4IJ8A

Crystal structure of the complex of setd8 with sam
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-lysine methyltransferase SETD8
publication title Crystal structure of the complex of SETD8 with SAM
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 44
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ij8A00
5AYFA 3MO0A 3F9YA 5JINA 5T0MA 3F9WA 3CBMA 3VUZA 3QWVA 4O30A 4NVQA 3S7DA 1MVHA 4WUYA 3TG4A 1O9SA 4BUPA 3DB5A 3M57A 2JV0A 5LSZA 3MO5A 4LDGA 1N3JA 3OXFA 4QENA 2G46A 3K5KA 3FPDA 5F59A 3DALA 3RIBA 4J8OA 2W5ZA 3CBOA 4J7IA 3OS5A 5HI7A 4H12A 3HNAA 3OXLA 1MUFA 4IJ8A 3KMJA 3RAYA 3S7JA 4FMUA 1PEGA 3S7BA 4NJ5A 5HQ8A 1ZKKA 3M56A 1N6CA 5EG2A 4J7FA 5TH7A 2BQZA 3OXGA 2RFIA 2W5YA 5TTFA 2QPWA 3M5AA 4QEPA 5LSXA 3MEKA 5JIYA 3OOIA 4YNDA 3N71A 4AU7A 5JJ0A 4RZ0A 1H3IA 3M54A 4MI0A 5F6KC 5ARGA 4IJDA 4Z4PA 3M55A 5JHNA 4QEOA 1MT6A 4MI5A 5EX3A 4C1QA 3MO2A 5T0KA 1ML9A 3KMAA 3F9XA 4YPUA 5CPRB 3M53A 3F9ZA 4JDSA 3M58A 4YNMA 3OPEA 2IGQA 3CBPA 3RQ4A 1N6AA 4YPAA 3M59A 3BO5A 2R3AA 5KJLA 5F5EA 5CCMA 5ARFA 4I51A 3RJWA 1MVXA 3QWWA 5F6LA 1XQHA 4YNPA 4J83A 3TG5A 3S7FA 3SWCA 2F69A 3QWPA 5KJMA 3KMTA 4JLGA 3S8PA 4O6FA 5TEGA 3VV0A 5EX0A 3PDNA 3EP0A 5T5GA 5CCLA 5KJKA 2O8JA 3IHXA 5KJNA 3SW9A 4YPEA 4E47A 3RU0A
chains in the Genus database with same CATH superfamily
5AYFA 3MO0A 3F9YA 5JINA 5T0MA 3F9WA 3CBMA 3VUZA 3QWVA 4O30A 4NVQA 3S7DA 1MVHA 4WUYA 3TG4A 1O9SA 4BUPA 3DB5A 3M57A 2JV0A 5LSZA 3MO5A 4LDGA 1N3JA 3OXFA 4QENA 2G46A 3K5KA 3FPDA 5F59A 3DALA 3RIBA 4J8OA 2W5ZA 3CBOA 4J7IA 3OS5A 5HI7A 4H12A 3HNAA 3OXLA 1MUFA 4IJ8A 3KMJA 3RAYA 3S7JA 4FMUA 1PEGA 3S7BA 4NJ5A 5HQ8A 1ZKKA 3M56A 1N6CA 5EG2A 4J7FA 5TH7A 2BQZA 3OXGA 2RFIA 2W5YA 5TTFA 2QPWA 3M5AA 4QEPA 5LSXA 3MEKA 5JIYA 3OOIA 4YNDA 3N71A 4AU7A 5JJ0A 4RZ0A 1H3IA 3M54A 4MI0A 5F6KC 5ARGA 4IJDA 4Z4PA 3M55A 5JHNA 4QEOA 1MT6A 4MI5A 5EX3A 4C1QA 3MO2A 5T0KA 1ML9A 3KMAA 3F9XA 4YPUA 5CPRB 3M53A 3F9ZA 4JDSA 3M58A 4YNMA 3OPEA 2IGQA 3CBPA 3RQ4A 1N6AA 4YPAA 3M59A 3BO5A 2R3AA 5KJLA 5F5EA 5CCMA 5ARFA 4I51A 3RJWA 1MVXA 3QWWA 5F6LA 1XQHA 4YNPA 4J83A 3TG5A 3S7FA 3SWCA 2F69A 3QWPA 5KJMA 3KMTA 4JLGA 3S8PA 4O6FA 5TEGA 3VV0A 5EX0A 3PDNA 3EP0A 5T5GA 5CCLA 5KJKA 2O8JA 3IHXA 5KJNA 3SW9A 4YPEA 4E47A 3RU0A
chains in the Genus database with same CATH topology
5AYFA 3MO0A 3F9YA 5JINA 5T0MA 3F9WA 3CBMA 3VUZA 3QWVA 4O30A 4NVQA 3S7DA 1MVHA 4WUYA 3TG4A 1O9SA 4BUPA 3DB5A 3M57A 2JV0A 5LSZA 3MO5A 4LDGA 1N3JA 3OXFA 4QENA 2G46A 3K5KA 3FPDA 5F59A 3DALA 3RIBA 4J8OA 2W5ZA 3CBOA 4J7IA 3OS5A 5HI7A 4H12A 3HNAA 3OXLA 1MUFA 4IJ8A 3KMJA 3RAYA 3S7JA 4FMUA 1PEGA 3S7BA 4NJ5A 5HQ8A 1ZKKA 3M56A 1N6CA 5EG2A 4J7FA 5TH7A 2BQZA 3OXGA 2RFIA 2W5YA 5TTFA 2QPWA 3M5AA 4QEPA 5LSXA 3MEKA 5JIYA 3OOIA 4YNDA 3N71A 4AU7A 5JJ0A 4RZ0A 1H3IA 3M54A 4MI0A 5F6KC 5ARGA 4IJDA 4Z4PA 3M55A 5JHNA 4QEOA 1MT6A 4MI5A 5EX3A 4C1QA 3MO2A 5T0KA 1ML9A 3KMAA 3F9XA 4YPUA 5CPRB 3M53A 3F9ZA 4JDSA 3M58A 4YNMA 3OPEA 2IGQA 3CBPA 3RQ4A 1N6AA 4YPAA 3M59A 3BO5A 2R3AA 5KJLA 5F5EA 5CCMA 5ARFA 4I51A 3RJWA 1MVXA 3QWWA 5F6LA 1XQHA 4YNPA 4J83A 3TG5A 3S7FA 3SWCA 2F69A 3QWPA 5KJMA 3KMTA 4JLGA 3S8PA 4O6FA 5TEGA 3VV0A 5EX0A 3PDNA 3EP0A 5T5GA 5CCLA 5KJKA 2O8JA 3IHXA 5KJNA 3SW9A 4YPEA 4E47A 3RU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYF A;  3MO0 A;  3F9Y A;  5JIN A;  5T0M A;  3F9W A;  3CBM A;  3VUZ A;  3QWV A;  4O30 A;  4NVQ A;  3S7D A;  1MVH A;  4WUY A;  3TG4 A;  1O9S A;  4BUP A;  3DB5 A;  3M57 A;  2JV0 A;  5LSZ A;  3MO5 A;  4LDG A;  1N3J A;  3OXF A;  4QEN A;  2G46 A;  3K5K A;  3FPD A;  5F59 A;  3DAL A;  3RIB A;  4J8O A;  2W5Z A;  3CBO A;  4J7I A;  3OS5 A;  5HI7 A;  4H12 A;  3HNA A;  3OXL A;  1MUF A;  4IJ8 A;  3KMJ A;  3RAY A;  3S7J A;  4FMU A;  1PEG A;  3S7B A;  4NJ5 A;  5HQ8 A;  1ZKK A;  3M56 A;  1N6C A;  5EG2 A;  4J7F A;  5TH7 A;  2BQZ A;  3OXG A;  2RFI A;  2W5Y A;  5TTF A;  2QPW A;  3M5A A;  4QEP A;  5LSX A;  3MEK A;  5JIY A;  3OOI A;  4YND A;  3N71 A;  4AU7 A;  5JJ0 A;  4RZ0 A;  1H3I A;  3M54 A;  4MI0 A;  5F6K C;  5ARG A;  4IJD A;  4Z4P A;  3M55 A;  5JHN A;  4QEO A;  1MT6 A;  4MI5 A;  5EX3 A;  4C1Q A;  3MO2 A;  5T0K A;  1ML9 A;  3KMA A;  3F9X A;  4YPU A;  5CPR B;  3M53 A;  3F9Z A;  4JDS A;  3M58 A;  4YNM A;  3OPE A;  2IGQ A;  3CBP A;  3RQ4 A;  1N6A A;  4YPA A;  3M59 A;  3BO5 A;  2R3A A;  5KJL A;  5F5E A;  5CCM A;  5ARF A;  4I51 A;  3RJW A;  1MVX A;  3QWW A;  5F6L A;  1XQH A;  4YNP A;  4J83 A;  3TG5 A;  3S7F A;  3SWC A;  2F69 A;  3QWP A;  5KJM A;  3KMT A;  4JLG A;  3S8P A;  4O6F A;  5TEG A;  3VV0 A;  5EX0 A;  3PDN A;  3EP0 A;  5T5G A;  5CCL A;  5KJK A;  2O8J A;  3IHX A;  5KJN A;  3SW9 A;  4YPE A;  4E47 A;  3RU0 A; 
#chains in the Genus database with same CATH topology
 5AYF A;  3MO0 A;  3F9Y A;  5JIN A;  5T0M A;  3F9W A;  3CBM A;  3VUZ A;  3QWV A;  4O30 A;  4NVQ A;  3S7D A;  1MVH A;  4WUY A;  3TG4 A;  1O9S A;  4BUP A;  3DB5 A;  3M57 A;  2JV0 A;  5LSZ A;  3MO5 A;  4LDG A;  1N3J A;  3OXF A;  4QEN A;  2G46 A;  3K5K A;  3FPD A;  5F59 A;  3DAL A;  3RIB A;  4J8O A;  2W5Z A;  3CBO A;  4J7I A;  3OS5 A;  5HI7 A;  4H12 A;  3HNA A;  3OXL A;  1MUF A;  4IJ8 A;  3KMJ A;  3RAY A;  3S7J A;  4FMU A;  1PEG A;  3S7B A;  4NJ5 A;  5HQ8 A;  1ZKK A;  3M56 A;  1N6C A;  5EG2 A;  4J7F A;  5TH7 A;  2BQZ A;  3OXG A;  2RFI A;  2W5Y A;  5TTF A;  2QPW A;  3M5A A;  4QEP A;  5LSX A;  3MEK A;  5JIY A;  3OOI A;  4YND A;  3N71 A;  4AU7 A;  5JJ0 A;  4RZ0 A;  1H3I A;  3M54 A;  4MI0 A;  5F6K C;  5ARG A;  4IJD A;  4Z4P A;  3M55 A;  5JHN A;  4QEO A;  1MT6 A;  4MI5 A;  5EX3 A;  4C1Q A;  3MO2 A;  5T0K A;  1ML9 A;  3KMA A;  3F9X A;  4YPU A;  5CPR B;  3M53 A;  3F9Z A;  4JDS A;  3M58 A;  4YNM A;  3OPE A;  2IGQ A;  3CBP A;  3RQ4 A;  1N6A A;  4YPA A;  3M59 A;  3BO5 A;  2R3A A;  5KJL A;  5F5E A;  5CCM A;  5ARF A;  4I51 A;  3RJW A;  1MVX A;  3QWW A;  5F6L A;  1XQH A;  4YNP A;  4J83 A;  3TG5 A;  3S7F A;  3SWC A;  2F69 A;  3QWP A;  5KJM A;  3KMT A;  4JLG A;  3S8P A;  4O6F A;  5TEG A;  3VV0 A;  5EX0 A;  3PDN A;  3EP0 A;  5T5G A;  5CCL A;  5KJK A;  2O8J A;  3IHX A;  5KJN A;  3SW9 A;  4YPE A;  4E47 A;  3RU0 A; 
#chains in the Genus database with same CATH homology
 5AYF A;  3MO0 A;  3F9Y A;  5JIN A;  5T0M A;  3F9W A;  3CBM A;  3VUZ A;  3QWV A;  4O30 A;  4NVQ A;  3S7D A;  1MVH A;  4WUY A;  3TG4 A;  1O9S A;  4BUP A;  3DB5 A;  3M57 A;  2JV0 A;  5LSZ A;  3MO5 A;  4LDG A;  1N3J A;  3OXF A;  4QEN A;  2G46 A;  3K5K A;  3FPD A;  5F59 A;  3DAL A;  3RIB A;  4J8O A;  2W5Z A;  3CBO A;  4J7I A;  3OS5 A;  5HI7 A;  4H12 A;  3HNA A;  3OXL A;  1MUF A;  4IJ8 A;  3KMJ A;  3RAY A;  3S7J A;  4FMU A;  1PEG A;  3S7B A;  4NJ5 A;  5HQ8 A;  1ZKK A;  3M56 A;  1N6C A;  5EG2 A;  4J7F A;  5TH7 A;  2BQZ A;  3OXG A;  2RFI A;  2W5Y A;  5TTF A;  2QPW A;  3M5A A;  4QEP A;  5LSX A;  3MEK A;  5JIY A;  3OOI A;  4YND A;  3N71 A;  4AU7 A;  5JJ0 A;  4RZ0 A;  1H3I A;  3M54 A;  4MI0 A;  5F6K C;  5ARG A;  4IJD A;  4Z4P A;  3M55 A;  5JHN A;  4QEO A;  1MT6 A;  4MI5 A;  5EX3 A;  4C1Q A;  3MO2 A;  5T0K A;  1ML9 A;  3KMA A;  3F9X A;  4YPU A;  5CPR B;  3M53 A;  3F9Z A;  4JDS A;  3M58 A;  4YNM A;  3OPE A;  2IGQ A;  3CBP A;  3RQ4 A;  1N6A A;  4YPA A;  3M59 A;  3BO5 A;  2R3A A;  5KJL A;  5F5E A;  5CCM A;  5ARF A;  4I51 A;  3RJW A;  1MVX A;  3QWW A;  5F6L A;  1XQH A;  4YNP A;  4J83 A;  3TG5 A;  3S7F A;  3SWC A;  2F69 A;  3QWP A;  5KJM A;  3KMT A;  4JLG A;  3S8P A;  4O6F A;  5TEG A;  3VV0 A;  5EX0 A;  3PDN A;  3EP0 A;  5T5G A;  5CCL A;  5KJK A;  2O8J A;  3IHX A;  5KJN A;  3SW9 A;  4YPE A;  4E47 A;  3RU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...