5F6LA

The crystal structure of mll1 (n3861i/q3867l) in complex with rbbp5 and ash2l
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
153
Chain Sequence
LPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGIVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Retinoblastoma-binding protein 5
total genus 44
structure length 153
sequence length 156
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5f6lA00
5T0MA 5AYFA 4J8OA 5KJMA 3M54A 3KMAA 3MO2A 5KJNA 2F69A 3KMJA 5HI7A 3CBMA 3DB5A 4YNDA 3F9WA 5ARGA 3OXLA 3RU0A 3RAYA 3K5KA 3MEKA 3MO0A 3QWVA 5ARFA 4YPEA 5T0KA 4MI0A 1XQHA 5TTFA 1N6CA 3M5AA 5CPRB 3RIBA 1MVHA 2W5ZA 4WUYA 2QPWA 2O8JA 3PDNA 1MT6A 3RQ4A 4YPUA 3IHXA 3M56A 5JIYA 5F6KC 1MUFA 3S7BA 3OXFA 3OOIA 1MVXA 3TG5A 4QEOA 2G46A 1ML9A 2RFIA 2BQZA 4J7IA 1N6AA 3SWCA 2R3AA 5LSZA 3KMTA 3S7FA 3F9XA 5CCLA 3RJWA 3VV0A 2IGQA 5EX3A 2W5YA 5TEGA 4IJDA 3M53A 5LSXA 5JHNA 4H12A 4QEPA 3VUZA 4BUPA 3M55A 4MI5A 3SW9A 1N3JA 5EX0A 4QENA 5CCMA 3M59A 4YNPA 4NJ5A 5HQ8A 3M58A 3QWPA 4O30A 4IJ8A 3BO5A 3S7JA 3QWWA 5JJ0A 3OS5A 5F6LA 5F5EA 3DALA 4YNMA 4JLGA 1O9SA 4I51A 3EP0A 5KJKA 3TG4A 4J83A 3M57A 3CBPA 5TH7A 1PEGA 3F9YA 3FPDA 4LDGA 5KJLA 4E47A 3MO5A 4Z4PA 1ZKKA 5JINA 4YPAA 3CBOA 4JDSA 4RZ0A 3HNAA 4C1QA 2JV0A 4AU7A 1H3IA 5T5GA 3S7DA 5F59A 4NVQA 3N71A 4O6FA 4FMUA 3OPEA 5EG2A 3S8PA 4J7FA 3F9ZA 3OXGA
chains in the Genus database with same CATH superfamily
5T0MA 5AYFA 4J8OA 5KJMA 3M54A 3KMAA 3MO2A 5KJNA 2F69A 3KMJA 5HI7A 3CBMA 3DB5A 4YNDA 3F9WA 5ARGA 3OXLA 3RU0A 3RAYA 3K5KA 3MEKA 3MO0A 3QWVA 5ARFA 4YPEA 5T0KA 4MI0A 1XQHA 5TTFA 1N6CA 3M5AA 5CPRB 3RIBA 1MVHA 2W5ZA 4WUYA 2QPWA 2O8JA 3PDNA 1MT6A 3RQ4A 4YPUA 3IHXA 3M56A 5JIYA 5F6KC 1MUFA 3S7BA 3OXFA 3OOIA 1MVXA 3TG5A 4QEOA 2G46A 1ML9A 2RFIA 2BQZA 4J7IA 1N6AA 3SWCA 2R3AA 5LSZA 3KMTA 3S7FA 3F9XA 5CCLA 3RJWA 3VV0A 2IGQA 5EX3A 2W5YA 5TEGA 4IJDA 3M53A 5LSXA 5JHNA 4H12A 4QEPA 3VUZA 4BUPA 3M55A 4MI5A 3SW9A 1N3JA 5EX0A 4QENA 5CCMA 3M59A 4YNPA 4NJ5A 5HQ8A 3M58A 3QWPA 4O30A 4IJ8A 3BO5A 3S7JA 3QWWA 5JJ0A 3OS5A 5F6LA 5F5EA 3DALA 4YNMA 4JLGA 1O9SA 4I51A 3EP0A 5KJKA 3TG4A 4J83A 3M57A 3CBPA 5TH7A 1PEGA 3F9YA 3FPDA 4LDGA 5KJLA 4E47A 3MO5A 4Z4PA 1ZKKA 5JINA 4YPAA 3CBOA 4JDSA 4RZ0A 3HNAA 4C1QA 2JV0A 4AU7A 1H3IA 5T5GA 3S7DA 5F59A 4NVQA 3N71A 4O6FA 4FMUA 3OPEA 5EG2A 3S8PA 4J7FA 3F9ZA 3OXGA
chains in the Genus database with same CATH topology
5T0MA 5AYFA 4J8OA 5KJMA 3M54A 3KMAA 3MO2A 5KJNA 2F69A 3KMJA 5HI7A 3CBMA 3DB5A 4YNDA 3F9WA 5ARGA 3OXLA 3RU0A 3RAYA 3K5KA 3MEKA 3MO0A 3QWVA 5ARFA 4YPEA 5T0KA 4MI0A 1XQHA 5TTFA 1N6CA 3M5AA 5CPRB 3RIBA 1MVHA 2W5ZA 4WUYA 2QPWA 2O8JA 3PDNA 1MT6A 3RQ4A 4YPUA 3IHXA 3M56A 5JIYA 5F6KC 1MUFA 3S7BA 3OXFA 3OOIA 1MVXA 3TG5A 4QEOA 2G46A 1ML9A 2RFIA 2BQZA 4J7IA 1N6AA 3SWCA 2R3AA 5LSZA 3KMTA 3S7FA 3F9XA 5CCLA 3RJWA 3VV0A 2IGQA 5EX3A 2W5YA 5TEGA 4IJDA 3M53A 5LSXA 5JHNA 4H12A 4QEPA 3VUZA 4BUPA 3M55A 4MI5A 3SW9A 1N3JA 5EX0A 4QENA 5CCMA 3M59A 4YNPA 4NJ5A 5HQ8A 3M58A 3QWPA 4O30A 4IJ8A 3BO5A 3S7JA 3QWWA 5JJ0A 3OS5A 5F6LA 5F5EA 3DALA 4YNMA 4JLGA 1O9SA 4I51A 3EP0A 5KJKA 3TG4A 4J83A 3M57A 3CBPA 5TH7A 1PEGA 3F9YA 3FPDA 4LDGA 5KJLA 4E47A 3MO5A 4Z4PA 1ZKKA 5JINA 4YPAA 3CBOA 4JDSA 4RZ0A 3HNAA 4C1QA 2JV0A 4AU7A 1H3IA 5T5GA 3S7DA 5F59A 4NVQA 3N71A 4O6FA 4FMUA 3OPEA 5EG2A 3S8PA 4J7FA 3F9ZA 3OXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T0M A;  5AYF A;  4J8O A;  5KJM A;  3M54 A;  3KMA A;  3MO2 A;  5KJN A;  2F69 A;  3KMJ A;  5HI7 A;  3CBM A;  3DB5 A;  4YND A;  3F9W A;  5ARG A;  3OXL A;  3RU0 A;  3RAY A;  3K5K A;  3MEK A;  3MO0 A;  3QWV A;  5ARF A;  4YPE A;  5T0K A;  4MI0 A;  1XQH A;  5TTF A;  1N6C A;  3M5A A;  5CPR B;  3RIB A;  1MVH A;  2W5Z A;  4WUY A;  2QPW A;  2O8J A;  3PDN A;  1MT6 A;  3RQ4 A;  4YPU A;  3IHX A;  3M56 A;  5JIY A;  5F6K C;  1MUF A;  3S7B A;  3OXF A;  3OOI A;  1MVX A;  3TG5 A;  4QEO A;  2G46 A;  1ML9 A;  2RFI A;  2BQZ A;  4J7I A;  1N6A A;  3SWC A;  2R3A A;  5LSZ A;  3KMT A;  3S7F A;  3F9X A;  5CCL A;  3RJW A;  3VV0 A;  2IGQ A;  5EX3 A;  2W5Y A;  5TEG A;  4IJD A;  3M53 A;  5LSX A;  5JHN A;  4H12 A;  4QEP A;  3VUZ A;  4BUP A;  3M55 A;  4MI5 A;  3SW9 A;  1N3J A;  5EX0 A;  4QEN A;  5CCM A;  3M59 A;  4YNP A;  4NJ5 A;  5HQ8 A;  3M58 A;  3QWP A;  4O30 A;  4IJ8 A;  3BO5 A;  3S7J A;  3QWW A;  5JJ0 A;  3OS5 A;  5F6L A;  5F5E A;  3DAL A;  4YNM A;  4JLG A;  1O9S A;  4I51 A;  3EP0 A;  5KJK A;  3TG4 A;  4J83 A;  3M57 A;  3CBP A;  5TH7 A;  1PEG A;  3F9Y A;  3FPD A;  4LDG A;  5KJL A;  4E47 A;  3MO5 A;  4Z4P A;  1ZKK A;  5JIN A;  4YPA A;  3CBO A;  4JDS A;  4RZ0 A;  3HNA A;  4C1Q A;  2JV0 A;  4AU7 A;  1H3I A;  5T5G A;  3S7D A;  5F59 A;  4NVQ A;  3N71 A;  4O6F A;  4FMU A;  3OPE A;  5EG2 A;  3S8P A;  4J7F A;  3F9Z A;  3OXG A; 
#chains in the Genus database with same CATH topology
 5T0M A;  5AYF A;  4J8O A;  5KJM A;  3M54 A;  3KMA A;  3MO2 A;  5KJN A;  2F69 A;  3KMJ A;  5HI7 A;  3CBM A;  3DB5 A;  4YND A;  3F9W A;  5ARG A;  3OXL A;  3RU0 A;  3RAY A;  3K5K A;  3MEK A;  3MO0 A;  3QWV A;  5ARF A;  4YPE A;  5T0K A;  4MI0 A;  1XQH A;  5TTF A;  1N6C A;  3M5A A;  5CPR B;  3RIB A;  1MVH A;  2W5Z A;  4WUY A;  2QPW A;  2O8J A;  3PDN A;  1MT6 A;  3RQ4 A;  4YPU A;  3IHX A;  3M56 A;  5JIY A;  5F6K C;  1MUF A;  3S7B A;  3OXF A;  3OOI A;  1MVX A;  3TG5 A;  4QEO A;  2G46 A;  1ML9 A;  2RFI A;  2BQZ A;  4J7I A;  1N6A A;  3SWC A;  2R3A A;  5LSZ A;  3KMT A;  3S7F A;  3F9X A;  5CCL A;  3RJW A;  3VV0 A;  2IGQ A;  5EX3 A;  2W5Y A;  5TEG A;  4IJD A;  3M53 A;  5LSX A;  5JHN A;  4H12 A;  4QEP A;  3VUZ A;  4BUP A;  3M55 A;  4MI5 A;  3SW9 A;  1N3J A;  5EX0 A;  4QEN A;  5CCM A;  3M59 A;  4YNP A;  4NJ5 A;  5HQ8 A;  3M58 A;  3QWP A;  4O30 A;  4IJ8 A;  3BO5 A;  3S7J A;  3QWW A;  5JJ0 A;  3OS5 A;  5F6L A;  5F5E A;  3DAL A;  4YNM A;  4JLG A;  1O9S A;  4I51 A;  3EP0 A;  5KJK A;  3TG4 A;  4J83 A;  3M57 A;  3CBP A;  5TH7 A;  1PEG A;  3F9Y A;  3FPD A;  4LDG A;  5KJL A;  4E47 A;  3MO5 A;  4Z4P A;  1ZKK A;  5JIN A;  4YPA A;  3CBO A;  4JDS A;  4RZ0 A;  3HNA A;  4C1Q A;  2JV0 A;  4AU7 A;  1H3I A;  5T5G A;  3S7D A;  5F59 A;  4NVQ A;  3N71 A;  4O6F A;  4FMU A;  3OPE A;  5EG2 A;  3S8P A;  4J7F A;  3F9Z A;  3OXG A; 
#chains in the Genus database with same CATH homology
 5T0M A;  5AYF A;  4J8O A;  5KJM A;  3M54 A;  3KMA A;  3MO2 A;  5KJN A;  2F69 A;  3KMJ A;  5HI7 A;  3CBM A;  3DB5 A;  4YND A;  3F9W A;  5ARG A;  3OXL A;  3RU0 A;  3RAY A;  3K5K A;  3MEK A;  3MO0 A;  3QWV A;  5ARF A;  4YPE A;  5T0K A;  4MI0 A;  1XQH A;  5TTF A;  1N6C A;  3M5A A;  5CPR B;  3RIB A;  1MVH A;  2W5Z A;  4WUY A;  2QPW A;  2O8J A;  3PDN A;  1MT6 A;  3RQ4 A;  4YPU A;  3IHX A;  3M56 A;  5JIY A;  5F6K C;  1MUF A;  3S7B A;  3OXF A;  3OOI A;  1MVX A;  3TG5 A;  4QEO A;  2G46 A;  1ML9 A;  2RFI A;  2BQZ A;  4J7I A;  1N6A A;  3SWC A;  2R3A A;  5LSZ A;  3KMT A;  3S7F A;  3F9X A;  5CCL A;  3RJW A;  3VV0 A;  2IGQ A;  5EX3 A;  2W5Y A;  5TEG A;  4IJD A;  3M53 A;  5LSX A;  5JHN A;  4H12 A;  4QEP A;  3VUZ A;  4BUP A;  3M55 A;  4MI5 A;  3SW9 A;  1N3J A;  5EX0 A;  4QEN A;  5CCM A;  3M59 A;  4YNP A;  4NJ5 A;  5HQ8 A;  3M58 A;  3QWP A;  4O30 A;  4IJ8 A;  3BO5 A;  3S7J A;  3QWW A;  5JJ0 A;  3OS5 A;  5F6L A;  5F5E A;  3DAL A;  4YNM A;  4JLG A;  1O9S A;  4I51 A;  3EP0 A;  5KJK A;  3TG4 A;  4J83 A;  3M57 A;  3CBP A;  5TH7 A;  1PEG A;  3F9Y A;  3FPD A;  4LDG A;  5KJL A;  4E47 A;  3MO5 A;  4Z4P A;  1ZKK A;  5JIN A;  4YPA A;  3CBO A;  4JDS A;  4RZ0 A;  3HNA A;  4C1Q A;  2JV0 A;  4AU7 A;  1H3I A;  5T5G A;  3S7D A;  5F59 A;  4NVQ A;  3N71 A;  4O6F A;  4FMU A;  3OPE A;  5EG2 A;  3S8P A;  4J7F A;  3F9Z A;  3OXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...