5F6LA

The crystal structure of mll1 (n3861i/q3867l) in complex with rbbp5 and ash2l
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
153
Chain Sequence
LPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGIVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Retinoblastoma-binding protein 5
total genus 44
structure length 153
sequence length 156
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f6lA00
3DB5A 4IJDA 3FPDA 1MVHA 5F6KC 3M54A 5JIYA 3QWPA 1N6CA 5CCLA 1ZKKA 3VV0A 3RQ4A 5AYFA 2G46A 3BO5A 1N6AA 4O6FA 3CBOA 5TEGA 5KJLA 3S7FA 2BQZA 3EP0A 3M58A 5F6LA 5HI7A 5LSXA 3CBMA 4YNMA 1N3JA 2QPWA 4J7FA 1MVXA 5CCMA 3QWVA 5JJ0A 1ML9A 3KMJA 3SWCA 3KMAA 5F5EA 4H12A 4C1QA 3OXFA 4FMUA 3OXLA 5T0KA 3F9XA 3M59A 3TG5A 4YNDA 3OXGA 4IJ8A 3VUZA 2R3AA 2F69A 4NJ5A 1MUFA 5KJKA 4Z4PA 3CBPA 4AU7A 4J83A 2IGQA 5TTFA 3MO0A 2RFIA 3K5KA 3S7JA 3DALA 3RIBA 5F59A 5T5GA 4YNPA 5HQ8A 3OOIA 5KJMA 4JLGA 3S7DA 3S7BA 4J8OA 3KMTA 3M55A 3OPEA 2JV0A 4QEPA 4QENA 5JHNA 3RAYA 3F9WA 4LDGA 2W5YA 5TH7A 5LSZA 5EX3A 3MO5A 5EX0A 4BUPA 3N71A 3IHXA 5KJNA 4I51A 5EG2A 2W5ZA 3MO2A 4YPAA 4MI0A 3PDNA 1MT6A 3HNAA 5CPRB 1XQHA 3RU0A 4NVQA 4RZ0A 3S8PA 4JDSA 1H3IA 4MI5A 4O30A 3RJWA 5ARFA 4QEOA 3F9YA 3M53A 5ARGA 4J7IA 1PEGA 4E47A 3QWWA 3F9ZA 3OS5A 4YPEA 5T0MA 4WUYA 3M56A 3M5AA 1O9SA 5JINA 2O8JA 4YPUA 3TG4A 3MEKA 3SW9A 3M57A
chains in the Genus database with same CATH superfamily
3DB5A 4IJDA 3FPDA 1MVHA 5F6KC 3M54A 5JIYA 3QWPA 1N6CA 5CCLA 1ZKKA 3VV0A 3RQ4A 5AYFA 2G46A 3BO5A 1N6AA 4O6FA 3CBOA 5TEGA 5KJLA 3S7FA 2BQZA 3EP0A 3M58A 5F6LA 5HI7A 5LSXA 3CBMA 4YNMA 1N3JA 2QPWA 4J7FA 1MVXA 5CCMA 3QWVA 5JJ0A 1ML9A 3KMJA 3SWCA 3KMAA 5F5EA 4H12A 4C1QA 3OXFA 4FMUA 3OXLA 5T0KA 3F9XA 3M59A 3TG5A 4YNDA 3OXGA 4IJ8A 3VUZA 2R3AA 2F69A 4NJ5A 1MUFA 5KJKA 4Z4PA 3CBPA 4AU7A 4J83A 2IGQA 5TTFA 3MO0A 2RFIA 3K5KA 3S7JA 3DALA 3RIBA 5F59A 5T5GA 4YNPA 5HQ8A 3OOIA 5KJMA 4JLGA 3S7DA 3S7BA 4J8OA 3KMTA 3M55A 3OPEA 2JV0A 4QEPA 4QENA 5JHNA 3RAYA 3F9WA 4LDGA 2W5YA 5TH7A 5LSZA 5EX3A 3MO5A 5EX0A 4BUPA 3N71A 3IHXA 5KJNA 4I51A 5EG2A 2W5ZA 3MO2A 4YPAA 4MI0A 3PDNA 1MT6A 3HNAA 5CPRB 1XQHA 3RU0A 4NVQA 4RZ0A 3S8PA 4JDSA 1H3IA 4MI5A 4O30A 3RJWA 5ARFA 4QEOA 3F9YA 3M53A 5ARGA 4J7IA 1PEGA 4E47A 3QWWA 3F9ZA 3OS5A 4YPEA 5T0MA 4WUYA 3M56A 3M5AA 1O9SA 5JINA 2O8JA 4YPUA 3TG4A 3MEKA 3SW9A 3M57A
chains in the Genus database with same CATH topology
3DB5A 4IJDA 3FPDA 1MVHA 5F6KC 3M54A 5JIYA 3QWPA 1N6CA 5CCLA 1ZKKA 3VV0A 3RQ4A 5AYFA 2G46A 3BO5A 1N6AA 4O6FA 3CBOA 5TEGA 5KJLA 3S7FA 2BQZA 3EP0A 3M58A 5F6LA 5HI7A 5LSXA 3CBMA 4YNMA 1N3JA 2QPWA 4J7FA 1MVXA 5CCMA 3QWVA 5JJ0A 1ML9A 3KMJA 3SWCA 3KMAA 5F5EA 4H12A 4C1QA 3OXFA 4FMUA 3OXLA 5T0KA 3F9XA 3M59A 3TG5A 4YNDA 3OXGA 4IJ8A 3VUZA 2R3AA 2F69A 4NJ5A 1MUFA 5KJKA 4Z4PA 3CBPA 4AU7A 4J83A 2IGQA 5TTFA 3MO0A 2RFIA 3K5KA 3S7JA 3DALA 3RIBA 5F59A 5T5GA 4YNPA 5HQ8A 3OOIA 5KJMA 4JLGA 3S7DA 3S7BA 4J8OA 3KMTA 3M55A 3OPEA 2JV0A 4QEPA 4QENA 5JHNA 3RAYA 3F9WA 4LDGA 2W5YA 5TH7A 5LSZA 5EX3A 3MO5A 5EX0A 4BUPA 3N71A 3IHXA 5KJNA 4I51A 5EG2A 2W5ZA 3MO2A 4YPAA 4MI0A 3PDNA 1MT6A 3HNAA 5CPRB 1XQHA 3RU0A 4NVQA 4RZ0A 3S8PA 4JDSA 1H3IA 4MI5A 4O30A 3RJWA 5ARFA 4QEOA 3F9YA 3M53A 5ARGA 4J7IA 1PEGA 4E47A 3QWWA 3F9ZA 3OS5A 4YPEA 5T0MA 4WUYA 3M56A 3M5AA 1O9SA 5JINA 2O8JA 4YPUA 3TG4A 3MEKA 3SW9A 3M57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB5 A;  4IJD A;  3FPD A;  1MVH A;  5F6K C;  3M54 A;  5JIY A;  3QWP A;  1N6C A;  5CCL A;  1ZKK A;  3VV0 A;  3RQ4 A;  5AYF A;  2G46 A;  3BO5 A;  1N6A A;  4O6F A;  3CBO A;  5TEG A;  5KJL A;  3S7F A;  2BQZ A;  3EP0 A;  3M58 A;  5F6L A;  5HI7 A;  5LSX A;  3CBM A;  4YNM A;  1N3J A;  2QPW A;  4J7F A;  1MVX A;  5CCM A;  3QWV A;  5JJ0 A;  1ML9 A;  3KMJ A;  3SWC A;  3KMA A;  5F5E A;  4H12 A;  4C1Q A;  3OXF A;  4FMU A;  3OXL A;  5T0K A;  3F9X A;  3M59 A;  3TG5 A;  4YND A;  3OXG A;  4IJ8 A;  3VUZ A;  2R3A A;  2F69 A;  4NJ5 A;  1MUF A;  5KJK A;  4Z4P A;  3CBP A;  4AU7 A;  4J83 A;  2IGQ A;  5TTF A;  3MO0 A;  2RFI A;  3K5K A;  3S7J A;  3DAL A;  3RIB A;  5F59 A;  5T5G A;  4YNP A;  5HQ8 A;  3OOI A;  5KJM A;  4JLG A;  3S7D A;  3S7B A;  4J8O A;  3KMT A;  3M55 A;  3OPE A;  2JV0 A;  4QEP A;  4QEN A;  5JHN A;  3RAY A;  3F9W A;  4LDG A;  2W5Y A;  5TH7 A;  5LSZ A;  5EX3 A;  3MO5 A;  5EX0 A;  4BUP A;  3N71 A;  3IHX A;  5KJN A;  4I51 A;  5EG2 A;  2W5Z A;  3MO2 A;  4YPA A;  4MI0 A;  3PDN A;  1MT6 A;  3HNA A;  5CPR B;  1XQH A;  3RU0 A;  4NVQ A;  4RZ0 A;  3S8P A;  4JDS A;  1H3I A;  4MI5 A;  4O30 A;  3RJW A;  5ARF A;  4QEO A;  3F9Y A;  3M53 A;  5ARG A;  4J7I A;  1PEG A;  4E47 A;  3QWW A;  3F9Z A;  3OS5 A;  4YPE A;  5T0M A;  4WUY A;  3M56 A;  3M5A A;  1O9S A;  5JIN A;  2O8J A;  4YPU A;  3TG4 A;  3MEK A;  3SW9 A;  3M57 A; 
#chains in the Genus database with same CATH topology
 3DB5 A;  4IJD A;  3FPD A;  1MVH A;  5F6K C;  3M54 A;  5JIY A;  3QWP A;  1N6C A;  5CCL A;  1ZKK A;  3VV0 A;  3RQ4 A;  5AYF A;  2G46 A;  3BO5 A;  1N6A A;  4O6F A;  3CBO A;  5TEG A;  5KJL A;  3S7F A;  2BQZ A;  3EP0 A;  3M58 A;  5F6L A;  5HI7 A;  5LSX A;  3CBM A;  4YNM A;  1N3J A;  2QPW A;  4J7F A;  1MVX A;  5CCM A;  3QWV A;  5JJ0 A;  1ML9 A;  3KMJ A;  3SWC A;  3KMA A;  5F5E A;  4H12 A;  4C1Q A;  3OXF A;  4FMU A;  3OXL A;  5T0K A;  3F9X A;  3M59 A;  3TG5 A;  4YND A;  3OXG A;  4IJ8 A;  3VUZ A;  2R3A A;  2F69 A;  4NJ5 A;  1MUF A;  5KJK A;  4Z4P A;  3CBP A;  4AU7 A;  4J83 A;  2IGQ A;  5TTF A;  3MO0 A;  2RFI A;  3K5K A;  3S7J A;  3DAL A;  3RIB A;  5F59 A;  5T5G A;  4YNP A;  5HQ8 A;  3OOI A;  5KJM A;  4JLG A;  3S7D A;  3S7B A;  4J8O A;  3KMT A;  3M55 A;  3OPE A;  2JV0 A;  4QEP A;  4QEN A;  5JHN A;  3RAY A;  3F9W A;  4LDG A;  2W5Y A;  5TH7 A;  5LSZ A;  5EX3 A;  3MO5 A;  5EX0 A;  4BUP A;  3N71 A;  3IHX A;  5KJN A;  4I51 A;  5EG2 A;  2W5Z A;  3MO2 A;  4YPA A;  4MI0 A;  3PDN A;  1MT6 A;  3HNA A;  5CPR B;  1XQH A;  3RU0 A;  4NVQ A;  4RZ0 A;  3S8P A;  4JDS A;  1H3I A;  4MI5 A;  4O30 A;  3RJW A;  5ARF A;  4QEO A;  3F9Y A;  3M53 A;  5ARG A;  4J7I A;  1PEG A;  4E47 A;  3QWW A;  3F9Z A;  3OS5 A;  4YPE A;  5T0M A;  4WUY A;  3M56 A;  3M5A A;  1O9S A;  5JIN A;  2O8J A;  4YPU A;  3TG4 A;  3MEK A;  3SW9 A;  3M57 A; 
#chains in the Genus database with same CATH homology
 3DB5 A;  4IJD A;  3FPD A;  1MVH A;  5F6K C;  3M54 A;  5JIY A;  3QWP A;  1N6C A;  5CCL A;  1ZKK A;  3VV0 A;  3RQ4 A;  5AYF A;  2G46 A;  3BO5 A;  1N6A A;  4O6F A;  3CBO A;  5TEG A;  5KJL A;  3S7F A;  2BQZ A;  3EP0 A;  3M58 A;  5F6L A;  5HI7 A;  5LSX A;  3CBM A;  4YNM A;  1N3J A;  2QPW A;  4J7F A;  1MVX A;  5CCM A;  3QWV A;  5JJ0 A;  1ML9 A;  3KMJ A;  3SWC A;  3KMA A;  5F5E A;  4H12 A;  4C1Q A;  3OXF A;  4FMU A;  3OXL A;  5T0K A;  3F9X A;  3M59 A;  3TG5 A;  4YND A;  3OXG A;  4IJ8 A;  3VUZ A;  2R3A A;  2F69 A;  4NJ5 A;  1MUF A;  5KJK A;  4Z4P A;  3CBP A;  4AU7 A;  4J83 A;  2IGQ A;  5TTF A;  3MO0 A;  2RFI A;  3K5K A;  3S7J A;  3DAL A;  3RIB A;  5F59 A;  5T5G A;  4YNP A;  5HQ8 A;  3OOI A;  5KJM A;  4JLG A;  3S7D A;  3S7B A;  4J8O A;  3KMT A;  3M55 A;  3OPE A;  2JV0 A;  4QEP A;  4QEN A;  5JHN A;  3RAY A;  3F9W A;  4LDG A;  2W5Y A;  5TH7 A;  5LSZ A;  5EX3 A;  3MO5 A;  5EX0 A;  4BUP A;  3N71 A;  3IHX A;  5KJN A;  4I51 A;  5EG2 A;  2W5Z A;  3MO2 A;  4YPA A;  4MI0 A;  3PDN A;  1MT6 A;  3HNA A;  5CPR B;  1XQH A;  3RU0 A;  4NVQ A;  4RZ0 A;  3S8P A;  4JDS A;  1H3I A;  4MI5 A;  4O30 A;  3RJW A;  5ARF A;  4QEO A;  3F9Y A;  3M53 A;  5ARG A;  4J7I A;  1PEG A;  4E47 A;  3QWW A;  3F9Z A;  3OS5 A;  4YPE A;  5T0M A;  4WUY A;  3M56 A;  3M5A A;  1O9S A;  5JIN A;  2O8J A;  4YPU A;  3TG4 A;  3MEK A;  3SW9 A;  3M57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...