5T5GA

Human setd8 in complex with ms2177
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
143
structure length
143
Chain Sequence
SKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design of a Covalent Inhibitor of the SET Domain-Containing Protein 8 (SETD8) Lysine Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase KMT5A
total genus 34
structure length 143
sequence length 143
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5t5gA00
2O8JA 4NVQA 3MEKA 5KJNA 2IGQA 5EX3A 4I51A 2G46A 4YNMA 3QWWA 1MT6A 3M55A 3KMJA 3S8PA 3M58A 5ARGA 3KMAA 3OPEA 4J83A 4Z4PA 5TH7A 5LSZA 3F9XA 3OOIA 5EG2A 4MI0A 5F59A 3OXGA 3M53A 4J8OA 3SWCA 1N3JA 4QEOA 4WUYA 5T5GA 1PEGA 3S7FA 5CCMA 2BQZA 3BO5A 3EP0A 5KJKA 3RQ4A 4H12A 3S7BA 1XQHA 4QENA 4O30A 1MVXA 5JINA 3CBOA 4RZ0A 4YNDA 1MUFA 3F9WA 4C1QA 2JV0A 4E47A 3CBMA 1ZKKA 3TG5A 4YPUA 3RU0A 5T0MA 4AU7A 5JJ0A 4JDSA 5F6LA 2RFIA 5LSXA 4JLGA 1H3IA 4IJ8A 4J7FA 2W5YA 1O9SA 1N6AA 5ARFA 2F69A 5CPRB 3QWVA 1ML9A 3IHXA 3M5AA 3RIBA 5HQ8A 3PDNA 3M57A 3M59A 3M54A 4LDGA 5TEGA 3CBPA 3VUZA 5F5EA 4BUPA 3RAYA 3SW9A 3S7JA 4MI5A 4NJ5A 4YPEA 5JIYA 4J7IA 4FMUA 4YNPA 5CCLA 3M56A 4IJDA 3N71A 4YPAA 3S7DA 3HNAA 3KMTA 5HI7A 4O6FA 5TTFA 5AYFA 2R3AA 1N6CA 3OXFA 3MO0A 5T0KA 3FPDA 3QWPA 3VV0A 5KJMA 5F6KC 5KJLA 3DB5A 2W5ZA 3K5KA 3MO2A 3F9ZA 3TG4A 3F9YA 2QPWA 4QEPA 5EX0A 3DALA 3OS5A 1MVHA 3RJWA 5JHNA 3MO5A 3OXLA
chains in the Genus database with same CATH superfamily
2O8JA 4NVQA 3MEKA 5KJNA 2IGQA 5EX3A 4I51A 2G46A 4YNMA 3QWWA 1MT6A 3M55A 3KMJA 3S8PA 3M58A 5ARGA 3KMAA 3OPEA 4J83A 4Z4PA 5TH7A 5LSZA 3F9XA 3OOIA 5EG2A 4MI0A 5F59A 3OXGA 3M53A 4J8OA 3SWCA 1N3JA 4QEOA 4WUYA 5T5GA 1PEGA 3S7FA 5CCMA 2BQZA 3BO5A 3EP0A 5KJKA 3RQ4A 4H12A 3S7BA 1XQHA 4QENA 4O30A 1MVXA 5JINA 3CBOA 4RZ0A 4YNDA 1MUFA 3F9WA 4C1QA 2JV0A 4E47A 3CBMA 1ZKKA 3TG5A 4YPUA 3RU0A 5T0MA 4AU7A 5JJ0A 4JDSA 5F6LA 2RFIA 5LSXA 4JLGA 1H3IA 4IJ8A 4J7FA 2W5YA 1O9SA 1N6AA 5ARFA 2F69A 5CPRB 3QWVA 1ML9A 3IHXA 3M5AA 3RIBA 5HQ8A 3PDNA 3M57A 3M59A 3M54A 4LDGA 5TEGA 3CBPA 3VUZA 5F5EA 4BUPA 3RAYA 3SW9A 3S7JA 4MI5A 4NJ5A 4YPEA 5JIYA 4J7IA 4FMUA 4YNPA 5CCLA 3M56A 4IJDA 3N71A 4YPAA 3S7DA 3HNAA 3KMTA 5HI7A 4O6FA 5TTFA 5AYFA 2R3AA 1N6CA 3OXFA 3MO0A 5T0KA 3FPDA 3QWPA 3VV0A 5KJMA 5F6KC 5KJLA 3DB5A 2W5ZA 3K5KA 3MO2A 3F9ZA 3TG4A 3F9YA 2QPWA 4QEPA 5EX0A 3DALA 3OS5A 1MVHA 3RJWA 5JHNA 3MO5A 3OXLA
chains in the Genus database with same CATH topology
2O8JA 4NVQA 3MEKA 5KJNA 2IGQA 5EX3A 4I51A 2G46A 4YNMA 3QWWA 1MT6A 3M55A 3KMJA 3S8PA 3M58A 5ARGA 3KMAA 3OPEA 4J83A 4Z4PA 5TH7A 5LSZA 3F9XA 3OOIA 5EG2A 4MI0A 5F59A 3OXGA 3M53A 4J8OA 3SWCA 1N3JA 4QEOA 4WUYA 5T5GA 1PEGA 3S7FA 5CCMA 2BQZA 3BO5A 3EP0A 5KJKA 3RQ4A 4H12A 3S7BA 1XQHA 4QENA 4O30A 1MVXA 5JINA 3CBOA 4RZ0A 4YNDA 1MUFA 3F9WA 4C1QA 2JV0A 4E47A 3CBMA 1ZKKA 3TG5A 4YPUA 3RU0A 5T0MA 4AU7A 5JJ0A 4JDSA 5F6LA 2RFIA 5LSXA 4JLGA 1H3IA 4IJ8A 4J7FA 2W5YA 1O9SA 1N6AA 5ARFA 2F69A 5CPRB 3QWVA 1ML9A 3IHXA 3M5AA 3RIBA 5HQ8A 3PDNA 3M57A 3M59A 3M54A 4LDGA 5TEGA 3CBPA 3VUZA 5F5EA 4BUPA 3RAYA 3SW9A 3S7JA 4MI5A 4NJ5A 4YPEA 5JIYA 4J7IA 4FMUA 4YNPA 5CCLA 3M56A 4IJDA 3N71A 4YPAA 3S7DA 3HNAA 3KMTA 5HI7A 4O6FA 5TTFA 5AYFA 2R3AA 1N6CA 3OXFA 3MO0A 5T0KA 3FPDA 3QWPA 3VV0A 5KJMA 5F6KC 5KJLA 3DB5A 2W5ZA 3K5KA 3MO2A 3F9ZA 3TG4A 3F9YA 2QPWA 4QEPA 5EX0A 3DALA 3OS5A 1MVHA 3RJWA 5JHNA 3MO5A 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O8J A;  4NVQ A;  3MEK A;  5KJN A;  2IGQ A;  5EX3 A;  4I51 A;  2G46 A;  4YNM A;  3QWW A;  1MT6 A;  3M55 A;  3KMJ A;  3S8P A;  3M58 A;  5ARG A;  3KMA A;  3OPE A;  4J83 A;  4Z4P A;  5TH7 A;  5LSZ A;  3F9X A;  3OOI A;  5EG2 A;  4MI0 A;  5F59 A;  3OXG A;  3M53 A;  4J8O A;  3SWC A;  1N3J A;  4QEO A;  4WUY A;  5T5G A;  1PEG A;  3S7F A;  5CCM A;  2BQZ A;  3BO5 A;  3EP0 A;  5KJK A;  3RQ4 A;  4H12 A;  3S7B A;  1XQH A;  4QEN A;  4O30 A;  1MVX A;  5JIN A;  3CBO A;  4RZ0 A;  4YND A;  1MUF A;  3F9W A;  4C1Q A;  2JV0 A;  4E47 A;  3CBM A;  1ZKK A;  3TG5 A;  4YPU A;  3RU0 A;  5T0M A;  4AU7 A;  5JJ0 A;  4JDS A;  5F6L A;  2RFI A;  5LSX A;  4JLG A;  1H3I A;  4IJ8 A;  4J7F A;  2W5Y A;  1O9S A;  1N6A A;  5ARF A;  2F69 A;  5CPR B;  3QWV A;  1ML9 A;  3IHX A;  3M5A A;  3RIB A;  5HQ8 A;  3PDN A;  3M57 A;  3M59 A;  3M54 A;  4LDG A;  5TEG A;  3CBP A;  3VUZ A;  5F5E A;  4BUP A;  3RAY A;  3SW9 A;  3S7J A;  4MI5 A;  4NJ5 A;  4YPE A;  5JIY A;  4J7I A;  4FMU A;  4YNP A;  5CCL A;  3M56 A;  4IJD A;  3N71 A;  4YPA A;  3S7D A;  3HNA A;  3KMT A;  5HI7 A;  4O6F A;  5TTF A;  5AYF A;  2R3A A;  1N6C A;  3OXF A;  3MO0 A;  5T0K A;  3FPD A;  3QWP A;  3VV0 A;  5KJM A;  5F6K C;  5KJL A;  3DB5 A;  2W5Z A;  3K5K A;  3MO2 A;  3F9Z A;  3TG4 A;  3F9Y A;  2QPW A;  4QEP A;  5EX0 A;  3DAL A;  3OS5 A;  1MVH A;  3RJW A;  5JHN A;  3MO5 A;  3OXL A; 
#chains in the Genus database with same CATH topology
 2O8J A;  4NVQ A;  3MEK A;  5KJN A;  2IGQ A;  5EX3 A;  4I51 A;  2G46 A;  4YNM A;  3QWW A;  1MT6 A;  3M55 A;  3KMJ A;  3S8P A;  3M58 A;  5ARG A;  3KMA A;  3OPE A;  4J83 A;  4Z4P A;  5TH7 A;  5LSZ A;  3F9X A;  3OOI A;  5EG2 A;  4MI0 A;  5F59 A;  3OXG A;  3M53 A;  4J8O A;  3SWC A;  1N3J A;  4QEO A;  4WUY A;  5T5G A;  1PEG A;  3S7F A;  5CCM A;  2BQZ A;  3BO5 A;  3EP0 A;  5KJK A;  3RQ4 A;  4H12 A;  3S7B A;  1XQH A;  4QEN A;  4O30 A;  1MVX A;  5JIN A;  3CBO A;  4RZ0 A;  4YND A;  1MUF A;  3F9W A;  4C1Q A;  2JV0 A;  4E47 A;  3CBM A;  1ZKK A;  3TG5 A;  4YPU A;  3RU0 A;  5T0M A;  4AU7 A;  5JJ0 A;  4JDS A;  5F6L A;  2RFI A;  5LSX A;  4JLG A;  1H3I A;  4IJ8 A;  4J7F A;  2W5Y A;  1O9S A;  1N6A A;  5ARF A;  2F69 A;  5CPR B;  3QWV A;  1ML9 A;  3IHX A;  3M5A A;  3RIB A;  5HQ8 A;  3PDN A;  3M57 A;  3M59 A;  3M54 A;  4LDG A;  5TEG A;  3CBP A;  3VUZ A;  5F5E A;  4BUP A;  3RAY A;  3SW9 A;  3S7J A;  4MI5 A;  4NJ5 A;  4YPE A;  5JIY A;  4J7I A;  4FMU A;  4YNP A;  5CCL A;  3M56 A;  4IJD A;  3N71 A;  4YPA A;  3S7D A;  3HNA A;  3KMT A;  5HI7 A;  4O6F A;  5TTF A;  5AYF A;  2R3A A;  1N6C A;  3OXF A;  3MO0 A;  5T0K A;  3FPD A;  3QWP A;  3VV0 A;  5KJM A;  5F6K C;  5KJL A;  3DB5 A;  2W5Z A;  3K5K A;  3MO2 A;  3F9Z A;  3TG4 A;  3F9Y A;  2QPW A;  4QEP A;  5EX0 A;  3DAL A;  3OS5 A;  1MVH A;  3RJW A;  5JHN A;  3MO5 A;  3OXL A; 
#chains in the Genus database with same CATH homology
 2O8J A;  4NVQ A;  3MEK A;  5KJN A;  2IGQ A;  5EX3 A;  4I51 A;  2G46 A;  4YNM A;  3QWW A;  1MT6 A;  3M55 A;  3KMJ A;  3S8P A;  3M58 A;  5ARG A;  3KMA A;  3OPE A;  4J83 A;  4Z4P A;  5TH7 A;  5LSZ A;  3F9X A;  3OOI A;  5EG2 A;  4MI0 A;  5F59 A;  3OXG A;  3M53 A;  4J8O A;  3SWC A;  1N3J A;  4QEO A;  4WUY A;  5T5G A;  1PEG A;  3S7F A;  5CCM A;  2BQZ A;  3BO5 A;  3EP0 A;  5KJK A;  3RQ4 A;  4H12 A;  3S7B A;  1XQH A;  4QEN A;  4O30 A;  1MVX A;  5JIN A;  3CBO A;  4RZ0 A;  4YND A;  1MUF A;  3F9W A;  4C1Q A;  2JV0 A;  4E47 A;  3CBM A;  1ZKK A;  3TG5 A;  4YPU A;  3RU0 A;  5T0M A;  4AU7 A;  5JJ0 A;  4JDS A;  5F6L A;  2RFI A;  5LSX A;  4JLG A;  1H3I A;  4IJ8 A;  4J7F A;  2W5Y A;  1O9S A;  1N6A A;  5ARF A;  2F69 A;  5CPR B;  3QWV A;  1ML9 A;  3IHX A;  3M5A A;  3RIB A;  5HQ8 A;  3PDN A;  3M57 A;  3M59 A;  3M54 A;  4LDG A;  5TEG A;  3CBP A;  3VUZ A;  5F5E A;  4BUP A;  3RAY A;  3SW9 A;  3S7J A;  4MI5 A;  4NJ5 A;  4YPE A;  5JIY A;  4J7I A;  4FMU A;  4YNP A;  5CCL A;  3M56 A;  4IJD A;  3N71 A;  4YPA A;  3S7D A;  3HNA A;  3KMT A;  5HI7 A;  4O6F A;  5TTF A;  5AYF A;  2R3A A;  1N6C A;  3OXF A;  3MO0 A;  5T0K A;  3FPD A;  3QWP A;  3VV0 A;  5KJM A;  5F6K C;  5KJL A;  3DB5 A;  2W5Z A;  3K5K A;  3MO2 A;  3F9Z A;  3TG4 A;  3F9Y A;  2QPW A;  4QEP A;  5EX0 A;  3DAL A;  3OS5 A;  1MVH A;  3RJW A;  5JHN A;  3MO5 A;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...