4IJ8A

Crystal structure of the complex of setd8 with sam
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the complex of SETD8 with SAM
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SETD8
total genus 44
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ij8A00
3DB5A 3F9XA 2R3AA 3RAYA 3MEKA 4JLGA 3CBMA 3M53A 5LSXA 3M58A 2G46A 2RFIA 2JV0A 1ZKKA 3DALA 3S7FA 3M5AA 5ARFA 3MO2A 3N71A 5CCLA 3OS5A 4FMUA 3RU0A 4J8OA 4NVQA 4YPUA 1PEGA 1N6CA 5JIYA 5TH7A 3F9ZA 3M57A 3OOIA 4IJDA 3IHXA 5EG2A 5T0KA 3K5KA 5F5EA 4BUPA 3VUZA 3CBPA 3F9YA 5TTFA 3VV0A 1MT6A 1N3JA 3RQ4A 4LDGA 4IJ8A 5TEGA 3OXLA 5KJKA 4J7FA 3MO0A 4O30A 4C1QA 5T5GA 3F9WA 5KJNA 5LSZA 3OXFA 3S8PA 1XQHA 5EX3A 3EP0A 4I51A 4H12A 3HNAA 4Z4PA 5HI7A 5F6LA 5HQ8A 5F59A 4QEOA 1O9SA 2BQZA 3TG4A 4YPAA 4J83A 3S7JA 2F69A 5T0MA 3M54A 4NJ5A 5JHNA 3M56A 4AU7A 5JINA 4MI0A 3S7BA 5KJMA 4RZ0A 5KJLA 3RJWA 1MVXA 3MO5A 2QPWA 3KMTA 4YNMA 5ARGA 3KMAA 1N6AA 5CCMA 3TG5A 1MUFA 4QEPA 3SWCA 3QWPA 3S7DA 1H3IA 4J7IA 4JDSA 4E47A 3OPEA 2IGQA 5JJ0A 3CBOA 4YNDA 3SW9A 3QWVA 4YPEA 5AYFA 4QENA 3RIBA 4YNPA 2O8JA 2W5ZA 3M55A 1MVHA 3BO5A 5CPRB 3M59A 3OXGA 5F6KC 3QWWA 5EX0A 2W5YA 3FPDA 4WUYA 1ML9A 3KMJA 4MI5A 4O6FA 3PDNA
chains in the Genus database with same CATH superfamily
3DB5A 3F9XA 2R3AA 3RAYA 3MEKA 4JLGA 3CBMA 3M53A 5LSXA 3M58A 2G46A 2RFIA 2JV0A 1ZKKA 3DALA 3S7FA 3M5AA 5ARFA 3MO2A 3N71A 5CCLA 3OS5A 4FMUA 3RU0A 4J8OA 4NVQA 4YPUA 1PEGA 1N6CA 5JIYA 5TH7A 3F9ZA 3M57A 3OOIA 4IJDA 3IHXA 5EG2A 5T0KA 3K5KA 5F5EA 4BUPA 3VUZA 3CBPA 3F9YA 5TTFA 3VV0A 1MT6A 1N3JA 3RQ4A 4LDGA 4IJ8A 5TEGA 3OXLA 5KJKA 4J7FA 3MO0A 4O30A 4C1QA 5T5GA 3F9WA 5KJNA 5LSZA 3OXFA 3S8PA 1XQHA 5EX3A 3EP0A 4I51A 4H12A 3HNAA 4Z4PA 5HI7A 5F6LA 5HQ8A 5F59A 4QEOA 1O9SA 2BQZA 3TG4A 4YPAA 4J83A 3S7JA 2F69A 5T0MA 3M54A 4NJ5A 5JHNA 3M56A 4AU7A 5JINA 4MI0A 3S7BA 5KJMA 4RZ0A 5KJLA 3RJWA 1MVXA 3MO5A 2QPWA 3KMTA 4YNMA 5ARGA 3KMAA 1N6AA 5CCMA 3TG5A 1MUFA 4QEPA 3SWCA 3QWPA 3S7DA 1H3IA 4J7IA 4JDSA 4E47A 3OPEA 2IGQA 5JJ0A 3CBOA 4YNDA 3SW9A 3QWVA 4YPEA 5AYFA 4QENA 3RIBA 4YNPA 2O8JA 2W5ZA 3M55A 1MVHA 3BO5A 5CPRB 3M59A 3OXGA 5F6KC 3QWWA 5EX0A 2W5YA 3FPDA 4WUYA 1ML9A 3KMJA 4MI5A 4O6FA 3PDNA
chains in the Genus database with same CATH topology
3DB5A 3F9XA 2R3AA 3RAYA 3MEKA 4JLGA 3CBMA 3M53A 5LSXA 3M58A 2G46A 2RFIA 2JV0A 1ZKKA 3DALA 3S7FA 3M5AA 5ARFA 3MO2A 3N71A 5CCLA 3OS5A 4FMUA 3RU0A 4J8OA 4NVQA 4YPUA 1PEGA 1N6CA 5JIYA 5TH7A 3F9ZA 3M57A 3OOIA 4IJDA 3IHXA 5EG2A 5T0KA 3K5KA 5F5EA 4BUPA 3VUZA 3CBPA 3F9YA 5TTFA 3VV0A 1MT6A 1N3JA 3RQ4A 4LDGA 4IJ8A 5TEGA 3OXLA 5KJKA 4J7FA 3MO0A 4O30A 4C1QA 5T5GA 3F9WA 5KJNA 5LSZA 3OXFA 3S8PA 1XQHA 5EX3A 3EP0A 4I51A 4H12A 3HNAA 4Z4PA 5HI7A 5F6LA 5HQ8A 5F59A 4QEOA 1O9SA 2BQZA 3TG4A 4YPAA 4J83A 3S7JA 2F69A 5T0MA 3M54A 4NJ5A 5JHNA 3M56A 4AU7A 5JINA 4MI0A 3S7BA 5KJMA 4RZ0A 5KJLA 3RJWA 1MVXA 3MO5A 2QPWA 3KMTA 4YNMA 5ARGA 3KMAA 1N6AA 5CCMA 3TG5A 1MUFA 4QEPA 3SWCA 3QWPA 3S7DA 1H3IA 4J7IA 4JDSA 4E47A 3OPEA 2IGQA 5JJ0A 3CBOA 4YNDA 3SW9A 3QWVA 4YPEA 5AYFA 4QENA 3RIBA 4YNPA 2O8JA 2W5ZA 3M55A 1MVHA 3BO5A 5CPRB 3M59A 3OXGA 5F6KC 3QWWA 5EX0A 2W5YA 3FPDA 4WUYA 1ML9A 3KMJA 4MI5A 4O6FA 3PDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB5 A;  3F9X A;  2R3A A;  3RAY A;  3MEK A;  4JLG A;  3CBM A;  3M53 A;  5LSX A;  3M58 A;  2G46 A;  2RFI A;  2JV0 A;  1ZKK A;  3DAL A;  3S7F A;  3M5A A;  5ARF A;  3MO2 A;  3N71 A;  5CCL A;  3OS5 A;  4FMU A;  3RU0 A;  4J8O A;  4NVQ A;  4YPU A;  1PEG A;  1N6C A;  5JIY A;  5TH7 A;  3F9Z A;  3M57 A;  3OOI A;  4IJD A;  3IHX A;  5EG2 A;  5T0K A;  3K5K A;  5F5E A;  4BUP A;  3VUZ A;  3CBP A;  3F9Y A;  5TTF A;  3VV0 A;  1MT6 A;  1N3J A;  3RQ4 A;  4LDG A;  4IJ8 A;  5TEG A;  3OXL A;  5KJK A;  4J7F A;  3MO0 A;  4O30 A;  4C1Q A;  5T5G A;  3F9W A;  5KJN A;  5LSZ A;  3OXF A;  3S8P A;  1XQH A;  5EX3 A;  3EP0 A;  4I51 A;  4H12 A;  3HNA A;  4Z4P A;  5HI7 A;  5F6L A;  5HQ8 A;  5F59 A;  4QEO A;  1O9S A;  2BQZ A;  3TG4 A;  4YPA A;  4J83 A;  3S7J A;  2F69 A;  5T0M A;  3M54 A;  4NJ5 A;  5JHN A;  3M56 A;  4AU7 A;  5JIN A;  4MI0 A;  3S7B A;  5KJM A;  4RZ0 A;  5KJL A;  3RJW A;  1MVX A;  3MO5 A;  2QPW A;  3KMT A;  4YNM A;  5ARG A;  3KMA A;  1N6A A;  5CCM A;  3TG5 A;  1MUF A;  4QEP A;  3SWC A;  3QWP A;  3S7D A;  1H3I A;  4J7I A;  4JDS A;  4E47 A;  3OPE A;  2IGQ A;  5JJ0 A;  3CBO A;  4YND A;  3SW9 A;  3QWV A;  4YPE A;  5AYF A;  4QEN A;  3RIB A;  4YNP A;  2O8J A;  2W5Z A;  3M55 A;  1MVH A;  3BO5 A;  5CPR B;  3M59 A;  3OXG A;  5F6K C;  3QWW A;  5EX0 A;  2W5Y A;  3FPD A;  4WUY A;  1ML9 A;  3KMJ A;  4MI5 A;  4O6F A;  3PDN A; 
#chains in the Genus database with same CATH topology
 3DB5 A;  3F9X A;  2R3A A;  3RAY A;  3MEK A;  4JLG A;  3CBM A;  3M53 A;  5LSX A;  3M58 A;  2G46 A;  2RFI A;  2JV0 A;  1ZKK A;  3DAL A;  3S7F A;  3M5A A;  5ARF A;  3MO2 A;  3N71 A;  5CCL A;  3OS5 A;  4FMU A;  3RU0 A;  4J8O A;  4NVQ A;  4YPU A;  1PEG A;  1N6C A;  5JIY A;  5TH7 A;  3F9Z A;  3M57 A;  3OOI A;  4IJD A;  3IHX A;  5EG2 A;  5T0K A;  3K5K A;  5F5E A;  4BUP A;  3VUZ A;  3CBP A;  3F9Y A;  5TTF A;  3VV0 A;  1MT6 A;  1N3J A;  3RQ4 A;  4LDG A;  4IJ8 A;  5TEG A;  3OXL A;  5KJK A;  4J7F A;  3MO0 A;  4O30 A;  4C1Q A;  5T5G A;  3F9W A;  5KJN A;  5LSZ A;  3OXF A;  3S8P A;  1XQH A;  5EX3 A;  3EP0 A;  4I51 A;  4H12 A;  3HNA A;  4Z4P A;  5HI7 A;  5F6L A;  5HQ8 A;  5F59 A;  4QEO A;  1O9S A;  2BQZ A;  3TG4 A;  4YPA A;  4J83 A;  3S7J A;  2F69 A;  5T0M A;  3M54 A;  4NJ5 A;  5JHN A;  3M56 A;  4AU7 A;  5JIN A;  4MI0 A;  3S7B A;  5KJM A;  4RZ0 A;  5KJL A;  3RJW A;  1MVX A;  3MO5 A;  2QPW A;  3KMT A;  4YNM A;  5ARG A;  3KMA A;  1N6A A;  5CCM A;  3TG5 A;  1MUF A;  4QEP A;  3SWC A;  3QWP A;  3S7D A;  1H3I A;  4J7I A;  4JDS A;  4E47 A;  3OPE A;  2IGQ A;  5JJ0 A;  3CBO A;  4YND A;  3SW9 A;  3QWV A;  4YPE A;  5AYF A;  4QEN A;  3RIB A;  4YNP A;  2O8J A;  2W5Z A;  3M55 A;  1MVH A;  3BO5 A;  5CPR B;  3M59 A;  3OXG A;  5F6K C;  3QWW A;  5EX0 A;  2W5Y A;  3FPD A;  4WUY A;  1ML9 A;  3KMJ A;  4MI5 A;  4O6F A;  3PDN A; 
#chains in the Genus database with same CATH homology
 3DB5 A;  3F9X A;  2R3A A;  3RAY A;  3MEK A;  4JLG A;  3CBM A;  3M53 A;  5LSX A;  3M58 A;  2G46 A;  2RFI A;  2JV0 A;  1ZKK A;  3DAL A;  3S7F A;  3M5A A;  5ARF A;  3MO2 A;  3N71 A;  5CCL A;  3OS5 A;  4FMU A;  3RU0 A;  4J8O A;  4NVQ A;  4YPU A;  1PEG A;  1N6C A;  5JIY A;  5TH7 A;  3F9Z A;  3M57 A;  3OOI A;  4IJD A;  3IHX A;  5EG2 A;  5T0K A;  3K5K A;  5F5E A;  4BUP A;  3VUZ A;  3CBP A;  3F9Y A;  5TTF A;  3VV0 A;  1MT6 A;  1N3J A;  3RQ4 A;  4LDG A;  4IJ8 A;  5TEG A;  3OXL A;  5KJK A;  4J7F A;  3MO0 A;  4O30 A;  4C1Q A;  5T5G A;  3F9W A;  5KJN A;  5LSZ A;  3OXF A;  3S8P A;  1XQH A;  5EX3 A;  3EP0 A;  4I51 A;  4H12 A;  3HNA A;  4Z4P A;  5HI7 A;  5F6L A;  5HQ8 A;  5F59 A;  4QEO A;  1O9S A;  2BQZ A;  3TG4 A;  4YPA A;  4J83 A;  3S7J A;  2F69 A;  5T0M A;  3M54 A;  4NJ5 A;  5JHN A;  3M56 A;  4AU7 A;  5JIN A;  4MI0 A;  3S7B A;  5KJM A;  4RZ0 A;  5KJL A;  3RJW A;  1MVX A;  3MO5 A;  2QPW A;  3KMT A;  4YNM A;  5ARG A;  3KMA A;  1N6A A;  5CCM A;  3TG5 A;  1MUF A;  4QEP A;  3SWC A;  3QWP A;  3S7D A;  1H3I A;  4J7I A;  4JDS A;  4E47 A;  3OPE A;  2IGQ A;  5JJ0 A;  3CBO A;  4YND A;  3SW9 A;  3QWV A;  4YPE A;  5AYF A;  4QEN A;  3RIB A;  4YNP A;  2O8J A;  2W5Z A;  3M55 A;  1MVH A;  3BO5 A;  5CPR B;  3M59 A;  3OXG A;  5F6K C;  3QWW A;  5EX0 A;  2W5Y A;  3FPD A;  4WUY A;  1ML9 A;  3KMJ A;  4MI5 A;  4O6F A;  3PDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...