3MO2A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e67
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
258
structure length
255
Chain Sequence
IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 255
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo2A00
4JLGA 5TTFA 3RQ4A 5HQ8A 3VUZA 4JDSA 5KJLA 1O9SA 1MVXA 2W5YA 4YNDA 3K5KA 3S7BA 1N6CA 3RAYA 2G46A 4YNPA 5EX3A 1N6AA 3M55A 4J83A 4BUPA 3EP0A 3M5AA 5HI7A 4C1QA 4NVQA 5AYFA 3OXFA 4IJDA 4QEPA 3OXLA 3CBOA 3RIBA 1ML9A 4H12A 3F9ZA 3DALA 3RJWA 3M54A 3OXGA 3M57A 3F9YA 5JHNA 3S8PA 5T0KA 2O8JA 4YPUA 5EX0A 4LDGA 1N3JA 3PDNA 5F5EA 1ZKKA 4YPEA 4QEOA 3KMJA 3TG4A 3BO5A 4MI5A 5KJNA 3M59A 4YPAA 4WUYA 5KJMA 4QENA 5LSZA 4I51A 4J8OA 3QWPA 4NJ5A 3MO2A 3OS5A 1MVHA 3MEKA 3M58A 1PEGA 3CBPA 3SWCA 3MO5A 3QWVA 1H3IA 5ARFA 3KMTA 3S7DA 3MO0A 5F59A 5TEGA 2IGQA 3HNAA 5ARGA 5TH7A 4YNMA 5JJ0A 3DB5A 3TG5A 5LSXA 1XQHA 3F9WA 4MI0A 5CPRB 5CCLA 1MUFA 5F6KC 3S7JA 4Z4PA 5T5GA 5CCMA 2W5ZA 2RFIA 3KMAA 3S7FA 5F6LA 3OOIA 5T0MA 4IJ8A 5JIYA 3IHXA 3M53A 5KJKA 4O6FA 3QWWA 4E47A 2F69A 4FMUA 4RZ0A 4AU7A 3FPDA 5JINA 2JV0A 4J7FA 3VV0A 4J7IA 3OPEA 3RU0A 2BQZA 3N71A 2QPWA 3F9XA 2R3AA 3SW9A 3M56A 3CBMA 5EG2A 1MT6A 4O30A
chains in the Genus database with same CATH superfamily
4JLGA 5TTFA 3RQ4A 5HQ8A 3VUZA 4JDSA 5KJLA 1O9SA 1MVXA 2W5YA 4YNDA 3K5KA 3S7BA 1N6CA 3RAYA 2G46A 4YNPA 5EX3A 1N6AA 3M55A 4J83A 4BUPA 3EP0A 3M5AA 5HI7A 4C1QA 4NVQA 5AYFA 3OXFA 4IJDA 4QEPA 3OXLA 3CBOA 3RIBA 1ML9A 4H12A 3F9ZA 3DALA 3RJWA 3M54A 3OXGA 3M57A 3F9YA 5JHNA 3S8PA 5T0KA 2O8JA 4YPUA 5EX0A 4LDGA 1N3JA 3PDNA 5F5EA 1ZKKA 4YPEA 4QEOA 3KMJA 3TG4A 3BO5A 4MI5A 5KJNA 3M59A 4YPAA 4WUYA 5KJMA 4QENA 5LSZA 4I51A 4J8OA 3QWPA 4NJ5A 3MO2A 3OS5A 1MVHA 3MEKA 3M58A 1PEGA 3CBPA 3SWCA 3MO5A 3QWVA 1H3IA 5ARFA 3KMTA 3S7DA 3MO0A 5F59A 5TEGA 2IGQA 3HNAA 5ARGA 5TH7A 4YNMA 5JJ0A 3DB5A 3TG5A 5LSXA 1XQHA 3F9WA 4MI0A 5CPRB 5CCLA 1MUFA 5F6KC 3S7JA 4Z4PA 5T5GA 5CCMA 2W5ZA 2RFIA 3KMAA 3S7FA 5F6LA 3OOIA 5T0MA 4IJ8A 5JIYA 3IHXA 3M53A 5KJKA 4O6FA 3QWWA 4E47A 2F69A 4FMUA 4RZ0A 4AU7A 3FPDA 5JINA 2JV0A 4J7FA 3VV0A 4J7IA 3OPEA 3RU0A 2BQZA 3N71A 2QPWA 3F9XA 2R3AA 3SW9A 3M56A 3CBMA 5EG2A 1MT6A 4O30A
chains in the Genus database with same CATH topology
4JLGA 5TTFA 3RQ4A 5HQ8A 3VUZA 4JDSA 5KJLA 1O9SA 1MVXA 2W5YA 4YNDA 3K5KA 3S7BA 1N6CA 3RAYA 2G46A 4YNPA 5EX3A 1N6AA 3M55A 4J83A 4BUPA 3EP0A 3M5AA 5HI7A 4C1QA 4NVQA 5AYFA 3OXFA 4IJDA 4QEPA 3OXLA 3CBOA 3RIBA 1ML9A 4H12A 3F9ZA 3DALA 3RJWA 3M54A 3OXGA 3M57A 3F9YA 5JHNA 3S8PA 5T0KA 2O8JA 4YPUA 5EX0A 4LDGA 1N3JA 3PDNA 5F5EA 1ZKKA 4YPEA 4QEOA 3KMJA 3TG4A 3BO5A 4MI5A 5KJNA 3M59A 4YPAA 4WUYA 5KJMA 4QENA 5LSZA 4I51A 4J8OA 3QWPA 4NJ5A 3MO2A 3OS5A 1MVHA 3MEKA 3M58A 1PEGA 3CBPA 3SWCA 3MO5A 3QWVA 1H3IA 5ARFA 3KMTA 3S7DA 3MO0A 5F59A 5TEGA 2IGQA 3HNAA 5ARGA 5TH7A 4YNMA 5JJ0A 3DB5A 3TG5A 5LSXA 1XQHA 3F9WA 4MI0A 5CPRB 5CCLA 1MUFA 5F6KC 3S7JA 4Z4PA 5T5GA 5CCMA 2W5ZA 2RFIA 3KMAA 3S7FA 5F6LA 3OOIA 5T0MA 4IJ8A 5JIYA 3IHXA 3M53A 5KJKA 4O6FA 3QWWA 4E47A 2F69A 4FMUA 4RZ0A 4AU7A 3FPDA 5JINA 2JV0A 4J7FA 3VV0A 4J7IA 3OPEA 3RU0A 2BQZA 3N71A 2QPWA 3F9XA 2R3AA 3SW9A 3M56A 3CBMA 5EG2A 1MT6A 4O30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLG A;  5TTF A;  3RQ4 A;  5HQ8 A;  3VUZ A;  4JDS A;  5KJL A;  1O9S A;  1MVX A;  2W5Y A;  4YND A;  3K5K A;  3S7B A;  1N6C A;  3RAY A;  2G46 A;  4YNP A;  5EX3 A;  1N6A A;  3M55 A;  4J83 A;  4BUP A;  3EP0 A;  3M5A A;  5HI7 A;  4C1Q A;  4NVQ A;  5AYF A;  3OXF A;  4IJD A;  4QEP A;  3OXL A;  3CBO A;  3RIB A;  1ML9 A;  4H12 A;  3F9Z A;  3DAL A;  3RJW A;  3M54 A;  3OXG A;  3M57 A;  3F9Y A;  5JHN A;  3S8P A;  5T0K A;  2O8J A;  4YPU A;  5EX0 A;  4LDG A;  1N3J A;  3PDN A;  5F5E A;  1ZKK A;  4YPE A;  4QEO A;  3KMJ A;  3TG4 A;  3BO5 A;  4MI5 A;  5KJN A;  3M59 A;  4YPA A;  4WUY A;  5KJM A;  4QEN A;  5LSZ A;  4I51 A;  4J8O A;  3QWP A;  4NJ5 A;  3MO2 A;  3OS5 A;  1MVH A;  3MEK A;  3M58 A;  1PEG A;  3CBP A;  3SWC A;  3MO5 A;  3QWV A;  1H3I A;  5ARF A;  3KMT A;  3S7D A;  3MO0 A;  5F59 A;  5TEG A;  2IGQ A;  3HNA A;  5ARG A;  5TH7 A;  4YNM A;  5JJ0 A;  3DB5 A;  3TG5 A;  5LSX A;  1XQH A;  3F9W A;  4MI0 A;  5CPR B;  5CCL A;  1MUF A;  5F6K C;  3S7J A;  4Z4P A;  5T5G A;  5CCM A;  2W5Z A;  2RFI A;  3KMA A;  3S7F A;  5F6L A;  3OOI A;  5T0M A;  4IJ8 A;  5JIY A;  3IHX A;  3M53 A;  5KJK A;  4O6F A;  3QWW A;  4E47 A;  2F69 A;  4FMU A;  4RZ0 A;  4AU7 A;  3FPD A;  5JIN A;  2JV0 A;  4J7F A;  3VV0 A;  4J7I A;  3OPE A;  3RU0 A;  2BQZ A;  3N71 A;  2QPW A;  3F9X A;  2R3A A;  3SW9 A;  3M56 A;  3CBM A;  5EG2 A;  1MT6 A;  4O30 A; 
#chains in the Genus database with same CATH topology
 4JLG A;  5TTF A;  3RQ4 A;  5HQ8 A;  3VUZ A;  4JDS A;  5KJL A;  1O9S A;  1MVX A;  2W5Y A;  4YND A;  3K5K A;  3S7B A;  1N6C A;  3RAY A;  2G46 A;  4YNP A;  5EX3 A;  1N6A A;  3M55 A;  4J83 A;  4BUP A;  3EP0 A;  3M5A A;  5HI7 A;  4C1Q A;  4NVQ A;  5AYF A;  3OXF A;  4IJD A;  4QEP A;  3OXL A;  3CBO A;  3RIB A;  1ML9 A;  4H12 A;  3F9Z A;  3DAL A;  3RJW A;  3M54 A;  3OXG A;  3M57 A;  3F9Y A;  5JHN A;  3S8P A;  5T0K A;  2O8J A;  4YPU A;  5EX0 A;  4LDG A;  1N3J A;  3PDN A;  5F5E A;  1ZKK A;  4YPE A;  4QEO A;  3KMJ A;  3TG4 A;  3BO5 A;  4MI5 A;  5KJN A;  3M59 A;  4YPA A;  4WUY A;  5KJM A;  4QEN A;  5LSZ A;  4I51 A;  4J8O A;  3QWP A;  4NJ5 A;  3MO2 A;  3OS5 A;  1MVH A;  3MEK A;  3M58 A;  1PEG A;  3CBP A;  3SWC A;  3MO5 A;  3QWV A;  1H3I A;  5ARF A;  3KMT A;  3S7D A;  3MO0 A;  5F59 A;  5TEG A;  2IGQ A;  3HNA A;  5ARG A;  5TH7 A;  4YNM A;  5JJ0 A;  3DB5 A;  3TG5 A;  5LSX A;  1XQH A;  3F9W A;  4MI0 A;  5CPR B;  5CCL A;  1MUF A;  5F6K C;  3S7J A;  4Z4P A;  5T5G A;  5CCM A;  2W5Z A;  2RFI A;  3KMA A;  3S7F A;  5F6L A;  3OOI A;  5T0M A;  4IJ8 A;  5JIY A;  3IHX A;  3M53 A;  5KJK A;  4O6F A;  3QWW A;  4E47 A;  2F69 A;  4FMU A;  4RZ0 A;  4AU7 A;  3FPD A;  5JIN A;  2JV0 A;  4J7F A;  3VV0 A;  4J7I A;  3OPE A;  3RU0 A;  2BQZ A;  3N71 A;  2QPW A;  3F9X A;  2R3A A;  3SW9 A;  3M56 A;  3CBM A;  5EG2 A;  1MT6 A;  4O30 A; 
#chains in the Genus database with same CATH homology
 4JLG A;  5TTF A;  3RQ4 A;  5HQ8 A;  3VUZ A;  4JDS A;  5KJL A;  1O9S A;  1MVX A;  2W5Y A;  4YND A;  3K5K A;  3S7B A;  1N6C A;  3RAY A;  2G46 A;  4YNP A;  5EX3 A;  1N6A A;  3M55 A;  4J83 A;  4BUP A;  3EP0 A;  3M5A A;  5HI7 A;  4C1Q A;  4NVQ A;  5AYF A;  3OXF A;  4IJD A;  4QEP A;  3OXL A;  3CBO A;  3RIB A;  1ML9 A;  4H12 A;  3F9Z A;  3DAL A;  3RJW A;  3M54 A;  3OXG A;  3M57 A;  3F9Y A;  5JHN A;  3S8P A;  5T0K A;  2O8J A;  4YPU A;  5EX0 A;  4LDG A;  1N3J A;  3PDN A;  5F5E A;  1ZKK A;  4YPE A;  4QEO A;  3KMJ A;  3TG4 A;  3BO5 A;  4MI5 A;  5KJN A;  3M59 A;  4YPA A;  4WUY A;  5KJM A;  4QEN A;  5LSZ A;  4I51 A;  4J8O A;  3QWP A;  4NJ5 A;  3MO2 A;  3OS5 A;  1MVH A;  3MEK A;  3M58 A;  1PEG A;  3CBP A;  3SWC A;  3MO5 A;  3QWV A;  1H3I A;  5ARF A;  3KMT A;  3S7D A;  3MO0 A;  5F59 A;  5TEG A;  2IGQ A;  3HNA A;  5ARG A;  5TH7 A;  4YNM A;  5JJ0 A;  3DB5 A;  3TG5 A;  5LSX A;  1XQH A;  3F9W A;  4MI0 A;  5CPR B;  5CCL A;  1MUF A;  5F6K C;  3S7J A;  4Z4P A;  5T5G A;  5CCM A;  2W5Z A;  2RFI A;  3KMA A;  3S7F A;  5F6L A;  3OOI A;  5T0M A;  4IJ8 A;  5JIY A;  3IHX A;  3M53 A;  5KJK A;  4O6F A;  3QWW A;  4E47 A;  2F69 A;  4FMU A;  4RZ0 A;  4AU7 A;  3FPD A;  5JIN A;  2JV0 A;  4J7F A;  3VV0 A;  4J7I A;  3OPE A;  3RU0 A;  2BQZ A;  3N71 A;  2QPW A;  3F9X A;  2R3A A;  3SW9 A;  3M56 A;  3CBM A;  5EG2 A;  1MT6 A;  4O30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...