4IJ8A

Crystal structure of the complex of setd8 with sam
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the complex of SETD8 with SAM
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SETD8
total genus 44
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ij8A00
3M59A 3KMJA 3TG5A 5CPRB 3M55A 3RIBA 3M56A 4JLGA 3K5KA 3RJWA 1ML9A 2O8JA 5LSXA 3DB5A 3QWWA 3KMAA 3M58A 3PDNA 4J8OA 5JJ0A 5CCMA 3RU0A 4C1QA 1ZKKA 2F69A 5KJKA 3F9WA 3SW9A 3F9XA 3OPEA 3M5AA 4H12A 5HQ8A 5AYFA 3EP0A 5EX0A 3S8PA 3S7JA 5KJMA 4YPUA 3N71A 1N6CA 4IJDA 3CBMA 3MO5A 3S7FA 4LDGA 2JV0A 1O9SA 3SWCA 2BQZA 4YNMA 1MT6A 5TH7A 3MO0A 3VUZA 3CBOA 5F6KC 2QPWA 2W5ZA 5TTFA 5ARFA 4BUPA 1H3IA 4IJ8A 4J83A 2RFIA 5JINA 5CCLA 3OXLA 3M57A 5HI7A 4Z4PA 1MVXA 2G46A 4NJ5A 5T5GA 3FPDA 4WUYA 3F9ZA 4YPEA 5F5EA 3DALA 5KJNA 4J7IA 1XQHA 3MO2A 3VV0A 3F9YA 4RZ0A 5ARGA 2IGQA 3IHXA 3M54A 5JHNA 5JIYA 3TG4A 4I51A 5F6LA 1MVHA 1N6AA 4QEOA 3CBPA 3OXFA 5F59A 5TEGA 3HNAA 5EX3A 1PEGA 4YPAA 4QEPA 4MI0A 3S7BA 1N3JA 4QENA 5EG2A 4AU7A 4FMUA 2W5YA 3KMTA 4O6FA 5KJLA 3RQ4A 4YNPA 4MI5A 3QWVA 3S7DA 4NVQA 4J7FA 3OXGA 3M53A 4YNDA 2R3AA 3RAYA 3QWPA 3MEKA 5T0MA 1MUFA 5T0KA 3OS5A 4O30A 5LSZA 3BO5A 3OOIA 4E47A 4JDSA
chains in the Genus database with same CATH superfamily
3M59A 3KMJA 3TG5A 5CPRB 3M55A 3RIBA 3M56A 4JLGA 3K5KA 3RJWA 1ML9A 2O8JA 5LSXA 3DB5A 3QWWA 3KMAA 3M58A 3PDNA 4J8OA 5JJ0A 5CCMA 3RU0A 4C1QA 1ZKKA 2F69A 5KJKA 3F9WA 3SW9A 3F9XA 3OPEA 3M5AA 4H12A 5HQ8A 5AYFA 3EP0A 5EX0A 3S8PA 3S7JA 5KJMA 4YPUA 3N71A 1N6CA 4IJDA 3CBMA 3MO5A 3S7FA 4LDGA 2JV0A 1O9SA 3SWCA 2BQZA 4YNMA 1MT6A 5TH7A 3MO0A 3VUZA 3CBOA 5F6KC 2QPWA 2W5ZA 5TTFA 5ARFA 4BUPA 1H3IA 4IJ8A 4J83A 2RFIA 5JINA 5CCLA 3OXLA 3M57A 5HI7A 4Z4PA 1MVXA 2G46A 4NJ5A 5T5GA 3FPDA 4WUYA 3F9ZA 4YPEA 5F5EA 3DALA 5KJNA 4J7IA 1XQHA 3MO2A 3VV0A 3F9YA 4RZ0A 5ARGA 2IGQA 3IHXA 3M54A 5JHNA 5JIYA 3TG4A 4I51A 5F6LA 1MVHA 1N6AA 4QEOA 3CBPA 3OXFA 5F59A 5TEGA 3HNAA 5EX3A 1PEGA 4YPAA 4QEPA 4MI0A 3S7BA 1N3JA 4QENA 5EG2A 4AU7A 4FMUA 2W5YA 3KMTA 4O6FA 5KJLA 3RQ4A 4YNPA 4MI5A 3QWVA 3S7DA 4NVQA 4J7FA 3OXGA 3M53A 4YNDA 2R3AA 3RAYA 3QWPA 3MEKA 5T0MA 1MUFA 5T0KA 3OS5A 4O30A 5LSZA 3BO5A 3OOIA 4E47A 4JDSA
chains in the Genus database with same CATH topology
3M59A 3KMJA 3TG5A 5CPRB 3M55A 3RIBA 3M56A 4JLGA 3K5KA 3RJWA 1ML9A 2O8JA 5LSXA 3DB5A 3QWWA 3KMAA 3M58A 3PDNA 4J8OA 5JJ0A 5CCMA 3RU0A 4C1QA 1ZKKA 2F69A 5KJKA 3F9WA 3SW9A 3F9XA 3OPEA 3M5AA 4H12A 5HQ8A 5AYFA 3EP0A 5EX0A 3S8PA 3S7JA 5KJMA 4YPUA 3N71A 1N6CA 4IJDA 3CBMA 3MO5A 3S7FA 4LDGA 2JV0A 1O9SA 3SWCA 2BQZA 4YNMA 1MT6A 5TH7A 3MO0A 3VUZA 3CBOA 5F6KC 2QPWA 2W5ZA 5TTFA 5ARFA 4BUPA 1H3IA 4IJ8A 4J83A 2RFIA 5JINA 5CCLA 3OXLA 3M57A 5HI7A 4Z4PA 1MVXA 2G46A 4NJ5A 5T5GA 3FPDA 4WUYA 3F9ZA 4YPEA 5F5EA 3DALA 5KJNA 4J7IA 1XQHA 3MO2A 3VV0A 3F9YA 4RZ0A 5ARGA 2IGQA 3IHXA 3M54A 5JHNA 5JIYA 3TG4A 4I51A 5F6LA 1MVHA 1N6AA 4QEOA 3CBPA 3OXFA 5F59A 5TEGA 3HNAA 5EX3A 1PEGA 4YPAA 4QEPA 4MI0A 3S7BA 1N3JA 4QENA 5EG2A 4AU7A 4FMUA 2W5YA 3KMTA 4O6FA 5KJLA 3RQ4A 4YNPA 4MI5A 3QWVA 3S7DA 4NVQA 4J7FA 3OXGA 3M53A 4YNDA 2R3AA 3RAYA 3QWPA 3MEKA 5T0MA 1MUFA 5T0KA 3OS5A 4O30A 5LSZA 3BO5A 3OOIA 4E47A 4JDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M59 A;  3KMJ A;  3TG5 A;  5CPR B;  3M55 A;  3RIB A;  3M56 A;  4JLG A;  3K5K A;  3RJW A;  1ML9 A;  2O8J A;  5LSX A;  3DB5 A;  3QWW A;  3KMA A;  3M58 A;  3PDN A;  4J8O A;  5JJ0 A;  5CCM A;  3RU0 A;  4C1Q A;  1ZKK A;  2F69 A;  5KJK A;  3F9W A;  3SW9 A;  3F9X A;  3OPE A;  3M5A A;  4H12 A;  5HQ8 A;  5AYF A;  3EP0 A;  5EX0 A;  3S8P A;  3S7J A;  5KJM A;  4YPU A;  3N71 A;  1N6C A;  4IJD A;  3CBM A;  3MO5 A;  3S7F A;  4LDG A;  2JV0 A;  1O9S A;  3SWC A;  2BQZ A;  4YNM A;  1MT6 A;  5TH7 A;  3MO0 A;  3VUZ A;  3CBO A;  5F6K C;  2QPW A;  2W5Z A;  5TTF A;  5ARF A;  4BUP A;  1H3I A;  4IJ8 A;  4J83 A;  2RFI A;  5JIN A;  5CCL A;  3OXL A;  3M57 A;  5HI7 A;  4Z4P A;  1MVX A;  2G46 A;  4NJ5 A;  5T5G A;  3FPD A;  4WUY A;  3F9Z A;  4YPE A;  5F5E A;  3DAL A;  5KJN A;  4J7I A;  1XQH A;  3MO2 A;  3VV0 A;  3F9Y A;  4RZ0 A;  5ARG A;  2IGQ A;  3IHX A;  3M54 A;  5JHN A;  5JIY A;  3TG4 A;  4I51 A;  5F6L A;  1MVH A;  1N6A A;  4QEO A;  3CBP A;  3OXF A;  5F59 A;  5TEG A;  3HNA A;  5EX3 A;  1PEG A;  4YPA A;  4QEP A;  4MI0 A;  3S7B A;  1N3J A;  4QEN A;  5EG2 A;  4AU7 A;  4FMU A;  2W5Y A;  3KMT A;  4O6F A;  5KJL A;  3RQ4 A;  4YNP A;  4MI5 A;  3QWV A;  3S7D A;  4NVQ A;  4J7F A;  3OXG A;  3M53 A;  4YND A;  2R3A A;  3RAY A;  3QWP A;  3MEK A;  5T0M A;  1MUF A;  5T0K A;  3OS5 A;  4O30 A;  5LSZ A;  3BO5 A;  3OOI A;  4E47 A;  4JDS A; 
#chains in the Genus database with same CATH topology
 3M59 A;  3KMJ A;  3TG5 A;  5CPR B;  3M55 A;  3RIB A;  3M56 A;  4JLG A;  3K5K A;  3RJW A;  1ML9 A;  2O8J A;  5LSX A;  3DB5 A;  3QWW A;  3KMA A;  3M58 A;  3PDN A;  4J8O A;  5JJ0 A;  5CCM A;  3RU0 A;  4C1Q A;  1ZKK A;  2F69 A;  5KJK A;  3F9W A;  3SW9 A;  3F9X A;  3OPE A;  3M5A A;  4H12 A;  5HQ8 A;  5AYF A;  3EP0 A;  5EX0 A;  3S8P A;  3S7J A;  5KJM A;  4YPU A;  3N71 A;  1N6C A;  4IJD A;  3CBM A;  3MO5 A;  3S7F A;  4LDG A;  2JV0 A;  1O9S A;  3SWC A;  2BQZ A;  4YNM A;  1MT6 A;  5TH7 A;  3MO0 A;  3VUZ A;  3CBO A;  5F6K C;  2QPW A;  2W5Z A;  5TTF A;  5ARF A;  4BUP A;  1H3I A;  4IJ8 A;  4J83 A;  2RFI A;  5JIN A;  5CCL A;  3OXL A;  3M57 A;  5HI7 A;  4Z4P A;  1MVX A;  2G46 A;  4NJ5 A;  5T5G A;  3FPD A;  4WUY A;  3F9Z A;  4YPE A;  5F5E A;  3DAL A;  5KJN A;  4J7I A;  1XQH A;  3MO2 A;  3VV0 A;  3F9Y A;  4RZ0 A;  5ARG A;  2IGQ A;  3IHX A;  3M54 A;  5JHN A;  5JIY A;  3TG4 A;  4I51 A;  5F6L A;  1MVH A;  1N6A A;  4QEO A;  3CBP A;  3OXF A;  5F59 A;  5TEG A;  3HNA A;  5EX3 A;  1PEG A;  4YPA A;  4QEP A;  4MI0 A;  3S7B A;  1N3J A;  4QEN A;  5EG2 A;  4AU7 A;  4FMU A;  2W5Y A;  3KMT A;  4O6F A;  5KJL A;  3RQ4 A;  4YNP A;  4MI5 A;  3QWV A;  3S7D A;  4NVQ A;  4J7F A;  3OXG A;  3M53 A;  4YND A;  2R3A A;  3RAY A;  3QWP A;  3MEK A;  5T0M A;  1MUF A;  5T0K A;  3OS5 A;  4O30 A;  5LSZ A;  3BO5 A;  3OOI A;  4E47 A;  4JDS A; 
#chains in the Genus database with same CATH homology
 3M59 A;  3KMJ A;  3TG5 A;  5CPR B;  3M55 A;  3RIB A;  3M56 A;  4JLG A;  3K5K A;  3RJW A;  1ML9 A;  2O8J A;  5LSX A;  3DB5 A;  3QWW A;  3KMA A;  3M58 A;  3PDN A;  4J8O A;  5JJ0 A;  5CCM A;  3RU0 A;  4C1Q A;  1ZKK A;  2F69 A;  5KJK A;  3F9W A;  3SW9 A;  3F9X A;  3OPE A;  3M5A A;  4H12 A;  5HQ8 A;  5AYF A;  3EP0 A;  5EX0 A;  3S8P A;  3S7J A;  5KJM A;  4YPU A;  3N71 A;  1N6C A;  4IJD A;  3CBM A;  3MO5 A;  3S7F A;  4LDG A;  2JV0 A;  1O9S A;  3SWC A;  2BQZ A;  4YNM A;  1MT6 A;  5TH7 A;  3MO0 A;  3VUZ A;  3CBO A;  5F6K C;  2QPW A;  2W5Z A;  5TTF A;  5ARF A;  4BUP A;  1H3I A;  4IJ8 A;  4J83 A;  2RFI A;  5JIN A;  5CCL A;  3OXL A;  3M57 A;  5HI7 A;  4Z4P A;  1MVX A;  2G46 A;  4NJ5 A;  5T5G A;  3FPD A;  4WUY A;  3F9Z A;  4YPE A;  5F5E A;  3DAL A;  5KJN A;  4J7I A;  1XQH A;  3MO2 A;  3VV0 A;  3F9Y A;  4RZ0 A;  5ARG A;  2IGQ A;  3IHX A;  3M54 A;  5JHN A;  5JIY A;  3TG4 A;  4I51 A;  5F6L A;  1MVH A;  1N6A A;  4QEO A;  3CBP A;  3OXF A;  5F59 A;  5TEG A;  3HNA A;  5EX3 A;  1PEG A;  4YPA A;  4QEP A;  4MI0 A;  3S7B A;  1N3J A;  4QEN A;  5EG2 A;  4AU7 A;  4FMU A;  2W5Y A;  3KMT A;  4O6F A;  5KJL A;  3RQ4 A;  4YNP A;  4MI5 A;  3QWV A;  3S7D A;  4NVQ A;  4J7F A;  3OXG A;  3M53 A;  4YND A;  2R3A A;  3RAY A;  3QWP A;  3MEK A;  5T0M A;  1MUF A;  5T0K A;  3OS5 A;  4O30 A;  5LSZ A;  3BO5 A;  3OOI A;  4E47 A;  4JDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...