4QEPA

Crystal structure of kryptonite in complex with mchg dna and sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
526
structure length
467
Chain Sequence
b'LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQPELTTDEGLVCEDISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSVHKVKQLACYCGALNCRKRLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
molecule tags Transcription/dna
source organism Arabidopsis thaliana
publication title Mechanism of DNA Methylation-Directed Histone Methylation by KRYPTONITE.
pubmed doi rcsb
total genus 118
structure length 467
sequence length 526
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF02182 SAD_SRA SAD/SRA domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4qepA03
5TH7A 3S8PA 5KJNA 5T0MA 4O6FA 5EX3A 4C1QA 3RIBA 3M58A 3OXGA 4JDSA 4Z4PA 1PEGA 3OOIA 3OPEA 4RZ0A 3MO5A 5KJLA 4J8OA 5HI7A 3RJWA 3OXLA 4YNDA 4IJDA 3S7FA 5JINA 3KMTA 4WUYA 2F69A 3M55A 3OS5A 4YPAA 3M59A 3M53A 3CBMA 3FPDA 5F6LA 5HQ8A 5TEGA 4J7IA 5TTFA 3KMJA 4BUPA 3N71A 5LSXA 3F9ZA 5T5GA 2BQZA 1N6AA 5CCLA 4IJ8A 3QWVA 3M56A 2G46A 3DB5A 1XQHA 3RAYA 3F9XA 1N6CA 5ARGA 4YPEA 3MEKA 1MVHA 5EG2A 3KMAA 3VUZA 5F5EA 1ZKKA 3S7DA 3BO5A 3TG4A 4J83A 3MO0A 5CPRB 4AU7A 1MUFA 2QPWA 3MO2A 4YNMA 3RU0A 5KJMA 3VV0A 4QEOA 1MVXA 1MT6A 3PDNA 2IGQA 4QENA 2W5ZA 3QWWA 3IHXA 1O9SA 5T0KA 5F6KC 4I51A 3S7BA 5KJKA 2O8JA 3QWPA 4YPUA 3RQ4A 3TG5A 3EP0A 3OXFA 3S7JA 2R3AA 4E47A 5AYFA 4YNPA 3HNAA 4JLGA 4MI5A 3M5AA 1H3IA 3SW9A 5EX0A 5JHNA 4NJ5A 4NVQA 3DALA 3CBOA 3F9WA 4MI0A 1N3JA 2JV0A 5LSZA 3M57A 5JJ0A 4LDGA 2W5YA 3M54A 5CCMA 4QEPA 3F9YA 3SWCA 1ML9A 5F59A 4O30A 4H12A 3K5KA 5ARFA 5JIYA 2RFIA 4FMUA 3CBPA 4J7FA
chains in the Genus database with same CATH superfamily
5TH7A 3S8PA 5KJNA 5T0MA 4O6FA 5EX3A 4C1QA 3RIBA 3M58A 3OXGA 4JDSA 4Z4PA 1PEGA 3OOIA 3OPEA 4RZ0A 3MO5A 5KJLA 4J8OA 5HI7A 3RJWA 3OXLA 4YNDA 4IJDA 3S7FA 5JINA 3KMTA 4WUYA 2F69A 3M55A 3OS5A 4YPAA 3M59A 3M53A 3CBMA 3FPDA 5F6LA 5HQ8A 5TEGA 4J7IA 5TTFA 3KMJA 4BUPA 3N71A 5LSXA 3F9ZA 5T5GA 2BQZA 1N6AA 5CCLA 4IJ8A 3QWVA 3M56A 2G46A 3DB5A 1XQHA 3RAYA 3F9XA 1N6CA 5ARGA 4YPEA 3MEKA 1MVHA 5EG2A 3KMAA 3VUZA 5F5EA 1ZKKA 3S7DA 3BO5A 3TG4A 4J83A 3MO0A 5CPRB 4AU7A 1MUFA 2QPWA 3MO2A 4YNMA 3RU0A 5KJMA 3VV0A 4QEOA 1MVXA 1MT6A 3PDNA 2IGQA 4QENA 2W5ZA 3QWWA 3IHXA 1O9SA 5T0KA 5F6KC 4I51A 3S7BA 5KJKA 2O8JA 3QWPA 4YPUA 3RQ4A 3TG5A 3EP0A 3OXFA 3S7JA 2R3AA 4E47A 5AYFA 4YNPA 3HNAA 4JLGA 4MI5A 3M5AA 1H3IA 3SW9A 5EX0A 5JHNA 4NJ5A 4NVQA 3DALA 3CBOA 3F9WA 4MI0A 1N3JA 2JV0A 5LSZA 3M57A 5JJ0A 4LDGA 2W5YA 3M54A 5CCMA 4QEPA 3F9YA 3SWCA 1ML9A 5F59A 4O30A 4H12A 3K5KA 5ARFA 5JIYA 2RFIA 4FMUA 3CBPA 4J7FA
chains in the Genus database with same CATH topology
5TH7A 3S8PA 5KJNA 5T0MA 4O6FA 5EX3A 4C1QA 3RIBA 3M58A 3OXGA 4JDSA 4Z4PA 1PEGA 3OOIA 3OPEA 4RZ0A 3MO5A 5KJLA 4J8OA 5HI7A 3RJWA 3OXLA 4YNDA 4IJDA 3S7FA 5JINA 3KMTA 4WUYA 2F69A 3M55A 3OS5A 4YPAA 3M59A 3M53A 3CBMA 3FPDA 5F6LA 5HQ8A 5TEGA 4J7IA 5TTFA 3KMJA 4BUPA 3N71A 5LSXA 3F9ZA 5T5GA 2BQZA 1N6AA 5CCLA 4IJ8A 3QWVA 3M56A 2G46A 3DB5A 1XQHA 3RAYA 3F9XA 1N6CA 5ARGA 4YPEA 3MEKA 1MVHA 5EG2A 3KMAA 3VUZA 5F5EA 1ZKKA 3S7DA 3BO5A 3TG4A 4J83A 3MO0A 5CPRB 4AU7A 1MUFA 2QPWA 3MO2A 4YNMA 3RU0A 5KJMA 3VV0A 4QEOA 1MVXA 1MT6A 3PDNA 2IGQA 4QENA 2W5ZA 3QWWA 3IHXA 1O9SA 5T0KA 5F6KC 4I51A 3S7BA 5KJKA 2O8JA 3QWPA 4YPUA 3RQ4A 3TG5A 3EP0A 3OXFA 3S7JA 2R3AA 4E47A 5AYFA 4YNPA 3HNAA 4JLGA 4MI5A 3M5AA 1H3IA 3SW9A 5EX0A 5JHNA 4NJ5A 4NVQA 3DALA 3CBOA 3F9WA 4MI0A 1N3JA 2JV0A 5LSZA 3M57A 5JJ0A 4LDGA 2W5YA 3M54A 5CCMA 4QEPA 3F9YA 3SWCA 1ML9A 5F59A 4O30A 4H12A 3K5KA 5ARFA 5JIYA 2RFIA 4FMUA 3CBPA 4J7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TH7 A;  3S8P A;  5KJN A;  5T0M A;  4O6F A;  5EX3 A;  4C1Q A;  3RIB A;  3M58 A;  3OXG A;  4JDS A;  4Z4P A;  1PEG A;  3OOI A;  3OPE A;  4RZ0 A;  3MO5 A;  5KJL A;  4J8O A;  5HI7 A;  3RJW A;  3OXL A;  4YND A;  4IJD A;  3S7F A;  5JIN A;  3KMT A;  4WUY A;  2F69 A;  3M55 A;  3OS5 A;  4YPA A;  3M59 A;  3M53 A;  3CBM A;  3FPD A;  5F6L A;  5HQ8 A;  5TEG A;  4J7I A;  5TTF A;  3KMJ A;  4BUP A;  3N71 A;  5LSX A;  3F9Z A;  5T5G A;  2BQZ A;  1N6A A;  5CCL A;  4IJ8 A;  3QWV A;  3M56 A;  2G46 A;  3DB5 A;  1XQH A;  3RAY A;  3F9X A;  1N6C A;  5ARG A;  4YPE A;  3MEK A;  1MVH A;  5EG2 A;  3KMA A;  3VUZ A;  5F5E A;  1ZKK A;  3S7D A;  3BO5 A;  3TG4 A;  4J83 A;  3MO0 A;  5CPR B;  4AU7 A;  1MUF A;  2QPW A;  3MO2 A;  4YNM A;  3RU0 A;  5KJM A;  3VV0 A;  4QEO A;  1MVX A;  1MT6 A;  3PDN A;  2IGQ A;  4QEN A;  2W5Z A;  3QWW A;  3IHX A;  1O9S A;  5T0K A;  5F6K C;  4I51 A;  3S7B A;  5KJK A;  2O8J A;  3QWP A;  4YPU A;  3RQ4 A;  3TG5 A;  3EP0 A;  3OXF A;  3S7J A;  2R3A A;  4E47 A;  5AYF A;  4YNP A;  3HNA A;  4JLG A;  4MI5 A;  3M5A A;  1H3I A;  3SW9 A;  5EX0 A;  5JHN A;  4NJ5 A;  4NVQ A;  3DAL A;  3CBO A;  3F9W A;  4MI0 A;  1N3J A;  2JV0 A;  5LSZ A;  3M57 A;  5JJ0 A;  4LDG A;  2W5Y A;  3M54 A;  5CCM A;  4QEP A;  3F9Y A;  3SWC A;  1ML9 A;  5F59 A;  4O30 A;  4H12 A;  3K5K A;  5ARF A;  5JIY A;  2RFI A;  4FMU A;  3CBP A;  4J7F A; 
#chains in the Genus database with same CATH topology
 5TH7 A;  3S8P A;  5KJN A;  5T0M A;  4O6F A;  5EX3 A;  4C1Q A;  3RIB A;  3M58 A;  3OXG A;  4JDS A;  4Z4P A;  1PEG A;  3OOI A;  3OPE A;  4RZ0 A;  3MO5 A;  5KJL A;  4J8O A;  5HI7 A;  3RJW A;  3OXL A;  4YND A;  4IJD A;  3S7F A;  5JIN A;  3KMT A;  4WUY A;  2F69 A;  3M55 A;  3OS5 A;  4YPA A;  3M59 A;  3M53 A;  3CBM A;  3FPD A;  5F6L A;  5HQ8 A;  5TEG A;  4J7I A;  5TTF A;  3KMJ A;  4BUP A;  3N71 A;  5LSX A;  3F9Z A;  5T5G A;  2BQZ A;  1N6A A;  5CCL A;  4IJ8 A;  3QWV A;  3M56 A;  2G46 A;  3DB5 A;  1XQH A;  3RAY A;  3F9X A;  1N6C A;  5ARG A;  4YPE A;  3MEK A;  1MVH A;  5EG2 A;  3KMA A;  3VUZ A;  5F5E A;  1ZKK A;  3S7D A;  3BO5 A;  3TG4 A;  4J83 A;  3MO0 A;  5CPR B;  4AU7 A;  1MUF A;  2QPW A;  3MO2 A;  4YNM A;  3RU0 A;  5KJM A;  3VV0 A;  4QEO A;  1MVX A;  1MT6 A;  3PDN A;  2IGQ A;  4QEN A;  2W5Z A;  3QWW A;  3IHX A;  1O9S A;  5T0K A;  5F6K C;  4I51 A;  3S7B A;  5KJK A;  2O8J A;  3QWP A;  4YPU A;  3RQ4 A;  3TG5 A;  3EP0 A;  3OXF A;  3S7J A;  2R3A A;  4E47 A;  5AYF A;  4YNP A;  3HNA A;  4JLG A;  4MI5 A;  3M5A A;  1H3I A;  3SW9 A;  5EX0 A;  5JHN A;  4NJ5 A;  4NVQ A;  3DAL A;  3CBO A;  3F9W A;  4MI0 A;  1N3J A;  2JV0 A;  5LSZ A;  3M57 A;  5JJ0 A;  4LDG A;  2W5Y A;  3M54 A;  5CCM A;  4QEP A;  3F9Y A;  3SWC A;  1ML9 A;  5F59 A;  4O30 A;  4H12 A;  3K5K A;  5ARF A;  5JIY A;  2RFI A;  4FMU A;  3CBP A;  4J7F A; 
#chains in the Genus database with same CATH homology
 5TH7 A;  3S8P A;  5KJN A;  5T0M A;  4O6F A;  5EX3 A;  4C1Q A;  3RIB A;  3M58 A;  3OXG A;  4JDS A;  4Z4P A;  1PEG A;  3OOI A;  3OPE A;  4RZ0 A;  3MO5 A;  5KJL A;  4J8O A;  5HI7 A;  3RJW A;  3OXL A;  4YND A;  4IJD A;  3S7F A;  5JIN A;  3KMT A;  4WUY A;  2F69 A;  3M55 A;  3OS5 A;  4YPA A;  3M59 A;  3M53 A;  3CBM A;  3FPD A;  5F6L A;  5HQ8 A;  5TEG A;  4J7I A;  5TTF A;  3KMJ A;  4BUP A;  3N71 A;  5LSX A;  3F9Z A;  5T5G A;  2BQZ A;  1N6A A;  5CCL A;  4IJ8 A;  3QWV A;  3M56 A;  2G46 A;  3DB5 A;  1XQH A;  3RAY A;  3F9X A;  1N6C A;  5ARG A;  4YPE A;  3MEK A;  1MVH A;  5EG2 A;  3KMA A;  3VUZ A;  5F5E A;  1ZKK A;  3S7D A;  3BO5 A;  3TG4 A;  4J83 A;  3MO0 A;  5CPR B;  4AU7 A;  1MUF A;  2QPW A;  3MO2 A;  4YNM A;  3RU0 A;  5KJM A;  3VV0 A;  4QEO A;  1MVX A;  1MT6 A;  3PDN A;  2IGQ A;  4QEN A;  2W5Z A;  3QWW A;  3IHX A;  1O9S A;  5T0K A;  5F6K C;  4I51 A;  3S7B A;  5KJK A;  2O8J A;  3QWP A;  4YPU A;  3RQ4 A;  3TG5 A;  3EP0 A;  3OXF A;  3S7J A;  2R3A A;  4E47 A;  5AYF A;  4YNP A;  3HNA A;  4JLG A;  4MI5 A;  3M5A A;  1H3I A;  3SW9 A;  5EX0 A;  5JHN A;  4NJ5 A;  4NVQ A;  3DAL A;  3CBO A;  3F9W A;  4MI0 A;  1N3J A;  2JV0 A;  5LSZ A;  3M57 A;  5JJ0 A;  4LDG A;  2W5Y A;  3M54 A;  5CCM A;  4QEP A;  3F9Y A;  3SWC A;  1ML9 A;  5F59 A;  4O30 A;  4H12 A;  3K5K A;  5ARF A;  5JIY A;  2RFI A;  4FMU A;  3CBP A;  4J7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...