5T5GA

Human setd8 in complex with ms2177
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
143
structure length
143
Chain Sequence
SKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design of a Covalent Inhibitor of the SET Domain-Containing Protein 8 (SETD8) Lysine Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase KMT5A
total genus 34
structure length 143
sequence length 143
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5t5gA00
3IHXA 3S7FA 5TTFA 4MI5A 3TG4A 4QENA 2W5YA 3DB5A 4H12A 3OXLA 5ARFA 1PEGA 2G46A 2O8JA 5LSZA 3KMTA 3MO2A 4YPUA 5F6KC 5T0MA 3S8PA 5JHNA 4O6FA 3VV0A 1MVHA 3OXGA 5F6LA 3CBPA 3RU0A 3F9XA 4QEPA 3F9ZA 1H3IA 3TG5A 4YNMA 3RQ4A 5CPRB 2QPWA 4NJ5A 2RFIA 4JDSA 3M59A 3DALA 3KMJA 2F69A 4WUYA 5EX0A 3N71A 5HI7A 5TEGA 3BO5A 3RJWA 5T5GA 1ZKKA 4IJDA 4AU7A 5KJNA 3F9WA 5F5EA 2BQZA 3M53A 1O9SA 3QWVA 3CBOA 4O30A 3S7JA 5F59A 3M54A 3SW9A 3M55A 5LSXA 3RAYA 1N6CA 3RIBA 5JJ0A 3HNAA 3M58A 3S7BA 5T0KA 4NVQA 3QWWA 3OOIA 2JV0A 1ML9A 2IGQA 5HQ8A 3PDNA 4MI0A 5JIYA 5TH7A 4I51A 4YPAA 1MVXA 4QEOA 3SWCA 1MUFA 4YNDA 4J8OA 3M5AA 4LDGA 3M56A 1N6AA 4J83A 4IJ8A 3OXFA 3CBMA 4YNPA 4RZ0A 3F9YA 5KJKA 4J7FA 3VUZA 3S7DA 3MEKA 4E47A 3K5KA 4BUPA 4Z4PA 1XQHA 3OPEA 5CCLA 5CCMA 5KJMA 4YPEA 1MT6A 2R3AA 1N3JA 3M57A 5EX3A 5JINA 3MO0A 5ARGA 3FPDA 4JLGA 4J7IA 3MO5A 3EP0A 3KMAA 5AYFA 5KJLA 2W5ZA 3QWPA 4FMUA 5EG2A 4C1QA 3OS5A
chains in the Genus database with same CATH superfamily
3IHXA 3S7FA 5TTFA 4MI5A 3TG4A 4QENA 2W5YA 3DB5A 4H12A 3OXLA 5ARFA 1PEGA 2G46A 2O8JA 5LSZA 3KMTA 3MO2A 4YPUA 5F6KC 5T0MA 3S8PA 5JHNA 4O6FA 3VV0A 1MVHA 3OXGA 5F6LA 3CBPA 3RU0A 3F9XA 4QEPA 3F9ZA 1H3IA 3TG5A 4YNMA 3RQ4A 5CPRB 2QPWA 4NJ5A 2RFIA 4JDSA 3M59A 3DALA 3KMJA 2F69A 4WUYA 5EX0A 3N71A 5HI7A 5TEGA 3BO5A 3RJWA 5T5GA 1ZKKA 4IJDA 4AU7A 5KJNA 3F9WA 5F5EA 2BQZA 3M53A 1O9SA 3QWVA 3CBOA 4O30A 3S7JA 5F59A 3M54A 3SW9A 3M55A 5LSXA 3RAYA 1N6CA 3RIBA 5JJ0A 3HNAA 3M58A 3S7BA 5T0KA 4NVQA 3QWWA 3OOIA 2JV0A 1ML9A 2IGQA 5HQ8A 3PDNA 4MI0A 5JIYA 5TH7A 4I51A 4YPAA 1MVXA 4QEOA 3SWCA 1MUFA 4YNDA 4J8OA 3M5AA 4LDGA 3M56A 1N6AA 4J83A 4IJ8A 3OXFA 3CBMA 4YNPA 4RZ0A 3F9YA 5KJKA 4J7FA 3VUZA 3S7DA 3MEKA 4E47A 3K5KA 4BUPA 4Z4PA 1XQHA 3OPEA 5CCLA 5CCMA 5KJMA 4YPEA 1MT6A 2R3AA 1N3JA 3M57A 5EX3A 5JINA 3MO0A 5ARGA 3FPDA 4JLGA 4J7IA 3MO5A 3EP0A 3KMAA 5AYFA 5KJLA 2W5ZA 3QWPA 4FMUA 5EG2A 4C1QA 3OS5A
chains in the Genus database with same CATH topology
3IHXA 3S7FA 5TTFA 4MI5A 3TG4A 4QENA 2W5YA 3DB5A 4H12A 3OXLA 5ARFA 1PEGA 2G46A 2O8JA 5LSZA 3KMTA 3MO2A 4YPUA 5F6KC 5T0MA 3S8PA 5JHNA 4O6FA 3VV0A 1MVHA 3OXGA 5F6LA 3CBPA 3RU0A 3F9XA 4QEPA 3F9ZA 1H3IA 3TG5A 4YNMA 3RQ4A 5CPRB 2QPWA 4NJ5A 2RFIA 4JDSA 3M59A 3DALA 3KMJA 2F69A 4WUYA 5EX0A 3N71A 5HI7A 5TEGA 3BO5A 3RJWA 5T5GA 1ZKKA 4IJDA 4AU7A 5KJNA 3F9WA 5F5EA 2BQZA 3M53A 1O9SA 3QWVA 3CBOA 4O30A 3S7JA 5F59A 3M54A 3SW9A 3M55A 5LSXA 3RAYA 1N6CA 3RIBA 5JJ0A 3HNAA 3M58A 3S7BA 5T0KA 4NVQA 3QWWA 3OOIA 2JV0A 1ML9A 2IGQA 5HQ8A 3PDNA 4MI0A 5JIYA 5TH7A 4I51A 4YPAA 1MVXA 4QEOA 3SWCA 1MUFA 4YNDA 4J8OA 3M5AA 4LDGA 3M56A 1N6AA 4J83A 4IJ8A 3OXFA 3CBMA 4YNPA 4RZ0A 3F9YA 5KJKA 4J7FA 3VUZA 3S7DA 3MEKA 4E47A 3K5KA 4BUPA 4Z4PA 1XQHA 3OPEA 5CCLA 5CCMA 5KJMA 4YPEA 1MT6A 2R3AA 1N3JA 3M57A 5EX3A 5JINA 3MO0A 5ARGA 3FPDA 4JLGA 4J7IA 3MO5A 3EP0A 3KMAA 5AYFA 5KJLA 2W5ZA 3QWPA 4FMUA 5EG2A 4C1QA 3OS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHX A;  3S7F A;  5TTF A;  4MI5 A;  3TG4 A;  4QEN A;  2W5Y A;  3DB5 A;  4H12 A;  3OXL A;  5ARF A;  1PEG A;  2G46 A;  2O8J A;  5LSZ A;  3KMT A;  3MO2 A;  4YPU A;  5F6K C;  5T0M A;  3S8P A;  5JHN A;  4O6F A;  3VV0 A;  1MVH A;  3OXG A;  5F6L A;  3CBP A;  3RU0 A;  3F9X A;  4QEP A;  3F9Z A;  1H3I A;  3TG5 A;  4YNM A;  3RQ4 A;  5CPR B;  2QPW A;  4NJ5 A;  2RFI A;  4JDS A;  3M59 A;  3DAL A;  3KMJ A;  2F69 A;  4WUY A;  5EX0 A;  3N71 A;  5HI7 A;  5TEG A;  3BO5 A;  3RJW A;  5T5G A;  1ZKK A;  4IJD A;  4AU7 A;  5KJN A;  3F9W A;  5F5E A;  2BQZ A;  3M53 A;  1O9S A;  3QWV A;  3CBO A;  4O30 A;  3S7J A;  5F59 A;  3M54 A;  3SW9 A;  3M55 A;  5LSX A;  3RAY A;  1N6C A;  3RIB A;  5JJ0 A;  3HNA A;  3M58 A;  3S7B A;  5T0K A;  4NVQ A;  3QWW A;  3OOI A;  2JV0 A;  1ML9 A;  2IGQ A;  5HQ8 A;  3PDN A;  4MI0 A;  5JIY A;  5TH7 A;  4I51 A;  4YPA A;  1MVX A;  4QEO A;  3SWC A;  1MUF A;  4YND A;  4J8O A;  3M5A A;  4LDG A;  3M56 A;  1N6A A;  4J83 A;  4IJ8 A;  3OXF A;  3CBM A;  4YNP A;  4RZ0 A;  3F9Y A;  5KJK A;  4J7F A;  3VUZ A;  3S7D A;  3MEK A;  4E47 A;  3K5K A;  4BUP A;  4Z4P A;  1XQH A;  3OPE A;  5CCL A;  5CCM A;  5KJM A;  4YPE A;  1MT6 A;  2R3A A;  1N3J A;  3M57 A;  5EX3 A;  5JIN A;  3MO0 A;  5ARG A;  3FPD A;  4JLG A;  4J7I A;  3MO5 A;  3EP0 A;  3KMA A;  5AYF A;  5KJL A;  2W5Z A;  3QWP A;  4FMU A;  5EG2 A;  4C1Q A;  3OS5 A; 
#chains in the Genus database with same CATH topology
 3IHX A;  3S7F A;  5TTF A;  4MI5 A;  3TG4 A;  4QEN A;  2W5Y A;  3DB5 A;  4H12 A;  3OXL A;  5ARF A;  1PEG A;  2G46 A;  2O8J A;  5LSZ A;  3KMT A;  3MO2 A;  4YPU A;  5F6K C;  5T0M A;  3S8P A;  5JHN A;  4O6F A;  3VV0 A;  1MVH A;  3OXG A;  5F6L A;  3CBP A;  3RU0 A;  3F9X A;  4QEP A;  3F9Z A;  1H3I A;  3TG5 A;  4YNM A;  3RQ4 A;  5CPR B;  2QPW A;  4NJ5 A;  2RFI A;  4JDS A;  3M59 A;  3DAL A;  3KMJ A;  2F69 A;  4WUY A;  5EX0 A;  3N71 A;  5HI7 A;  5TEG A;  3BO5 A;  3RJW A;  5T5G A;  1ZKK A;  4IJD A;  4AU7 A;  5KJN A;  3F9W A;  5F5E A;  2BQZ A;  3M53 A;  1O9S A;  3QWV A;  3CBO A;  4O30 A;  3S7J A;  5F59 A;  3M54 A;  3SW9 A;  3M55 A;  5LSX A;  3RAY A;  1N6C A;  3RIB A;  5JJ0 A;  3HNA A;  3M58 A;  3S7B A;  5T0K A;  4NVQ A;  3QWW A;  3OOI A;  2JV0 A;  1ML9 A;  2IGQ A;  5HQ8 A;  3PDN A;  4MI0 A;  5JIY A;  5TH7 A;  4I51 A;  4YPA A;  1MVX A;  4QEO A;  3SWC A;  1MUF A;  4YND A;  4J8O A;  3M5A A;  4LDG A;  3M56 A;  1N6A A;  4J83 A;  4IJ8 A;  3OXF A;  3CBM A;  4YNP A;  4RZ0 A;  3F9Y A;  5KJK A;  4J7F A;  3VUZ A;  3S7D A;  3MEK A;  4E47 A;  3K5K A;  4BUP A;  4Z4P A;  1XQH A;  3OPE A;  5CCL A;  5CCM A;  5KJM A;  4YPE A;  1MT6 A;  2R3A A;  1N3J A;  3M57 A;  5EX3 A;  5JIN A;  3MO0 A;  5ARG A;  3FPD A;  4JLG A;  4J7I A;  3MO5 A;  3EP0 A;  3KMA A;  5AYF A;  5KJL A;  2W5Z A;  3QWP A;  4FMU A;  5EG2 A;  4C1Q A;  3OS5 A; 
#chains in the Genus database with same CATH homology
 3IHX A;  3S7F A;  5TTF A;  4MI5 A;  3TG4 A;  4QEN A;  2W5Y A;  3DB5 A;  4H12 A;  3OXL A;  5ARF A;  1PEG A;  2G46 A;  2O8J A;  5LSZ A;  3KMT A;  3MO2 A;  4YPU A;  5F6K C;  5T0M A;  3S8P A;  5JHN A;  4O6F A;  3VV0 A;  1MVH A;  3OXG A;  5F6L A;  3CBP A;  3RU0 A;  3F9X A;  4QEP A;  3F9Z A;  1H3I A;  3TG5 A;  4YNM A;  3RQ4 A;  5CPR B;  2QPW A;  4NJ5 A;  2RFI A;  4JDS A;  3M59 A;  3DAL A;  3KMJ A;  2F69 A;  4WUY A;  5EX0 A;  3N71 A;  5HI7 A;  5TEG A;  3BO5 A;  3RJW A;  5T5G A;  1ZKK A;  4IJD A;  4AU7 A;  5KJN A;  3F9W A;  5F5E A;  2BQZ A;  3M53 A;  1O9S A;  3QWV A;  3CBO A;  4O30 A;  3S7J A;  5F59 A;  3M54 A;  3SW9 A;  3M55 A;  5LSX A;  3RAY A;  1N6C A;  3RIB A;  5JJ0 A;  3HNA A;  3M58 A;  3S7B A;  5T0K A;  4NVQ A;  3QWW A;  3OOI A;  2JV0 A;  1ML9 A;  2IGQ A;  5HQ8 A;  3PDN A;  4MI0 A;  5JIY A;  5TH7 A;  4I51 A;  4YPA A;  1MVX A;  4QEO A;  3SWC A;  1MUF A;  4YND A;  4J8O A;  3M5A A;  4LDG A;  3M56 A;  1N6A A;  4J83 A;  4IJ8 A;  3OXF A;  3CBM A;  4YNP A;  4RZ0 A;  3F9Y A;  5KJK A;  4J7F A;  3VUZ A;  3S7D A;  3MEK A;  4E47 A;  3K5K A;  4BUP A;  4Z4P A;  1XQH A;  3OPE A;  5CCL A;  5CCM A;  5KJM A;  4YPE A;  1MT6 A;  2R3A A;  1N3J A;  3M57 A;  5EX3 A;  5JIN A;  3MO0 A;  5ARG A;  3FPD A;  4JLG A;  4J7I A;  3MO5 A;  3EP0 A;  3KMA A;  5AYF A;  5KJL A;  2W5Z A;  3QWP A;  4FMU A;  5EG2 A;  4C1Q A;  3OS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...