 3S7BA 4MI0A 5KJMA 3SWCA 3M56A 1N3JA 5F59A 4AU7A 3KMTA 3BO5A 3MO0A 5CCMA 3FPDA 4RZ0A 5F6KC 3TG5A 5JHNA 4O6FA 5CPRB 2BQZA 4JLGA 5TH7A 3DALA 4BUPA 5LSXA 3F9XA 4MI5A 4NVQA 5AYFA 3RU0A 1PEGA 3K5KA 4C1QA 3KMAA 3RIBA 3IHXA 5T0MA 3CBOA 5ARFA 4YPEA 3HNAA 3M54A 4YNMA 5JINA 2JV0A 3M53A 5KJNA 3MEKA 2W5YA 1N6AA 4LDGA 5F6LA 5T5GA 1MVXA 2G46A 4QEOA 5JJ0A 3M55A 3QWWA 5KJKA 3N71A 3F9WA 3CBMA 4E47A 4YPUA 3M58A 3RQ4A 2W5ZA 4FMUA 3PDNA 5EX3A 5KJLA 5LSZA 3S8PA 3F9YA 4QENA 3M59A 4J7IA 1H3IA 3M5AA 5ARGA 4YNDA 4J83A 2QPWA 3OXFA 4JDSA 3EP0A 3OS5A 5JIYA 3OXLA 3M57A
chains in the Genus database with same CATH topology
4J7FA 4YNPA 3S7FA 4QEPA 2R3AA 4WUYA 5F5EA 1MT6A 5HQ8A 4J8OA 4YPAA 3QWVA 1ML9A 3KMJA 2F69A 4NJ5A 5HI7A 4H12A 4I51A 4Z4PA 1MUFA 2RFIA 5CCLA 3CBPA 3OXGA 3S7DA 1XQHA 3RAYA 5TTFA 3VUZA 5TEGA 3RJWA 3F9ZA 3MO2A 3OOIA 1N6CA 4O30A 3MO5A 3VV0A 3DB5A 3S7JA 3SW9A 3QWPA 3OPEA 1MVHA 5EX0A 5EG2A 1ZKKA 2O8JA 4IJ8A 3TG4A 2IGQA 1O9SA 4IJDA 5T0KA 3S7BA 4MI0A 5KJMA 3SWCA 3M56A 1N3JA 5F59A 4AU7A 3KMTA 3BO5A 3MO0A 5CCMA 3FPDA 4RZ0A 5F6KC 3TG5A 5JHNA 4O6FA 5CPRB 2BQZA 4JLGA 5TH7A 3DALA 4BUPA 5LSXA 3F9XA 4MI5A 4NVQA 5AYFA 3RU0A 1PEGA 3K5KA 4C1QA 3KMAA 3RIBA 3IHXA 5T0MA 3CBOA 5ARFA 4YPEA 3HNAA 3M54A 4YNMA 5JINA 2JV0A 3M53A 5KJNA 3MEKA 2W5YA 1N6AA 4LDGA 5F6LA 5T5GA 1MVXA 2G46A 4QEOA 5JJ0A 3M55A 3QWWA 5KJKA 3N71A 3F9WA 3CBMA 4E47A 4YPUA 3M58A 3RQ4A 2W5ZA 4FMUA 3PDNA 5EX3A 5KJLA 5LSZA 3S8PA 3F9YA 4QENA 3M59A 4J7IA 1H3IA 3M5AA 5ARGA 4YNDA 4J83A 2QPWA 3OXFA 4JDSA 3EP0A 3OS5A 5JIYA 3OXLA 3M57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7F A;  4YNP A;  3S7F A;  4QEP A;  2R3A A;  4WUY A;  5F5E A;  1MT6 A;  5HQ8 A;  4J8O A;  4YPA A;  3QWV A;  1ML9 A;  3KMJ A;  2F69 A;  4NJ5 A;  5HI7 A;  4H12 A;  4I51 A;  4Z4P A;  1MUF A;  2RFI A;  5CCL A;  3CBP A;  3OXG A;  3S7D A;  1XQH A;  3RAY A;  5TTF A;  3VUZ A;  5TEG A;  3RJW A;  3F9Z A;  3MO2 A;  3OOI A;  1N6C A;  4O30 A;  3MO5 A;  3VV0 A;  3DB5 A;  3S7J A;  3SW9 A;  3QWP A;  3OPE A;  1MVH A;  5EX0 A;  5EG2 A;  1ZKK A;  2O8J A;  4IJ8 A;  3TG4 A;  2IGQ A;  1O9S A;  4IJD A;  5T0K A;  3S7B A;  4MI0 A;  5KJM A;  3SWC A;  3M56 A;  1N3J A;  5F59 A;  4AU7 A;  3KMT A;  3BO5 A;  3MO0 A;  5CCM A;  3FPD A;  4RZ0 A;  5F6K C;  3TG5 A;  5JHN A;  4O6F A;  5CPR B;  2BQZ A;  4JLG A;  5TH7 A;  3DAL A;  4BUP A;  5LSX A;  3F9X A;  4MI5 A;  4NVQ A;  5AYF A;  3RU0 A;  1PEG A;  3K5K A;  4C1Q A;  3KMA A;  3RIB A;  3IHX A;  5T0M A;  3CBO A;  5ARF A;  4YPE A;  3HNA A;  3M54 A;  4YNM A;  5JIN A;  2JV0 A;  3M53 A;  5KJN A;  3MEK A;  2W5Y A;  1N6A A;  4LDG A;  5F6L A;  5T5G A;  1MVX A;  2G46 A;  4QEO A;  5JJ0 A;  3M55 A;  3QWW A;  5KJK A;  3N71 A;  3F9W A;  3CBM A;  4E47 A;  4YPU A;  3M58 A;  3RQ4 A;  2W5Z A;  4FMU A;  3PDN A;  5EX3 A;  5KJL A;  5LSZ A;  3S8P A;  3F9Y A;  4QEN A;  3M59 A;  4J7I A;  1H3I A;  3M5A A;  5ARG A;  4YND A;  4J83 A;  2QPW A;  3OXF A;  4JDS A;  3EP0 A;  3OS5 A;  5JIY A;  3OXL A;  3M57 A; 
#chains in the Genus database with same CATH topology
 4J7F A;  4YNP A;  3S7F A;  4QEP A;  2R3A A;  4WUY A;  5F5E A;  1MT6 A;  5HQ8 A;  4J8O A;  4YPA A;  3QWV A;  1ML9 A;  3KMJ A;  2F69 A;  4NJ5 A;  5HI7 A;  4H12 A;  4I51 A;  4Z4P A;  1MUF A;  2RFI A;  5CCL A;  3CBP A;  3OXG A;  3S7D A;  1XQH A;  3RAY A;  5TTF A;  3VUZ A;  5TEG A;  3RJW A;  3F9Z A;  3MO2 A;  3OOI A;  1N6C A;  4O30 A;  3MO5 A;  3VV0 A;  3DB5 A;  3S7J A;  3SW9 A;  3QWP A;  3OPE A;  1MVH A;  5EX0 A;  5EG2 A;  1ZKK A;  2O8J A;  4IJ8 A;  3TG4 A;  2IGQ A;  1O9S A;  4IJD A;  5T0K A;  3S7B A;  4MI0 A;  5KJM A;  3SWC A;  3M56 A;  1N3J A;  5F59 A;  4AU7 A;  3KMT A;  3BO5 A;  3MO0 A;  5CCM A;  3FPD A;  4RZ0 A;  5F6K C;  3TG5 A;  5JHN A;  4O6F A;  5CPR B;  2BQZ A;  4JLG A;  5TH7 A;  3DAL A;  4BUP A;  5LSX A;  3F9X A;  4MI5 A;  4NVQ A;  5AYF A;  3RU0 A;  1PEG A;  3K5K A;  4C1Q A;  3KMA A;  3RIB A;  3IHX A;  5T0M A;  3CBO A;  5ARF A;  4YPE A;  3HNA A;  3M54 A;  4YNM A;  5JIN A;  2JV0 A;  3M53 A;  5KJN A;  3MEK A;  2W5Y A;  1N6A A;  4LDG A;  5F6L A;  5T5G A;  1MVX A;  2G46 A;  4QEO A;  5JJ0 A;  3M55 A;  3QWW A;  5KJK A;  3N71 A;  3F9W A;  3CBM A;  4E47 A;  4YPU A;  3M58 A;  3RQ4 A;  2W5Z A;  4FMU A;  3PDN A;  5EX3 A;  5KJL A;  5LSZ A;  3S8P A;  3F9Y A;  4QEN A;  3M59 A;  4J7I A;  1H3I A;  3M5A A;  5ARG A;  4YND A;  4J83 A;  2QPW A;  3OXF A;  4JDS A;  3EP0 A;  3OS5 A;  5JIY A;  3OXL A;  3M57 A; 
#chains in the Genus database with same CATH homology
 4J7F A;  4YNP A;  3S7F A;  4QEP A;  2R3A A;  4WUY A;  5F5E A;  1MT6 A;  5HQ8 A;  4J8O A;  4YPA A;  3QWV A;  1ML9 A;  3KMJ A;  2F69 A;  4NJ5 A;  5HI7 A;  4H12 A;  4I51 A;  4Z4P A;  1MUF A;  2RFI A;  5CCL A;  3CBP A;  3OXG A;  3S7D A;  1XQH A;  3RAY A;  5TTF A;  3VUZ A;  5TEG A;  3RJW A;  3F9Z A;  3MO2 A;  3OOI A;  1N6C A;  4O30 A;  3MO5 A;  3VV0 A;  3DB5 A;  3S7J A;  3SW9 A;  3QWP A;  3OPE A;  1MVH A;  5EX0 A;  5EG2 A;  1ZKK A;  2O8J A;  4IJ8 A;  3TG4 A;  2IGQ A;  1O9S A;  4IJD A;  5T0K A;  3S7B A;  4MI0 A;  5KJM A;  3SWC A;  3M56 A;  1N3J A;  5F59 A;  4AU7 A;  3KMT A;  3BO5 A;  3MO0 A;  5CCM A;  3FPD A;  4RZ0 A;  5F6K C;  3TG5 A;  5JHN A;  4O6F A;  5CPR B;  2BQZ A;  4JLG A;  5TH7 A;  3DAL A;  4BUP A;  5LSX A;  3F9X A;  4MI5 A;  4NVQ A;  5AYF A;  3RU0 A;  1PEG A;  3K5K A;  4C1Q A;  3KMA A;  3RIB A;  3IHX A;  5T0M A;  3CBO A;  5ARF A;  4YPE A;  3HNA A;  3M54 A;  4YNM A;  5JIN A;  2JV0 A;  3M53 A;  5KJN A;  3MEK A;  2W5Y A;  1N6A A;  4LDG A;  5F6L A;  5T5G A;  1MVX A;  2G46 A;  4QEO A;  5JJ0 A;  3M55 A;  3QWW A;  5KJK A;  3N71 A;  3F9W A;  3CBM A;  4E47 A;  4YPU A;  3M58 A;  3RQ4 A;  2W5Z A;  4FMU A;  3PDN A;  5EX3 A;  5KJL A;  5LSZ A;  3S8P A;  3F9Y A;  4QEN A;  3M59 A;  4J7I A;  1H3I A;  3M5A A;  5ARG A;  4YND A;  4J83 A;  2QPW A;  3OXF A;  4JDS A;  3EP0 A;  3OS5 A;  5JIY A;  3OXL A;  3M57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...