4QEPA

Crystal structure of kryptonite in complex with mchg dna and sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
526
structure length
467
Chain Sequence
LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHKVKQLACYCGALNCRKRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
total genus 118
structure length 467
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qepA03
5TEGA 3RJWA 3OOIA 3MEKA 4NJ5A 3KMAA 5AYFA 1H3IA 5KJLA 3PDNA 3M57A 3N71A 3OXLA 4J7IA 4J7FA 5KJMA 3S7DA 1MVXA 5CPRB 3VUZA 3DB5A 4BUPA 2QPWA 3TG4A 3K5KA 3M55A 4YNDA 3SW9A 3MO0A 3VV0A 5EG2A 5KJNA 5T0MA 1PEGA 3CBPA 3F9ZA 4E47A 1N6AA 2F69A 4YNPA 4AU7A 1N3JA 3KMJA 3M54A 4J83A 1N6CA 3FPDA 3TG5A 3OS5A 3F9XA 5JHNA 5F59A 2G46A 1O9SA 3DALA 2W5ZA 4YNMA 5JIYA 1XQHA 5TH7A 4IJ8A 3OXGA 3RAYA 3RQ4A 3S7BA 4MI0A 3S8PA 2JV0A 5EX3A 5F6LA 4LDGA 3QWPA 3BO5A 3OPEA 4YPUA 5T5GA 4QEPA 1ZKKA 3EP0A 1MUFA 4IJDA 2RFIA 5F5EA 3IHXA 4J8OA 4JLGA 5LSZA 4C1QA 5ARGA 5JINA 4RZ0A 4WUYA 1MVHA 3MO5A 4JDSA 4MI5A 5T0KA 4QEOA 4I51A 5JJ0A 3HNAA 4H12A 5KJKA 3SWCA 3M53A 1ML9A 3OXFA 5LSXA 3M59A 2R3AA 2O8JA 3RIBA 5EX0A 3QWWA 3CBOA 5CCMA 5HI7A 4Z4PA 3RU0A 5CCLA 3F9WA 3KMTA 5ARFA 4O30A 5TTFA 3M58A 4FMUA 2IGQA 5F6KC 3S7JA 1MT6A 5HQ8A 3M56A 4NVQA 4O6FA 2BQZA 2W5YA 3QWVA 3MO2A 4YPEA 3F9YA 4QENA 3CBMA 3M5AA 4YPAA 3S7FA
chains in the Genus database with same CATH superfamily
5TEGA 3RJWA 3OOIA 3MEKA 4NJ5A 3KMAA 5AYFA 1H3IA 5KJLA 3PDNA 3M57A 3N71A 3OXLA 4J7IA 4J7FA 5KJMA 3S7DA 1MVXA 5CPRB 3VUZA 3DB5A 4BUPA 2QPWA 3TG4A 3K5KA 3M55A 4YNDA 3SW9A 3MO0A 3VV0A 5EG2A 5KJNA 5T0MA 1PEGA 3CBPA 3F9ZA 4E47A 1N6AA 2F69A 4YNPA 4AU7A 1N3JA 3KMJA 3M54A 4J83A 1N6CA 3FPDA 3TG5A 3OS5A 3F9XA 5JHNA 5F59A 2G46A 1O9SA 3DALA 2W5ZA 4YNMA 5JIYA 1XQHA 5TH7A 4IJ8A 3OXGA 3RAYA 3RQ4A 3S7BA 4MI0A 3S8PA 2JV0A 5EX3A 5F6LA 4LDGA 3QWPA 3BO5A 3OPEA 4YPUA 5T5GA 4QEPA 1ZKKA 3EP0A 1MUFA 4IJDA 2RFIA 5F5EA 3IHXA 4J8OA 4JLGA 5LSZA 4C1QA 5ARGA 5JINA 4RZ0A 4WUYA 1MVHA 3MO5A 4JDSA 4MI5A 5T0KA 4QEOA 4I51A 5JJ0A 3HNAA 4H12A 5KJKA 3SWCA 3M53A 1ML9A 3OXFA 5LSXA 3M59A 2R3AA 2O8JA 3RIBA 5EX0A 3QWWA 3CBOA 5CCMA 5HI7A 4Z4PA 3RU0A 5CCLA 3F9WA 3KMTA 5ARFA 4O30A 5TTFA 3M58A 4FMUA 2IGQA 5F6KC 3S7JA 1MT6A 5HQ8A 3M56A 4NVQA 4O6FA 2BQZA 2W5YA 3QWVA 3MO2A 4YPEA 3F9YA 4QENA 3CBMA 3M5AA 4YPAA 3S7FA
chains in the Genus database with same CATH topology
5TEGA 3RJWA 3OOIA 3MEKA 4NJ5A 3KMAA 5AYFA 1H3IA 5KJLA 3PDNA 3M57A 3N71A 3OXLA 4J7IA 4J7FA 5KJMA 3S7DA 1MVXA 5CPRB 3VUZA 3DB5A 4BUPA 2QPWA 3TG4A 3K5KA 3M55A 4YNDA 3SW9A 3MO0A 3VV0A 5EG2A 5KJNA 5T0MA 1PEGA 3CBPA 3F9ZA 4E47A 1N6AA 2F69A 4YNPA 4AU7A 1N3JA 3KMJA 3M54A 4J83A 1N6CA 3FPDA 3TG5A 3OS5A 3F9XA 5JHNA 5F59A 2G46A 1O9SA 3DALA 2W5ZA 4YNMA 5JIYA 1XQHA 5TH7A 4IJ8A 3OXGA 3RAYA 3RQ4A 3S7BA 4MI0A 3S8PA 2JV0A 5EX3A 5F6LA 4LDGA 3QWPA 3BO5A 3OPEA 4YPUA 5T5GA 4QEPA 1ZKKA 3EP0A 1MUFA 4IJDA 2RFIA 5F5EA 3IHXA 4J8OA 4JLGA 5LSZA 4C1QA 5ARGA 5JINA 4RZ0A 4WUYA 1MVHA 3MO5A 4JDSA 4MI5A 5T0KA 4QEOA 4I51A 5JJ0A 3HNAA 4H12A 5KJKA 3SWCA 3M53A 1ML9A 3OXFA 5LSXA 3M59A 2R3AA 2O8JA 3RIBA 5EX0A 3QWWA 3CBOA 5CCMA 5HI7A 4Z4PA 3RU0A 5CCLA 3F9WA 3KMTA 5ARFA 4O30A 5TTFA 3M58A 4FMUA 2IGQA 5F6KC 3S7JA 1MT6A 5HQ8A 3M56A 4NVQA 4O6FA 2BQZA 2W5YA 3QWVA 3MO2A 4YPEA 3F9YA 4QENA 3CBMA 3M5AA 4YPAA 3S7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TEG A;  3RJW A;  3OOI A;  3MEK A;  4NJ5 A;  3KMA A;  5AYF A;  1H3I A;  5KJL A;  3PDN A;  3M57 A;  3N71 A;  3OXL A;  4J7I A;  4J7F A;  5KJM A;  3S7D A;  1MVX A;  5CPR B;  3VUZ A;  3DB5 A;  4BUP A;  2QPW A;  3TG4 A;  3K5K A;  3M55 A;  4YND A;  3SW9 A;  3MO0 A;  3VV0 A;  5EG2 A;  5KJN A;  5T0M A;  1PEG A;  3CBP A;  3F9Z A;  4E47 A;  1N6A A;  2F69 A;  4YNP A;  4AU7 A;  1N3J A;  3KMJ A;  3M54 A;  4J83 A;  1N6C A;  3FPD A;  3TG5 A;  3OS5 A;  3F9X A;  5JHN A;  5F59 A;  2G46 A;  1O9S A;  3DAL A;  2W5Z A;  4YNM A;  5JIY A;  1XQH A;  5TH7 A;  4IJ8 A;  3OXG A;  3RAY A;  3RQ4 A;  3S7B A;  4MI0 A;  3S8P A;  2JV0 A;  5EX3 A;  5F6L A;  4LDG A;  3QWP A;  3BO5 A;  3OPE A;  4YPU A;  5T5G A;  4QEP A;  1ZKK A;  3EP0 A;  1MUF A;  4IJD A;  2RFI A;  5F5E A;  3IHX A;  4J8O A;  4JLG A;  5LSZ A;  4C1Q A;  5ARG A;  5JIN A;  4RZ0 A;  4WUY A;  1MVH A;  3MO5 A;  4JDS A;  4MI5 A;  5T0K A;  4QEO A;  4I51 A;  5JJ0 A;  3HNA A;  4H12 A;  5KJK A;  3SWC A;  3M53 A;  1ML9 A;  3OXF A;  5LSX A;  3M59 A;  2R3A A;  2O8J A;  3RIB A;  5EX0 A;  3QWW A;  3CBO A;  5CCM A;  5HI7 A;  4Z4P A;  3RU0 A;  5CCL A;  3F9W A;  3KMT A;  5ARF A;  4O30 A;  5TTF A;  3M58 A;  4FMU A;  2IGQ A;  5F6K C;  3S7J A;  1MT6 A;  5HQ8 A;  3M56 A;  4NVQ A;  4O6F A;  2BQZ A;  2W5Y A;  3QWV A;  3MO2 A;  4YPE A;  3F9Y A;  4QEN A;  3CBM A;  3M5A A;  4YPA A;  3S7F A; 
#chains in the Genus database with same CATH topology
 5TEG A;  3RJW A;  3OOI A;  3MEK A;  4NJ5 A;  3KMA A;  5AYF A;  1H3I A;  5KJL A;  3PDN A;  3M57 A;  3N71 A;  3OXL A;  4J7I A;  4J7F A;  5KJM A;  3S7D A;  1MVX A;  5CPR B;  3VUZ A;  3DB5 A;  4BUP A;  2QPW A;  3TG4 A;  3K5K A;  3M55 A;  4YND A;  3SW9 A;  3MO0 A;  3VV0 A;  5EG2 A;  5KJN A;  5T0M A;  1PEG A;  3CBP A;  3F9Z A;  4E47 A;  1N6A A;  2F69 A;  4YNP A;  4AU7 A;  1N3J A;  3KMJ A;  3M54 A;  4J83 A;  1N6C A;  3FPD A;  3TG5 A;  3OS5 A;  3F9X A;  5JHN A;  5F59 A;  2G46 A;  1O9S A;  3DAL A;  2W5Z A;  4YNM A;  5JIY A;  1XQH A;  5TH7 A;  4IJ8 A;  3OXG A;  3RAY A;  3RQ4 A;  3S7B A;  4MI0 A;  3S8P A;  2JV0 A;  5EX3 A;  5F6L A;  4LDG A;  3QWP A;  3BO5 A;  3OPE A;  4YPU A;  5T5G A;  4QEP A;  1ZKK A;  3EP0 A;  1MUF A;  4IJD A;  2RFI A;  5F5E A;  3IHX A;  4J8O A;  4JLG A;  5LSZ A;  4C1Q A;  5ARG A;  5JIN A;  4RZ0 A;  4WUY A;  1MVH A;  3MO5 A;  4JDS A;  4MI5 A;  5T0K A;  4QEO A;  4I51 A;  5JJ0 A;  3HNA A;  4H12 A;  5KJK A;  3SWC A;  3M53 A;  1ML9 A;  3OXF A;  5LSX A;  3M59 A;  2R3A A;  2O8J A;  3RIB A;  5EX0 A;  3QWW A;  3CBO A;  5CCM A;  5HI7 A;  4Z4P A;  3RU0 A;  5CCL A;  3F9W A;  3KMT A;  5ARF A;  4O30 A;  5TTF A;  3M58 A;  4FMU A;  2IGQ A;  5F6K C;  3S7J A;  1MT6 A;  5HQ8 A;  3M56 A;  4NVQ A;  4O6F A;  2BQZ A;  2W5Y A;  3QWV A;  3MO2 A;  4YPE A;  3F9Y A;  4QEN A;  3CBM A;  3M5A A;  4YPA A;  3S7F A; 
#chains in the Genus database with same CATH homology
 5TEG A;  3RJW A;  3OOI A;  3MEK A;  4NJ5 A;  3KMA A;  5AYF A;  1H3I A;  5KJL A;  3PDN A;  3M57 A;  3N71 A;  3OXL A;  4J7I A;  4J7F A;  5KJM A;  3S7D A;  1MVX A;  5CPR B;  3VUZ A;  3DB5 A;  4BUP A;  2QPW A;  3TG4 A;  3K5K A;  3M55 A;  4YND A;  3SW9 A;  3MO0 A;  3VV0 A;  5EG2 A;  5KJN A;  5T0M A;  1PEG A;  3CBP A;  3F9Z A;  4E47 A;  1N6A A;  2F69 A;  4YNP A;  4AU7 A;  1N3J A;  3KMJ A;  3M54 A;  4J83 A;  1N6C A;  3FPD A;  3TG5 A;  3OS5 A;  3F9X A;  5JHN A;  5F59 A;  2G46 A;  1O9S A;  3DAL A;  2W5Z A;  4YNM A;  5JIY A;  1XQH A;  5TH7 A;  4IJ8 A;  3OXG A;  3RAY A;  3RQ4 A;  3S7B A;  4MI0 A;  3S8P A;  2JV0 A;  5EX3 A;  5F6L A;  4LDG A;  3QWP A;  3BO5 A;  3OPE A;  4YPU A;  5T5G A;  4QEP A;  1ZKK A;  3EP0 A;  1MUF A;  4IJD A;  2RFI A;  5F5E A;  3IHX A;  4J8O A;  4JLG A;  5LSZ A;  4C1Q A;  5ARG A;  5JIN A;  4RZ0 A;  4WUY A;  1MVH A;  3MO5 A;  4JDS A;  4MI5 A;  5T0K A;  4QEO A;  4I51 A;  5JJ0 A;  3HNA A;  4H12 A;  5KJK A;  3SWC A;  3M53 A;  1ML9 A;  3OXF A;  5LSX A;  3M59 A;  2R3A A;  2O8J A;  3RIB A;  5EX0 A;  3QWW A;  3CBO A;  5CCM A;  5HI7 A;  4Z4P A;  3RU0 A;  5CCL A;  3F9W A;  3KMT A;  5ARF A;  4O30 A;  5TTF A;  3M58 A;  4FMU A;  2IGQ A;  5F6K C;  3S7J A;  1MT6 A;  5HQ8 A;  3M56 A;  4NVQ A;  4O6F A;  2BQZ A;  2W5Y A;  3QWV A;  3MO2 A;  4YPE A;  3F9Y A;  4QEN A;  3CBM A;  3M5A A;  4YPA A;  3S7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...