4IJ8A

Crystal structure of the complex of setd8 with sam
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
b'RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-lysine methyltransferase SETD8
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of the complex of SETD8 with SAM
rcsb
total genus 44
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ij8A00
3OOIA 1H3IA 5KJKA 4I51A 3M54A 2BQZA 3BO5A 4NVQA 3F9WA 5JINA 5HI7A 4JDSA 3MO2A 1MVXA 4YNDA 4YNPA 5CCLA 3OS5A 4Z4PA 5F5EA 5EX3A 5CCMA 3RU0A 4J83A 1N6CA 5CPRB 5F59A 1MVHA 3M59A 3QWWA 4IJDA 3OXGA 5EG2A 3S8PA 3M5AA 3M56A 1N6AA 4J8OA 4J7IA 3RAYA 5JHNA 5AYFA 5TH7A 3VUZA 3RIBA 3RJWA 5F6KC 4J7FA 3RQ4A 4H12A 4C1QA 3CBMA 2G46A 5T0KA 3S7BA 3OXLA 1PEGA 3M57A 2JV0A 4YPEA 1ML9A 5HQ8A 3SWCA 5T0MA 3FPDA 4QEOA 4E47A 5T5GA 1N3JA 3M55A 4O30A 1O9SA 1XQHA 5EX0A 5ARGA 3KMAA 3VV0A 4O6FA 3HNAA 3K5KA 3KMTA 3OXFA 3S7FA 3M53A 3KMJA 2QPWA 3PDNA 2O8JA 4RZ0A 2F69A 5KJMA 3TG4A 3OPEA 4YPUA 3F9YA 5JJ0A 3SW9A 4QENA 2RFIA 3CBOA 5LSXA 5LSZA 3IHXA 5TTFA 3DALA 5ARFA 1ZKKA 3DB5A 3MO5A 4BUPA 4YNMA 4WUYA 5TEGA 3QWPA 4AU7A 3N71A 3EP0A 4QEPA 4NJ5A 3MO0A 4YPAA 4JLGA 1MUFA 4LDGA 5KJNA 2R3AA 2W5YA 3S7JA 3F9XA 5F6LA 1MT6A 4MI0A 5JIYA 2W5ZA 4MI5A 3M58A 3CBPA 5KJLA 2IGQA 4IJ8A 3MEKA 3TG5A 3F9ZA 3S7DA 3QWVA 4FMUA
chains in the Genus database with same CATH superfamily
3OOIA 1H3IA 5KJKA 4I51A 3M54A 2BQZA 3BO5A 4NVQA 3F9WA 5JINA 5HI7A 4JDSA 3MO2A 1MVXA 4YNDA 4YNPA 5CCLA 3OS5A 4Z4PA 5F5EA 5EX3A 5CCMA 3RU0A 4J83A 1N6CA 5CPRB 5F59A 1MVHA 3M59A 3QWWA 4IJDA 3OXGA 5EG2A 3S8PA 3M5AA 3M56A 1N6AA 4J8OA 4J7IA 3RAYA 5JHNA 5AYFA 5TH7A 3VUZA 3RIBA 3RJWA 5F6KC 4J7FA 3RQ4A 4H12A 4C1QA 3CBMA 2G46A 5T0KA 3S7BA 3OXLA 1PEGA 3M57A 2JV0A 4YPEA 1ML9A 5HQ8A 3SWCA 5T0MA 3FPDA 4QEOA 4E47A 5T5GA 1N3JA 3M55A 4O30A 1O9SA 1XQHA 5EX0A 5ARGA 3KMAA 3VV0A 4O6FA 3HNAA 3K5KA 3KMTA 3OXFA 3S7FA 3M53A 3KMJA 2QPWA 3PDNA 2O8JA 4RZ0A 2F69A 5KJMA 3TG4A 3OPEA 4YPUA 3F9YA 5JJ0A 3SW9A 4QENA 2RFIA 3CBOA 5LSXA 5LSZA 3IHXA 5TTFA 3DALA 5ARFA 1ZKKA 3DB5A 3MO5A 4BUPA 4YNMA 4WUYA 5TEGA 3QWPA 4AU7A 3N71A 3EP0A 4QEPA 4NJ5A 3MO0A 4YPAA 4JLGA 1MUFA 4LDGA 5KJNA 2R3AA 2W5YA 3S7JA 3F9XA 5F6LA 1MT6A 4MI0A 5JIYA 2W5ZA 4MI5A 3M58A 3CBPA 5KJLA 2IGQA 4IJ8A 3MEKA 3TG5A 3F9ZA 3S7DA 3QWVA 4FMUA
chains in the Genus database with same CATH topology
3OOIA 1H3IA 5KJKA 4I51A 3M54A 2BQZA 3BO5A 4NVQA 3F9WA 5JINA 5HI7A 4JDSA 3MO2A 1MVXA 4YNDA 4YNPA 5CCLA 3OS5A 4Z4PA 5F5EA 5EX3A 5CCMA 3RU0A 4J83A 1N6CA 5CPRB 5F59A 1MVHA 3M59A 3QWWA 4IJDA 3OXGA 5EG2A 3S8PA 3M5AA 3M56A 1N6AA 4J8OA 4J7IA 3RAYA 5JHNA 5AYFA 5TH7A 3VUZA 3RIBA 3RJWA 5F6KC 4J7FA 3RQ4A 4H12A 4C1QA 3CBMA 2G46A 5T0KA 3S7BA 3OXLA 1PEGA 3M57A 2JV0A 4YPEA 1ML9A 5HQ8A 3SWCA 5T0MA 3FPDA 4QEOA 4E47A 5T5GA 1N3JA 3M55A 4O30A 1O9SA 1XQHA 5EX0A 5ARGA 3KMAA 3VV0A 4O6FA 3HNAA 3K5KA 3KMTA 3OXFA 3S7FA 3M53A 3KMJA 2QPWA 3PDNA 2O8JA 4RZ0A 2F69A 5KJMA 3TG4A 3OPEA 4YPUA 3F9YA 5JJ0A 3SW9A 4QENA 2RFIA 3CBOA 5LSXA 5LSZA 3IHXA 5TTFA 3DALA 5ARFA 1ZKKA 3DB5A 3MO5A 4BUPA 4YNMA 4WUYA 5TEGA 3QWPA 4AU7A 3N71A 3EP0A 4QEPA 4NJ5A 3MO0A 4YPAA 4JLGA 1MUFA 4LDGA 5KJNA 2R3AA 2W5YA 3S7JA 3F9XA 5F6LA 1MT6A 4MI0A 5JIYA 2W5ZA 4MI5A 3M58A 3CBPA 5KJLA 2IGQA 4IJ8A 3MEKA 3TG5A 3F9ZA 3S7DA 3QWVA 4FMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOI A;  1H3I A;  5KJK A;  4I51 A;  3M54 A;  2BQZ A;  3BO5 A;  4NVQ A;  3F9W A;  5JIN A;  5HI7 A;  4JDS A;  3MO2 A;  1MVX A;  4YND A;  4YNP A;  5CCL A;  3OS5 A;  4Z4P A;  5F5E A;  5EX3 A;  5CCM A;  3RU0 A;  4J83 A;  1N6C A;  5CPR B;  5F59 A;  1MVH A;  3M59 A;  3QWW A;  4IJD A;  3OXG A;  5EG2 A;  3S8P A;  3M5A A;  3M56 A;  1N6A A;  4J8O A;  4J7I A;  3RAY A;  5JHN A;  5AYF A;  5TH7 A;  3VUZ A;  3RIB A;  3RJW A;  5F6K C;  4J7F A;  3RQ4 A;  4H12 A;  4C1Q A;  3CBM A;  2G46 A;  5T0K A;  3S7B A;  3OXL A;  1PEG A;  3M57 A;  2JV0 A;  4YPE A;  1ML9 A;  5HQ8 A;  3SWC A;  5T0M A;  3FPD A;  4QEO A;  4E47 A;  5T5G A;  1N3J A;  3M55 A;  4O30 A;  1O9S A;  1XQH A;  5EX0 A;  5ARG A;  3KMA A;  3VV0 A;  4O6F A;  3HNA A;  3K5K A;  3KMT A;  3OXF A;  3S7F A;  3M53 A;  3KMJ A;  2QPW A;  3PDN A;  2O8J A;  4RZ0 A;  2F69 A;  5KJM A;  3TG4 A;  3OPE A;  4YPU A;  3F9Y A;  5JJ0 A;  3SW9 A;  4QEN A;  2RFI A;  3CBO A;  5LSX A;  5LSZ A;  3IHX A;  5TTF A;  3DAL A;  5ARF A;  1ZKK A;  3DB5 A;  3MO5 A;  4BUP A;  4YNM A;  4WUY A;  5TEG A;  3QWP A;  4AU7 A;  3N71 A;  3EP0 A;  4QEP A;  4NJ5 A;  3MO0 A;  4YPA A;  4JLG A;  1MUF A;  4LDG A;  5KJN A;  2R3A A;  2W5Y A;  3S7J A;  3F9X A;  5F6L A;  1MT6 A;  4MI0 A;  5JIY A;  2W5Z A;  4MI5 A;  3M58 A;  3CBP A;  5KJL A;  2IGQ A;  4IJ8 A;  3MEK A;  3TG5 A;  3F9Z A;  3S7D A;  3QWV A;  4FMU A; 
#chains in the Genus database with same CATH topology
 3OOI A;  1H3I A;  5KJK A;  4I51 A;  3M54 A;  2BQZ A;  3BO5 A;  4NVQ A;  3F9W A;  5JIN A;  5HI7 A;  4JDS A;  3MO2 A;  1MVX A;  4YND A;  4YNP A;  5CCL A;  3OS5 A;  4Z4P A;  5F5E A;  5EX3 A;  5CCM A;  3RU0 A;  4J83 A;  1N6C A;  5CPR B;  5F59 A;  1MVH A;  3M59 A;  3QWW A;  4IJD A;  3OXG A;  5EG2 A;  3S8P A;  3M5A A;  3M56 A;  1N6A A;  4J8O A;  4J7I A;  3RAY A;  5JHN A;  5AYF A;  5TH7 A;  3VUZ A;  3RIB A;  3RJW A;  5F6K C;  4J7F A;  3RQ4 A;  4H12 A;  4C1Q A;  3CBM A;  2G46 A;  5T0K A;  3S7B A;  3OXL A;  1PEG A;  3M57 A;  2JV0 A;  4YPE A;  1ML9 A;  5HQ8 A;  3SWC A;  5T0M A;  3FPD A;  4QEO A;  4E47 A;  5T5G A;  1N3J A;  3M55 A;  4O30 A;  1O9S A;  1XQH A;  5EX0 A;  5ARG A;  3KMA A;  3VV0 A;  4O6F A;  3HNA A;  3K5K A;  3KMT A;  3OXF A;  3S7F A;  3M53 A;  3KMJ A;  2QPW A;  3PDN A;  2O8J A;  4RZ0 A;  2F69 A;  5KJM A;  3TG4 A;  3OPE A;  4YPU A;  3F9Y A;  5JJ0 A;  3SW9 A;  4QEN A;  2RFI A;  3CBO A;  5LSX A;  5LSZ A;  3IHX A;  5TTF A;  3DAL A;  5ARF A;  1ZKK A;  3DB5 A;  3MO5 A;  4BUP A;  4YNM A;  4WUY A;  5TEG A;  3QWP A;  4AU7 A;  3N71 A;  3EP0 A;  4QEP A;  4NJ5 A;  3MO0 A;  4YPA A;  4JLG A;  1MUF A;  4LDG A;  5KJN A;  2R3A A;  2W5Y A;  3S7J A;  3F9X A;  5F6L A;  1MT6 A;  4MI0 A;  5JIY A;  2W5Z A;  4MI5 A;  3M58 A;  3CBP A;  5KJL A;  2IGQ A;  4IJ8 A;  3MEK A;  3TG5 A;  3F9Z A;  3S7D A;  3QWV A;  4FMU A; 
#chains in the Genus database with same CATH homology
 3OOI A;  1H3I A;  5KJK A;  4I51 A;  3M54 A;  2BQZ A;  3BO5 A;  4NVQ A;  3F9W A;  5JIN A;  5HI7 A;  4JDS A;  3MO2 A;  1MVX A;  4YND A;  4YNP A;  5CCL A;  3OS5 A;  4Z4P A;  5F5E A;  5EX3 A;  5CCM A;  3RU0 A;  4J83 A;  1N6C A;  5CPR B;  5F59 A;  1MVH A;  3M59 A;  3QWW A;  4IJD A;  3OXG A;  5EG2 A;  3S8P A;  3M5A A;  3M56 A;  1N6A A;  4J8O A;  4J7I A;  3RAY A;  5JHN A;  5AYF A;  5TH7 A;  3VUZ A;  3RIB A;  3RJW A;  5F6K C;  4J7F A;  3RQ4 A;  4H12 A;  4C1Q A;  3CBM A;  2G46 A;  5T0K A;  3S7B A;  3OXL A;  1PEG A;  3M57 A;  2JV0 A;  4YPE A;  1ML9 A;  5HQ8 A;  3SWC A;  5T0M A;  3FPD A;  4QEO A;  4E47 A;  5T5G A;  1N3J A;  3M55 A;  4O30 A;  1O9S A;  1XQH A;  5EX0 A;  5ARG A;  3KMA A;  3VV0 A;  4O6F A;  3HNA A;  3K5K A;  3KMT A;  3OXF A;  3S7F A;  3M53 A;  3KMJ A;  2QPW A;  3PDN A;  2O8J A;  4RZ0 A;  2F69 A;  5KJM A;  3TG4 A;  3OPE A;  4YPU A;  3F9Y A;  5JJ0 A;  3SW9 A;  4QEN A;  2RFI A;  3CBO A;  5LSX A;  5LSZ A;  3IHX A;  5TTF A;  3DAL A;  5ARF A;  1ZKK A;  3DB5 A;  3MO5 A;  4BUP A;  4YNM A;  4WUY A;  5TEG A;  3QWP A;  4AU7 A;  3N71 A;  3EP0 A;  4QEP A;  4NJ5 A;  3MO0 A;  4YPA A;  4JLG A;  1MUF A;  4LDG A;  5KJN A;  2R3A A;  2W5Y A;  3S7J A;  3F9X A;  5F6L A;  1MT6 A;  4MI0 A;  5JIY A;  2W5Z A;  4MI5 A;  3M58 A;  3CBP A;  5KJL A;  2IGQ A;  4IJ8 A;  3MEK A;  3TG5 A;  3F9Z A;  3S7D A;  3QWV A;  4FMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...