4IJ8A

Crystal structure of the complex of setd8 with sam
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
b'RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-lysine methyltransferase SETD8
publication title Crystal structure of the complex of SETD8 with SAM
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 44
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ij8A00
4YNPA 4J7IA 5LSXA 4Z4PA 3F9WA 4J7FA 3M57A 3RQ4A 3KMTA 4RZ0A 3SWCA 3CBMA 3HNAA 4YPUA 5AYFA 2G46A 3M58A 3EP0A 3F9YA 4IJ8A 2RFIA 3K5KA 3S8PA 4YNDA 3KMJA 5T0KA 2F69A 3S7DA 3FPDA 3OPEA 3M56A 3QWPA 4WUYA 5JINA 3F9XA 3OXGA 5EG2A 4AU7A 4J8OA 1N3JA 3M5AA 3OXFA 3MEKA 5LSZA 2QPWA 3S7BA 5CPRB 1O9SA 3QWVA 3VUZA 4QENA 1PEGA 2R3AA 5TEGA 1N6CA 5TH7A 5EX0A 3OS5A 4BUPA 5ARFA 5JHNA 5HI7A 3F9ZA 4YPAA 3MO5A 3VV0A 4YNMA 5T0MA 3PDNA 1MUFA 5F6KC 1ZKKA 1N6AA 3TG5A 4FMUA 3M59A 3M54A 5F5EA 4E47A 3RAYA 5TTFA 2JV0A 3DALA 3CBPA 3S7FA 3S7JA 3IHXA 5KJNA 4MI0A 1H3IA 3OOIA 2W5YA 2O8JA 4C1QA 1MT6A 3KMAA 3OXLA 3RIBA 3N71A 3TG4A 1MVXA 4J83A 4IJDA 3QWWA 5KJKA 2W5ZA 5JIYA 5CCLA 4H12A 5T5GA 2IGQA 3SW9A 4LDGA 5KJLA 4I51A 5KJMA 3M53A 3RU0A 3CBOA 3MO2A 4YPEA 3M55A 5F6LA 4MI5A 5ARGA 4QEPA 5JJ0A 3BO5A 4QEOA 3MO0A 5F59A 1ML9A 2BQZA 4O30A 3RJWA 4NJ5A 5EX3A 3DB5A 1XQHA 4JDSA 5CCMA 5HQ8A 4NVQA 1MVHA 4JLGA 4O6FA
chains in the Genus database with same CATH superfamily
4YNPA 4J7IA 5LSXA 4Z4PA 3F9WA 4J7FA 3M57A 3RQ4A 3KMTA 4RZ0A 3SWCA 3CBMA 3HNAA 4YPUA 5AYFA 2G46A 3M58A 3EP0A 3F9YA 4IJ8A 2RFIA 3K5KA 3S8PA 4YNDA 3KMJA 5T0KA 2F69A 3S7DA 3FPDA 3OPEA 3M56A 3QWPA 4WUYA 5JINA 3F9XA 3OXGA 5EG2A 4AU7A 4J8OA 1N3JA 3M5AA 3OXFA 3MEKA 5LSZA 2QPWA 3S7BA 5CPRB 1O9SA 3QWVA 3VUZA 4QENA 1PEGA 2R3AA 5TEGA 1N6CA 5TH7A 5EX0A 3OS5A 4BUPA 5ARFA 5JHNA 5HI7A 3F9ZA 4YPAA 3MO5A 3VV0A 4YNMA 5T0MA 3PDNA 1MUFA 5F6KC 1ZKKA 1N6AA 3TG5A 4FMUA 3M59A 3M54A 5F5EA 4E47A 3RAYA 5TTFA 2JV0A 3DALA 3CBPA 3S7FA 3S7JA 3IHXA 5KJNA 4MI0A 1H3IA 3OOIA 2W5YA 2O8JA 4C1QA 1MT6A 3KMAA 3OXLA 3RIBA 3N71A 3TG4A 1MVXA 4J83A 4IJDA 3QWWA 5KJKA 2W5ZA 5JIYA 5CCLA 4H12A 5T5GA 2IGQA 3SW9A 4LDGA 5KJLA 4I51A 5KJMA 3M53A 3RU0A 3CBOA 3MO2A 4YPEA 3M55A 5F6LA 4MI5A 5ARGA 4QEPA 5JJ0A 3BO5A 4QEOA 3MO0A 5F59A 1ML9A 2BQZA 4O30A 3RJWA 4NJ5A 5EX3A 3DB5A 1XQHA 4JDSA 5CCMA 5HQ8A 4NVQA 1MVHA 4JLGA 4O6FA
chains in the Genus database with same CATH topology
4YNPA 4J7IA 5LSXA 4Z4PA 3F9WA 4J7FA 3M57A 3RQ4A 3KMTA 4RZ0A 3SWCA 3CBMA 3HNAA 4YPUA 5AYFA 2G46A 3M58A 3EP0A 3F9YA 4IJ8A 2RFIA 3K5KA 3S8PA 4YNDA 3KMJA 5T0KA 2F69A 3S7DA 3FPDA 3OPEA 3M56A 3QWPA 4WUYA 5JINA 3F9XA 3OXGA 5EG2A 4AU7A 4J8OA 1N3JA 3M5AA 3OXFA 3MEKA 5LSZA 2QPWA 3S7BA 5CPRB 1O9SA 3QWVA 3VUZA 4QENA 1PEGA 2R3AA 5TEGA 1N6CA 5TH7A 5EX0A 3OS5A 4BUPA 5ARFA 5JHNA 5HI7A 3F9ZA 4YPAA 3MO5A 3VV0A 4YNMA 5T0MA 3PDNA 1MUFA 5F6KC 1ZKKA 1N6AA 3TG5A 4FMUA 3M59A 3M54A 5F5EA 4E47A 3RAYA 5TTFA 2JV0A 3DALA 3CBPA 3S7FA 3S7JA 3IHXA 5KJNA 4MI0A 1H3IA 3OOIA 2W5YA 2O8JA 4C1QA 1MT6A 3KMAA 3OXLA 3RIBA 3N71A 3TG4A 1MVXA 4J83A 4IJDA 3QWWA 5KJKA 2W5ZA 5JIYA 5CCLA 4H12A 5T5GA 2IGQA 3SW9A 4LDGA 5KJLA 4I51A 5KJMA 3M53A 3RU0A 3CBOA 3MO2A 4YPEA 3M55A 5F6LA 4MI5A 5ARGA 4QEPA 5JJ0A 3BO5A 4QEOA 3MO0A 5F59A 1ML9A 2BQZA 4O30A 3RJWA 4NJ5A 5EX3A 3DB5A 1XQHA 4JDSA 5CCMA 5HQ8A 4NVQA 1MVHA 4JLGA 4O6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YNP A;  4J7I A;  5LSX A;  4Z4P A;  3F9W A;  4J7F A;  3M57 A;  3RQ4 A;  3KMT A;  4RZ0 A;  3SWC A;  3CBM A;  3HNA A;  4YPU A;  5AYF A;  2G46 A;  3M58 A;  3EP0 A;  3F9Y A;  4IJ8 A;  2RFI A;  3K5K A;  3S8P A;  4YND A;  3KMJ A;  5T0K A;  2F69 A;  3S7D A;  3FPD A;  3OPE A;  3M56 A;  3QWP A;  4WUY A;  5JIN A;  3F9X A;  3OXG A;  5EG2 A;  4AU7 A;  4J8O A;  1N3J A;  3M5A A;  3OXF A;  3MEK A;  5LSZ A;  2QPW A;  3S7B A;  5CPR B;  1O9S A;  3QWV A;  3VUZ A;  4QEN A;  1PEG A;  2R3A A;  5TEG A;  1N6C A;  5TH7 A;  5EX0 A;  3OS5 A;  4BUP A;  5ARF A;  5JHN A;  5HI7 A;  3F9Z A;  4YPA A;  3MO5 A;  3VV0 A;  4YNM A;  5T0M A;  3PDN A;  1MUF A;  5F6K C;  1ZKK A;  1N6A A;  3TG5 A;  4FMU A;  3M59 A;  3M54 A;  5F5E A;  4E47 A;  3RAY A;  5TTF A;  2JV0 A;  3DAL A;  3CBP A;  3S7F A;  3S7J A;  3IHX A;  5KJN A;  4MI0 A;  1H3I A;  3OOI A;  2W5Y A;  2O8J A;  4C1Q A;  1MT6 A;  3KMA A;  3OXL A;  3RIB A;  3N71 A;  3TG4 A;  1MVX A;  4J83 A;  4IJD A;  3QWW A;  5KJK A;  2W5Z A;  5JIY A;  5CCL A;  4H12 A;  5T5G A;  2IGQ A;  3SW9 A;  4LDG A;  5KJL A;  4I51 A;  5KJM A;  3M53 A;  3RU0 A;  3CBO A;  3MO2 A;  4YPE A;  3M55 A;  5F6L A;  4MI5 A;  5ARG A;  4QEP A;  5JJ0 A;  3BO5 A;  4QEO A;  3MO0 A;  5F59 A;  1ML9 A;  2BQZ A;  4O30 A;  3RJW A;  4NJ5 A;  5EX3 A;  3DB5 A;  1XQH A;  4JDS A;  5CCM A;  5HQ8 A;  4NVQ A;  1MVH A;  4JLG A;  4O6F A; 
#chains in the Genus database with same CATH topology
 4YNP A;  4J7I A;  5LSX A;  4Z4P A;  3F9W A;  4J7F A;  3M57 A;  3RQ4 A;  3KMT A;  4RZ0 A;  3SWC A;  3CBM A;  3HNA A;  4YPU A;  5AYF A;  2G46 A;  3M58 A;  3EP0 A;  3F9Y A;  4IJ8 A;  2RFI A;  3K5K A;  3S8P A;  4YND A;  3KMJ A;  5T0K A;  2F69 A;  3S7D A;  3FPD A;  3OPE A;  3M56 A;  3QWP A;  4WUY A;  5JIN A;  3F9X A;  3OXG A;  5EG2 A;  4AU7 A;  4J8O A;  1N3J A;  3M5A A;  3OXF A;  3MEK A;  5LSZ A;  2QPW A;  3S7B A;  5CPR B;  1O9S A;  3QWV A;  3VUZ A;  4QEN A;  1PEG A;  2R3A A;  5TEG A;  1N6C A;  5TH7 A;  5EX0 A;  3OS5 A;  4BUP A;  5ARF A;  5JHN A;  5HI7 A;  3F9Z A;  4YPA A;  3MO5 A;  3VV0 A;  4YNM A;  5T0M A;  3PDN A;  1MUF A;  5F6K C;  1ZKK A;  1N6A A;  3TG5 A;  4FMU A;  3M59 A;  3M54 A;  5F5E A;  4E47 A;  3RAY A;  5TTF A;  2JV0 A;  3DAL A;  3CBP A;  3S7F A;  3S7J A;  3IHX A;  5KJN A;  4MI0 A;  1H3I A;  3OOI A;  2W5Y A;  2O8J A;  4C1Q A;  1MT6 A;  3KMA A;  3OXL A;  3RIB A;  3N71 A;  3TG4 A;  1MVX A;  4J83 A;  4IJD A;  3QWW A;  5KJK A;  2W5Z A;  5JIY A;  5CCL A;  4H12 A;  5T5G A;  2IGQ A;  3SW9 A;  4LDG A;  5KJL A;  4I51 A;  5KJM A;  3M53 A;  3RU0 A;  3CBO A;  3MO2 A;  4YPE A;  3M55 A;  5F6L A;  4MI5 A;  5ARG A;  4QEP A;  5JJ0 A;  3BO5 A;  4QEO A;  3MO0 A;  5F59 A;  1ML9 A;  2BQZ A;  4O30 A;  3RJW A;  4NJ5 A;  5EX3 A;  3DB5 A;  1XQH A;  4JDS A;  5CCM A;  5HQ8 A;  4NVQ A;  1MVH A;  4JLG A;  4O6F A; 
#chains in the Genus database with same CATH homology
 4YNP A;  4J7I A;  5LSX A;  4Z4P A;  3F9W A;  4J7F A;  3M57 A;  3RQ4 A;  3KMT A;  4RZ0 A;  3SWC A;  3CBM A;  3HNA A;  4YPU A;  5AYF A;  2G46 A;  3M58 A;  3EP0 A;  3F9Y A;  4IJ8 A;  2RFI A;  3K5K A;  3S8P A;  4YND A;  3KMJ A;  5T0K A;  2F69 A;  3S7D A;  3FPD A;  3OPE A;  3M56 A;  3QWP A;  4WUY A;  5JIN A;  3F9X A;  3OXG A;  5EG2 A;  4AU7 A;  4J8O A;  1N3J A;  3M5A A;  3OXF A;  3MEK A;  5LSZ A;  2QPW A;  3S7B A;  5CPR B;  1O9S A;  3QWV A;  3VUZ A;  4QEN A;  1PEG A;  2R3A A;  5TEG A;  1N6C A;  5TH7 A;  5EX0 A;  3OS5 A;  4BUP A;  5ARF A;  5JHN A;  5HI7 A;  3F9Z A;  4YPA A;  3MO5 A;  3VV0 A;  4YNM A;  5T0M A;  3PDN A;  1MUF A;  5F6K C;  1ZKK A;  1N6A A;  3TG5 A;  4FMU A;  3M59 A;  3M54 A;  5F5E A;  4E47 A;  3RAY A;  5TTF A;  2JV0 A;  3DAL A;  3CBP A;  3S7F A;  3S7J A;  3IHX A;  5KJN A;  4MI0 A;  1H3I A;  3OOI A;  2W5Y A;  2O8J A;  4C1Q A;  1MT6 A;  3KMA A;  3OXL A;  3RIB A;  3N71 A;  3TG4 A;  1MVX A;  4J83 A;  4IJD A;  3QWW A;  5KJK A;  2W5Z A;  5JIY A;  5CCL A;  4H12 A;  5T5G A;  2IGQ A;  3SW9 A;  4LDG A;  5KJL A;  4I51 A;  5KJM A;  3M53 A;  3RU0 A;  3CBO A;  3MO2 A;  4YPE A;  3M55 A;  5F6L A;  4MI5 A;  5ARG A;  4QEP A;  5JJ0 A;  3BO5 A;  4QEO A;  3MO0 A;  5F59 A;  1ML9 A;  2BQZ A;  4O30 A;  3RJW A;  4NJ5 A;  5EX3 A;  3DB5 A;  1XQH A;  4JDS A;  5CCM A;  5HQ8 A;  4NVQ A;  1MVH A;  4JLG A;  4O6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...