4O30A

Crystal structure of atxr5 in complex with histone h3.1 and adohcy
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
b'RRRLLPFVSSEDPAQRLKQMGTLASALTELQMEFSDDLTYSSGMAPRSANQARFEEGGMQVLTKEDIETLEQCRAMCKRGDCPPLLVVFDSREGFTVEADGQIKDMTFIAEYTGDVDYIRNREHDDCDSMMTLLLAKDPSKSLVICPDKRGNIARFISGINNHTLDGKKKQNCKCVRYSVNGECRVFLVATRDIAKGERLYYDYNGYEHEYPTQHFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase ATXR6, putative
molecule tags Transferase
source organism Ricinus communis
publication title Selective methylation of histone H3 variant H3.1 regulates heterochromatin replication.
pubmed doi rcsb
total genus 69
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4o30A00
4I51A 3S7DA 2JV0A 5T5GA 4MI5A 3RAYA 3KMTA 2W5ZA 3QWPA 4O30A 3TG4A 3F9XA 4IJDA 3CBOA 5LSXA 3QWVA 4J7FA 3DB5A 3OS5A 5EX3A 3M54A 4QENA 3RIBA 1MT6A 4YPEA 3TG5A 5CCLA 2QPWA 5KJKA 5CPRB 4YNDA 3VV0A 3EP0A 4FMUA 4H12A 1N3JA 3FPDA 3MO5A 5T0KA 5AYFA 4E47A 2R3AA 1PEGA 4JLGA 3M5AA 1ZKKA 3M55A 3S7BA 5EG2A 3DALA 3OXFA 3SWCA 5HQ8A 5TH7A 5KJNA 1MUFA 3SW9A 1MVXA 5ARGA 4QEPA 3PDNA 4IJ8A 1XQHA 3RQ4A 1ML9A 3M56A 4MI0A 5CCMA 4QEOA 5KJLA 3OXGA 3IHXA 4J7IA 2RFIA 5TTFA 2BQZA 5F6KC 4NJ5A 4RZ0A 3OPEA 3CBMA 3M53A 3MEKA 2O8JA 3OOIA 1N6AA 1MVHA 4LDGA 4C1QA 5HI7A 5T0MA 3K5KA 3MO0A 4J8OA 2IGQA 3VUZA 3KMJA 4AU7A 3MO2A 3HNAA 4YPUA 4YPAA 3S7JA 4BUPA 5F59A 5ARFA 3S8PA 4J83A 3M59A 4YNMA 5TEGA 3F9WA 3QWWA 2G46A 3N71A 5LSZA 4JDSA 3M57A 3OXLA 5JJ0A 4Z4PA 5F6LA 3BO5A 1O9SA 5F5EA 1N6CA 4NVQA 5EX0A 3RJWA 1H3IA 3F9YA 5JIYA 3KMAA 3F9ZA 3CBPA 2W5YA 4O6FA 5JHNA 5KJMA 3M58A 4WUYA 4YNPA 3S7FA 5JINA 3RU0A 2F69A
chains in the Genus database with same CATH superfamily
4I51A 3S7DA 2JV0A 5T5GA 4MI5A 3RAYA 3KMTA 2W5ZA 3QWPA 4O30A 3TG4A 3F9XA 4IJDA 3CBOA 5LSXA 3QWVA 4J7FA 3DB5A 3OS5A 5EX3A 3M54A 4QENA 3RIBA 1MT6A 4YPEA 3TG5A 5CCLA 2QPWA 5KJKA 5CPRB 4YNDA 3VV0A 3EP0A 4FMUA 4H12A 1N3JA 3FPDA 3MO5A 5T0KA 5AYFA 4E47A 2R3AA 1PEGA 4JLGA 3M5AA 1ZKKA 3M55A 3S7BA 5EG2A 3DALA 3OXFA 3SWCA 5HQ8A 5TH7A 5KJNA 1MUFA 3SW9A 1MVXA 5ARGA 4QEPA 3PDNA 4IJ8A 1XQHA 3RQ4A 1ML9A 3M56A 4MI0A 5CCMA 4QEOA 5KJLA 3OXGA 3IHXA 4J7IA 2RFIA 5TTFA 2BQZA 5F6KC 4NJ5A 4RZ0A 3OPEA 3CBMA 3M53A 3MEKA 2O8JA 3OOIA 1N6AA 1MVHA 4LDGA 4C1QA 5HI7A 5T0MA 3K5KA 3MO0A 4J8OA 2IGQA 3VUZA 3KMJA 4AU7A 3MO2A 3HNAA 4YPUA 4YPAA 3S7JA 4BUPA 5F59A 5ARFA 3S8PA 4J83A 3M59A 4YNMA 5TEGA 3F9WA 3QWWA 2G46A 3N71A 5LSZA 4JDSA 3M57A 3OXLA 5JJ0A 4Z4PA 5F6LA 3BO5A 1O9SA 5F5EA 1N6CA 4NVQA 5EX0A 3RJWA 1H3IA 3F9YA 5JIYA 3KMAA 3F9ZA 3CBPA 2W5YA 4O6FA 5JHNA 5KJMA 3M58A 4WUYA 4YNPA 3S7FA 5JINA 3RU0A 2F69A
chains in the Genus database with same CATH topology
4I51A 3S7DA 2JV0A 5T5GA 4MI5A 3RAYA 3KMTA 2W5ZA 3QWPA 4O30A 3TG4A 3F9XA 4IJDA 3CBOA 5LSXA 3QWVA 4J7FA 3DB5A 3OS5A 5EX3A 3M54A 4QENA 3RIBA 1MT6A 4YPEA 3TG5A 5CCLA 2QPWA 5KJKA 5CPRB 4YNDA 3VV0A 3EP0A 4FMUA 4H12A 1N3JA 3FPDA 3MO5A 5T0KA 5AYFA 4E47A 2R3AA 1PEGA 4JLGA 3M5AA 1ZKKA 3M55A 3S7BA 5EG2A 3DALA 3OXFA 3SWCA 5HQ8A 5TH7A 5KJNA 1MUFA 3SW9A 1MVXA 5ARGA 4QEPA 3PDNA 4IJ8A 1XQHA 3RQ4A 1ML9A 3M56A 4MI0A 5CCMA 4QEOA 5KJLA 3OXGA 3IHXA 4J7IA 2RFIA 5TTFA 2BQZA 5F6KC 4NJ5A 4RZ0A 3OPEA 3CBMA 3M53A 3MEKA 2O8JA 3OOIA 1N6AA 1MVHA 4LDGA 4C1QA 5HI7A 5T0MA 3K5KA 3MO0A 4J8OA 2IGQA 3VUZA 3KMJA 4AU7A 3MO2A 3HNAA 4YPUA 4YPAA 3S7JA 4BUPA 5F59A 5ARFA 3S8PA 4J83A 3M59A 4YNMA 5TEGA 3F9WA 3QWWA 2G46A 3N71A 5LSZA 4JDSA 3M57A 3OXLA 5JJ0A 4Z4PA 5F6LA 3BO5A 1O9SA 5F5EA 1N6CA 4NVQA 5EX0A 3RJWA 1H3IA 3F9YA 5JIYA 3KMAA 3F9ZA 3CBPA 2W5YA 4O6FA 5JHNA 5KJMA 3M58A 4WUYA 4YNPA 3S7FA 5JINA 3RU0A 2F69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I51 A;  3S7D A;  2JV0 A;  5T5G A;  4MI5 A;  3RAY A;  3KMT A;  2W5Z A;  3QWP A;  4O30 A;  3TG4 A;  3F9X A;  4IJD A;  3CBO A;  5LSX A;  3QWV A;  4J7F A;  3DB5 A;  3OS5 A;  5EX3 A;  3M54 A;  4QEN A;  3RIB A;  1MT6 A;  4YPE A;  3TG5 A;  5CCL A;  2QPW A;  5KJK A;  5CPR B;  4YND A;  3VV0 A;  3EP0 A;  4FMU A;  4H12 A;  1N3J A;  3FPD A;  3MO5 A;  5T0K A;  5AYF A;  4E47 A;  2R3A A;  1PEG A;  4JLG A;  3M5A A;  1ZKK A;  3M55 A;  3S7B A;  5EG2 A;  3DAL A;  3OXF A;  3SWC A;  5HQ8 A;  5TH7 A;  5KJN A;  1MUF A;  3SW9 A;  1MVX A;  5ARG A;  4QEP A;  3PDN A;  4IJ8 A;  1XQH A;  3RQ4 A;  1ML9 A;  3M56 A;  4MI0 A;  5CCM A;  4QEO A;  5KJL A;  3OXG A;  3IHX A;  4J7I A;  2RFI A;  5TTF A;  2BQZ A;  5F6K C;  4NJ5 A;  4RZ0 A;  3OPE A;  3CBM A;  3M53 A;  3MEK A;  2O8J A;  3OOI A;  1N6A A;  1MVH A;  4LDG A;  4C1Q A;  5HI7 A;  5T0M A;  3K5K A;  3MO0 A;  4J8O A;  2IGQ A;  3VUZ A;  3KMJ A;  4AU7 A;  3MO2 A;  3HNA A;  4YPU A;  4YPA A;  3S7J A;  4BUP A;  5F59 A;  5ARF A;  3S8P A;  4J83 A;  3M59 A;  4YNM A;  5TEG A;  3F9W A;  3QWW A;  2G46 A;  3N71 A;  5LSZ A;  4JDS A;  3M57 A;  3OXL A;  5JJ0 A;  4Z4P A;  5F6L A;  3BO5 A;  1O9S A;  5F5E A;  1N6C A;  4NVQ A;  5EX0 A;  3RJW A;  1H3I A;  3F9Y A;  5JIY A;  3KMA A;  3F9Z A;  3CBP A;  2W5Y A;  4O6F A;  5JHN A;  5KJM A;  3M58 A;  4WUY A;  4YNP A;  3S7F A;  5JIN A;  3RU0 A;  2F69 A; 
#chains in the Genus database with same CATH topology
 4I51 A;  3S7D A;  2JV0 A;  5T5G A;  4MI5 A;  3RAY A;  3KMT A;  2W5Z A;  3QWP A;  4O30 A;  3TG4 A;  3F9X A;  4IJD A;  3CBO A;  5LSX A;  3QWV A;  4J7F A;  3DB5 A;  3OS5 A;  5EX3 A;  3M54 A;  4QEN A;  3RIB A;  1MT6 A;  4YPE A;  3TG5 A;  5CCL A;  2QPW A;  5KJK A;  5CPR B;  4YND A;  3VV0 A;  3EP0 A;  4FMU A;  4H12 A;  1N3J A;  3FPD A;  3MO5 A;  5T0K A;  5AYF A;  4E47 A;  2R3A A;  1PEG A;  4JLG A;  3M5A A;  1ZKK A;  3M55 A;  3S7B A;  5EG2 A;  3DAL A;  3OXF A;  3SWC A;  5HQ8 A;  5TH7 A;  5KJN A;  1MUF A;  3SW9 A;  1MVX A;  5ARG A;  4QEP A;  3PDN A;  4IJ8 A;  1XQH A;  3RQ4 A;  1ML9 A;  3M56 A;  4MI0 A;  5CCM A;  4QEO A;  5KJL A;  3OXG A;  3IHX A;  4J7I A;  2RFI A;  5TTF A;  2BQZ A;  5F6K C;  4NJ5 A;  4RZ0 A;  3OPE A;  3CBM A;  3M53 A;  3MEK A;  2O8J A;  3OOI A;  1N6A A;  1MVH A;  4LDG A;  4C1Q A;  5HI7 A;  5T0M A;  3K5K A;  3MO0 A;  4J8O A;  2IGQ A;  3VUZ A;  3KMJ A;  4AU7 A;  3MO2 A;  3HNA A;  4YPU A;  4YPA A;  3S7J A;  4BUP A;  5F59 A;  5ARF A;  3S8P A;  4J83 A;  3M59 A;  4YNM A;  5TEG A;  3F9W A;  3QWW A;  2G46 A;  3N71 A;  5LSZ A;  4JDS A;  3M57 A;  3OXL A;  5JJ0 A;  4Z4P A;  5F6L A;  3BO5 A;  1O9S A;  5F5E A;  1N6C A;  4NVQ A;  5EX0 A;  3RJW A;  1H3I A;  3F9Y A;  5JIY A;  3KMA A;  3F9Z A;  3CBP A;  2W5Y A;  4O6F A;  5JHN A;  5KJM A;  3M58 A;  4WUY A;  4YNP A;  3S7F A;  5JIN A;  3RU0 A;  2F69 A; 
#chains in the Genus database with same CATH homology
 4I51 A;  3S7D A;  2JV0 A;  5T5G A;  4MI5 A;  3RAY A;  3KMT A;  2W5Z A;  3QWP A;  4O30 A;  3TG4 A;  3F9X A;  4IJD A;  3CBO A;  5LSX A;  3QWV A;  4J7F A;  3DB5 A;  3OS5 A;  5EX3 A;  3M54 A;  4QEN A;  3RIB A;  1MT6 A;  4YPE A;  3TG5 A;  5CCL A;  2QPW A;  5KJK A;  5CPR B;  4YND A;  3VV0 A;  3EP0 A;  4FMU A;  4H12 A;  1N3J A;  3FPD A;  3MO5 A;  5T0K A;  5AYF A;  4E47 A;  2R3A A;  1PEG A;  4JLG A;  3M5A A;  1ZKK A;  3M55 A;  3S7B A;  5EG2 A;  3DAL A;  3OXF A;  3SWC A;  5HQ8 A;  5TH7 A;  5KJN A;  1MUF A;  3SW9 A;  1MVX A;  5ARG A;  4QEP A;  3PDN A;  4IJ8 A;  1XQH A;  3RQ4 A;  1ML9 A;  3M56 A;  4MI0 A;  5CCM A;  4QEO A;  5KJL A;  3OXG A;  3IHX A;  4J7I A;  2RFI A;  5TTF A;  2BQZ A;  5F6K C;  4NJ5 A;  4RZ0 A;  3OPE A;  3CBM A;  3M53 A;  3MEK A;  2O8J A;  3OOI A;  1N6A A;  1MVH A;  4LDG A;  4C1Q A;  5HI7 A;  5T0M A;  3K5K A;  3MO0 A;  4J8O A;  2IGQ A;  3VUZ A;  3KMJ A;  4AU7 A;  3MO2 A;  3HNA A;  4YPU A;  4YPA A;  3S7J A;  4BUP A;  5F59 A;  5ARF A;  3S8P A;  4J83 A;  3M59 A;  4YNM A;  5TEG A;  3F9W A;  3QWW A;  2G46 A;  3N71 A;  5LSZ A;  4JDS A;  3M57 A;  3OXL A;  5JJ0 A;  4Z4P A;  5F6L A;  3BO5 A;  1O9S A;  5F5E A;  1N6C A;  4NVQ A;  5EX0 A;  3RJW A;  1H3I A;  3F9Y A;  5JIY A;  3KMA A;  3F9Z A;  3CBP A;  2W5Y A;  4O6F A;  5JHN A;  5KJM A;  3M58 A;  4WUY A;  4YNP A;  3S7F A;  5JIN A;  3RU0 A;  2F69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...