5F6LA

The crystal structure of mll1 (n3861i/q3867l) in complex with rbbp5 and ash2l
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
153
Chain Sequence
b'LPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGIVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDKLPCNCGAKKCRKFLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Retinoblastoma-binding protein 5
molecule tags Protein binding/transferase
source organism Homo sapiens
publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
total genus 44
structure length 153
sequence length 156
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f6lA00
5KJMA 3S7DA 1O9SA 5JJ0A 2W5YA 5LSXA 1ZKKA 3MO2A 4H12A 3BO5A 1N6CA 3KMJA 4Z4PA 4YNDA 5KJKA 3OXFA 4BUPA 5KJLA 3SW9A 5F59A 3RJWA 1N3JA 3MO5A 3M54A 4RZ0A 4JDSA 4YPAA 1PEGA 3FPDA 3PDNA 5ARFA 2RFIA 3CBPA 4NJ5A 3EP0A 5ARGA 3OXGA 4LDGA 4IJ8A 4J7FA 5KJNA 2G46A 3DB5A 3K5KA 3M57A 3M5AA 1XQHA 1H3IA 3MEKA 5F6LA 5T5GA 5CPRB 5TH7A 3S8PA 4WUYA 3DALA 2W5ZA 5JHNA 3M55A 5JIYA 3F9ZA 4YPUA 4I51A 4E47A 2F69A 5AYFA 5CCMA 5EX3A 3TG5A 4MI5A 3M56A 3F9YA 4MI0A 5TTFA 4YNPA 4C1QA 2JV0A 4O6FA 3QWVA 4J83A 1MVXA 3OXLA 4J8OA 5HQ8A 3IHXA 5CCLA 2BQZA 3S7BA 4NVQA 3M58A 3F9XA 4QEPA 3QWWA 3CBMA 3MO0A 4JLGA 4FMUA 3TG4A 4YPEA 4YNMA 5EG2A 5HI7A 3QWPA 1N6AA 3RQ4A 5TEGA 3F9WA 3N71A 4J7IA 5EX0A 3S7FA 5JINA 2IGQA 3VV0A 5LSZA 4IJDA 3KMAA 3CBOA 3M53A 3OS5A 5F5EA 2R3AA 5T0MA 1MT6A 4QEOA 5F6KC 4AU7A 3M59A 4O30A 3SWCA 4QENA 3RAYA 3RIBA 1MUFA 3OOIA 3HNAA 3S7JA 2QPWA 1ML9A 3VUZA 3OPEA 1MVHA 3RU0A 3KMTA 2O8JA 5T0KA
chains in the Genus database with same CATH superfamily
5KJMA 3S7DA 1O9SA 5JJ0A 2W5YA 5LSXA 1ZKKA 3MO2A 4H12A 3BO5A 1N6CA 3KMJA 4Z4PA 4YNDA 5KJKA 3OXFA 4BUPA 5KJLA 3SW9A 5F59A 3RJWA 1N3JA 3MO5A 3M54A 4RZ0A 4JDSA 4YPAA 1PEGA 3FPDA 3PDNA 5ARFA 2RFIA 3CBPA 4NJ5A 3EP0A 5ARGA 3OXGA 4LDGA 4IJ8A 4J7FA 5KJNA 2G46A 3DB5A 3K5KA 3M57A 3M5AA 1XQHA 1H3IA 3MEKA 5F6LA 5T5GA 5CPRB 5TH7A 3S8PA 4WUYA 3DALA 2W5ZA 5JHNA 3M55A 5JIYA 3F9ZA 4YPUA 4I51A 4E47A 2F69A 5AYFA 5CCMA 5EX3A 3TG5A 4MI5A 3M56A 3F9YA 4MI0A 5TTFA 4YNPA 4C1QA 2JV0A 4O6FA 3QWVA 4J83A 1MVXA 3OXLA 4J8OA 5HQ8A 3IHXA 5CCLA 2BQZA 3S7BA 4NVQA 3M58A 3F9XA 4QEPA 3QWWA 3CBMA 3MO0A 4JLGA 4FMUA 3TG4A 4YPEA 4YNMA 5EG2A 5HI7A 3QWPA 1N6AA 3RQ4A 5TEGA 3F9WA 3N71A 4J7IA 5EX0A 3S7FA 5JINA 2IGQA 3VV0A 5LSZA 4IJDA 3KMAA 3CBOA 3M53A 3OS5A 5F5EA 2R3AA 5T0MA 1MT6A 4QEOA 5F6KC 4AU7A 3M59A 4O30A 3SWCA 4QENA 3RAYA 3RIBA 1MUFA 3OOIA 3HNAA 3S7JA 2QPWA 1ML9A 3VUZA 3OPEA 1MVHA 3RU0A 3KMTA 2O8JA 5T0KA
chains in the Genus database with same CATH topology
5KJMA 3S7DA 1O9SA 5JJ0A 2W5YA 5LSXA 1ZKKA 3MO2A 4H12A 3BO5A 1N6CA 3KMJA 4Z4PA 4YNDA 5KJKA 3OXFA 4BUPA 5KJLA 3SW9A 5F59A 3RJWA 1N3JA 3MO5A 3M54A 4RZ0A 4JDSA 4YPAA 1PEGA 3FPDA 3PDNA 5ARFA 2RFIA 3CBPA 4NJ5A 3EP0A 5ARGA 3OXGA 4LDGA 4IJ8A 4J7FA 5KJNA 2G46A 3DB5A 3K5KA 3M57A 3M5AA 1XQHA 1H3IA 3MEKA 5F6LA 5T5GA 5CPRB 5TH7A 3S8PA 4WUYA 3DALA 2W5ZA 5JHNA 3M55A 5JIYA 3F9ZA 4YPUA 4I51A 4E47A 2F69A 5AYFA 5CCMA 5EX3A 3TG5A 4MI5A 3M56A 3F9YA 4MI0A 5TTFA 4YNPA 4C1QA 2JV0A 4O6FA 3QWVA 4J83A 1MVXA 3OXLA 4J8OA 5HQ8A 3IHXA 5CCLA 2BQZA 3S7BA 4NVQA 3M58A 3F9XA 4QEPA 3QWWA 3CBMA 3MO0A 4JLGA 4FMUA 3TG4A 4YPEA 4YNMA 5EG2A 5HI7A 3QWPA 1N6AA 3RQ4A 5TEGA 3F9WA 3N71A 4J7IA 5EX0A 3S7FA 5JINA 2IGQA 3VV0A 5LSZA 4IJDA 3KMAA 3CBOA 3M53A 3OS5A 5F5EA 2R3AA 5T0MA 1MT6A 4QEOA 5F6KC 4AU7A 3M59A 4O30A 3SWCA 4QENA 3RAYA 3RIBA 1MUFA 3OOIA 3HNAA 3S7JA 2QPWA 1ML9A 3VUZA 3OPEA 1MVHA 3RU0A 3KMTA 2O8JA 5T0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJM A;  3S7D A;  1O9S A;  5JJ0 A;  2W5Y A;  5LSX A;  1ZKK A;  3MO2 A;  4H12 A;  3BO5 A;  1N6C A;  3KMJ A;  4Z4P A;  4YND A;  5KJK A;  3OXF A;  4BUP A;  5KJL A;  3SW9 A;  5F59 A;  3RJW A;  1N3J A;  3MO5 A;  3M54 A;  4RZ0 A;  4JDS A;  4YPA A;  1PEG A;  3FPD A;  3PDN A;  5ARF A;  2RFI A;  3CBP A;  4NJ5 A;  3EP0 A;  5ARG A;  3OXG A;  4LDG A;  4IJ8 A;  4J7F A;  5KJN A;  2G46 A;  3DB5 A;  3K5K A;  3M57 A;  3M5A A;  1XQH A;  1H3I A;  3MEK A;  5F6L A;  5T5G A;  5CPR B;  5TH7 A;  3S8P A;  4WUY A;  3DAL A;  2W5Z A;  5JHN A;  3M55 A;  5JIY A;  3F9Z A;  4YPU A;  4I51 A;  4E47 A;  2F69 A;  5AYF A;  5CCM A;  5EX3 A;  3TG5 A;  4MI5 A;  3M56 A;  3F9Y A;  4MI0 A;  5TTF A;  4YNP A;  4C1Q A;  2JV0 A;  4O6F A;  3QWV A;  4J83 A;  1MVX A;  3OXL A;  4J8O A;  5HQ8 A;  3IHX A;  5CCL A;  2BQZ A;  3S7B A;  4NVQ A;  3M58 A;  3F9X A;  4QEP A;  3QWW A;  3CBM A;  3MO0 A;  4JLG A;  4FMU A;  3TG4 A;  4YPE A;  4YNM A;  5EG2 A;  5HI7 A;  3QWP A;  1N6A A;  3RQ4 A;  5TEG A;  3F9W A;  3N71 A;  4J7I A;  5EX0 A;  3S7F A;  5JIN A;  2IGQ A;  3VV0 A;  5LSZ A;  4IJD A;  3KMA A;  3CBO A;  3M53 A;  3OS5 A;  5F5E A;  2R3A A;  5T0M A;  1MT6 A;  4QEO A;  5F6K C;  4AU7 A;  3M59 A;  4O30 A;  3SWC A;  4QEN A;  3RAY A;  3RIB A;  1MUF A;  3OOI A;  3HNA A;  3S7J A;  2QPW A;  1ML9 A;  3VUZ A;  3OPE A;  1MVH A;  3RU0 A;  3KMT A;  2O8J A;  5T0K A; 
#chains in the Genus database with same CATH topology
 5KJM A;  3S7D A;  1O9S A;  5JJ0 A;  2W5Y A;  5LSX A;  1ZKK A;  3MO2 A;  4H12 A;  3BO5 A;  1N6C A;  3KMJ A;  4Z4P A;  4YND A;  5KJK A;  3OXF A;  4BUP A;  5KJL A;  3SW9 A;  5F59 A;  3RJW A;  1N3J A;  3MO5 A;  3M54 A;  4RZ0 A;  4JDS A;  4YPA A;  1PEG A;  3FPD A;  3PDN A;  5ARF A;  2RFI A;  3CBP A;  4NJ5 A;  3EP0 A;  5ARG A;  3OXG A;  4LDG A;  4IJ8 A;  4J7F A;  5KJN A;  2G46 A;  3DB5 A;  3K5K A;  3M57 A;  3M5A A;  1XQH A;  1H3I A;  3MEK A;  5F6L A;  5T5G A;  5CPR B;  5TH7 A;  3S8P A;  4WUY A;  3DAL A;  2W5Z A;  5JHN A;  3M55 A;  5JIY A;  3F9Z A;  4YPU A;  4I51 A;  4E47 A;  2F69 A;  5AYF A;  5CCM A;  5EX3 A;  3TG5 A;  4MI5 A;  3M56 A;  3F9Y A;  4MI0 A;  5TTF A;  4YNP A;  4C1Q A;  2JV0 A;  4O6F A;  3QWV A;  4J83 A;  1MVX A;  3OXL A;  4J8O A;  5HQ8 A;  3IHX A;  5CCL A;  2BQZ A;  3S7B A;  4NVQ A;  3M58 A;  3F9X A;  4QEP A;  3QWW A;  3CBM A;  3MO0 A;  4JLG A;  4FMU A;  3TG4 A;  4YPE A;  4YNM A;  5EG2 A;  5HI7 A;  3QWP A;  1N6A A;  3RQ4 A;  5TEG A;  3F9W A;  3N71 A;  4J7I A;  5EX0 A;  3S7F A;  5JIN A;  2IGQ A;  3VV0 A;  5LSZ A;  4IJD A;  3KMA A;  3CBO A;  3M53 A;  3OS5 A;  5F5E A;  2R3A A;  5T0M A;  1MT6 A;  4QEO A;  5F6K C;  4AU7 A;  3M59 A;  4O30 A;  3SWC A;  4QEN A;  3RAY A;  3RIB A;  1MUF A;  3OOI A;  3HNA A;  3S7J A;  2QPW A;  1ML9 A;  3VUZ A;  3OPE A;  1MVH A;  3RU0 A;  3KMT A;  2O8J A;  5T0K A; 
#chains in the Genus database with same CATH homology
 5KJM A;  3S7D A;  1O9S A;  5JJ0 A;  2W5Y A;  5LSX A;  1ZKK A;  3MO2 A;  4H12 A;  3BO5 A;  1N6C A;  3KMJ A;  4Z4P A;  4YND A;  5KJK A;  3OXF A;  4BUP A;  5KJL A;  3SW9 A;  5F59 A;  3RJW A;  1N3J A;  3MO5 A;  3M54 A;  4RZ0 A;  4JDS A;  4YPA A;  1PEG A;  3FPD A;  3PDN A;  5ARF A;  2RFI A;  3CBP A;  4NJ5 A;  3EP0 A;  5ARG A;  3OXG A;  4LDG A;  4IJ8 A;  4J7F A;  5KJN A;  2G46 A;  3DB5 A;  3K5K A;  3M57 A;  3M5A A;  1XQH A;  1H3I A;  3MEK A;  5F6L A;  5T5G A;  5CPR B;  5TH7 A;  3S8P A;  4WUY A;  3DAL A;  2W5Z A;  5JHN A;  3M55 A;  5JIY A;  3F9Z A;  4YPU A;  4I51 A;  4E47 A;  2F69 A;  5AYF A;  5CCM A;  5EX3 A;  3TG5 A;  4MI5 A;  3M56 A;  3F9Y A;  4MI0 A;  5TTF A;  4YNP A;  4C1Q A;  2JV0 A;  4O6F A;  3QWV A;  4J83 A;  1MVX A;  3OXL A;  4J8O A;  5HQ8 A;  3IHX A;  5CCL A;  2BQZ A;  3S7B A;  4NVQ A;  3M58 A;  3F9X A;  4QEP A;  3QWW A;  3CBM A;  3MO0 A;  4JLG A;  4FMU A;  3TG4 A;  4YPE A;  4YNM A;  5EG2 A;  5HI7 A;  3QWP A;  1N6A A;  3RQ4 A;  5TEG A;  3F9W A;  3N71 A;  4J7I A;  5EX0 A;  3S7F A;  5JIN A;  2IGQ A;  3VV0 A;  5LSZ A;  4IJD A;  3KMA A;  3CBO A;  3M53 A;  3OS5 A;  5F5E A;  2R3A A;  5T0M A;  1MT6 A;  4QEO A;  5F6K C;  4AU7 A;  3M59 A;  4O30 A;  3SWC A;  4QEN A;  3RAY A;  3RIB A;  1MUF A;  3OOI A;  3HNA A;  3S7J A;  2QPW A;  1ML9 A;  3VUZ A;  3OPE A;  1MVH A;  3RU0 A;  3KMT A;  2O8J A;  5T0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...