1ZKKA

Crystal structure of hset8 in ternary complex with h4 peptide (16-24) and adohcy
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H4 lysine-20 specific
molecule tags Transferase
source organism Homo sapiens
publication title Structural and functional analysis of SET8, a histone H4 Lys-20 methyltransferase
pubmed doi rcsb
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1zkkA00
3M58A 1MUFA 5TTFA 4JLGA 2QPWA 3M57A 5EG2A 3RQ4A 3S8PA 5T0MA 1H3IA 4MI0A 1MVHA 3VV0A 5JIYA 5KJMA 3KMTA 4YPAA 1N3JA 2F69A 5KJLA 4IJDA 5F6KC 4I51A 4JDSA 4YNPA 4MI5A 5F59A 1PEGA 3QWPA 3TG5A 3FPDA 3KMJA 4H12A 3M55A 4Z4PA 3OXGA 2BQZA 4QENA 3F9YA 4J83A 5JHNA 3MO5A 5EX3A 3IHXA 4J7IA 3TG4A 1MVXA 3KMAA 3PDNA 5JJ0A 4AU7A 4O30A 3DALA 3RIBA 3MO0A 4FMUA 4QEPA 2RFIA 3S7DA 5CCMA 5JINA 3EP0A 4J7FA 5CPRB 3F9WA 3OXLA 3OXFA 5LSXA 3RAYA 3M53A 5HI7A 2W5ZA 3F9ZA 2IGQA 5ARGA 4NJ5A 4YNDA 4NVQA 4C1QA 4J8OA 3OS5A 5T0KA 3M56A 5ARFA 3CBMA 5AYFA 4WUYA 3HNAA 5HQ8A 3QWVA 4IJ8A 3M54A 3SWCA 5TH7A 3RJWA 3K5KA 3SW9A 1N6AA 3OOIA 3CBOA 4RZ0A 1XQHA 3VUZA 3OPEA 3F9XA 4YPEA 5KJKA 2W5YA 3N71A 3QWWA 3CBPA 4YNMA 3RU0A 5T5GA 5F5EA 4QEOA 3S7JA 4E47A 4LDGA 5CCLA 1MT6A 4YPUA 5EX0A 5F6LA 3DB5A 5TEGA 3MEKA 2O8JA 4O6FA 3S7FA 1N6CA 3M59A 1O9SA 3M5AA 4BUPA 3S7BA 5KJNA 5LSZA 1ZKKA 3MO2A 2R3AA 2JV0A 3BO5A 1ML9A 2G46A
chains in the Genus database with same CATH superfamily
3M58A 1MUFA 5TTFA 4JLGA 2QPWA 3M57A 5EG2A 3RQ4A 3S8PA 5T0MA 1H3IA 4MI0A 1MVHA 3VV0A 5JIYA 5KJMA 3KMTA 4YPAA 1N3JA 2F69A 5KJLA 4IJDA 5F6KC 4I51A 4JDSA 4YNPA 4MI5A 5F59A 1PEGA 3QWPA 3TG5A 3FPDA 3KMJA 4H12A 3M55A 4Z4PA 3OXGA 2BQZA 4QENA 3F9YA 4J83A 5JHNA 3MO5A 5EX3A 3IHXA 4J7IA 3TG4A 1MVXA 3KMAA 3PDNA 5JJ0A 4AU7A 4O30A 3DALA 3RIBA 3MO0A 4FMUA 4QEPA 2RFIA 3S7DA 5CCMA 5JINA 3EP0A 4J7FA 5CPRB 3F9WA 3OXLA 3OXFA 5LSXA 3RAYA 3M53A 5HI7A 2W5ZA 3F9ZA 2IGQA 5ARGA 4NJ5A 4YNDA 4NVQA 4C1QA 4J8OA 3OS5A 5T0KA 3M56A 5ARFA 3CBMA 5AYFA 4WUYA 3HNAA 5HQ8A 3QWVA 4IJ8A 3M54A 3SWCA 5TH7A 3RJWA 3K5KA 3SW9A 1N6AA 3OOIA 3CBOA 4RZ0A 1XQHA 3VUZA 3OPEA 3F9XA 4YPEA 5KJKA 2W5YA 3N71A 3QWWA 3CBPA 4YNMA 3RU0A 5T5GA 5F5EA 4QEOA 3S7JA 4E47A 4LDGA 5CCLA 1MT6A 4YPUA 5EX0A 5F6LA 3DB5A 5TEGA 3MEKA 2O8JA 4O6FA 3S7FA 1N6CA 3M59A 1O9SA 3M5AA 4BUPA 3S7BA 5KJNA 5LSZA 1ZKKA 3MO2A 2R3AA 2JV0A 3BO5A 1ML9A 2G46A
chains in the Genus database with same CATH topology
3M58A 1MUFA 5TTFA 4JLGA 2QPWA 3M57A 5EG2A 3RQ4A 3S8PA 5T0MA 1H3IA 4MI0A 1MVHA 3VV0A 5JIYA 5KJMA 3KMTA 4YPAA 1N3JA 2F69A 5KJLA 4IJDA 5F6KC 4I51A 4JDSA 4YNPA 4MI5A 5F59A 1PEGA 3QWPA 3TG5A 3FPDA 3KMJA 4H12A 3M55A 4Z4PA 3OXGA 2BQZA 4QENA 3F9YA 4J83A 5JHNA 3MO5A 5EX3A 3IHXA 4J7IA 3TG4A 1MVXA 3KMAA 3PDNA 5JJ0A 4AU7A 4O30A 3DALA 3RIBA 3MO0A 4FMUA 4QEPA 2RFIA 3S7DA 5CCMA 5JINA 3EP0A 4J7FA 5CPRB 3F9WA 3OXLA 3OXFA 5LSXA 3RAYA 3M53A 5HI7A 2W5ZA 3F9ZA 2IGQA 5ARGA 4NJ5A 4YNDA 4NVQA 4C1QA 4J8OA 3OS5A 5T0KA 3M56A 5ARFA 3CBMA 5AYFA 4WUYA 3HNAA 5HQ8A 3QWVA 4IJ8A 3M54A 3SWCA 5TH7A 3RJWA 3K5KA 3SW9A 1N6AA 3OOIA 3CBOA 4RZ0A 1XQHA 3VUZA 3OPEA 3F9XA 4YPEA 5KJKA 2W5YA 3N71A 3QWWA 3CBPA 4YNMA 3RU0A 5T5GA 5F5EA 4QEOA 3S7JA 4E47A 4LDGA 5CCLA 1MT6A 4YPUA 5EX0A 5F6LA 3DB5A 5TEGA 3MEKA 2O8JA 4O6FA 3S7FA 1N6CA 3M59A 1O9SA 3M5AA 4BUPA 3S7BA 5KJNA 5LSZA 1ZKKA 3MO2A 2R3AA 2JV0A 3BO5A 1ML9A 2G46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M58 A;  1MUF A;  5TTF A;  4JLG A;  2QPW A;  3M57 A;  5EG2 A;  3RQ4 A;  3S8P A;  5T0M A;  1H3I A;  4MI0 A;  1MVH A;  3VV0 A;  5JIY A;  5KJM A;  3KMT A;  4YPA A;  1N3J A;  2F69 A;  5KJL A;  4IJD A;  5F6K C;  4I51 A;  4JDS A;  4YNP A;  4MI5 A;  5F59 A;  1PEG A;  3QWP A;  3TG5 A;  3FPD A;  3KMJ A;  4H12 A;  3M55 A;  4Z4P A;  3OXG A;  2BQZ A;  4QEN A;  3F9Y A;  4J83 A;  5JHN A;  3MO5 A;  5EX3 A;  3IHX A;  4J7I A;  3TG4 A;  1MVX A;  3KMA A;  3PDN A;  5JJ0 A;  4AU7 A;  4O30 A;  3DAL A;  3RIB A;  3MO0 A;  4FMU A;  4QEP A;  2RFI A;  3S7D A;  5CCM A;  5JIN A;  3EP0 A;  4J7F A;  5CPR B;  3F9W A;  3OXL A;  3OXF A;  5LSX A;  3RAY A;  3M53 A;  5HI7 A;  2W5Z A;  3F9Z A;  2IGQ A;  5ARG A;  4NJ5 A;  4YND A;  4NVQ A;  4C1Q A;  4J8O A;  3OS5 A;  5T0K A;  3M56 A;  5ARF A;  3CBM A;  5AYF A;  4WUY A;  3HNA A;  5HQ8 A;  3QWV A;  4IJ8 A;  3M54 A;  3SWC A;  5TH7 A;  3RJW A;  3K5K A;  3SW9 A;  1N6A A;  3OOI A;  3CBO A;  4RZ0 A;  1XQH A;  3VUZ A;  3OPE A;  3F9X A;  4YPE A;  5KJK A;  2W5Y A;  3N71 A;  3QWW A;  3CBP A;  4YNM A;  3RU0 A;  5T5G A;  5F5E A;  4QEO A;  3S7J A;  4E47 A;  4LDG A;  5CCL A;  1MT6 A;  4YPU A;  5EX0 A;  5F6L A;  3DB5 A;  5TEG A;  3MEK A;  2O8J A;  4O6F A;  3S7F A;  1N6C A;  3M59 A;  1O9S A;  3M5A A;  4BUP A;  3S7B A;  5KJN A;  5LSZ A;  1ZKK A;  3MO2 A;  2R3A A;  2JV0 A;  3BO5 A;  1ML9 A;  2G46 A; 
#chains in the Genus database with same CATH topology
 3M58 A;  1MUF A;  5TTF A;  4JLG A;  2QPW A;  3M57 A;  5EG2 A;  3RQ4 A;  3S8P A;  5T0M A;  1H3I A;  4MI0 A;  1MVH A;  3VV0 A;  5JIY A;  5KJM A;  3KMT A;  4YPA A;  1N3J A;  2F69 A;  5KJL A;  4IJD A;  5F6K C;  4I51 A;  4JDS A;  4YNP A;  4MI5 A;  5F59 A;  1PEG A;  3QWP A;  3TG5 A;  3FPD A;  3KMJ A;  4H12 A;  3M55 A;  4Z4P A;  3OXG A;  2BQZ A;  4QEN A;  3F9Y A;  4J83 A;  5JHN A;  3MO5 A;  5EX3 A;  3IHX A;  4J7I A;  3TG4 A;  1MVX A;  3KMA A;  3PDN A;  5JJ0 A;  4AU7 A;  4O30 A;  3DAL A;  3RIB A;  3MO0 A;  4FMU A;  4QEP A;  2RFI A;  3S7D A;  5CCM A;  5JIN A;  3EP0 A;  4J7F A;  5CPR B;  3F9W A;  3OXL A;  3OXF A;  5LSX A;  3RAY A;  3M53 A;  5HI7 A;  2W5Z A;  3F9Z A;  2IGQ A;  5ARG A;  4NJ5 A;  4YND A;  4NVQ A;  4C1Q A;  4J8O A;  3OS5 A;  5T0K A;  3M56 A;  5ARF A;  3CBM A;  5AYF A;  4WUY A;  3HNA A;  5HQ8 A;  3QWV A;  4IJ8 A;  3M54 A;  3SWC A;  5TH7 A;  3RJW A;  3K5K A;  3SW9 A;  1N6A A;  3OOI A;  3CBO A;  4RZ0 A;  1XQH A;  3VUZ A;  3OPE A;  3F9X A;  4YPE A;  5KJK A;  2W5Y A;  3N71 A;  3QWW A;  3CBP A;  4YNM A;  3RU0 A;  5T5G A;  5F5E A;  4QEO A;  3S7J A;  4E47 A;  4LDG A;  5CCL A;  1MT6 A;  4YPU A;  5EX0 A;  5F6L A;  3DB5 A;  5TEG A;  3MEK A;  2O8J A;  4O6F A;  3S7F A;  1N6C A;  3M59 A;  1O9S A;  3M5A A;  4BUP A;  3S7B A;  5KJN A;  5LSZ A;  1ZKK A;  3MO2 A;  2R3A A;  2JV0 A;  3BO5 A;  1ML9 A;  2G46 A; 
#chains in the Genus database with same CATH homology
 3M58 A;  1MUF A;  5TTF A;  4JLG A;  2QPW A;  3M57 A;  5EG2 A;  3RQ4 A;  3S8P A;  5T0M A;  1H3I A;  4MI0 A;  1MVH A;  3VV0 A;  5JIY A;  5KJM A;  3KMT A;  4YPA A;  1N3J A;  2F69 A;  5KJL A;  4IJD A;  5F6K C;  4I51 A;  4JDS A;  4YNP A;  4MI5 A;  5F59 A;  1PEG A;  3QWP A;  3TG5 A;  3FPD A;  3KMJ A;  4H12 A;  3M55 A;  4Z4P A;  3OXG A;  2BQZ A;  4QEN A;  3F9Y A;  4J83 A;  5JHN A;  3MO5 A;  5EX3 A;  3IHX A;  4J7I A;  3TG4 A;  1MVX A;  3KMA A;  3PDN A;  5JJ0 A;  4AU7 A;  4O30 A;  3DAL A;  3RIB A;  3MO0 A;  4FMU A;  4QEP A;  2RFI A;  3S7D A;  5CCM A;  5JIN A;  3EP0 A;  4J7F A;  5CPR B;  3F9W A;  3OXL A;  3OXF A;  5LSX A;  3RAY A;  3M53 A;  5HI7 A;  2W5Z A;  3F9Z A;  2IGQ A;  5ARG A;  4NJ5 A;  4YND A;  4NVQ A;  4C1Q A;  4J8O A;  3OS5 A;  5T0K A;  3M56 A;  5ARF A;  3CBM A;  5AYF A;  4WUY A;  3HNA A;  5HQ8 A;  3QWV A;  4IJ8 A;  3M54 A;  3SWC A;  5TH7 A;  3RJW A;  3K5K A;  3SW9 A;  1N6A A;  3OOI A;  3CBO A;  4RZ0 A;  1XQH A;  3VUZ A;  3OPE A;  3F9X A;  4YPE A;  5KJK A;  2W5Y A;  3N71 A;  3QWW A;  3CBP A;  4YNM A;  3RU0 A;  5T5G A;  5F5E A;  4QEO A;  3S7J A;  4E47 A;  4LDG A;  5CCL A;  1MT6 A;  4YPU A;  5EX0 A;  5F6L A;  3DB5 A;  5TEG A;  3MEK A;  2O8J A;  4O6F A;  3S7F A;  1N6C A;  3M59 A;  1O9S A;  3M5A A;  4BUP A;  3S7B A;  5KJN A;  5LSZ A;  1ZKK A;  3MO2 A;  2R3A A;  2JV0 A;  3BO5 A;  1ML9 A;  2G46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...