4QEPA

Crystal structure of kryptonite in complex with mchg dna and sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
526
structure length
467
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
total genus 118
structure length 467
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qepA03
2W5YA 3S7FA 2R3AA 4WUYA 3DB5A 4NVQA 5CCMA 3OXGA 5T0KA 4J8OA 4YPAA 3OS5A 5ARGA 5CPRB 2O8JA 3F9ZA 4IJDA 5F5EA 4JLGA 2JV0A 3MO5A 3M57A 1N6AA 4J7IA 5JIYA 5JHNA 3OPEA 3SW9A 1MVXA 4O30A 3TG4A 4YNMA 5TTFA 5AYFA 1MVHA 3M58A 5HQ8A 3M53A 1MUFA 4FMUA 4BUPA 3OOIA 3KMJA 2F69A 3RAYA 4O6FA 4YNDA 5ARFA 3PDNA 5T0MA 3S8PA 4YNPA 5KJNA 3RU0A 1ZKKA 3F9WA 3M5AA 5EX3A 3BO5A 1PEGA 5EX0A 3RQ4A 5KJKA 4AU7A 4JDSA 3F9XA 3M54A 5TH7A 3S7BA 3OXLA 3FPDA 2G46A 2RFIA 3KMAA 3S7JA 5F6LA 3OXFA 4IJ8A 3EP0A 4E47A 4J83A 4QEPA 4H12A 3N71A 3IHXA 5CCLA 5KJMA 4MI0A 3VV0A 4QENA 4LDGA 3K5KA 4J7FA 3RJWA 5LSZA 3CBPA 5F59A 1XQHA 3KMTA 3M56A 5JJ0A 4Z4PA 5TEGA 4NJ5A 3QWVA 4MI5A 1H3IA 3F9YA 4C1QA 5JINA 4QEOA 4I51A 5LSXA 3CBOA 4YPUA 5HI7A 2W5ZA 3SWCA 3VUZA 3MEKA 5F6KC 3HNAA 3QWPA 5T5GA 3RIBA 4YPEA 2BQZA 5EG2A 3M55A 2IGQA 3TG5A 1ML9A 1N6CA 2QPWA 4RZ0A 3CBMA 3QWWA 3S7DA 1N3JA 5KJLA 3MO0A 3M59A 1MT6A 3MO2A 1O9SA 3DALA
chains in the Genus database with same CATH superfamily
2W5YA 3S7FA 2R3AA 4WUYA 3DB5A 4NVQA 5CCMA 3OXGA 5T0KA 4J8OA 4YPAA 3OS5A 5ARGA 5CPRB 2O8JA 3F9ZA 4IJDA 5F5EA 4JLGA 2JV0A 3MO5A 3M57A 1N6AA 4J7IA 5JIYA 5JHNA 3OPEA 3SW9A 1MVXA 4O30A 3TG4A 4YNMA 5TTFA 5AYFA 1MVHA 3M58A 5HQ8A 3M53A 1MUFA 4FMUA 4BUPA 3OOIA 3KMJA 2F69A 3RAYA 4O6FA 4YNDA 5ARFA 3PDNA 5T0MA 3S8PA 4YNPA 5KJNA 3RU0A 1ZKKA 3F9WA 3M5AA 5EX3A 3BO5A 1PEGA 5EX0A 3RQ4A 5KJKA 4AU7A 4JDSA 3F9XA 3M54A 5TH7A 3S7BA 3OXLA 3FPDA 2G46A 2RFIA 3KMAA 3S7JA 5F6LA 3OXFA 4IJ8A 3EP0A 4E47A 4J83A 4QEPA 4H12A 3N71A 3IHXA 5CCLA 5KJMA 4MI0A 3VV0A 4QENA 4LDGA 3K5KA 4J7FA 3RJWA 5LSZA 3CBPA 5F59A 1XQHA 3KMTA 3M56A 5JJ0A 4Z4PA 5TEGA 4NJ5A 3QWVA 4MI5A 1H3IA 3F9YA 4C1QA 5JINA 4QEOA 4I51A 5LSXA 3CBOA 4YPUA 5HI7A 2W5ZA 3SWCA 3VUZA 3MEKA 5F6KC 3HNAA 3QWPA 5T5GA 3RIBA 4YPEA 2BQZA 5EG2A 3M55A 2IGQA 3TG5A 1ML9A 1N6CA 2QPWA 4RZ0A 3CBMA 3QWWA 3S7DA 1N3JA 5KJLA 3MO0A 3M59A 1MT6A 3MO2A 1O9SA 3DALA
chains in the Genus database with same CATH topology
2W5YA 3S7FA 2R3AA 4WUYA 3DB5A 4NVQA 5CCMA 3OXGA 5T0KA 4J8OA 4YPAA 3OS5A 5ARGA 5CPRB 2O8JA 3F9ZA 4IJDA 5F5EA 4JLGA 2JV0A 3MO5A 3M57A 1N6AA 4J7IA 5JIYA 5JHNA 3OPEA 3SW9A 1MVXA 4O30A 3TG4A 4YNMA 5TTFA 5AYFA 1MVHA 3M58A 5HQ8A 3M53A 1MUFA 4FMUA 4BUPA 3OOIA 3KMJA 2F69A 3RAYA 4O6FA 4YNDA 5ARFA 3PDNA 5T0MA 3S8PA 4YNPA 5KJNA 3RU0A 1ZKKA 3F9WA 3M5AA 5EX3A 3BO5A 1PEGA 5EX0A 3RQ4A 5KJKA 4AU7A 4JDSA 3F9XA 3M54A 5TH7A 3S7BA 3OXLA 3FPDA 2G46A 2RFIA 3KMAA 3S7JA 5F6LA 3OXFA 4IJ8A 3EP0A 4E47A 4J83A 4QEPA 4H12A 3N71A 3IHXA 5CCLA 5KJMA 4MI0A 3VV0A 4QENA 4LDGA 3K5KA 4J7FA 3RJWA 5LSZA 3CBPA 5F59A 1XQHA 3KMTA 3M56A 5JJ0A 4Z4PA 5TEGA 4NJ5A 3QWVA 4MI5A 1H3IA 3F9YA 4C1QA 5JINA 4QEOA 4I51A 5LSXA 3CBOA 4YPUA 5HI7A 2W5ZA 3SWCA 3VUZA 3MEKA 5F6KC 3HNAA 3QWPA 5T5GA 3RIBA 4YPEA 2BQZA 5EG2A 3M55A 2IGQA 3TG5A 1ML9A 1N6CA 2QPWA 4RZ0A 3CBMA 3QWWA 3S7DA 1N3JA 5KJLA 3MO0A 3M59A 1MT6A 3MO2A 1O9SA 3DALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W5Y A;  3S7F A;  2R3A A;  4WUY A;  3DB5 A;  4NVQ A;  5CCM A;  3OXG A;  5T0K A;  4J8O A;  4YPA A;  3OS5 A;  5ARG A;  5CPR B;  2O8J A;  3F9Z A;  4IJD A;  5F5E A;  4JLG A;  2JV0 A;  3MO5 A;  3M57 A;  1N6A A;  4J7I A;  5JIY A;  5JHN A;  3OPE A;  3SW9 A;  1MVX A;  4O30 A;  3TG4 A;  4YNM A;  5TTF A;  5AYF A;  1MVH A;  3M58 A;  5HQ8 A;  3M53 A;  1MUF A;  4FMU A;  4BUP A;  3OOI A;  3KMJ A;  2F69 A;  3RAY A;  4O6F A;  4YND A;  5ARF A;  3PDN A;  5T0M A;  3S8P A;  4YNP A;  5KJN A;  3RU0 A;  1ZKK A;  3F9W A;  3M5A A;  5EX3 A;  3BO5 A;  1PEG A;  5EX0 A;  3RQ4 A;  5KJK A;  4AU7 A;  4JDS A;  3F9X A;  3M54 A;  5TH7 A;  3S7B A;  3OXL A;  3FPD A;  2G46 A;  2RFI A;  3KMA A;  3S7J A;  5F6L A;  3OXF A;  4IJ8 A;  3EP0 A;  4E47 A;  4J83 A;  4QEP A;  4H12 A;  3N71 A;  3IHX A;  5CCL A;  5KJM A;  4MI0 A;  3VV0 A;  4QEN A;  4LDG A;  3K5K A;  4J7F A;  3RJW A;  5LSZ A;  3CBP A;  5F59 A;  1XQH A;  3KMT A;  3M56 A;  5JJ0 A;  4Z4P A;  5TEG A;  4NJ5 A;  3QWV A;  4MI5 A;  1H3I A;  3F9Y A;  4C1Q A;  5JIN A;  4QEO A;  4I51 A;  5LSX A;  3CBO A;  4YPU A;  5HI7 A;  2W5Z A;  3SWC A;  3VUZ A;  3MEK A;  5F6K C;  3HNA A;  3QWP A;  5T5G A;  3RIB A;  4YPE A;  2BQZ A;  5EG2 A;  3M55 A;  2IGQ A;  3TG5 A;  1ML9 A;  1N6C A;  2QPW A;  4RZ0 A;  3CBM A;  3QWW A;  3S7D A;  1N3J A;  5KJL A;  3MO0 A;  3M59 A;  1MT6 A;  3MO2 A;  1O9S A;  3DAL A; 
#chains in the Genus database with same CATH topology
 2W5Y A;  3S7F A;  2R3A A;  4WUY A;  3DB5 A;  4NVQ A;  5CCM A;  3OXG A;  5T0K A;  4J8O A;  4YPA A;  3OS5 A;  5ARG A;  5CPR B;  2O8J A;  3F9Z A;  4IJD A;  5F5E A;  4JLG A;  2JV0 A;  3MO5 A;  3M57 A;  1N6A A;  4J7I A;  5JIY A;  5JHN A;  3OPE A;  3SW9 A;  1MVX A;  4O30 A;  3TG4 A;  4YNM A;  5TTF A;  5AYF A;  1MVH A;  3M58 A;  5HQ8 A;  3M53 A;  1MUF A;  4FMU A;  4BUP A;  3OOI A;  3KMJ A;  2F69 A;  3RAY A;  4O6F A;  4YND A;  5ARF A;  3PDN A;  5T0M A;  3S8P A;  4YNP A;  5KJN A;  3RU0 A;  1ZKK A;  3F9W A;  3M5A A;  5EX3 A;  3BO5 A;  1PEG A;  5EX0 A;  3RQ4 A;  5KJK A;  4AU7 A;  4JDS A;  3F9X A;  3M54 A;  5TH7 A;  3S7B A;  3OXL A;  3FPD A;  2G46 A;  2RFI A;  3KMA A;  3S7J A;  5F6L A;  3OXF A;  4IJ8 A;  3EP0 A;  4E47 A;  4J83 A;  4QEP A;  4H12 A;  3N71 A;  3IHX A;  5CCL A;  5KJM A;  4MI0 A;  3VV0 A;  4QEN A;  4LDG A;  3K5K A;  4J7F A;  3RJW A;  5LSZ A;  3CBP A;  5F59 A;  1XQH A;  3KMT A;  3M56 A;  5JJ0 A;  4Z4P A;  5TEG A;  4NJ5 A;  3QWV A;  4MI5 A;  1H3I A;  3F9Y A;  4C1Q A;  5JIN A;  4QEO A;  4I51 A;  5LSX A;  3CBO A;  4YPU A;  5HI7 A;  2W5Z A;  3SWC A;  3VUZ A;  3MEK A;  5F6K C;  3HNA A;  3QWP A;  5T5G A;  3RIB A;  4YPE A;  2BQZ A;  5EG2 A;  3M55 A;  2IGQ A;  3TG5 A;  1ML9 A;  1N6C A;  2QPW A;  4RZ0 A;  3CBM A;  3QWW A;  3S7D A;  1N3J A;  5KJL A;  3MO0 A;  3M59 A;  1MT6 A;  3MO2 A;  1O9S A;  3DAL A; 
#chains in the Genus database with same CATH homology
 2W5Y A;  3S7F A;  2R3A A;  4WUY A;  3DB5 A;  4NVQ A;  5CCM A;  3OXG A;  5T0K A;  4J8O A;  4YPA A;  3OS5 A;  5ARG A;  5CPR B;  2O8J A;  3F9Z A;  4IJD A;  5F5E A;  4JLG A;  2JV0 A;  3MO5 A;  3M57 A;  1N6A A;  4J7I A;  5JIY A;  5JHN A;  3OPE A;  3SW9 A;  1MVX A;  4O30 A;  3TG4 A;  4YNM A;  5TTF A;  5AYF A;  1MVH A;  3M58 A;  5HQ8 A;  3M53 A;  1MUF A;  4FMU A;  4BUP A;  3OOI A;  3KMJ A;  2F69 A;  3RAY A;  4O6F A;  4YND A;  5ARF A;  3PDN A;  5T0M A;  3S8P A;  4YNP A;  5KJN A;  3RU0 A;  1ZKK A;  3F9W A;  3M5A A;  5EX3 A;  3BO5 A;  1PEG A;  5EX0 A;  3RQ4 A;  5KJK A;  4AU7 A;  4JDS A;  3F9X A;  3M54 A;  5TH7 A;  3S7B A;  3OXL A;  3FPD A;  2G46 A;  2RFI A;  3KMA A;  3S7J A;  5F6L A;  3OXF A;  4IJ8 A;  3EP0 A;  4E47 A;  4J83 A;  4QEP A;  4H12 A;  3N71 A;  3IHX A;  5CCL A;  5KJM A;  4MI0 A;  3VV0 A;  4QEN A;  4LDG A;  3K5K A;  4J7F A;  3RJW A;  5LSZ A;  3CBP A;  5F59 A;  1XQH A;  3KMT A;  3M56 A;  5JJ0 A;  4Z4P A;  5TEG A;  4NJ5 A;  3QWV A;  4MI5 A;  1H3I A;  3F9Y A;  4C1Q A;  5JIN A;  4QEO A;  4I51 A;  5LSX A;  3CBO A;  4YPU A;  5HI7 A;  2W5Z A;  3SWC A;  3VUZ A;  3MEK A;  5F6K C;  3HNA A;  3QWP A;  5T5G A;  3RIB A;  4YPE A;  2BQZ A;  5EG2 A;  3M55 A;  2IGQ A;  3TG5 A;  1ML9 A;  1N6C A;  2QPW A;  4RZ0 A;  3CBM A;  3QWW A;  3S7D A;  1N3J A;  5KJL A;  3MO0 A;  3M59 A;  1MT6 A;  3MO2 A;  1O9S A;  3DAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...