5T5GA

Human setd8 in complex with ms2177
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
143
structure length
143
Chain Sequence
b'SKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-lysine methyltransferase KMT5A
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Structure-Based Design of a Covalent Inhibitor of the SET Domain-Containing Protein 8 (SETD8) Lysine Methyltransferase.
pubmed doi rcsb
total genus 34
structure length 143
sequence length 143
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5t5gA00
4YPUA 5HQ8A 5KJLA 3KMAA 3MEKA 5EG2A 5T5GA 5CPRB 3CBMA 5F6LA 5JJ0A 4J7FA 2RFIA 1O9SA 3HNAA 3TG4A 2F69A 5TEGA 4J7IA 4H12A 4IJ8A 3MO2A 5JHNA 3KMTA 3OPEA 5KJKA 5HI7A 3S7JA 4J83A 1N6AA 4YNPA 2W5YA 3QWPA 3OXGA 4NVQA 4FMUA 4QEOA 5ARFA 1MVXA 4C1QA 5LSZA 4Z4PA 3SW9A 3QWWA 4YNDA 5EX3A 1N3JA 1MT6A 4MI5A 3M57A 3F9XA 3MO0A 3F9YA 5CCLA 4J8OA 4BUPA 3M54A 3QWVA 3CBOA 5LSXA 3OOIA 3RAYA 1XQHA 3RJWA 5F6KC 5JIYA 4YNMA 2R3AA 5F59A 3S7FA 3TG5A 3M56A 3OXLA 4LDGA 2IGQA 3IHXA 4YPEA 4JLGA 4E47A 5JINA 3M5AA 5TH7A 5CCMA 3BO5A 4O30A 3N71A 3M55A 5TTFA 1N6CA 3DB5A 3M53A 3OS5A 4JDSA 3VV0A 4NJ5A 4O6FA 5ARGA 5F5EA 3S7BA 5AYFA 3RU0A 1ML9A 4AU7A 3EP0A 4YPAA 3MO5A 3VUZA 3OXFA 5T0KA 3F9WA 3CBPA 1MVHA 3PDNA 4MI0A 4RZ0A 3RIBA 5KJNA 2BQZA 5EX0A 3K5KA 1ZKKA 3F9ZA 4IJDA 2G46A 3M59A 5T0MA 3RQ4A 3M58A 2JV0A 4QEPA 3KMJA 3S7DA 2O8JA 2QPWA 2W5ZA 1MUFA 4I51A 3S8PA 1PEGA 3FPDA 4WUYA 3SWCA 1H3IA 3DALA 4QENA 5KJMA
chains in the Genus database with same CATH superfamily
4YPUA 5HQ8A 5KJLA 3KMAA 3MEKA 5EG2A 5T5GA 5CPRB 3CBMA 5F6LA 5JJ0A 4J7FA 2RFIA 1O9SA 3HNAA 3TG4A 2F69A 5TEGA 4J7IA 4H12A 4IJ8A 3MO2A 5JHNA 3KMTA 3OPEA 5KJKA 5HI7A 3S7JA 4J83A 1N6AA 4YNPA 2W5YA 3QWPA 3OXGA 4NVQA 4FMUA 4QEOA 5ARFA 1MVXA 4C1QA 5LSZA 4Z4PA 3SW9A 3QWWA 4YNDA 5EX3A 1N3JA 1MT6A 4MI5A 3M57A 3F9XA 3MO0A 3F9YA 5CCLA 4J8OA 4BUPA 3M54A 3QWVA 3CBOA 5LSXA 3OOIA 3RAYA 1XQHA 3RJWA 5F6KC 5JIYA 4YNMA 2R3AA 5F59A 3S7FA 3TG5A 3M56A 3OXLA 4LDGA 2IGQA 3IHXA 4YPEA 4JLGA 4E47A 5JINA 3M5AA 5TH7A 5CCMA 3BO5A 4O30A 3N71A 3M55A 5TTFA 1N6CA 3DB5A 3M53A 3OS5A 4JDSA 3VV0A 4NJ5A 4O6FA 5ARGA 5F5EA 3S7BA 5AYFA 3RU0A 1ML9A 4AU7A 3EP0A 4YPAA 3MO5A 3VUZA 3OXFA 5T0KA 3F9WA 3CBPA 1MVHA 3PDNA 4MI0A 4RZ0A 3RIBA 5KJNA 2BQZA 5EX0A 3K5KA 1ZKKA 3F9ZA 4IJDA 2G46A 3M59A 5T0MA 3RQ4A 3M58A 2JV0A 4QEPA 3KMJA 3S7DA 2O8JA 2QPWA 2W5ZA 1MUFA 4I51A 3S8PA 1PEGA 3FPDA 4WUYA 3SWCA 1H3IA 3DALA 4QENA 5KJMA
chains in the Genus database with same CATH topology
4YPUA 5HQ8A 5KJLA 3KMAA 3MEKA 5EG2A 5T5GA 5CPRB 3CBMA 5F6LA 5JJ0A 4J7FA 2RFIA 1O9SA 3HNAA 3TG4A 2F69A 5TEGA 4J7IA 4H12A 4IJ8A 3MO2A 5JHNA 3KMTA 3OPEA 5KJKA 5HI7A 3S7JA 4J83A 1N6AA 4YNPA 2W5YA 3QWPA 3OXGA 4NVQA 4FMUA 4QEOA 5ARFA 1MVXA 4C1QA 5LSZA 4Z4PA 3SW9A 3QWWA 4YNDA 5EX3A 1N3JA 1MT6A 4MI5A 3M57A 3F9XA 3MO0A 3F9YA 5CCLA 4J8OA 4BUPA 3M54A 3QWVA 3CBOA 5LSXA 3OOIA 3RAYA 1XQHA 3RJWA 5F6KC 5JIYA 4YNMA 2R3AA 5F59A 3S7FA 3TG5A 3M56A 3OXLA 4LDGA 2IGQA 3IHXA 4YPEA 4JLGA 4E47A 5JINA 3M5AA 5TH7A 5CCMA 3BO5A 4O30A 3N71A 3M55A 5TTFA 1N6CA 3DB5A 3M53A 3OS5A 4JDSA 3VV0A 4NJ5A 4O6FA 5ARGA 5F5EA 3S7BA 5AYFA 3RU0A 1ML9A 4AU7A 3EP0A 4YPAA 3MO5A 3VUZA 3OXFA 5T0KA 3F9WA 3CBPA 1MVHA 3PDNA 4MI0A 4RZ0A 3RIBA 5KJNA 2BQZA 5EX0A 3K5KA 1ZKKA 3F9ZA 4IJDA 2G46A 3M59A 5T0MA 3RQ4A 3M58A 2JV0A 4QEPA 3KMJA 3S7DA 2O8JA 2QPWA 2W5ZA 1MUFA 4I51A 3S8PA 1PEGA 3FPDA 4WUYA 3SWCA 1H3IA 3DALA 4QENA 5KJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPU A;  5HQ8 A;  5KJL A;  3KMA A;  3MEK A;  5EG2 A;  5T5G A;  5CPR B;  3CBM A;  5F6L A;  5JJ0 A;  4J7F A;  2RFI A;  1O9S A;  3HNA A;  3TG4 A;  2F69 A;  5TEG A;  4J7I A;  4H12 A;  4IJ8 A;  3MO2 A;  5JHN A;  3KMT A;  3OPE A;  5KJK A;  5HI7 A;  3S7J A;  4J83 A;  1N6A A;  4YNP A;  2W5Y A;  3QWP A;  3OXG A;  4NVQ A;  4FMU A;  4QEO A;  5ARF A;  1MVX A;  4C1Q A;  5LSZ A;  4Z4P A;  3SW9 A;  3QWW A;  4YND A;  5EX3 A;  1N3J A;  1MT6 A;  4MI5 A;  3M57 A;  3F9X A;  3MO0 A;  3F9Y A;  5CCL A;  4J8O A;  4BUP A;  3M54 A;  3QWV A;  3CBO A;  5LSX A;  3OOI A;  3RAY A;  1XQH A;  3RJW A;  5F6K C;  5JIY A;  4YNM A;  2R3A A;  5F59 A;  3S7F A;  3TG5 A;  3M56 A;  3OXL A;  4LDG A;  2IGQ A;  3IHX A;  4YPE A;  4JLG A;  4E47 A;  5JIN A;  3M5A A;  5TH7 A;  5CCM A;  3BO5 A;  4O30 A;  3N71 A;  3M55 A;  5TTF A;  1N6C A;  3DB5 A;  3M53 A;  3OS5 A;  4JDS A;  3VV0 A;  4NJ5 A;  4O6F A;  5ARG A;  5F5E A;  3S7B A;  5AYF A;  3RU0 A;  1ML9 A;  4AU7 A;  3EP0 A;  4YPA A;  3MO5 A;  3VUZ A;  3OXF A;  5T0K A;  3F9W A;  3CBP A;  1MVH A;  3PDN A;  4MI0 A;  4RZ0 A;  3RIB A;  5KJN A;  2BQZ A;  5EX0 A;  3K5K A;  1ZKK A;  3F9Z A;  4IJD A;  2G46 A;  3M59 A;  5T0M A;  3RQ4 A;  3M58 A;  2JV0 A;  4QEP A;  3KMJ A;  3S7D A;  2O8J A;  2QPW A;  2W5Z A;  1MUF A;  4I51 A;  3S8P A;  1PEG A;  3FPD A;  4WUY A;  3SWC A;  1H3I A;  3DAL A;  4QEN A;  5KJM A; 
#chains in the Genus database with same CATH topology
 4YPU A;  5HQ8 A;  5KJL A;  3KMA A;  3MEK A;  5EG2 A;  5T5G A;  5CPR B;  3CBM A;  5F6L A;  5JJ0 A;  4J7F A;  2RFI A;  1O9S A;  3HNA A;  3TG4 A;  2F69 A;  5TEG A;  4J7I A;  4H12 A;  4IJ8 A;  3MO2 A;  5JHN A;  3KMT A;  3OPE A;  5KJK A;  5HI7 A;  3S7J A;  4J83 A;  1N6A A;  4YNP A;  2W5Y A;  3QWP A;  3OXG A;  4NVQ A;  4FMU A;  4QEO A;  5ARF A;  1MVX A;  4C1Q A;  5LSZ A;  4Z4P A;  3SW9 A;  3QWW A;  4YND A;  5EX3 A;  1N3J A;  1MT6 A;  4MI5 A;  3M57 A;  3F9X A;  3MO0 A;  3F9Y A;  5CCL A;  4J8O A;  4BUP A;  3M54 A;  3QWV A;  3CBO A;  5LSX A;  3OOI A;  3RAY A;  1XQH A;  3RJW A;  5F6K C;  5JIY A;  4YNM A;  2R3A A;  5F59 A;  3S7F A;  3TG5 A;  3M56 A;  3OXL A;  4LDG A;  2IGQ A;  3IHX A;  4YPE A;  4JLG A;  4E47 A;  5JIN A;  3M5A A;  5TH7 A;  5CCM A;  3BO5 A;  4O30 A;  3N71 A;  3M55 A;  5TTF A;  1N6C A;  3DB5 A;  3M53 A;  3OS5 A;  4JDS A;  3VV0 A;  4NJ5 A;  4O6F A;  5ARG A;  5F5E A;  3S7B A;  5AYF A;  3RU0 A;  1ML9 A;  4AU7 A;  3EP0 A;  4YPA A;  3MO5 A;  3VUZ A;  3OXF A;  5T0K A;  3F9W A;  3CBP A;  1MVH A;  3PDN A;  4MI0 A;  4RZ0 A;  3RIB A;  5KJN A;  2BQZ A;  5EX0 A;  3K5K A;  1ZKK A;  3F9Z A;  4IJD A;  2G46 A;  3M59 A;  5T0M A;  3RQ4 A;  3M58 A;  2JV0 A;  4QEP A;  3KMJ A;  3S7D A;  2O8J A;  2QPW A;  2W5Z A;  1MUF A;  4I51 A;  3S8P A;  1PEG A;  3FPD A;  4WUY A;  3SWC A;  1H3I A;  3DAL A;  4QEN A;  5KJM A; 
#chains in the Genus database with same CATH homology
 4YPU A;  5HQ8 A;  5KJL A;  3KMA A;  3MEK A;  5EG2 A;  5T5G A;  5CPR B;  3CBM A;  5F6L A;  5JJ0 A;  4J7F A;  2RFI A;  1O9S A;  3HNA A;  3TG4 A;  2F69 A;  5TEG A;  4J7I A;  4H12 A;  4IJ8 A;  3MO2 A;  5JHN A;  3KMT A;  3OPE A;  5KJK A;  5HI7 A;  3S7J A;  4J83 A;  1N6A A;  4YNP A;  2W5Y A;  3QWP A;  3OXG A;  4NVQ A;  4FMU A;  4QEO A;  5ARF A;  1MVX A;  4C1Q A;  5LSZ A;  4Z4P A;  3SW9 A;  3QWW A;  4YND A;  5EX3 A;  1N3J A;  1MT6 A;  4MI5 A;  3M57 A;  3F9X A;  3MO0 A;  3F9Y A;  5CCL A;  4J8O A;  4BUP A;  3M54 A;  3QWV A;  3CBO A;  5LSX A;  3OOI A;  3RAY A;  1XQH A;  3RJW A;  5F6K C;  5JIY A;  4YNM A;  2R3A A;  5F59 A;  3S7F A;  3TG5 A;  3M56 A;  3OXL A;  4LDG A;  2IGQ A;  3IHX A;  4YPE A;  4JLG A;  4E47 A;  5JIN A;  3M5A A;  5TH7 A;  5CCM A;  3BO5 A;  4O30 A;  3N71 A;  3M55 A;  5TTF A;  1N6C A;  3DB5 A;  3M53 A;  3OS5 A;  4JDS A;  3VV0 A;  4NJ5 A;  4O6F A;  5ARG A;  5F5E A;  3S7B A;  5AYF A;  3RU0 A;  1ML9 A;  4AU7 A;  3EP0 A;  4YPA A;  3MO5 A;  3VUZ A;  3OXF A;  5T0K A;  3F9W A;  3CBP A;  1MVH A;  3PDN A;  4MI0 A;  4RZ0 A;  3RIB A;  5KJN A;  2BQZ A;  5EX0 A;  3K5K A;  1ZKK A;  3F9Z A;  4IJD A;  2G46 A;  3M59 A;  5T0M A;  3RQ4 A;  3M58 A;  2JV0 A;  4QEP A;  3KMJ A;  3S7D A;  2O8J A;  2QPW A;  2W5Z A;  1MUF A;  4I51 A;  3S8P A;  1PEG A;  3FPD A;  4WUY A;  3SWC A;  1H3I A;  3DAL A;  4QEN A;  5KJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...