3MO2A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e67
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
258
structure length
255
Chain Sequence
IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 62
structure length 255
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo2A00
5F5EA 3FPDA 1N6CA 4J7IA 4O6FA 2W5YA 3MEKA 3M56A 5EG2A 3TG4A 3SW9A 4AU7A 4QENA 2R3AA 3F9XA 3M59A 4YPAA 3CBOA 5HQ8A 3M5AA 2O8JA 3F9ZA 4IJ8A 5F59A 3RAYA 5AYFA 2G46A 5F6KC 3KMAA 1MVXA 1XQHA 4BUPA 3RQ4A 4WUYA 4J7FA 3SWCA 1ZKKA 4YNPA 3PDNA 3BO5A 4J8OA 3OOIA 5JJ0A 4JDSA 4O30A 5CCLA 3S7FA 4LDGA 3S7BA 3MO2A 5T5GA 4J83A 5F6LA 3S7DA 4E47A 3TG5A 3MO0A 5HI7A 4YNMA 4QEPA 4I51A 3S7JA 4Z4PA 4MI5A 5LSZA 1PEGA 1ML9A 3K5KA 4QEOA 3QWVA 3HNAA 3OS5A 3OPEA 5TEGA 5JIYA 1MUFA 1MT6A 4MI0A 5JHNA 3KMJA 4C1QA 3OXGA 3CBMA 2RFIA 3OXFA 1MVHA 3OXLA 3M58A 3F9YA 4IJDA 5TH7A 2F69A 3CBPA 1N3JA 5ARGA 4YPUA 5T0MA 1H3IA 4YNDA 5KJMA 4JLGA 3M54A 1O9SA 5TTFA 4RZ0A 3RJWA 3IHXA 5ARFA 3M55A 5EX0A 4YPEA 3VV0A 3M53A 5LSXA 3DALA 5KJLA 3S8PA 5JINA 4H12A 3F9WA 3EP0A 3MO5A 5KJKA 5EX3A 2QPWA 5KJNA 2IGQA 2JV0A 1N6AA 5T0KA 3KMTA 3M57A 3RU0A 2W5ZA 4NVQA 3DB5A 5CCMA 4FMUA 2BQZA 3QWPA 3QWWA 3VUZA 4NJ5A 3RIBA 3N71A 5CPRB
chains in the Genus database with same CATH superfamily
5F5EA 3FPDA 1N6CA 4J7IA 4O6FA 2W5YA 3MEKA 3M56A 5EG2A 3TG4A 3SW9A 4AU7A 4QENA 2R3AA 3F9XA 3M59A 4YPAA 3CBOA 5HQ8A 3M5AA 2O8JA 3F9ZA 4IJ8A 5F59A 3RAYA 5AYFA 2G46A 5F6KC 3KMAA 1MVXA 1XQHA 4BUPA 3RQ4A 4WUYA 4J7FA 3SWCA 1ZKKA 4YNPA 3PDNA 3BO5A 4J8OA 3OOIA 5JJ0A 4JDSA 4O30A 5CCLA 3S7FA 4LDGA 3S7BA 3MO2A 5T5GA 4J83A 5F6LA 3S7DA 4E47A 3TG5A 3MO0A 5HI7A 4YNMA 4QEPA 4I51A 3S7JA 4Z4PA 4MI5A 5LSZA 1PEGA 1ML9A 3K5KA 4QEOA 3QWVA 3HNAA 3OS5A 3OPEA 5TEGA 5JIYA 1MUFA 1MT6A 4MI0A 5JHNA 3KMJA 4C1QA 3OXGA 3CBMA 2RFIA 3OXFA 1MVHA 3OXLA 3M58A 3F9YA 4IJDA 5TH7A 2F69A 3CBPA 1N3JA 5ARGA 4YPUA 5T0MA 1H3IA 4YNDA 5KJMA 4JLGA 3M54A 1O9SA 5TTFA 4RZ0A 3RJWA 3IHXA 5ARFA 3M55A 5EX0A 4YPEA 3VV0A 3M53A 5LSXA 3DALA 5KJLA 3S8PA 5JINA 4H12A 3F9WA 3EP0A 3MO5A 5KJKA 5EX3A 2QPWA 5KJNA 2IGQA 2JV0A 1N6AA 5T0KA 3KMTA 3M57A 3RU0A 2W5ZA 4NVQA 3DB5A 5CCMA 4FMUA 2BQZA 3QWPA 3QWWA 3VUZA 4NJ5A 3RIBA 3N71A 5CPRB
chains in the Genus database with same CATH topology
5F5EA 3FPDA 1N6CA 4J7IA 4O6FA 2W5YA 3MEKA 3M56A 5EG2A 3TG4A 3SW9A 4AU7A 4QENA 2R3AA 3F9XA 3M59A 4YPAA 3CBOA 5HQ8A 3M5AA 2O8JA 3F9ZA 4IJ8A 5F59A 3RAYA 5AYFA 2G46A 5F6KC 3KMAA 1MVXA 1XQHA 4BUPA 3RQ4A 4WUYA 4J7FA 3SWCA 1ZKKA 4YNPA 3PDNA 3BO5A 4J8OA 3OOIA 5JJ0A 4JDSA 4O30A 5CCLA 3S7FA 4LDGA 3S7BA 3MO2A 5T5GA 4J83A 5F6LA 3S7DA 4E47A 3TG5A 3MO0A 5HI7A 4YNMA 4QEPA 4I51A 3S7JA 4Z4PA 4MI5A 5LSZA 1PEGA 1ML9A 3K5KA 4QEOA 3QWVA 3HNAA 3OS5A 3OPEA 5TEGA 5JIYA 1MUFA 1MT6A 4MI0A 5JHNA 3KMJA 4C1QA 3OXGA 3CBMA 2RFIA 3OXFA 1MVHA 3OXLA 3M58A 3F9YA 4IJDA 5TH7A 2F69A 3CBPA 1N3JA 5ARGA 4YPUA 5T0MA 1H3IA 4YNDA 5KJMA 4JLGA 3M54A 1O9SA 5TTFA 4RZ0A 3RJWA 3IHXA 5ARFA 3M55A 5EX0A 4YPEA 3VV0A 3M53A 5LSXA 3DALA 5KJLA 3S8PA 5JINA 4H12A 3F9WA 3EP0A 3MO5A 5KJKA 5EX3A 2QPWA 5KJNA 2IGQA 2JV0A 1N6AA 5T0KA 3KMTA 3M57A 3RU0A 2W5ZA 4NVQA 3DB5A 5CCMA 4FMUA 2BQZA 3QWPA 3QWWA 3VUZA 4NJ5A 3RIBA 3N71A 5CPRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5E A;  3FPD A;  1N6C A;  4J7I A;  4O6F A;  2W5Y A;  3MEK A;  3M56 A;  5EG2 A;  3TG4 A;  3SW9 A;  4AU7 A;  4QEN A;  2R3A A;  3F9X A;  3M59 A;  4YPA A;  3CBO A;  5HQ8 A;  3M5A A;  2O8J A;  3F9Z A;  4IJ8 A;  5F59 A;  3RAY A;  5AYF A;  2G46 A;  5F6K C;  3KMA A;  1MVX A;  1XQH A;  4BUP A;  3RQ4 A;  4WUY A;  4J7F A;  3SWC A;  1ZKK A;  4YNP A;  3PDN A;  3BO5 A;  4J8O A;  3OOI A;  5JJ0 A;  4JDS A;  4O30 A;  5CCL A;  3S7F A;  4LDG A;  3S7B A;  3MO2 A;  5T5G A;  4J83 A;  5F6L A;  3S7D A;  4E47 A;  3TG5 A;  3MO0 A;  5HI7 A;  4YNM A;  4QEP A;  4I51 A;  3S7J A;  4Z4P A;  4MI5 A;  5LSZ A;  1PEG A;  1ML9 A;  3K5K A;  4QEO A;  3QWV A;  3HNA A;  3OS5 A;  3OPE A;  5TEG A;  5JIY A;  1MUF A;  1MT6 A;  4MI0 A;  5JHN A;  3KMJ A;  4C1Q A;  3OXG A;  3CBM A;  2RFI A;  3OXF A;  1MVH A;  3OXL A;  3M58 A;  3F9Y A;  4IJD A;  5TH7 A;  2F69 A;  3CBP A;  1N3J A;  5ARG A;  4YPU A;  5T0M A;  1H3I A;  4YND A;  5KJM A;  4JLG A;  3M54 A;  1O9S A;  5TTF A;  4RZ0 A;  3RJW A;  3IHX A;  5ARF A;  3M55 A;  5EX0 A;  4YPE A;  3VV0 A;  3M53 A;  5LSX A;  3DAL A;  5KJL A;  3S8P A;  5JIN A;  4H12 A;  3F9W A;  3EP0 A;  3MO5 A;  5KJK A;  5EX3 A;  2QPW A;  5KJN A;  2IGQ A;  2JV0 A;  1N6A A;  5T0K A;  3KMT A;  3M57 A;  3RU0 A;  2W5Z A;  4NVQ A;  3DB5 A;  5CCM A;  4FMU A;  2BQZ A;  3QWP A;  3QWW A;  3VUZ A;  4NJ5 A;  3RIB A;  3N71 A;  5CPR B; 
#chains in the Genus database with same CATH topology
 5F5E A;  3FPD A;  1N6C A;  4J7I A;  4O6F A;  2W5Y A;  3MEK A;  3M56 A;  5EG2 A;  3TG4 A;  3SW9 A;  4AU7 A;  4QEN A;  2R3A A;  3F9X A;  3M59 A;  4YPA A;  3CBO A;  5HQ8 A;  3M5A A;  2O8J A;  3F9Z A;  4IJ8 A;  5F59 A;  3RAY A;  5AYF A;  2G46 A;  5F6K C;  3KMA A;  1MVX A;  1XQH A;  4BUP A;  3RQ4 A;  4WUY A;  4J7F A;  3SWC A;  1ZKK A;  4YNP A;  3PDN A;  3BO5 A;  4J8O A;  3OOI A;  5JJ0 A;  4JDS A;  4O30 A;  5CCL A;  3S7F A;  4LDG A;  3S7B A;  3MO2 A;  5T5G A;  4J83 A;  5F6L A;  3S7D A;  4E47 A;  3TG5 A;  3MO0 A;  5HI7 A;  4YNM A;  4QEP A;  4I51 A;  3S7J A;  4Z4P A;  4MI5 A;  5LSZ A;  1PEG A;  1ML9 A;  3K5K A;  4QEO A;  3QWV A;  3HNA A;  3OS5 A;  3OPE A;  5TEG A;  5JIY A;  1MUF A;  1MT6 A;  4MI0 A;  5JHN A;  3KMJ A;  4C1Q A;  3OXG A;  3CBM A;  2RFI A;  3OXF A;  1MVH A;  3OXL A;  3M58 A;  3F9Y A;  4IJD A;  5TH7 A;  2F69 A;  3CBP A;  1N3J A;  5ARG A;  4YPU A;  5T0M A;  1H3I A;  4YND A;  5KJM A;  4JLG A;  3M54 A;  1O9S A;  5TTF A;  4RZ0 A;  3RJW A;  3IHX A;  5ARF A;  3M55 A;  5EX0 A;  4YPE A;  3VV0 A;  3M53 A;  5LSX A;  3DAL A;  5KJL A;  3S8P A;  5JIN A;  4H12 A;  3F9W A;  3EP0 A;  3MO5 A;  5KJK A;  5EX3 A;  2QPW A;  5KJN A;  2IGQ A;  2JV0 A;  1N6A A;  5T0K A;  3KMT A;  3M57 A;  3RU0 A;  2W5Z A;  4NVQ A;  3DB5 A;  5CCM A;  4FMU A;  2BQZ A;  3QWP A;  3QWW A;  3VUZ A;  4NJ5 A;  3RIB A;  3N71 A;  5CPR B; 
#chains in the Genus database with same CATH homology
 5F5E A;  3FPD A;  1N6C A;  4J7I A;  4O6F A;  2W5Y A;  3MEK A;  3M56 A;  5EG2 A;  3TG4 A;  3SW9 A;  4AU7 A;  4QEN A;  2R3A A;  3F9X A;  3M59 A;  4YPA A;  3CBO A;  5HQ8 A;  3M5A A;  2O8J A;  3F9Z A;  4IJ8 A;  5F59 A;  3RAY A;  5AYF A;  2G46 A;  5F6K C;  3KMA A;  1MVX A;  1XQH A;  4BUP A;  3RQ4 A;  4WUY A;  4J7F A;  3SWC A;  1ZKK A;  4YNP A;  3PDN A;  3BO5 A;  4J8O A;  3OOI A;  5JJ0 A;  4JDS A;  4O30 A;  5CCL A;  3S7F A;  4LDG A;  3S7B A;  3MO2 A;  5T5G A;  4J83 A;  5F6L A;  3S7D A;  4E47 A;  3TG5 A;  3MO0 A;  5HI7 A;  4YNM A;  4QEP A;  4I51 A;  3S7J A;  4Z4P A;  4MI5 A;  5LSZ A;  1PEG A;  1ML9 A;  3K5K A;  4QEO A;  3QWV A;  3HNA A;  3OS5 A;  3OPE A;  5TEG A;  5JIY A;  1MUF A;  1MT6 A;  4MI0 A;  5JHN A;  3KMJ A;  4C1Q A;  3OXG A;  3CBM A;  2RFI A;  3OXF A;  1MVH A;  3OXL A;  3M58 A;  3F9Y A;  4IJD A;  5TH7 A;  2F69 A;  3CBP A;  1N3J A;  5ARG A;  4YPU A;  5T0M A;  1H3I A;  4YND A;  5KJM A;  4JLG A;  3M54 A;  1O9S A;  5TTF A;  4RZ0 A;  3RJW A;  3IHX A;  5ARF A;  3M55 A;  5EX0 A;  4YPE A;  3VV0 A;  3M53 A;  5LSX A;  3DAL A;  5KJL A;  3S8P A;  5JIN A;  4H12 A;  3F9W A;  3EP0 A;  3MO5 A;  5KJK A;  5EX3 A;  2QPW A;  5KJN A;  2IGQ A;  2JV0 A;  1N6A A;  5T0K A;  3KMT A;  3M57 A;  3RU0 A;  2W5Z A;  4NVQ A;  3DB5 A;  5CCM A;  4FMU A;  2BQZ A;  3QWP A;  3QWW A;  3VUZ A;  4NJ5 A;  3RIB A;  3N71 A;  5CPR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...