4O30A

Crystal structure of atxr5 in complex with histone h3.1 and adohcy
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
RRRLLPFVSSEDPAQRLKQMGTLASALTELQMEFSDDLTYSSGMAPRSANQARFEEGGMQVLTKEDIETLEQCRAMCKRGDCPPLLVVFDSREGFTVEADGQIKDMTFIAEYTGDVDYIRNREHDDCDSMMTLLLAKDPSKSLVICPDKRGNIARFISGINNHTLDGKKKQNCKCVRYSVNGECRVFLVATRDIAKGERLYYDYNGYEHEYPTQHFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective methylation of histone H3 variant H3.1 regulates heterochromatin replication.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ATXR6, putative
total genus 69
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4o30A00
3TG4A 5F6LA 1MVHA 4IJDA 3QWVA 5KJMA 3QWPA 3F9XA 3MO5A 3S7JA 4E47A 1MT6A 4Z4PA 3M56A 5JJ0A 5KJLA 3VV0A 3RJWA 4O30A 3EP0A 4YPEA 5CCMA 3K5KA 5T5GA 3M55A 4J7FA 5T0MA 1MUFA 3MO2A 3RU0A 2G46A 4J7IA 5T0KA 3M58A 3BO5A 4NJ5A 3SWCA 5CCLA 4QEOA 4J83A 3PDNA 1H3IA 2F69A 3CBMA 5EX3A 5F59A 1N6AA 3VUZA 3F9WA 3CBPA 4MI0A 4LDGA 3M53A 4YNMA 5CPRB 5F5EA 3N71A 5TTFA 4WUYA 1XQHA 4H12A 5KJKA 1N6CA 1ML9A 4YPUA 2QPWA 5EX0A 3RQ4A 5KJNA 4MI5A 3MO0A 2BQZA 4RZ0A 3M54A 3SW9A 3KMAA 3M57A 4IJ8A 2R3AA 3HNAA 4YPAA 3S7BA 5LSZA 4YNDA 3CBOA 1N3JA 3KMTA 5EG2A 1ZKKA 1PEGA 4FMUA 5AYFA 3OS5A 5TEGA 5HI7A 1O9SA 4QEPA 5ARGA 3MEKA 3RIBA 3TG5A 2W5YA 5LSXA 3OPEA 3S7DA 3S7FA 3S8PA 4I51A 4JLGA 5JHNA 4QENA 5JINA 5JIYA 3F9ZA 3OOIA 2RFIA 5ARFA 4BUPA 2O8JA 3F9YA 3OXFA 3QWWA 4O6FA 4NVQA 4J8OA 1MVXA 3OXGA 3DALA 5F6KC 2W5ZA 3M5AA 5HQ8A 3M59A 2IGQA 4YNPA 4C1QA 3KMJA 3OXLA 3DB5A 2JV0A 3FPDA 3IHXA 5TH7A 3RAYA 4AU7A 4JDSA
chains in the Genus database with same CATH superfamily
3TG4A 5F6LA 1MVHA 4IJDA 3QWVA 5KJMA 3QWPA 3F9XA 3MO5A 3S7JA 4E47A 1MT6A 4Z4PA 3M56A 5JJ0A 5KJLA 3VV0A 3RJWA 4O30A 3EP0A 4YPEA 5CCMA 3K5KA 5T5GA 3M55A 4J7FA 5T0MA 1MUFA 3MO2A 3RU0A 2G46A 4J7IA 5T0KA 3M58A 3BO5A 4NJ5A 3SWCA 5CCLA 4QEOA 4J83A 3PDNA 1H3IA 2F69A 3CBMA 5EX3A 5F59A 1N6AA 3VUZA 3F9WA 3CBPA 4MI0A 4LDGA 3M53A 4YNMA 5CPRB 5F5EA 3N71A 5TTFA 4WUYA 1XQHA 4H12A 5KJKA 1N6CA 1ML9A 4YPUA 2QPWA 5EX0A 3RQ4A 5KJNA 4MI5A 3MO0A 2BQZA 4RZ0A 3M54A 3SW9A 3KMAA 3M57A 4IJ8A 2R3AA 3HNAA 4YPAA 3S7BA 5LSZA 4YNDA 3CBOA 1N3JA 3KMTA 5EG2A 1ZKKA 1PEGA 4FMUA 5AYFA 3OS5A 5TEGA 5HI7A 1O9SA 4QEPA 5ARGA 3MEKA 3RIBA 3TG5A 2W5YA 5LSXA 3OPEA 3S7DA 3S7FA 3S8PA 4I51A 4JLGA 5JHNA 4QENA 5JINA 5JIYA 3F9ZA 3OOIA 2RFIA 5ARFA 4BUPA 2O8JA 3F9YA 3OXFA 3QWWA 4O6FA 4NVQA 4J8OA 1MVXA 3OXGA 3DALA 5F6KC 2W5ZA 3M5AA 5HQ8A 3M59A 2IGQA 4YNPA 4C1QA 3KMJA 3OXLA 3DB5A 2JV0A 3FPDA 3IHXA 5TH7A 3RAYA 4AU7A 4JDSA
chains in the Genus database with same CATH topology
3TG4A 5F6LA 1MVHA 4IJDA 3QWVA 5KJMA 3QWPA 3F9XA 3MO5A 3S7JA 4E47A 1MT6A 4Z4PA 3M56A 5JJ0A 5KJLA 3VV0A 3RJWA 4O30A 3EP0A 4YPEA 5CCMA 3K5KA 5T5GA 3M55A 4J7FA 5T0MA 1MUFA 3MO2A 3RU0A 2G46A 4J7IA 5T0KA 3M58A 3BO5A 4NJ5A 3SWCA 5CCLA 4QEOA 4J83A 3PDNA 1H3IA 2F69A 3CBMA 5EX3A 5F59A 1N6AA 3VUZA 3F9WA 3CBPA 4MI0A 4LDGA 3M53A 4YNMA 5CPRB 5F5EA 3N71A 5TTFA 4WUYA 1XQHA 4H12A 5KJKA 1N6CA 1ML9A 4YPUA 2QPWA 5EX0A 3RQ4A 5KJNA 4MI5A 3MO0A 2BQZA 4RZ0A 3M54A 3SW9A 3KMAA 3M57A 4IJ8A 2R3AA 3HNAA 4YPAA 3S7BA 5LSZA 4YNDA 3CBOA 1N3JA 3KMTA 5EG2A 1ZKKA 1PEGA 4FMUA 5AYFA 3OS5A 5TEGA 5HI7A 1O9SA 4QEPA 5ARGA 3MEKA 3RIBA 3TG5A 2W5YA 5LSXA 3OPEA 3S7DA 3S7FA 3S8PA 4I51A 4JLGA 5JHNA 4QENA 5JINA 5JIYA 3F9ZA 3OOIA 2RFIA 5ARFA 4BUPA 2O8JA 3F9YA 3OXFA 3QWWA 4O6FA 4NVQA 4J8OA 1MVXA 3OXGA 3DALA 5F6KC 2W5ZA 3M5AA 5HQ8A 3M59A 2IGQA 4YNPA 4C1QA 3KMJA 3OXLA 3DB5A 2JV0A 3FPDA 3IHXA 5TH7A 3RAYA 4AU7A 4JDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TG4 A;  5F6L A;  1MVH A;  4IJD A;  3QWV A;  5KJM A;  3QWP A;  3F9X A;  3MO5 A;  3S7J A;  4E47 A;  1MT6 A;  4Z4P A;  3M56 A;  5JJ0 A;  5KJL A;  3VV0 A;  3RJW A;  4O30 A;  3EP0 A;  4YPE A;  5CCM A;  3K5K A;  5T5G A;  3M55 A;  4J7F A;  5T0M A;  1MUF A;  3MO2 A;  3RU0 A;  2G46 A;  4J7I A;  5T0K A;  3M58 A;  3BO5 A;  4NJ5 A;  3SWC A;  5CCL A;  4QEO A;  4J83 A;  3PDN A;  1H3I A;  2F69 A;  3CBM A;  5EX3 A;  5F59 A;  1N6A A;  3VUZ A;  3F9W A;  3CBP A;  4MI0 A;  4LDG A;  3M53 A;  4YNM A;  5CPR B;  5F5E A;  3N71 A;  5TTF A;  4WUY A;  1XQH A;  4H12 A;  5KJK A;  1N6C A;  1ML9 A;  4YPU A;  2QPW A;  5EX0 A;  3RQ4 A;  5KJN A;  4MI5 A;  3MO0 A;  2BQZ A;  4RZ0 A;  3M54 A;  3SW9 A;  3KMA A;  3M57 A;  4IJ8 A;  2R3A A;  3HNA A;  4YPA A;  3S7B A;  5LSZ A;  4YND A;  3CBO A;  1N3J A;  3KMT A;  5EG2 A;  1ZKK A;  1PEG A;  4FMU A;  5AYF A;  3OS5 A;  5TEG A;  5HI7 A;  1O9S A;  4QEP A;  5ARG A;  3MEK A;  3RIB A;  3TG5 A;  2W5Y A;  5LSX A;  3OPE A;  3S7D A;  3S7F A;  3S8P A;  4I51 A;  4JLG A;  5JHN A;  4QEN A;  5JIN A;  5JIY A;  3F9Z A;  3OOI A;  2RFI A;  5ARF A;  4BUP A;  2O8J A;  3F9Y A;  3OXF A;  3QWW A;  4O6F A;  4NVQ A;  4J8O A;  1MVX A;  3OXG A;  3DAL A;  5F6K C;  2W5Z A;  3M5A A;  5HQ8 A;  3M59 A;  2IGQ A;  4YNP A;  4C1Q A;  3KMJ A;  3OXL A;  3DB5 A;  2JV0 A;  3FPD A;  3IHX A;  5TH7 A;  3RAY A;  4AU7 A;  4JDS A; 
#chains in the Genus database with same CATH topology
 3TG4 A;  5F6L A;  1MVH A;  4IJD A;  3QWV A;  5KJM A;  3QWP A;  3F9X A;  3MO5 A;  3S7J A;  4E47 A;  1MT6 A;  4Z4P A;  3M56 A;  5JJ0 A;  5KJL A;  3VV0 A;  3RJW A;  4O30 A;  3EP0 A;  4YPE A;  5CCM A;  3K5K A;  5T5G A;  3M55 A;  4J7F A;  5T0M A;  1MUF A;  3MO2 A;  3RU0 A;  2G46 A;  4J7I A;  5T0K A;  3M58 A;  3BO5 A;  4NJ5 A;  3SWC A;  5CCL A;  4QEO A;  4J83 A;  3PDN A;  1H3I A;  2F69 A;  3CBM A;  5EX3 A;  5F59 A;  1N6A A;  3VUZ A;  3F9W A;  3CBP A;  4MI0 A;  4LDG A;  3M53 A;  4YNM A;  5CPR B;  5F5E A;  3N71 A;  5TTF A;  4WUY A;  1XQH A;  4H12 A;  5KJK A;  1N6C A;  1ML9 A;  4YPU A;  2QPW A;  5EX0 A;  3RQ4 A;  5KJN A;  4MI5 A;  3MO0 A;  2BQZ A;  4RZ0 A;  3M54 A;  3SW9 A;  3KMA A;  3M57 A;  4IJ8 A;  2R3A A;  3HNA A;  4YPA A;  3S7B A;  5LSZ A;  4YND A;  3CBO A;  1N3J A;  3KMT A;  5EG2 A;  1ZKK A;  1PEG A;  4FMU A;  5AYF A;  3OS5 A;  5TEG A;  5HI7 A;  1O9S A;  4QEP A;  5ARG A;  3MEK A;  3RIB A;  3TG5 A;  2W5Y A;  5LSX A;  3OPE A;  3S7D A;  3S7F A;  3S8P A;  4I51 A;  4JLG A;  5JHN A;  4QEN A;  5JIN A;  5JIY A;  3F9Z A;  3OOI A;  2RFI A;  5ARF A;  4BUP A;  2O8J A;  3F9Y A;  3OXF A;  3QWW A;  4O6F A;  4NVQ A;  4J8O A;  1MVX A;  3OXG A;  3DAL A;  5F6K C;  2W5Z A;  3M5A A;  5HQ8 A;  3M59 A;  2IGQ A;  4YNP A;  4C1Q A;  3KMJ A;  3OXL A;  3DB5 A;  2JV0 A;  3FPD A;  3IHX A;  5TH7 A;  3RAY A;  4AU7 A;  4JDS A; 
#chains in the Genus database with same CATH homology
 3TG4 A;  5F6L A;  1MVH A;  4IJD A;  3QWV A;  5KJM A;  3QWP A;  3F9X A;  3MO5 A;  3S7J A;  4E47 A;  1MT6 A;  4Z4P A;  3M56 A;  5JJ0 A;  5KJL A;  3VV0 A;  3RJW A;  4O30 A;  3EP0 A;  4YPE A;  5CCM A;  3K5K A;  5T5G A;  3M55 A;  4J7F A;  5T0M A;  1MUF A;  3MO2 A;  3RU0 A;  2G46 A;  4J7I A;  5T0K A;  3M58 A;  3BO5 A;  4NJ5 A;  3SWC A;  5CCL A;  4QEO A;  4J83 A;  3PDN A;  1H3I A;  2F69 A;  3CBM A;  5EX3 A;  5F59 A;  1N6A A;  3VUZ A;  3F9W A;  3CBP A;  4MI0 A;  4LDG A;  3M53 A;  4YNM A;  5CPR B;  5F5E A;  3N71 A;  5TTF A;  4WUY A;  1XQH A;  4H12 A;  5KJK A;  1N6C A;  1ML9 A;  4YPU A;  2QPW A;  5EX0 A;  3RQ4 A;  5KJN A;  4MI5 A;  3MO0 A;  2BQZ A;  4RZ0 A;  3M54 A;  3SW9 A;  3KMA A;  3M57 A;  4IJ8 A;  2R3A A;  3HNA A;  4YPA A;  3S7B A;  5LSZ A;  4YND A;  3CBO A;  1N3J A;  3KMT A;  5EG2 A;  1ZKK A;  1PEG A;  4FMU A;  5AYF A;  3OS5 A;  5TEG A;  5HI7 A;  1O9S A;  4QEP A;  5ARG A;  3MEK A;  3RIB A;  3TG5 A;  2W5Y A;  5LSX A;  3OPE A;  3S7D A;  3S7F A;  3S8P A;  4I51 A;  4JLG A;  5JHN A;  4QEN A;  5JIN A;  5JIY A;  3F9Z A;  3OOI A;  2RFI A;  5ARF A;  4BUP A;  2O8J A;  3F9Y A;  3OXF A;  3QWW A;  4O6F A;  4NVQ A;  4J8O A;  1MVX A;  3OXG A;  3DAL A;  5F6K C;  2W5Z A;  3M5A A;  5HQ8 A;  3M59 A;  2IGQ A;  4YNP A;  4C1Q A;  3KMJ A;  3OXL A;  3DB5 A;  2JV0 A;  3FPD A;  3IHX A;  5TH7 A;  3RAY A;  4AU7 A;  4JDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...