1ZKKA

Crystal structure of hset8 in ternary complex with h4 peptide (16-24) and adohcy
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H4 lysine-20 specific
publication title Structural and functional analysis of SET8, a histone H4 Lys-20 methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1zkkA00
5TTFA 3VUZA 4J83A 4IJ8A 3RJWA 3RU0A 3VV0A 4NJ5A 4YPEA 4YPUA 3S7BA 4LDGA 3CBMA 3OS5A 4AU7A 4YPAA 3QWPA 5EG2A 3KMJA 4JDSA 5TH7A 5KJMA 1O9SA 3M54A 3CBOA 3M5AA 5F59A 5T0MA 4QENA 1N3JA 3BO5A 3DALA 5CCMA 4BUPA 3MEKA 5HI7A 1ZKKA 5KJNA 2F69A 3IHXA 3M53A 1XQHA 4MI0A 4YNPA 3F9ZA 4O30A 5HQ8A 2RFIA 5LSZA 4E47A 5ARFA 4NVQA 4YNDA 3DB5A 4WUYA 3RAYA 3S8PA 4RZ0A 4IJDA 5EX3A 3OXGA 1N6AA 5F5EA 3QWVA 5CPRB 5JJ0A 2W5YA 3OXFA 4JLGA 3OPEA 4O6FA 5TEGA 3M55A 5LSXA 3M56A 3EP0A 3SWCA 3F9YA 2G46A 3SW9A 3KMAA 5CCLA 1H3IA 4J7FA 3HNAA 4FMUA 2BQZA 5KJKA 3S7JA 5F6LA 1MVXA 5F6KC 4I51A 3M58A 5T0KA 3K5KA 5EX0A 5KJLA 5JINA 2QPWA 4Z4PA 3N71A 3S7FA 3MO2A 5ARGA 4QEOA 3FPDA 3S7DA 1ML9A 4C1QA 2O8JA 3M57A 5AYFA 3RIBA 4QEPA 3MO5A 3OXLA 2JV0A 3TG4A 4J7IA 1MUFA 4J8OA 3MO0A 3M59A 4H12A 3CBPA 2IGQA 1MVHA 5T5GA 1N6CA 5JHNA 1PEGA 4YNMA 3KMTA 3F9WA 3QWWA 3RQ4A 2R3AA 3OOIA 3F9XA 4MI5A 1MT6A 3PDNA 2W5ZA 3TG5A 5JIYA
chains in the Genus database with same CATH superfamily
5TTFA 3VUZA 4J83A 4IJ8A 3RJWA 3RU0A 3VV0A 4NJ5A 4YPEA 4YPUA 3S7BA 4LDGA 3CBMA 3OS5A 4AU7A 4YPAA 3QWPA 5EG2A 3KMJA 4JDSA 5TH7A 5KJMA 1O9SA 3M54A 3CBOA 3M5AA 5F59A 5T0MA 4QENA 1N3JA 3BO5A 3DALA 5CCMA 4BUPA 3MEKA 5HI7A 1ZKKA 5KJNA 2F69A 3IHXA 3M53A 1XQHA 4MI0A 4YNPA 3F9ZA 4O30A 5HQ8A 2RFIA 5LSZA 4E47A 5ARFA 4NVQA 4YNDA 3DB5A 4WUYA 3RAYA 3S8PA 4RZ0A 4IJDA 5EX3A 3OXGA 1N6AA 5F5EA 3QWVA 5CPRB 5JJ0A 2W5YA 3OXFA 4JLGA 3OPEA 4O6FA 5TEGA 3M55A 5LSXA 3M56A 3EP0A 3SWCA 3F9YA 2G46A 3SW9A 3KMAA 5CCLA 1H3IA 4J7FA 3HNAA 4FMUA 2BQZA 5KJKA 3S7JA 5F6LA 1MVXA 5F6KC 4I51A 3M58A 5T0KA 3K5KA 5EX0A 5KJLA 5JINA 2QPWA 4Z4PA 3N71A 3S7FA 3MO2A 5ARGA 4QEOA 3FPDA 3S7DA 1ML9A 4C1QA 2O8JA 3M57A 5AYFA 3RIBA 4QEPA 3MO5A 3OXLA 2JV0A 3TG4A 4J7IA 1MUFA 4J8OA 3MO0A 3M59A 4H12A 3CBPA 2IGQA 1MVHA 5T5GA 1N6CA 5JHNA 1PEGA 4YNMA 3KMTA 3F9WA 3QWWA 3RQ4A 2R3AA 3OOIA 3F9XA 4MI5A 1MT6A 3PDNA 2W5ZA 3TG5A 5JIYA
chains in the Genus database with same CATH topology
5TTFA 3VUZA 4J83A 4IJ8A 3RJWA 3RU0A 3VV0A 4NJ5A 4YPEA 4YPUA 3S7BA 4LDGA 3CBMA 3OS5A 4AU7A 4YPAA 3QWPA 5EG2A 3KMJA 4JDSA 5TH7A 5KJMA 1O9SA 3M54A 3CBOA 3M5AA 5F59A 5T0MA 4QENA 1N3JA 3BO5A 3DALA 5CCMA 4BUPA 3MEKA 5HI7A 1ZKKA 5KJNA 2F69A 3IHXA 3M53A 1XQHA 4MI0A 4YNPA 3F9ZA 4O30A 5HQ8A 2RFIA 5LSZA 4E47A 5ARFA 4NVQA 4YNDA 3DB5A 4WUYA 3RAYA 3S8PA 4RZ0A 4IJDA 5EX3A 3OXGA 1N6AA 5F5EA 3QWVA 5CPRB 5JJ0A 2W5YA 3OXFA 4JLGA 3OPEA 4O6FA 5TEGA 3M55A 5LSXA 3M56A 3EP0A 3SWCA 3F9YA 2G46A 3SW9A 3KMAA 5CCLA 1H3IA 4J7FA 3HNAA 4FMUA 2BQZA 5KJKA 3S7JA 5F6LA 1MVXA 5F6KC 4I51A 3M58A 5T0KA 3K5KA 5EX0A 5KJLA 5JINA 2QPWA 4Z4PA 3N71A 3S7FA 3MO2A 5ARGA 4QEOA 3FPDA 3S7DA 1ML9A 4C1QA 2O8JA 3M57A 5AYFA 3RIBA 4QEPA 3MO5A 3OXLA 2JV0A 3TG4A 4J7IA 1MUFA 4J8OA 3MO0A 3M59A 4H12A 3CBPA 2IGQA 1MVHA 5T5GA 1N6CA 5JHNA 1PEGA 4YNMA 3KMTA 3F9WA 3QWWA 3RQ4A 2R3AA 3OOIA 3F9XA 4MI5A 1MT6A 3PDNA 2W5ZA 3TG5A 5JIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TTF A;  3VUZ A;  4J83 A;  4IJ8 A;  3RJW A;  3RU0 A;  3VV0 A;  4NJ5 A;  4YPE A;  4YPU A;  3S7B A;  4LDG A;  3CBM A;  3OS5 A;  4AU7 A;  4YPA A;  3QWP A;  5EG2 A;  3KMJ A;  4JDS A;  5TH7 A;  5KJM A;  1O9S A;  3M54 A;  3CBO A;  3M5A A;  5F59 A;  5T0M A;  4QEN A;  1N3J A;  3BO5 A;  3DAL A;  5CCM A;  4BUP A;  3MEK A;  5HI7 A;  1ZKK A;  5KJN A;  2F69 A;  3IHX A;  3M53 A;  1XQH A;  4MI0 A;  4YNP A;  3F9Z A;  4O30 A;  5HQ8 A;  2RFI A;  5LSZ A;  4E47 A;  5ARF A;  4NVQ A;  4YND A;  3DB5 A;  4WUY A;  3RAY A;  3S8P A;  4RZ0 A;  4IJD A;  5EX3 A;  3OXG A;  1N6A A;  5F5E A;  3QWV A;  5CPR B;  5JJ0 A;  2W5Y A;  3OXF A;  4JLG A;  3OPE A;  4O6F A;  5TEG A;  3M55 A;  5LSX A;  3M56 A;  3EP0 A;  3SWC A;  3F9Y A;  2G46 A;  3SW9 A;  3KMA A;  5CCL A;  1H3I A;  4J7F A;  3HNA A;  4FMU A;  2BQZ A;  5KJK A;  3S7J A;  5F6L A;  1MVX A;  5F6K C;  4I51 A;  3M58 A;  5T0K A;  3K5K A;  5EX0 A;  5KJL A;  5JIN A;  2QPW A;  4Z4P A;  3N71 A;  3S7F A;  3MO2 A;  5ARG A;  4QEO A;  3FPD A;  3S7D A;  1ML9 A;  4C1Q A;  2O8J A;  3M57 A;  5AYF A;  3RIB A;  4QEP A;  3MO5 A;  3OXL A;  2JV0 A;  3TG4 A;  4J7I A;  1MUF A;  4J8O A;  3MO0 A;  3M59 A;  4H12 A;  3CBP A;  2IGQ A;  1MVH A;  5T5G A;  1N6C A;  5JHN A;  1PEG A;  4YNM A;  3KMT A;  3F9W A;  3QWW A;  3RQ4 A;  2R3A A;  3OOI A;  3F9X A;  4MI5 A;  1MT6 A;  3PDN A;  2W5Z A;  3TG5 A;  5JIY A; 
#chains in the Genus database with same CATH topology
 5TTF A;  3VUZ A;  4J83 A;  4IJ8 A;  3RJW A;  3RU0 A;  3VV0 A;  4NJ5 A;  4YPE A;  4YPU A;  3S7B A;  4LDG A;  3CBM A;  3OS5 A;  4AU7 A;  4YPA A;  3QWP A;  5EG2 A;  3KMJ A;  4JDS A;  5TH7 A;  5KJM A;  1O9S A;  3M54 A;  3CBO A;  3M5A A;  5F59 A;  5T0M A;  4QEN A;  1N3J A;  3BO5 A;  3DAL A;  5CCM A;  4BUP A;  3MEK A;  5HI7 A;  1ZKK A;  5KJN A;  2F69 A;  3IHX A;  3M53 A;  1XQH A;  4MI0 A;  4YNP A;  3F9Z A;  4O30 A;  5HQ8 A;  2RFI A;  5LSZ A;  4E47 A;  5ARF A;  4NVQ A;  4YND A;  3DB5 A;  4WUY A;  3RAY A;  3S8P A;  4RZ0 A;  4IJD A;  5EX3 A;  3OXG A;  1N6A A;  5F5E A;  3QWV A;  5CPR B;  5JJ0 A;  2W5Y A;  3OXF A;  4JLG A;  3OPE A;  4O6F A;  5TEG A;  3M55 A;  5LSX A;  3M56 A;  3EP0 A;  3SWC A;  3F9Y A;  2G46 A;  3SW9 A;  3KMA A;  5CCL A;  1H3I A;  4J7F A;  3HNA A;  4FMU A;  2BQZ A;  5KJK A;  3S7J A;  5F6L A;  1MVX A;  5F6K C;  4I51 A;  3M58 A;  5T0K A;  3K5K A;  5EX0 A;  5KJL A;  5JIN A;  2QPW A;  4Z4P A;  3N71 A;  3S7F A;  3MO2 A;  5ARG A;  4QEO A;  3FPD A;  3S7D A;  1ML9 A;  4C1Q A;  2O8J A;  3M57 A;  5AYF A;  3RIB A;  4QEP A;  3MO5 A;  3OXL A;  2JV0 A;  3TG4 A;  4J7I A;  1MUF A;  4J8O A;  3MO0 A;  3M59 A;  4H12 A;  3CBP A;  2IGQ A;  1MVH A;  5T5G A;  1N6C A;  5JHN A;  1PEG A;  4YNM A;  3KMT A;  3F9W A;  3QWW A;  3RQ4 A;  2R3A A;  3OOI A;  3F9X A;  4MI5 A;  1MT6 A;  3PDN A;  2W5Z A;  3TG5 A;  5JIY A; 
#chains in the Genus database with same CATH homology
 5TTF A;  3VUZ A;  4J83 A;  4IJ8 A;  3RJW A;  3RU0 A;  3VV0 A;  4NJ5 A;  4YPE A;  4YPU A;  3S7B A;  4LDG A;  3CBM A;  3OS5 A;  4AU7 A;  4YPA A;  3QWP A;  5EG2 A;  3KMJ A;  4JDS A;  5TH7 A;  5KJM A;  1O9S A;  3M54 A;  3CBO A;  3M5A A;  5F59 A;  5T0M A;  4QEN A;  1N3J A;  3BO5 A;  3DAL A;  5CCM A;  4BUP A;  3MEK A;  5HI7 A;  1ZKK A;  5KJN A;  2F69 A;  3IHX A;  3M53 A;  1XQH A;  4MI0 A;  4YNP A;  3F9Z A;  4O30 A;  5HQ8 A;  2RFI A;  5LSZ A;  4E47 A;  5ARF A;  4NVQ A;  4YND A;  3DB5 A;  4WUY A;  3RAY A;  3S8P A;  4RZ0 A;  4IJD A;  5EX3 A;  3OXG A;  1N6A A;  5F5E A;  3QWV A;  5CPR B;  5JJ0 A;  2W5Y A;  3OXF A;  4JLG A;  3OPE A;  4O6F A;  5TEG A;  3M55 A;  5LSX A;  3M56 A;  3EP0 A;  3SWC A;  3F9Y A;  2G46 A;  3SW9 A;  3KMA A;  5CCL A;  1H3I A;  4J7F A;  3HNA A;  4FMU A;  2BQZ A;  5KJK A;  3S7J A;  5F6L A;  1MVX A;  5F6K C;  4I51 A;  3M58 A;  5T0K A;  3K5K A;  5EX0 A;  5KJL A;  5JIN A;  2QPW A;  4Z4P A;  3N71 A;  3S7F A;  3MO2 A;  5ARG A;  4QEO A;  3FPD A;  3S7D A;  1ML9 A;  4C1Q A;  2O8J A;  3M57 A;  5AYF A;  3RIB A;  4QEP A;  3MO5 A;  3OXL A;  2JV0 A;  3TG4 A;  4J7I A;  1MUF A;  4J8O A;  3MO0 A;  3M59 A;  4H12 A;  3CBP A;  2IGQ A;  1MVH A;  5T5G A;  1N6C A;  5JHN A;  1PEG A;  4YNM A;  3KMT A;  3F9W A;  3QWW A;  3RQ4 A;  2R3A A;  3OOI A;  3F9X A;  4MI5 A;  1MT6 A;  3PDN A;  2W5Z A;  3TG5 A;  5JIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...