3MO2A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e67
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
258
structure length
255
Chain Sequence
IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
total genus 62
structure length 255
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo2A00
4NVQA 3RU0A 5CCLA 1N3JA 3VV0A 1MVXA 5TTFA 2BQZA 3RJWA 1ML9A 1H3IA 5F6LA 5T0KA 4FMUA 3DALA 5T0MA 3S7JA 4J83A 3FPDA 3KMJA 3QWWA 4AU7A 5JINA 4O6FA 5EG2A 1N6AA 4YPAA 3CBOA 3RIBA 3OXLA 3OXFA 3F9ZA 3M55A 5KJKA 4J7IA 5KJNA 3CBPA 5LSZA 4IJ8A 3M5AA 2G46A 3DB5A 2RFIA 3KMTA 3F9XA 3IHXA 5TH7A 4BUPA 4JDSA 5ARGA 5F6KC 4MI0A 5T5GA 1PEGA 3M54A 3F9WA 3S8PA 3M56A 3OPEA 3HNAA 3MO0A 4J8OA 5AYFA 2W5YA 3F9YA 3PDNA 3BO5A 3OOIA 5CCMA 5F5EA 4QENA 2R3AA 4RZ0A 3M57A 3SW9A 3N71A 5JHNA 3M53A 4YPUA 3MO5A 1ZKKA 2W5ZA 3S7BA 5JIYA 1MUFA 3OXGA 3EP0A 4H12A 4MI5A 4QEOA 4O30A 4YNMA 1MVHA 4WUYA 1O9SA 3MEKA 3VUZA 3RAYA 2QPWA 3KMAA 5HI7A 3S7DA 2O8JA 3MO2A 5HQ8A 1N6CA 3OS5A 3K5KA 5JJ0A 3M58A 5ARFA 5LSXA 1MT6A 5KJMA 3M59A 5KJLA 3QWVA 4JLGA 4YNDA 3SWCA 4NJ5A 4LDGA 2IGQA 4I51A 3TG5A 1XQHA 5EX0A 3S7FA 3QWPA 3RQ4A 4YPEA 4YNPA 4IJDA 5EX3A 2F69A 2JV0A 3TG4A 5F59A 4E47A 5TEGA 4J7FA 4Z4PA 4QEPA 3CBMA 4C1QA 5CPRB
chains in the Genus database with same CATH superfamily
4NVQA 3RU0A 5CCLA 1N3JA 3VV0A 1MVXA 5TTFA 2BQZA 3RJWA 1ML9A 1H3IA 5F6LA 5T0KA 4FMUA 3DALA 5T0MA 3S7JA 4J83A 3FPDA 3KMJA 3QWWA 4AU7A 5JINA 4O6FA 5EG2A 1N6AA 4YPAA 3CBOA 3RIBA 3OXLA 3OXFA 3F9ZA 3M55A 5KJKA 4J7IA 5KJNA 3CBPA 5LSZA 4IJ8A 3M5AA 2G46A 3DB5A 2RFIA 3KMTA 3F9XA 3IHXA 5TH7A 4BUPA 4JDSA 5ARGA 5F6KC 4MI0A 5T5GA 1PEGA 3M54A 3F9WA 3S8PA 3M56A 3OPEA 3HNAA 3MO0A 4J8OA 5AYFA 2W5YA 3F9YA 3PDNA 3BO5A 3OOIA 5CCMA 5F5EA 4QENA 2R3AA 4RZ0A 3M57A 3SW9A 3N71A 5JHNA 3M53A 4YPUA 3MO5A 1ZKKA 2W5ZA 3S7BA 5JIYA 1MUFA 3OXGA 3EP0A 4H12A 4MI5A 4QEOA 4O30A 4YNMA 1MVHA 4WUYA 1O9SA 3MEKA 3VUZA 3RAYA 2QPWA 3KMAA 5HI7A 3S7DA 2O8JA 3MO2A 5HQ8A 1N6CA 3OS5A 3K5KA 5JJ0A 3M58A 5ARFA 5LSXA 1MT6A 5KJMA 3M59A 5KJLA 3QWVA 4JLGA 4YNDA 3SWCA 4NJ5A 4LDGA 2IGQA 4I51A 3TG5A 1XQHA 5EX0A 3S7FA 3QWPA 3RQ4A 4YPEA 4YNPA 4IJDA 5EX3A 2F69A 2JV0A 3TG4A 5F59A 4E47A 5TEGA 4J7FA 4Z4PA 4QEPA 3CBMA 4C1QA 5CPRB
chains in the Genus database with same CATH topology
4NVQA 3RU0A 5CCLA 1N3JA 3VV0A 1MVXA 5TTFA 2BQZA 3RJWA 1ML9A 1H3IA 5F6LA 5T0KA 4FMUA 3DALA 5T0MA 3S7JA 4J83A 3FPDA 3KMJA 3QWWA 4AU7A 5JINA 4O6FA 5EG2A 1N6AA 4YPAA 3CBOA 3RIBA 3OXLA 3OXFA 3F9ZA 3M55A 5KJKA 4J7IA 5KJNA 3CBPA 5LSZA 4IJ8A 3M5AA 2G46A 3DB5A 2RFIA 3KMTA 3F9XA 3IHXA 5TH7A 4BUPA 4JDSA 5ARGA 5F6KC 4MI0A 5T5GA 1PEGA 3M54A 3F9WA 3S8PA 3M56A 3OPEA 3HNAA 3MO0A 4J8OA 5AYFA 2W5YA 3F9YA 3PDNA 3BO5A 3OOIA 5CCMA 5F5EA 4QENA 2R3AA 4RZ0A 3M57A 3SW9A 3N71A 5JHNA 3M53A 4YPUA 3MO5A 1ZKKA 2W5ZA 3S7BA 5JIYA 1MUFA 3OXGA 3EP0A 4H12A 4MI5A 4QEOA 4O30A 4YNMA 1MVHA 4WUYA 1O9SA 3MEKA 3VUZA 3RAYA 2QPWA 3KMAA 5HI7A 3S7DA 2O8JA 3MO2A 5HQ8A 1N6CA 3OS5A 3K5KA 5JJ0A 3M58A 5ARFA 5LSXA 1MT6A 5KJMA 3M59A 5KJLA 3QWVA 4JLGA 4YNDA 3SWCA 4NJ5A 4LDGA 2IGQA 4I51A 3TG5A 1XQHA 5EX0A 3S7FA 3QWPA 3RQ4A 4YPEA 4YNPA 4IJDA 5EX3A 2F69A 2JV0A 3TG4A 5F59A 4E47A 5TEGA 4J7FA 4Z4PA 4QEPA 3CBMA 4C1QA 5CPRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NVQ A;  3RU0 A;  5CCL A;  1N3J A;  3VV0 A;  1MVX A;  5TTF A;  2BQZ A;  3RJW A;  1ML9 A;  1H3I A;  5F6L A;  5T0K A;  4FMU A;  3DAL A;  5T0M A;  3S7J A;  4J83 A;  3FPD A;  3KMJ A;  3QWW A;  4AU7 A;  5JIN A;  4O6F A;  5EG2 A;  1N6A A;  4YPA A;  3CBO A;  3RIB A;  3OXL A;  3OXF A;  3F9Z A;  3M55 A;  5KJK A;  4J7I A;  5KJN A;  3CBP A;  5LSZ A;  4IJ8 A;  3M5A A;  2G46 A;  3DB5 A;  2RFI A;  3KMT A;  3F9X A;  3IHX A;  5TH7 A;  4BUP A;  4JDS A;  5ARG A;  5F6K C;  4MI0 A;  5T5G A;  1PEG A;  3M54 A;  3F9W A;  3S8P A;  3M56 A;  3OPE A;  3HNA A;  3MO0 A;  4J8O A;  5AYF A;  2W5Y A;  3F9Y A;  3PDN A;  3BO5 A;  3OOI A;  5CCM A;  5F5E A;  4QEN A;  2R3A A;  4RZ0 A;  3M57 A;  3SW9 A;  3N71 A;  5JHN A;  3M53 A;  4YPU A;  3MO5 A;  1ZKK A;  2W5Z A;  3S7B A;  5JIY A;  1MUF A;  3OXG A;  3EP0 A;  4H12 A;  4MI5 A;  4QEO A;  4O30 A;  4YNM A;  1MVH A;  4WUY A;  1O9S A;  3MEK A;  3VUZ A;  3RAY A;  2QPW A;  3KMA A;  5HI7 A;  3S7D A;  2O8J A;  3MO2 A;  5HQ8 A;  1N6C A;  3OS5 A;  3K5K A;  5JJ0 A;  3M58 A;  5ARF A;  5LSX A;  1MT6 A;  5KJM A;  3M59 A;  5KJL A;  3QWV A;  4JLG A;  4YND A;  3SWC A;  4NJ5 A;  4LDG A;  2IGQ A;  4I51 A;  3TG5 A;  1XQH A;  5EX0 A;  3S7F A;  3QWP A;  3RQ4 A;  4YPE A;  4YNP A;  4IJD A;  5EX3 A;  2F69 A;  2JV0 A;  3TG4 A;  5F59 A;  4E47 A;  5TEG A;  4J7F A;  4Z4P A;  4QEP A;  3CBM A;  4C1Q A;  5CPR B; 
#chains in the Genus database with same CATH topology
 4NVQ A;  3RU0 A;  5CCL A;  1N3J A;  3VV0 A;  1MVX A;  5TTF A;  2BQZ A;  3RJW A;  1ML9 A;  1H3I A;  5F6L A;  5T0K A;  4FMU A;  3DAL A;  5T0M A;  3S7J A;  4J83 A;  3FPD A;  3KMJ A;  3QWW A;  4AU7 A;  5JIN A;  4O6F A;  5EG2 A;  1N6A A;  4YPA A;  3CBO A;  3RIB A;  3OXL A;  3OXF A;  3F9Z A;  3M55 A;  5KJK A;  4J7I A;  5KJN A;  3CBP A;  5LSZ A;  4IJ8 A;  3M5A A;  2G46 A;  3DB5 A;  2RFI A;  3KMT A;  3F9X A;  3IHX A;  5TH7 A;  4BUP A;  4JDS A;  5ARG A;  5F6K C;  4MI0 A;  5T5G A;  1PEG A;  3M54 A;  3F9W A;  3S8P A;  3M56 A;  3OPE A;  3HNA A;  3MO0 A;  4J8O A;  5AYF A;  2W5Y A;  3F9Y A;  3PDN A;  3BO5 A;  3OOI A;  5CCM A;  5F5E A;  4QEN A;  2R3A A;  4RZ0 A;  3M57 A;  3SW9 A;  3N71 A;  5JHN A;  3M53 A;  4YPU A;  3MO5 A;  1ZKK A;  2W5Z A;  3S7B A;  5JIY A;  1MUF A;  3OXG A;  3EP0 A;  4H12 A;  4MI5 A;  4QEO A;  4O30 A;  4YNM A;  1MVH A;  4WUY A;  1O9S A;  3MEK A;  3VUZ A;  3RAY A;  2QPW A;  3KMA A;  5HI7 A;  3S7D A;  2O8J A;  3MO2 A;  5HQ8 A;  1N6C A;  3OS5 A;  3K5K A;  5JJ0 A;  3M58 A;  5ARF A;  5LSX A;  1MT6 A;  5KJM A;  3M59 A;  5KJL A;  3QWV A;  4JLG A;  4YND A;  3SWC A;  4NJ5 A;  4LDG A;  2IGQ A;  4I51 A;  3TG5 A;  1XQH A;  5EX0 A;  3S7F A;  3QWP A;  3RQ4 A;  4YPE A;  4YNP A;  4IJD A;  5EX3 A;  2F69 A;  2JV0 A;  3TG4 A;  5F59 A;  4E47 A;  5TEG A;  4J7F A;  4Z4P A;  4QEP A;  3CBM A;  4C1Q A;  5CPR B; 
#chains in the Genus database with same CATH homology
 4NVQ A;  3RU0 A;  5CCL A;  1N3J A;  3VV0 A;  1MVX A;  5TTF A;  2BQZ A;  3RJW A;  1ML9 A;  1H3I A;  5F6L A;  5T0K A;  4FMU A;  3DAL A;  5T0M A;  3S7J A;  4J83 A;  3FPD A;  3KMJ A;  3QWW A;  4AU7 A;  5JIN A;  4O6F A;  5EG2 A;  1N6A A;  4YPA A;  3CBO A;  3RIB A;  3OXL A;  3OXF A;  3F9Z A;  3M55 A;  5KJK A;  4J7I A;  5KJN A;  3CBP A;  5LSZ A;  4IJ8 A;  3M5A A;  2G46 A;  3DB5 A;  2RFI A;  3KMT A;  3F9X A;  3IHX A;  5TH7 A;  4BUP A;  4JDS A;  5ARG A;  5F6K C;  4MI0 A;  5T5G A;  1PEG A;  3M54 A;  3F9W A;  3S8P A;  3M56 A;  3OPE A;  3HNA A;  3MO0 A;  4J8O A;  5AYF A;  2W5Y A;  3F9Y A;  3PDN A;  3BO5 A;  3OOI A;  5CCM A;  5F5E A;  4QEN A;  2R3A A;  4RZ0 A;  3M57 A;  3SW9 A;  3N71 A;  5JHN A;  3M53 A;  4YPU A;  3MO5 A;  1ZKK A;  2W5Z A;  3S7B A;  5JIY A;  1MUF A;  3OXG A;  3EP0 A;  4H12 A;  4MI5 A;  4QEO A;  4O30 A;  4YNM A;  1MVH A;  4WUY A;  1O9S A;  3MEK A;  3VUZ A;  3RAY A;  2QPW A;  3KMA A;  5HI7 A;  3S7D A;  2O8J A;  3MO2 A;  5HQ8 A;  1N6C A;  3OS5 A;  3K5K A;  5JJ0 A;  3M58 A;  5ARF A;  5LSX A;  1MT6 A;  5KJM A;  3M59 A;  5KJL A;  3QWV A;  4JLG A;  4YND A;  3SWC A;  4NJ5 A;  4LDG A;  2IGQ A;  4I51 A;  3TG5 A;  1XQH A;  5EX0 A;  3S7F A;  3QWP A;  3RQ4 A;  4YPE A;  4YNP A;  4IJD A;  5EX3 A;  2F69 A;  2JV0 A;  3TG4 A;  5F59 A;  4E47 A;  5TEG A;  4J7F A;  4Z4P A;  4QEP A;  3CBM A;  4C1Q A;  5CPR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...