4O30A

Crystal structure of atxr5 in complex with histone h3.1 and adohcy
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
RRRLLPFVSSEDPAQRLKQMGTLASALTELQMEFSDDLTYSSGMAPRSANQARFEEGGMQVLTKEDIETLEQCRAMCKRGDCPPLLVVFDSREGFTVEADGQIKDMTFIAEYTGDVDYIRNREHDDCDSMMTLLLAKDPSKSLVICPDKRGNIARFISGINNHTLDGKKKQNCKCVRYSVNGECRVFLVATRDIAKGERLYYDYNGYEHEYPTQHFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective methylation of histone H3 variant H3.1 regulates heterochromatin replication.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ATXR6, putative
total genus 69
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4o30A00
1ZKKA 5KJMA 3M57A 3QWVA 3M5AA 3RU0A 1H3IA 4J7FA 2RFIA 4JLGA 3S7BA 3CBOA 5LSZA 4YPEA 5KJNA 2IGQA 4C1QA 3OOIA 3RJWA 3RIBA 3S7DA 5EX0A 3CBPA 4J83A 4RZ0A 3VV0A 4YNDA 3F9ZA 3KMJA 1XQHA 3TG5A 4Z4PA 1MVHA 4IJDA 2O8JA 3M54A 3OXFA 3PDNA 4QEPA 5CPRB 2F69A 4BUPA 3K5KA 3M58A 5HQ8A 1N6AA 5HI7A 3MO5A 3MEKA 5F6KC 4J7IA 3OPEA 5KJLA 3SW9A 2JV0A 4I51A 4WUYA 4IJ8A 3TG4A 5JHNA 4YPUA 4NVQA 5F59A 1MT6A 5F5EA 3M56A 3M53A 2BQZA 1MVXA 3DB5A 4O30A 3QWPA 5F6LA 3CBMA 5ARGA 3S8PA 4AU7A 4QEOA 4E47A 4YPAA 5T5GA 5CCLA 5T0MA 1ML9A 5T0KA 3RQ4A 4YNPA 1PEGA 3N71A 3KMAA 3S7JA 5EG2A 5AYFA 5CCMA 5EX3A 3HNAA 3F9XA 2W5ZA 3OS5A 3OXGA 4MI5A 4J8OA 5TH7A 1MUFA 3BO5A 3FPDA 3F9WA 2R3AA 3SWCA 4MI0A 3S7FA 4LDGA 5ARFA 3M55A 4JDSA 4FMUA 3KMTA 4YNMA 3MO2A 3OXLA 5LSXA 3VUZA 3EP0A 3DALA 1N6CA 5JINA 2W5YA 5TTFA 2G46A 5JJ0A 5JIYA 3QWWA 4H12A 4QENA 3M59A 1O9SA 3IHXA 5KJKA 4NJ5A 2QPWA 3F9YA 5TEGA 3RAYA 1N3JA 4O6FA 3MO0A
chains in the Genus database with same CATH superfamily
1ZKKA 5KJMA 3M57A 3QWVA 3M5AA 3RU0A 1H3IA 4J7FA 2RFIA 4JLGA 3S7BA 3CBOA 5LSZA 4YPEA 5KJNA 2IGQA 4C1QA 3OOIA 3RJWA 3RIBA 3S7DA 5EX0A 3CBPA 4J83A 4RZ0A 3VV0A 4YNDA 3F9ZA 3KMJA 1XQHA 3TG5A 4Z4PA 1MVHA 4IJDA 2O8JA 3M54A 3OXFA 3PDNA 4QEPA 5CPRB 2F69A 4BUPA 3K5KA 3M58A 5HQ8A 1N6AA 5HI7A 3MO5A 3MEKA 5F6KC 4J7IA 3OPEA 5KJLA 3SW9A 2JV0A 4I51A 4WUYA 4IJ8A 3TG4A 5JHNA 4YPUA 4NVQA 5F59A 1MT6A 5F5EA 3M56A 3M53A 2BQZA 1MVXA 3DB5A 4O30A 3QWPA 5F6LA 3CBMA 5ARGA 3S8PA 4AU7A 4QEOA 4E47A 4YPAA 5T5GA 5CCLA 5T0MA 1ML9A 5T0KA 3RQ4A 4YNPA 1PEGA 3N71A 3KMAA 3S7JA 5EG2A 5AYFA 5CCMA 5EX3A 3HNAA 3F9XA 2W5ZA 3OS5A 3OXGA 4MI5A 4J8OA 5TH7A 1MUFA 3BO5A 3FPDA 3F9WA 2R3AA 3SWCA 4MI0A 3S7FA 4LDGA 5ARFA 3M55A 4JDSA 4FMUA 3KMTA 4YNMA 3MO2A 3OXLA 5LSXA 3VUZA 3EP0A 3DALA 1N6CA 5JINA 2W5YA 5TTFA 2G46A 5JJ0A 5JIYA 3QWWA 4H12A 4QENA 3M59A 1O9SA 3IHXA 5KJKA 4NJ5A 2QPWA 3F9YA 5TEGA 3RAYA 1N3JA 4O6FA 3MO0A
chains in the Genus database with same CATH topology
1ZKKA 5KJMA 3M57A 3QWVA 3M5AA 3RU0A 1H3IA 4J7FA 2RFIA 4JLGA 3S7BA 3CBOA 5LSZA 4YPEA 5KJNA 2IGQA 4C1QA 3OOIA 3RJWA 3RIBA 3S7DA 5EX0A 3CBPA 4J83A 4RZ0A 3VV0A 4YNDA 3F9ZA 3KMJA 1XQHA 3TG5A 4Z4PA 1MVHA 4IJDA 2O8JA 3M54A 3OXFA 3PDNA 4QEPA 5CPRB 2F69A 4BUPA 3K5KA 3M58A 5HQ8A 1N6AA 5HI7A 3MO5A 3MEKA 5F6KC 4J7IA 3OPEA 5KJLA 3SW9A 2JV0A 4I51A 4WUYA 4IJ8A 3TG4A 5JHNA 4YPUA 4NVQA 5F59A 1MT6A 5F5EA 3M56A 3M53A 2BQZA 1MVXA 3DB5A 4O30A 3QWPA 5F6LA 3CBMA 5ARGA 3S8PA 4AU7A 4QEOA 4E47A 4YPAA 5T5GA 5CCLA 5T0MA 1ML9A 5T0KA 3RQ4A 4YNPA 1PEGA 3N71A 3KMAA 3S7JA 5EG2A 5AYFA 5CCMA 5EX3A 3HNAA 3F9XA 2W5ZA 3OS5A 3OXGA 4MI5A 4J8OA 5TH7A 1MUFA 3BO5A 3FPDA 3F9WA 2R3AA 3SWCA 4MI0A 3S7FA 4LDGA 5ARFA 3M55A 4JDSA 4FMUA 3KMTA 4YNMA 3MO2A 3OXLA 5LSXA 3VUZA 3EP0A 3DALA 1N6CA 5JINA 2W5YA 5TTFA 2G46A 5JJ0A 5JIYA 3QWWA 4H12A 4QENA 3M59A 1O9SA 3IHXA 5KJKA 4NJ5A 2QPWA 3F9YA 5TEGA 3RAYA 1N3JA 4O6FA 3MO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKK A;  5KJM A;  3M57 A;  3QWV A;  3M5A A;  3RU0 A;  1H3I A;  4J7F A;  2RFI A;  4JLG A;  3S7B A;  3CBO A;  5LSZ A;  4YPE A;  5KJN A;  2IGQ A;  4C1Q A;  3OOI A;  3RJW A;  3RIB A;  3S7D A;  5EX0 A;  3CBP A;  4J83 A;  4RZ0 A;  3VV0 A;  4YND A;  3F9Z A;  3KMJ A;  1XQH A;  3TG5 A;  4Z4P A;  1MVH A;  4IJD A;  2O8J A;  3M54 A;  3OXF A;  3PDN A;  4QEP A;  5CPR B;  2F69 A;  4BUP A;  3K5K A;  3M58 A;  5HQ8 A;  1N6A A;  5HI7 A;  3MO5 A;  3MEK A;  5F6K C;  4J7I A;  3OPE A;  5KJL A;  3SW9 A;  2JV0 A;  4I51 A;  4WUY A;  4IJ8 A;  3TG4 A;  5JHN A;  4YPU A;  4NVQ A;  5F59 A;  1MT6 A;  5F5E A;  3M56 A;  3M53 A;  2BQZ A;  1MVX A;  3DB5 A;  4O30 A;  3QWP A;  5F6L A;  3CBM A;  5ARG A;  3S8P A;  4AU7 A;  4QEO A;  4E47 A;  4YPA A;  5T5G A;  5CCL A;  5T0M A;  1ML9 A;  5T0K A;  3RQ4 A;  4YNP A;  1PEG A;  3N71 A;  3KMA A;  3S7J A;  5EG2 A;  5AYF A;  5CCM A;  5EX3 A;  3HNA A;  3F9X A;  2W5Z A;  3OS5 A;  3OXG A;  4MI5 A;  4J8O A;  5TH7 A;  1MUF A;  3BO5 A;  3FPD A;  3F9W A;  2R3A A;  3SWC A;  4MI0 A;  3S7F A;  4LDG A;  5ARF A;  3M55 A;  4JDS A;  4FMU A;  3KMT A;  4YNM A;  3MO2 A;  3OXL A;  5LSX A;  3VUZ A;  3EP0 A;  3DAL A;  1N6C A;  5JIN A;  2W5Y A;  5TTF A;  2G46 A;  5JJ0 A;  5JIY A;  3QWW A;  4H12 A;  4QEN A;  3M59 A;  1O9S A;  3IHX A;  5KJK A;  4NJ5 A;  2QPW A;  3F9Y A;  5TEG A;  3RAY A;  1N3J A;  4O6F A;  3MO0 A; 
#chains in the Genus database with same CATH topology
 1ZKK A;  5KJM A;  3M57 A;  3QWV A;  3M5A A;  3RU0 A;  1H3I A;  4J7F A;  2RFI A;  4JLG A;  3S7B A;  3CBO A;  5LSZ A;  4YPE A;  5KJN A;  2IGQ A;  4C1Q A;  3OOI A;  3RJW A;  3RIB A;  3S7D A;  5EX0 A;  3CBP A;  4J83 A;  4RZ0 A;  3VV0 A;  4YND A;  3F9Z A;  3KMJ A;  1XQH A;  3TG5 A;  4Z4P A;  1MVH A;  4IJD A;  2O8J A;  3M54 A;  3OXF A;  3PDN A;  4QEP A;  5CPR B;  2F69 A;  4BUP A;  3K5K A;  3M58 A;  5HQ8 A;  1N6A A;  5HI7 A;  3MO5 A;  3MEK A;  5F6K C;  4J7I A;  3OPE A;  5KJL A;  3SW9 A;  2JV0 A;  4I51 A;  4WUY A;  4IJ8 A;  3TG4 A;  5JHN A;  4YPU A;  4NVQ A;  5F59 A;  1MT6 A;  5F5E A;  3M56 A;  3M53 A;  2BQZ A;  1MVX A;  3DB5 A;  4O30 A;  3QWP A;  5F6L A;  3CBM A;  5ARG A;  3S8P A;  4AU7 A;  4QEO A;  4E47 A;  4YPA A;  5T5G A;  5CCL A;  5T0M A;  1ML9 A;  5T0K A;  3RQ4 A;  4YNP A;  1PEG A;  3N71 A;  3KMA A;  3S7J A;  5EG2 A;  5AYF A;  5CCM A;  5EX3 A;  3HNA A;  3F9X A;  2W5Z A;  3OS5 A;  3OXG A;  4MI5 A;  4J8O A;  5TH7 A;  1MUF A;  3BO5 A;  3FPD A;  3F9W A;  2R3A A;  3SWC A;  4MI0 A;  3S7F A;  4LDG A;  5ARF A;  3M55 A;  4JDS A;  4FMU A;  3KMT A;  4YNM A;  3MO2 A;  3OXL A;  5LSX A;  3VUZ A;  3EP0 A;  3DAL A;  1N6C A;  5JIN A;  2W5Y A;  5TTF A;  2G46 A;  5JJ0 A;  5JIY A;  3QWW A;  4H12 A;  4QEN A;  3M59 A;  1O9S A;  3IHX A;  5KJK A;  4NJ5 A;  2QPW A;  3F9Y A;  5TEG A;  3RAY A;  1N3J A;  4O6F A;  3MO0 A; 
#chains in the Genus database with same CATH homology
 1ZKK A;  5KJM A;  3M57 A;  3QWV A;  3M5A A;  3RU0 A;  1H3I A;  4J7F A;  2RFI A;  4JLG A;  3S7B A;  3CBO A;  5LSZ A;  4YPE A;  5KJN A;  2IGQ A;  4C1Q A;  3OOI A;  3RJW A;  3RIB A;  3S7D A;  5EX0 A;  3CBP A;  4J83 A;  4RZ0 A;  3VV0 A;  4YND A;  3F9Z A;  3KMJ A;  1XQH A;  3TG5 A;  4Z4P A;  1MVH A;  4IJD A;  2O8J A;  3M54 A;  3OXF A;  3PDN A;  4QEP A;  5CPR B;  2F69 A;  4BUP A;  3K5K A;  3M58 A;  5HQ8 A;  1N6A A;  5HI7 A;  3MO5 A;  3MEK A;  5F6K C;  4J7I A;  3OPE A;  5KJL A;  3SW9 A;  2JV0 A;  4I51 A;  4WUY A;  4IJ8 A;  3TG4 A;  5JHN A;  4YPU A;  4NVQ A;  5F59 A;  1MT6 A;  5F5E A;  3M56 A;  3M53 A;  2BQZ A;  1MVX A;  3DB5 A;  4O30 A;  3QWP A;  5F6L A;  3CBM A;  5ARG A;  3S8P A;  4AU7 A;  4QEO A;  4E47 A;  4YPA A;  5T5G A;  5CCL A;  5T0M A;  1ML9 A;  5T0K A;  3RQ4 A;  4YNP A;  1PEG A;  3N71 A;  3KMA A;  3S7J A;  5EG2 A;  5AYF A;  5CCM A;  5EX3 A;  3HNA A;  3F9X A;  2W5Z A;  3OS5 A;  3OXG A;  4MI5 A;  4J8O A;  5TH7 A;  1MUF A;  3BO5 A;  3FPD A;  3F9W A;  2R3A A;  3SWC A;  4MI0 A;  3S7F A;  4LDG A;  5ARF A;  3M55 A;  4JDS A;  4FMU A;  3KMT A;  4YNM A;  3MO2 A;  3OXL A;  5LSX A;  3VUZ A;  3EP0 A;  3DAL A;  1N6C A;  5JIN A;  2W5Y A;  5TTF A;  2G46 A;  5JJ0 A;  5JIY A;  3QWW A;  4H12 A;  4QEN A;  3M59 A;  1O9S A;  3IHX A;  5KJK A;  4NJ5 A;  2QPW A;  3F9Y A;  5TEG A;  3RAY A;  1N3J A;  4O6F A;  3MO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...