5F6LA

The crystal structure of mll1 (n3861i/q3867l) in complex with rbbp5 and ash2l
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
153
Chain Sequence
LPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGIVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/transferase
molecule keywords Retinoblastoma-binding protein 5
publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 153
sequence length 156
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f6lA00
5TTFA 5JIYA 5CPRB 3TG4A 4FMUA 4YNPA 4JLGA 5JINA 5CCLA 2BQZA 3QWWA 1H3IA 4J83A 4YPAA 3M55A 5KJMA 3M54A 5LSXA 3SWCA 5KJKA 3KMTA 4WUYA 3F9ZA 3F9YA 1N3JA 1XQHA 5AYFA 3TG5A 4YPEA 3S7DA 3MEKA 5ARGA 3CBMA 4J7IA 4YNMA 4MI5A 1ML9A 1MVHA 3CBPA 5TH7A 3F9WA 3EP0A 4IJ8A 3M57A 3M59A 2W5ZA 4RZ0A 4YPUA 3RJWA 3OXFA 5KJLA 3N71A 5HQ8A 5EG2A 3MO2A 3CBOA 3DALA 1N6CA 3HNAA 5EX3A 5ARFA 3RU0A 4QEPA 4NVQA 5T0KA 3OPEA 4YNDA 5KJNA 1PEGA 3PDNA 3F9XA 4IJDA 5JHNA 4LDGA 3OOIA 2RFIA 5HI7A 1MT6A 4O30A 3RAYA 4AU7A 3OXGA 3RQ4A 3MO0A 4E47A 1MVXA 3M53A 3BO5A 3KMJA 3S7BA 4NJ5A 5F5EA 4Z4PA 3FPDA 3S7JA 3SW9A 2JV0A 5T0MA 4H12A 4J8OA 3M5AA 5TEGA 1O9SA 3OS5A 3QWPA 3KMAA 5F59A 2F69A 5F6KC 3K5KA 5CCMA 3MO5A 1MUFA 4C1QA 3RIBA 3M58A 5EX0A 4BUPA 3IHXA 2IGQA 5JJ0A 5T5GA 3S7FA 4J7FA 5F6LA 4I51A 1N6AA 2G46A 5LSZA 4QEOA 4MI0A 4JDSA 3VV0A 3DB5A 2R3AA 2W5YA 3M56A 3VUZA 2O8JA 4O6FA 3S8PA 3QWVA 2QPWA 4QENA 1ZKKA 3OXLA
chains in the Genus database with same CATH superfamily
5TTFA 5JIYA 5CPRB 3TG4A 4FMUA 4YNPA 4JLGA 5JINA 5CCLA 2BQZA 3QWWA 1H3IA 4J83A 4YPAA 3M55A 5KJMA 3M54A 5LSXA 3SWCA 5KJKA 3KMTA 4WUYA 3F9ZA 3F9YA 1N3JA 1XQHA 5AYFA 3TG5A 4YPEA 3S7DA 3MEKA 5ARGA 3CBMA 4J7IA 4YNMA 4MI5A 1ML9A 1MVHA 3CBPA 5TH7A 3F9WA 3EP0A 4IJ8A 3M57A 3M59A 2W5ZA 4RZ0A 4YPUA 3RJWA 3OXFA 5KJLA 3N71A 5HQ8A 5EG2A 3MO2A 3CBOA 3DALA 1N6CA 3HNAA 5EX3A 5ARFA 3RU0A 4QEPA 4NVQA 5T0KA 3OPEA 4YNDA 5KJNA 1PEGA 3PDNA 3F9XA 4IJDA 5JHNA 4LDGA 3OOIA 2RFIA 5HI7A 1MT6A 4O30A 3RAYA 4AU7A 3OXGA 3RQ4A 3MO0A 4E47A 1MVXA 3M53A 3BO5A 3KMJA 3S7BA 4NJ5A 5F5EA 4Z4PA 3FPDA 3S7JA 3SW9A 2JV0A 5T0MA 4H12A 4J8OA 3M5AA 5TEGA 1O9SA 3OS5A 3QWPA 3KMAA 5F59A 2F69A 5F6KC 3K5KA 5CCMA 3MO5A 1MUFA 4C1QA 3RIBA 3M58A 5EX0A 4BUPA 3IHXA 2IGQA 5JJ0A 5T5GA 3S7FA 4J7FA 5F6LA 4I51A 1N6AA 2G46A 5LSZA 4QEOA 4MI0A 4JDSA 3VV0A 3DB5A 2R3AA 2W5YA 3M56A 3VUZA 2O8JA 4O6FA 3S8PA 3QWVA 2QPWA 4QENA 1ZKKA 3OXLA
chains in the Genus database with same CATH topology
5TTFA 5JIYA 5CPRB 3TG4A 4FMUA 4YNPA 4JLGA 5JINA 5CCLA 2BQZA 3QWWA 1H3IA 4J83A 4YPAA 3M55A 5KJMA 3M54A 5LSXA 3SWCA 5KJKA 3KMTA 4WUYA 3F9ZA 3F9YA 1N3JA 1XQHA 5AYFA 3TG5A 4YPEA 3S7DA 3MEKA 5ARGA 3CBMA 4J7IA 4YNMA 4MI5A 1ML9A 1MVHA 3CBPA 5TH7A 3F9WA 3EP0A 4IJ8A 3M57A 3M59A 2W5ZA 4RZ0A 4YPUA 3RJWA 3OXFA 5KJLA 3N71A 5HQ8A 5EG2A 3MO2A 3CBOA 3DALA 1N6CA 3HNAA 5EX3A 5ARFA 3RU0A 4QEPA 4NVQA 5T0KA 3OPEA 4YNDA 5KJNA 1PEGA 3PDNA 3F9XA 4IJDA 5JHNA 4LDGA 3OOIA 2RFIA 5HI7A 1MT6A 4O30A 3RAYA 4AU7A 3OXGA 3RQ4A 3MO0A 4E47A 1MVXA 3M53A 3BO5A 3KMJA 3S7BA 4NJ5A 5F5EA 4Z4PA 3FPDA 3S7JA 3SW9A 2JV0A 5T0MA 4H12A 4J8OA 3M5AA 5TEGA 1O9SA 3OS5A 3QWPA 3KMAA 5F59A 2F69A 5F6KC 3K5KA 5CCMA 3MO5A 1MUFA 4C1QA 3RIBA 3M58A 5EX0A 4BUPA 3IHXA 2IGQA 5JJ0A 5T5GA 3S7FA 4J7FA 5F6LA 4I51A 1N6AA 2G46A 5LSZA 4QEOA 4MI0A 4JDSA 3VV0A 3DB5A 2R3AA 2W5YA 3M56A 3VUZA 2O8JA 4O6FA 3S8PA 3QWVA 2QPWA 4QENA 1ZKKA 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TTF A;  5JIY A;  5CPR B;  3TG4 A;  4FMU A;  4YNP A;  4JLG A;  5JIN A;  5CCL A;  2BQZ A;  3QWW A;  1H3I A;  4J83 A;  4YPA A;  3M55 A;  5KJM A;  3M54 A;  5LSX A;  3SWC A;  5KJK A;  3KMT A;  4WUY A;  3F9Z A;  3F9Y A;  1N3J A;  1XQH A;  5AYF A;  3TG5 A;  4YPE A;  3S7D A;  3MEK A;  5ARG A;  3CBM A;  4J7I A;  4YNM A;  4MI5 A;  1ML9 A;  1MVH A;  3CBP A;  5TH7 A;  3F9W A;  3EP0 A;  4IJ8 A;  3M57 A;  3M59 A;  2W5Z A;  4RZ0 A;  4YPU A;  3RJW A;  3OXF A;  5KJL A;  3N71 A;  5HQ8 A;  5EG2 A;  3MO2 A;  3CBO A;  3DAL A;  1N6C A;  3HNA A;  5EX3 A;  5ARF A;  3RU0 A;  4QEP A;  4NVQ A;  5T0K A;  3OPE A;  4YND A;  5KJN A;  1PEG A;  3PDN A;  3F9X A;  4IJD A;  5JHN A;  4LDG A;  3OOI A;  2RFI A;  5HI7 A;  1MT6 A;  4O30 A;  3RAY A;  4AU7 A;  3OXG A;  3RQ4 A;  3MO0 A;  4E47 A;  1MVX A;  3M53 A;  3BO5 A;  3KMJ A;  3S7B A;  4NJ5 A;  5F5E A;  4Z4P A;  3FPD A;  3S7J A;  3SW9 A;  2JV0 A;  5T0M A;  4H12 A;  4J8O A;  3M5A A;  5TEG A;  1O9S A;  3OS5 A;  3QWP A;  3KMA A;  5F59 A;  2F69 A;  5F6K C;  3K5K A;  5CCM A;  3MO5 A;  1MUF A;  4C1Q A;  3RIB A;  3M58 A;  5EX0 A;  4BUP A;  3IHX A;  2IGQ A;  5JJ0 A;  5T5G A;  3S7F A;  4J7F A;  5F6L A;  4I51 A;  1N6A A;  2G46 A;  5LSZ A;  4QEO A;  4MI0 A;  4JDS A;  3VV0 A;  3DB5 A;  2R3A A;  2W5Y A;  3M56 A;  3VUZ A;  2O8J A;  4O6F A;  3S8P A;  3QWV A;  2QPW A;  4QEN A;  1ZKK A;  3OXL A; 
#chains in the Genus database with same CATH topology
 5TTF A;  5JIY A;  5CPR B;  3TG4 A;  4FMU A;  4YNP A;  4JLG A;  5JIN A;  5CCL A;  2BQZ A;  3QWW A;  1H3I A;  4J83 A;  4YPA A;  3M55 A;  5KJM A;  3M54 A;  5LSX A;  3SWC A;  5KJK A;  3KMT A;  4WUY A;  3F9Z A;  3F9Y A;  1N3J A;  1XQH A;  5AYF A;  3TG5 A;  4YPE A;  3S7D A;  3MEK A;  5ARG A;  3CBM A;  4J7I A;  4YNM A;  4MI5 A;  1ML9 A;  1MVH A;  3CBP A;  5TH7 A;  3F9W A;  3EP0 A;  4IJ8 A;  3M57 A;  3M59 A;  2W5Z A;  4RZ0 A;  4YPU A;  3RJW A;  3OXF A;  5KJL A;  3N71 A;  5HQ8 A;  5EG2 A;  3MO2 A;  3CBO A;  3DAL A;  1N6C A;  3HNA A;  5EX3 A;  5ARF A;  3RU0 A;  4QEP A;  4NVQ A;  5T0K A;  3OPE A;  4YND A;  5KJN A;  1PEG A;  3PDN A;  3F9X A;  4IJD A;  5JHN A;  4LDG A;  3OOI A;  2RFI A;  5HI7 A;  1MT6 A;  4O30 A;  3RAY A;  4AU7 A;  3OXG A;  3RQ4 A;  3MO0 A;  4E47 A;  1MVX A;  3M53 A;  3BO5 A;  3KMJ A;  3S7B A;  4NJ5 A;  5F5E A;  4Z4P A;  3FPD A;  3S7J A;  3SW9 A;  2JV0 A;  5T0M A;  4H12 A;  4J8O A;  3M5A A;  5TEG A;  1O9S A;  3OS5 A;  3QWP A;  3KMA A;  5F59 A;  2F69 A;  5F6K C;  3K5K A;  5CCM A;  3MO5 A;  1MUF A;  4C1Q A;  3RIB A;  3M58 A;  5EX0 A;  4BUP A;  3IHX A;  2IGQ A;  5JJ0 A;  5T5G A;  3S7F A;  4J7F A;  5F6L A;  4I51 A;  1N6A A;  2G46 A;  5LSZ A;  4QEO A;  4MI0 A;  4JDS A;  3VV0 A;  3DB5 A;  2R3A A;  2W5Y A;  3M56 A;  3VUZ A;  2O8J A;  4O6F A;  3S8P A;  3QWV A;  2QPW A;  4QEN A;  1ZKK A;  3OXL A; 
#chains in the Genus database with same CATH homology
 5TTF A;  5JIY A;  5CPR B;  3TG4 A;  4FMU A;  4YNP A;  4JLG A;  5JIN A;  5CCL A;  2BQZ A;  3QWW A;  1H3I A;  4J83 A;  4YPA A;  3M55 A;  5KJM A;  3M54 A;  5LSX A;  3SWC A;  5KJK A;  3KMT A;  4WUY A;  3F9Z A;  3F9Y A;  1N3J A;  1XQH A;  5AYF A;  3TG5 A;  4YPE A;  3S7D A;  3MEK A;  5ARG A;  3CBM A;  4J7I A;  4YNM A;  4MI5 A;  1ML9 A;  1MVH A;  3CBP A;  5TH7 A;  3F9W A;  3EP0 A;  4IJ8 A;  3M57 A;  3M59 A;  2W5Z A;  4RZ0 A;  4YPU A;  3RJW A;  3OXF A;  5KJL A;  3N71 A;  5HQ8 A;  5EG2 A;  3MO2 A;  3CBO A;  3DAL A;  1N6C A;  3HNA A;  5EX3 A;  5ARF A;  3RU0 A;  4QEP A;  4NVQ A;  5T0K A;  3OPE A;  4YND A;  5KJN A;  1PEG A;  3PDN A;  3F9X A;  4IJD A;  5JHN A;  4LDG A;  3OOI A;  2RFI A;  5HI7 A;  1MT6 A;  4O30 A;  3RAY A;  4AU7 A;  3OXG A;  3RQ4 A;  3MO0 A;  4E47 A;  1MVX A;  3M53 A;  3BO5 A;  3KMJ A;  3S7B A;  4NJ5 A;  5F5E A;  4Z4P A;  3FPD A;  3S7J A;  3SW9 A;  2JV0 A;  5T0M A;  4H12 A;  4J8O A;  3M5A A;  5TEG A;  1O9S A;  3OS5 A;  3QWP A;  3KMA A;  5F59 A;  2F69 A;  5F6K C;  3K5K A;  5CCM A;  3MO5 A;  1MUF A;  4C1Q A;  3RIB A;  3M58 A;  5EX0 A;  4BUP A;  3IHX A;  2IGQ A;  5JJ0 A;  5T5G A;  3S7F A;  4J7F A;  5F6L A;  4I51 A;  1N6A A;  2G46 A;  5LSZ A;  4QEO A;  4MI0 A;  4JDS A;  3VV0 A;  3DB5 A;  2R3A A;  2W5Y A;  3M56 A;  3VUZ A;  2O8J A;  4O6F A;  3S8P A;  3QWV A;  2QPW A;  4QEN A;  1ZKK A;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...