1ZKKA

Crystal structure of hset8 in ternary complex with h4 peptide (16-24) and adohcy
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional analysis of SET8, a histone H4 Lys-20 methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H4 lysine-20 specific
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1zkkA00
3M57A 2JV0A 4E47A 4H12A 3S7BA 3S7DA 4IJ8A 2W5ZA 2RFIA 4J7IA 1N6AA 3OS5A 4RZ0A 4I51A 3MEKA 4YPUA 5KJKA 3KMAA 3QWVA 3F9XA 5EG2A 5LSXA 3M53A 4NJ5A 4BUPA 1H3IA 3M56A 3CBMA 3QWPA 3RIBA 5TH7A 5EX0A 1XQHA 4JLGA 3M5AA 4J7FA 5T5GA 5TEGA 4IJDA 5JHNA 2QPWA 3OXFA 1MVHA 4O30A 2F69A 3OOIA 3DALA 5F5EA 4WUYA 5ARFA 3RU0A 3F9YA 3SW9A 3M54A 5ARGA 1N3JA 1MVXA 5T0KA 3S7JA 3IHXA 5AYFA 3SWCA 1ZKKA 4NVQA 4YPEA 4JDSA 5CPRB 3PDNA 1O9SA 2O8JA 3OXGA 1PEGA 5F59A 2R3AA 4MI5A 3RAYA 3QWWA 5F6LA 4FMUA 5HQ8A 1MT6A 3S7FA 4YNPA 3CBPA 3MO5A 5TTFA 3F9ZA 1ML9A 3BO5A 5CCMA 4QENA 4YNDA 1N6CA 2W5YA 4MI0A 4C1QA 5CCLA 3M58A 3TG4A 4QEOA 4LDGA 3S8PA 4AU7A 5KJLA 3OPEA 3RJWA 3EP0A 5KJMA 5F6KC 3CBOA 3DB5A 2BQZA 3KMTA 5KJNA 3HNAA 3OXLA 3N71A 3FPDA 4J83A 3M55A 3TG5A 4O6FA 4Z4PA 3VUZA 3MO2A 2IGQA 3VV0A 5JIYA 5JJ0A 4QEPA 5LSZA 4YPAA 3MO0A 3M59A 3RQ4A 3KMJA 4J8OA 3K5KA 4YNMA 1MUFA 3F9WA 5EX3A 2G46A 5T0MA 5HI7A 5JINA
chains in the Genus database with same CATH superfamily
3M57A 2JV0A 4E47A 4H12A 3S7BA 3S7DA 4IJ8A 2W5ZA 2RFIA 4J7IA 1N6AA 3OS5A 4RZ0A 4I51A 3MEKA 4YPUA 5KJKA 3KMAA 3QWVA 3F9XA 5EG2A 5LSXA 3M53A 4NJ5A 4BUPA 1H3IA 3M56A 3CBMA 3QWPA 3RIBA 5TH7A 5EX0A 1XQHA 4JLGA 3M5AA 4J7FA 5T5GA 5TEGA 4IJDA 5JHNA 2QPWA 3OXFA 1MVHA 4O30A 2F69A 3OOIA 3DALA 5F5EA 4WUYA 5ARFA 3RU0A 3F9YA 3SW9A 3M54A 5ARGA 1N3JA 1MVXA 5T0KA 3S7JA 3IHXA 5AYFA 3SWCA 1ZKKA 4NVQA 4YPEA 4JDSA 5CPRB 3PDNA 1O9SA 2O8JA 3OXGA 1PEGA 5F59A 2R3AA 4MI5A 3RAYA 3QWWA 5F6LA 4FMUA 5HQ8A 1MT6A 3S7FA 4YNPA 3CBPA 3MO5A 5TTFA 3F9ZA 1ML9A 3BO5A 5CCMA 4QENA 4YNDA 1N6CA 2W5YA 4MI0A 4C1QA 5CCLA 3M58A 3TG4A 4QEOA 4LDGA 3S8PA 4AU7A 5KJLA 3OPEA 3RJWA 3EP0A 5KJMA 5F6KC 3CBOA 3DB5A 2BQZA 3KMTA 5KJNA 3HNAA 3OXLA 3N71A 3FPDA 4J83A 3M55A 3TG5A 4O6FA 4Z4PA 3VUZA 3MO2A 2IGQA 3VV0A 5JIYA 5JJ0A 4QEPA 5LSZA 4YPAA 3MO0A 3M59A 3RQ4A 3KMJA 4J8OA 3K5KA 4YNMA 1MUFA 3F9WA 5EX3A 2G46A 5T0MA 5HI7A 5JINA
chains in the Genus database with same CATH topology
3M57A 2JV0A 4E47A 4H12A 3S7BA 3S7DA 4IJ8A 2W5ZA 2RFIA 4J7IA 1N6AA 3OS5A 4RZ0A 4I51A 3MEKA 4YPUA 5KJKA 3KMAA 3QWVA 3F9XA 5EG2A 5LSXA 3M53A 4NJ5A 4BUPA 1H3IA 3M56A 3CBMA 3QWPA 3RIBA 5TH7A 5EX0A 1XQHA 4JLGA 3M5AA 4J7FA 5T5GA 5TEGA 4IJDA 5JHNA 2QPWA 3OXFA 1MVHA 4O30A 2F69A 3OOIA 3DALA 5F5EA 4WUYA 5ARFA 3RU0A 3F9YA 3SW9A 3M54A 5ARGA 1N3JA 1MVXA 5T0KA 3S7JA 3IHXA 5AYFA 3SWCA 1ZKKA 4NVQA 4YPEA 4JDSA 5CPRB 3PDNA 1O9SA 2O8JA 3OXGA 1PEGA 5F59A 2R3AA 4MI5A 3RAYA 3QWWA 5F6LA 4FMUA 5HQ8A 1MT6A 3S7FA 4YNPA 3CBPA 3MO5A 5TTFA 3F9ZA 1ML9A 3BO5A 5CCMA 4QENA 4YNDA 1N6CA 2W5YA 4MI0A 4C1QA 5CCLA 3M58A 3TG4A 4QEOA 4LDGA 3S8PA 4AU7A 5KJLA 3OPEA 3RJWA 3EP0A 5KJMA 5F6KC 3CBOA 3DB5A 2BQZA 3KMTA 5KJNA 3HNAA 3OXLA 3N71A 3FPDA 4J83A 3M55A 3TG5A 4O6FA 4Z4PA 3VUZA 3MO2A 2IGQA 3VV0A 5JIYA 5JJ0A 4QEPA 5LSZA 4YPAA 3MO0A 3M59A 3RQ4A 3KMJA 4J8OA 3K5KA 4YNMA 1MUFA 3F9WA 5EX3A 2G46A 5T0MA 5HI7A 5JINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M57 A;  2JV0 A;  4E47 A;  4H12 A;  3S7B A;  3S7D A;  4IJ8 A;  2W5Z A;  2RFI A;  4J7I A;  1N6A A;  3OS5 A;  4RZ0 A;  4I51 A;  3MEK A;  4YPU A;  5KJK A;  3KMA A;  3QWV A;  3F9X A;  5EG2 A;  5LSX A;  3M53 A;  4NJ5 A;  4BUP A;  1H3I A;  3M56 A;  3CBM A;  3QWP A;  3RIB A;  5TH7 A;  5EX0 A;  1XQH A;  4JLG A;  3M5A A;  4J7F A;  5T5G A;  5TEG A;  4IJD A;  5JHN A;  2QPW A;  3OXF A;  1MVH A;  4O30 A;  2F69 A;  3OOI A;  3DAL A;  5F5E A;  4WUY A;  5ARF A;  3RU0 A;  3F9Y A;  3SW9 A;  3M54 A;  5ARG A;  1N3J A;  1MVX A;  5T0K A;  3S7J A;  3IHX A;  5AYF A;  3SWC A;  1ZKK A;  4NVQ A;  4YPE A;  4JDS A;  5CPR B;  3PDN A;  1O9S A;  2O8J A;  3OXG A;  1PEG A;  5F59 A;  2R3A A;  4MI5 A;  3RAY A;  3QWW A;  5F6L A;  4FMU A;  5HQ8 A;  1MT6 A;  3S7F A;  4YNP A;  3CBP A;  3MO5 A;  5TTF A;  3F9Z A;  1ML9 A;  3BO5 A;  5CCM A;  4QEN A;  4YND A;  1N6C A;  2W5Y A;  4MI0 A;  4C1Q A;  5CCL A;  3M58 A;  3TG4 A;  4QEO A;  4LDG A;  3S8P A;  4AU7 A;  5KJL A;  3OPE A;  3RJW A;  3EP0 A;  5KJM A;  5F6K C;  3CBO A;  3DB5 A;  2BQZ A;  3KMT A;  5KJN A;  3HNA A;  3OXL A;  3N71 A;  3FPD A;  4J83 A;  3M55 A;  3TG5 A;  4O6F A;  4Z4P A;  3VUZ A;  3MO2 A;  2IGQ A;  3VV0 A;  5JIY A;  5JJ0 A;  4QEP A;  5LSZ A;  4YPA A;  3MO0 A;  3M59 A;  3RQ4 A;  3KMJ A;  4J8O A;  3K5K A;  4YNM A;  1MUF A;  3F9W A;  5EX3 A;  2G46 A;  5T0M A;  5HI7 A;  5JIN A; 
#chains in the Genus database with same CATH topology
 3M57 A;  2JV0 A;  4E47 A;  4H12 A;  3S7B A;  3S7D A;  4IJ8 A;  2W5Z A;  2RFI A;  4J7I A;  1N6A A;  3OS5 A;  4RZ0 A;  4I51 A;  3MEK A;  4YPU A;  5KJK A;  3KMA A;  3QWV A;  3F9X A;  5EG2 A;  5LSX A;  3M53 A;  4NJ5 A;  4BUP A;  1H3I A;  3M56 A;  3CBM A;  3QWP A;  3RIB A;  5TH7 A;  5EX0 A;  1XQH A;  4JLG A;  3M5A A;  4J7F A;  5T5G A;  5TEG A;  4IJD A;  5JHN A;  2QPW A;  3OXF A;  1MVH A;  4O30 A;  2F69 A;  3OOI A;  3DAL A;  5F5E A;  4WUY A;  5ARF A;  3RU0 A;  3F9Y A;  3SW9 A;  3M54 A;  5ARG A;  1N3J A;  1MVX A;  5T0K A;  3S7J A;  3IHX A;  5AYF A;  3SWC A;  1ZKK A;  4NVQ A;  4YPE A;  4JDS A;  5CPR B;  3PDN A;  1O9S A;  2O8J A;  3OXG A;  1PEG A;  5F59 A;  2R3A A;  4MI5 A;  3RAY A;  3QWW A;  5F6L A;  4FMU A;  5HQ8 A;  1MT6 A;  3S7F A;  4YNP A;  3CBP A;  3MO5 A;  5TTF A;  3F9Z A;  1ML9 A;  3BO5 A;  5CCM A;  4QEN A;  4YND A;  1N6C A;  2W5Y A;  4MI0 A;  4C1Q A;  5CCL A;  3M58 A;  3TG4 A;  4QEO A;  4LDG A;  3S8P A;  4AU7 A;  5KJL A;  3OPE A;  3RJW A;  3EP0 A;  5KJM A;  5F6K C;  3CBO A;  3DB5 A;  2BQZ A;  3KMT A;  5KJN A;  3HNA A;  3OXL A;  3N71 A;  3FPD A;  4J83 A;  3M55 A;  3TG5 A;  4O6F A;  4Z4P A;  3VUZ A;  3MO2 A;  2IGQ A;  3VV0 A;  5JIY A;  5JJ0 A;  4QEP A;  5LSZ A;  4YPA A;  3MO0 A;  3M59 A;  3RQ4 A;  3KMJ A;  4J8O A;  3K5K A;  4YNM A;  1MUF A;  3F9W A;  5EX3 A;  2G46 A;  5T0M A;  5HI7 A;  5JIN A; 
#chains in the Genus database with same CATH homology
 3M57 A;  2JV0 A;  4E47 A;  4H12 A;  3S7B A;  3S7D A;  4IJ8 A;  2W5Z A;  2RFI A;  4J7I A;  1N6A A;  3OS5 A;  4RZ0 A;  4I51 A;  3MEK A;  4YPU A;  5KJK A;  3KMA A;  3QWV A;  3F9X A;  5EG2 A;  5LSX A;  3M53 A;  4NJ5 A;  4BUP A;  1H3I A;  3M56 A;  3CBM A;  3QWP A;  3RIB A;  5TH7 A;  5EX0 A;  1XQH A;  4JLG A;  3M5A A;  4J7F A;  5T5G A;  5TEG A;  4IJD A;  5JHN A;  2QPW A;  3OXF A;  1MVH A;  4O30 A;  2F69 A;  3OOI A;  3DAL A;  5F5E A;  4WUY A;  5ARF A;  3RU0 A;  3F9Y A;  3SW9 A;  3M54 A;  5ARG A;  1N3J A;  1MVX A;  5T0K A;  3S7J A;  3IHX A;  5AYF A;  3SWC A;  1ZKK A;  4NVQ A;  4YPE A;  4JDS A;  5CPR B;  3PDN A;  1O9S A;  2O8J A;  3OXG A;  1PEG A;  5F59 A;  2R3A A;  4MI5 A;  3RAY A;  3QWW A;  5F6L A;  4FMU A;  5HQ8 A;  1MT6 A;  3S7F A;  4YNP A;  3CBP A;  3MO5 A;  5TTF A;  3F9Z A;  1ML9 A;  3BO5 A;  5CCM A;  4QEN A;  4YND A;  1N6C A;  2W5Y A;  4MI0 A;  4C1Q A;  5CCL A;  3M58 A;  3TG4 A;  4QEO A;  4LDG A;  3S8P A;  4AU7 A;  5KJL A;  3OPE A;  3RJW A;  3EP0 A;  5KJM A;  5F6K C;  3CBO A;  3DB5 A;  2BQZ A;  3KMT A;  5KJN A;  3HNA A;  3OXL A;  3N71 A;  3FPD A;  4J83 A;  3M55 A;  3TG5 A;  4O6F A;  4Z4P A;  3VUZ A;  3MO2 A;  2IGQ A;  3VV0 A;  5JIY A;  5JJ0 A;  4QEP A;  5LSZ A;  4YPA A;  3MO0 A;  3M59 A;  3RQ4 A;  3KMJ A;  4J8O A;  3K5K A;  4YNM A;  1MUF A;  3F9W A;  5EX3 A;  2G46 A;  5T0M A;  5HI7 A;  5JIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...