3MO2A

Human g9a-like (glp, also known as ehmt1) in complex with inhibitor e67
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
258
structure length
255
Chain Sequence
IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific 5
publication title Adding a lysine mimic in the design of potent inhibitors of histone lysine methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 62
structure length 255
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3mo2A00
4YNPA 3F9XA 1MVXA 4LDGA 5F5EA 5F6LA 1MT6A 3K5KA 4J83A 3OXLA 3RAYA 4I51A 1N6CA 2BQZA 3KMTA 3CBMA 2W5ZA 3F9ZA 3OS5A 5T0MA 3CBPA 4YPAA 3M53A 4MI0A 1PEGA 3F9YA 4FMUA 2QPWA 3MO2A 3RJWA 3F9WA 4YPUA 3M54A 5KJNA 3MO0A 4O6FA 4C1QA 3QWPA 3BO5A 3TG4A 3TG5A 3M55A 2R3AA 4E47A 3S7DA 3MO5A 1XQHA 3HNAA 3RQ4A 3S7JA 3SW9A 2W5YA 3VV0A 4J7FA 5LSXA 3DALA 3OXFA 4NJ5A 3SWCA 4Z4PA 3RU0A 3MEKA 5T5GA 3DB5A 5JINA 3VUZA 5JHNA 1ML9A 4AU7A 5EX3A 3PDNA 3M59A 3RIBA 5F6KC 3CBOA 4NVQA 4QEOA 1N3JA 2G46A 3S7FA 5KJMA 4MI5A 5JJ0A 1MVHA 4J8OA 2IGQA 3M57A 4IJDA 4YNMA 5ARGA 3OPEA 5KJKA 3M56A 2JV0A 5ARFA 5EG2A 3S8PA 3M5AA 4YNDA 3QWWA 5F59A 2RFIA 4J7IA 4JLGA 4JDSA 5HI7A 3M58A 3KMAA 5EX0A 5TEGA 4WUYA 5CCLA 3FPDA 5CCMA 5HQ8A 3QWVA 3S7BA 1N6AA 3EP0A 3OXGA 1ZKKA 1MUFA 5KJLA 5AYFA 3N71A 1O9SA 4YPEA 5LSZA 4O30A 4H12A 4BUPA 2F69A 5T0KA 5JIYA 2O8JA 4QENA 3IHXA 3OOIA 4QEPA 5CPRB 3KMJA 5TTFA 1H3IA 5TH7A 4IJ8A 4RZ0A
chains in the Genus database with same CATH superfamily
4YNPA 3F9XA 1MVXA 4LDGA 5F5EA 5F6LA 1MT6A 3K5KA 4J83A 3OXLA 3RAYA 4I51A 1N6CA 2BQZA 3KMTA 3CBMA 2W5ZA 3F9ZA 3OS5A 5T0MA 3CBPA 4YPAA 3M53A 4MI0A 1PEGA 3F9YA 4FMUA 2QPWA 3MO2A 3RJWA 3F9WA 4YPUA 3M54A 5KJNA 3MO0A 4O6FA 4C1QA 3QWPA 3BO5A 3TG4A 3TG5A 3M55A 2R3AA 4E47A 3S7DA 3MO5A 1XQHA 3HNAA 3RQ4A 3S7JA 3SW9A 2W5YA 3VV0A 4J7FA 5LSXA 3DALA 3OXFA 4NJ5A 3SWCA 4Z4PA 3RU0A 3MEKA 5T5GA 3DB5A 5JINA 3VUZA 5JHNA 1ML9A 4AU7A 5EX3A 3PDNA 3M59A 3RIBA 5F6KC 3CBOA 4NVQA 4QEOA 1N3JA 2G46A 3S7FA 5KJMA 4MI5A 5JJ0A 1MVHA 4J8OA 2IGQA 3M57A 4IJDA 4YNMA 5ARGA 3OPEA 5KJKA 3M56A 2JV0A 5ARFA 5EG2A 3S8PA 3M5AA 4YNDA 3QWWA 5F59A 2RFIA 4J7IA 4JLGA 4JDSA 5HI7A 3M58A 3KMAA 5EX0A 5TEGA 4WUYA 5CCLA 3FPDA 5CCMA 5HQ8A 3QWVA 3S7BA 1N6AA 3EP0A 3OXGA 1ZKKA 1MUFA 5KJLA 5AYFA 3N71A 1O9SA 4YPEA 5LSZA 4O30A 4H12A 4BUPA 2F69A 5T0KA 5JIYA 2O8JA 4QENA 3IHXA 3OOIA 4QEPA 5CPRB 3KMJA 5TTFA 1H3IA 5TH7A 4IJ8A 4RZ0A
chains in the Genus database with same CATH topology
4YNPA 3F9XA 1MVXA 4LDGA 5F5EA 5F6LA 1MT6A 3K5KA 4J83A 3OXLA 3RAYA 4I51A 1N6CA 2BQZA 3KMTA 3CBMA 2W5ZA 3F9ZA 3OS5A 5T0MA 3CBPA 4YPAA 3M53A 4MI0A 1PEGA 3F9YA 4FMUA 2QPWA 3MO2A 3RJWA 3F9WA 4YPUA 3M54A 5KJNA 3MO0A 4O6FA 4C1QA 3QWPA 3BO5A 3TG4A 3TG5A 3M55A 2R3AA 4E47A 3S7DA 3MO5A 1XQHA 3HNAA 3RQ4A 3S7JA 3SW9A 2W5YA 3VV0A 4J7FA 5LSXA 3DALA 3OXFA 4NJ5A 3SWCA 4Z4PA 3RU0A 3MEKA 5T5GA 3DB5A 5JINA 3VUZA 5JHNA 1ML9A 4AU7A 5EX3A 3PDNA 3M59A 3RIBA 5F6KC 3CBOA 4NVQA 4QEOA 1N3JA 2G46A 3S7FA 5KJMA 4MI5A 5JJ0A 1MVHA 4J8OA 2IGQA 3M57A 4IJDA 4YNMA 5ARGA 3OPEA 5KJKA 3M56A 2JV0A 5ARFA 5EG2A 3S8PA 3M5AA 4YNDA 3QWWA 5F59A 2RFIA 4J7IA 4JLGA 4JDSA 5HI7A 3M58A 3KMAA 5EX0A 5TEGA 4WUYA 5CCLA 3FPDA 5CCMA 5HQ8A 3QWVA 3S7BA 1N6AA 3EP0A 3OXGA 1ZKKA 1MUFA 5KJLA 5AYFA 3N71A 1O9SA 4YPEA 5LSZA 4O30A 4H12A 4BUPA 2F69A 5T0KA 5JIYA 2O8JA 4QENA 3IHXA 3OOIA 4QEPA 5CPRB 3KMJA 5TTFA 1H3IA 5TH7A 4IJ8A 4RZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YNP A;  3F9X A;  1MVX A;  4LDG A;  5F5E A;  5F6L A;  1MT6 A;  3K5K A;  4J83 A;  3OXL A;  3RAY A;  4I51 A;  1N6C A;  2BQZ A;  3KMT A;  3CBM A;  2W5Z A;  3F9Z A;  3OS5 A;  5T0M A;  3CBP A;  4YPA A;  3M53 A;  4MI0 A;  1PEG A;  3F9Y A;  4FMU A;  2QPW A;  3MO2 A;  3RJW A;  3F9W A;  4YPU A;  3M54 A;  5KJN A;  3MO0 A;  4O6F A;  4C1Q A;  3QWP A;  3BO5 A;  3TG4 A;  3TG5 A;  3M55 A;  2R3A A;  4E47 A;  3S7D A;  3MO5 A;  1XQH A;  3HNA A;  3RQ4 A;  3S7J A;  3SW9 A;  2W5Y A;  3VV0 A;  4J7F A;  5LSX A;  3DAL A;  3OXF A;  4NJ5 A;  3SWC A;  4Z4P A;  3RU0 A;  3MEK A;  5T5G A;  3DB5 A;  5JIN A;  3VUZ A;  5JHN A;  1ML9 A;  4AU7 A;  5EX3 A;  3PDN A;  3M59 A;  3RIB A;  5F6K C;  3CBO A;  4NVQ A;  4QEO A;  1N3J A;  2G46 A;  3S7F A;  5KJM A;  4MI5 A;  5JJ0 A;  1MVH A;  4J8O A;  2IGQ A;  3M57 A;  4IJD A;  4YNM A;  5ARG A;  3OPE A;  5KJK A;  3M56 A;  2JV0 A;  5ARF A;  5EG2 A;  3S8P A;  3M5A A;  4YND A;  3QWW A;  5F59 A;  2RFI A;  4J7I A;  4JLG A;  4JDS A;  5HI7 A;  3M58 A;  3KMA A;  5EX0 A;  5TEG A;  4WUY A;  5CCL A;  3FPD A;  5CCM A;  5HQ8 A;  3QWV A;  3S7B A;  1N6A A;  3EP0 A;  3OXG A;  1ZKK A;  1MUF A;  5KJL A;  5AYF A;  3N71 A;  1O9S A;  4YPE A;  5LSZ A;  4O30 A;  4H12 A;  4BUP A;  2F69 A;  5T0K A;  5JIY A;  2O8J A;  4QEN A;  3IHX A;  3OOI A;  4QEP A;  5CPR B;  3KMJ A;  5TTF A;  1H3I A;  5TH7 A;  4IJ8 A;  4RZ0 A; 
#chains in the Genus database with same CATH topology
 4YNP A;  3F9X A;  1MVX A;  4LDG A;  5F5E A;  5F6L A;  1MT6 A;  3K5K A;  4J83 A;  3OXL A;  3RAY A;  4I51 A;  1N6C A;  2BQZ A;  3KMT A;  3CBM A;  2W5Z A;  3F9Z A;  3OS5 A;  5T0M A;  3CBP A;  4YPA A;  3M53 A;  4MI0 A;  1PEG A;  3F9Y A;  4FMU A;  2QPW A;  3MO2 A;  3RJW A;  3F9W A;  4YPU A;  3M54 A;  5KJN A;  3MO0 A;  4O6F A;  4C1Q A;  3QWP A;  3BO5 A;  3TG4 A;  3TG5 A;  3M55 A;  2R3A A;  4E47 A;  3S7D A;  3MO5 A;  1XQH A;  3HNA A;  3RQ4 A;  3S7J A;  3SW9 A;  2W5Y A;  3VV0 A;  4J7F A;  5LSX A;  3DAL A;  3OXF A;  4NJ5 A;  3SWC A;  4Z4P A;  3RU0 A;  3MEK A;  5T5G A;  3DB5 A;  5JIN A;  3VUZ A;  5JHN A;  1ML9 A;  4AU7 A;  5EX3 A;  3PDN A;  3M59 A;  3RIB A;  5F6K C;  3CBO A;  4NVQ A;  4QEO A;  1N3J A;  2G46 A;  3S7F A;  5KJM A;  4MI5 A;  5JJ0 A;  1MVH A;  4J8O A;  2IGQ A;  3M57 A;  4IJD A;  4YNM A;  5ARG A;  3OPE A;  5KJK A;  3M56 A;  2JV0 A;  5ARF A;  5EG2 A;  3S8P A;  3M5A A;  4YND A;  3QWW A;  5F59 A;  2RFI A;  4J7I A;  4JLG A;  4JDS A;  5HI7 A;  3M58 A;  3KMA A;  5EX0 A;  5TEG A;  4WUY A;  5CCL A;  3FPD A;  5CCM A;  5HQ8 A;  3QWV A;  3S7B A;  1N6A A;  3EP0 A;  3OXG A;  1ZKK A;  1MUF A;  5KJL A;  5AYF A;  3N71 A;  1O9S A;  4YPE A;  5LSZ A;  4O30 A;  4H12 A;  4BUP A;  2F69 A;  5T0K A;  5JIY A;  2O8J A;  4QEN A;  3IHX A;  3OOI A;  4QEP A;  5CPR B;  3KMJ A;  5TTF A;  1H3I A;  5TH7 A;  4IJ8 A;  4RZ0 A; 
#chains in the Genus database with same CATH homology
 4YNP A;  3F9X A;  1MVX A;  4LDG A;  5F5E A;  5F6L A;  1MT6 A;  3K5K A;  4J83 A;  3OXL A;  3RAY A;  4I51 A;  1N6C A;  2BQZ A;  3KMT A;  3CBM A;  2W5Z A;  3F9Z A;  3OS5 A;  5T0M A;  3CBP A;  4YPA A;  3M53 A;  4MI0 A;  1PEG A;  3F9Y A;  4FMU A;  2QPW A;  3MO2 A;  3RJW A;  3F9W A;  4YPU A;  3M54 A;  5KJN A;  3MO0 A;  4O6F A;  4C1Q A;  3QWP A;  3BO5 A;  3TG4 A;  3TG5 A;  3M55 A;  2R3A A;  4E47 A;  3S7D A;  3MO5 A;  1XQH A;  3HNA A;  3RQ4 A;  3S7J A;  3SW9 A;  2W5Y A;  3VV0 A;  4J7F A;  5LSX A;  3DAL A;  3OXF A;  4NJ5 A;  3SWC A;  4Z4P A;  3RU0 A;  3MEK A;  5T5G A;  3DB5 A;  5JIN A;  3VUZ A;  5JHN A;  1ML9 A;  4AU7 A;  5EX3 A;  3PDN A;  3M59 A;  3RIB A;  5F6K C;  3CBO A;  4NVQ A;  4QEO A;  1N3J A;  2G46 A;  3S7F A;  5KJM A;  4MI5 A;  5JJ0 A;  1MVH A;  4J8O A;  2IGQ A;  3M57 A;  4IJD A;  4YNM A;  5ARG A;  3OPE A;  5KJK A;  3M56 A;  2JV0 A;  5ARF A;  5EG2 A;  3S8P A;  3M5A A;  4YND A;  3QWW A;  5F59 A;  2RFI A;  4J7I A;  4JLG A;  4JDS A;  5HI7 A;  3M58 A;  3KMA A;  5EX0 A;  5TEG A;  4WUY A;  5CCL A;  3FPD A;  5CCM A;  5HQ8 A;  3QWV A;  3S7B A;  1N6A A;  3EP0 A;  3OXG A;  1ZKK A;  1MUF A;  5KJL A;  5AYF A;  3N71 A;  1O9S A;  4YPE A;  5LSZ A;  4O30 A;  4H12 A;  4BUP A;  2F69 A;  5T0K A;  5JIY A;  2O8J A;  4QEN A;  3IHX A;  3OOI A;  4QEP A;  5CPR B;  3KMJ A;  5TTF A;  1H3I A;  5TH7 A;  4IJ8 A;  4RZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...