1ZKKA

Crystal structure of hset8 in ternary complex with h4 peptide (16-24) and adohcy
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional analysis of SET8, a histone H4 Lys-20 methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H4 lysine-20 specific
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1zkkA00
4O30A 3TG5A 3M5AA 4BUPA 4IJDA 4WUYA 5LSXA 3CBPA 3S7FA 2F69A 5CPRB 1XQHA 5F5EA 4AU7A 3M53A 5JHNA 5CCMA 5ARFA 4YNDA 5CCLA 4LDGA 3MO0A 3IHXA 3MEKA 3PDNA 5JIYA 3EP0A 5T0MA 2RFIA 3HNAA 5KJLA 3CBMA 5ARGA 5HQ8A 5KJNA 3OXGA 4E47A 3VUZA 3F9ZA 3F9XA 2JV0A 3RQ4A 2BQZA 4MI0A 4Z4PA 3VV0A 3KMJA 3KMTA 3S8PA 5JINA 4JLGA 4IJ8A 5TH7A 2IGQA 3F9YA 3DALA 4RZ0A 4MI5A 5F59A 3M57A 1PEGA 2R3AA 5TTFA 2O8JA 3SWCA 3OOIA 5T5GA 3KMAA 3MO5A 1N6CA 1ML9A 3M58A 4NJ5A 5HI7A 5TEGA 3QWVA 4O6FA 3BO5A 4YPEA 2QPWA 3K5KA 5KJMA 5LSZA 1MVXA 4QENA 3MO2A 1ZKKA 3M54A 1N6AA 4QEOA 3M55A 1MVHA 4FMUA 3RAYA 3DB5A 4J8OA 4YNMA 1MT6A 3CBOA 5F6LA 3S7BA 2G46A 1MUFA 4H12A 1N3JA 5JJ0A 2W5ZA 4J7FA 5T0KA 5EX0A 4NVQA 4QEPA 3QWWA 3S7DA 4YPUA 3TG4A 4C1QA 1H3IA 1O9SA 3F9WA 4JDSA 4J7IA 4J83A 5EG2A 4I51A 5EX3A 3RU0A 3OPEA 3S7JA 3SW9A 3FPDA 5KJKA 2W5YA 3RJWA 3QWPA 4YNPA 3N71A 3RIBA 5F6KC 3OS5A 3OXFA 3M56A 3OXLA 3M59A 5AYFA 4YPAA
chains in the Genus database with same CATH superfamily
4O30A 3TG5A 3M5AA 4BUPA 4IJDA 4WUYA 5LSXA 3CBPA 3S7FA 2F69A 5CPRB 1XQHA 5F5EA 4AU7A 3M53A 5JHNA 5CCMA 5ARFA 4YNDA 5CCLA 4LDGA 3MO0A 3IHXA 3MEKA 3PDNA 5JIYA 3EP0A 5T0MA 2RFIA 3HNAA 5KJLA 3CBMA 5ARGA 5HQ8A 5KJNA 3OXGA 4E47A 3VUZA 3F9ZA 3F9XA 2JV0A 3RQ4A 2BQZA 4MI0A 4Z4PA 3VV0A 3KMJA 3KMTA 3S8PA 5JINA 4JLGA 4IJ8A 5TH7A 2IGQA 3F9YA 3DALA 4RZ0A 4MI5A 5F59A 3M57A 1PEGA 2R3AA 5TTFA 2O8JA 3SWCA 3OOIA 5T5GA 3KMAA 3MO5A 1N6CA 1ML9A 3M58A 4NJ5A 5HI7A 5TEGA 3QWVA 4O6FA 3BO5A 4YPEA 2QPWA 3K5KA 5KJMA 5LSZA 1MVXA 4QENA 3MO2A 1ZKKA 3M54A 1N6AA 4QEOA 3M55A 1MVHA 4FMUA 3RAYA 3DB5A 4J8OA 4YNMA 1MT6A 3CBOA 5F6LA 3S7BA 2G46A 1MUFA 4H12A 1N3JA 5JJ0A 2W5ZA 4J7FA 5T0KA 5EX0A 4NVQA 4QEPA 3QWWA 3S7DA 4YPUA 3TG4A 4C1QA 1H3IA 1O9SA 3F9WA 4JDSA 4J7IA 4J83A 5EG2A 4I51A 5EX3A 3RU0A 3OPEA 3S7JA 3SW9A 3FPDA 5KJKA 2W5YA 3RJWA 3QWPA 4YNPA 3N71A 3RIBA 5F6KC 3OS5A 3OXFA 3M56A 3OXLA 3M59A 5AYFA 4YPAA
chains in the Genus database with same CATH topology
4O30A 3TG5A 3M5AA 4BUPA 4IJDA 4WUYA 5LSXA 3CBPA 3S7FA 2F69A 5CPRB 1XQHA 5F5EA 4AU7A 3M53A 5JHNA 5CCMA 5ARFA 4YNDA 5CCLA 4LDGA 3MO0A 3IHXA 3MEKA 3PDNA 5JIYA 3EP0A 5T0MA 2RFIA 3HNAA 5KJLA 3CBMA 5ARGA 5HQ8A 5KJNA 3OXGA 4E47A 3VUZA 3F9ZA 3F9XA 2JV0A 3RQ4A 2BQZA 4MI0A 4Z4PA 3VV0A 3KMJA 3KMTA 3S8PA 5JINA 4JLGA 4IJ8A 5TH7A 2IGQA 3F9YA 3DALA 4RZ0A 4MI5A 5F59A 3M57A 1PEGA 2R3AA 5TTFA 2O8JA 3SWCA 3OOIA 5T5GA 3KMAA 3MO5A 1N6CA 1ML9A 3M58A 4NJ5A 5HI7A 5TEGA 3QWVA 4O6FA 3BO5A 4YPEA 2QPWA 3K5KA 5KJMA 5LSZA 1MVXA 4QENA 3MO2A 1ZKKA 3M54A 1N6AA 4QEOA 3M55A 1MVHA 4FMUA 3RAYA 3DB5A 4J8OA 4YNMA 1MT6A 3CBOA 5F6LA 3S7BA 2G46A 1MUFA 4H12A 1N3JA 5JJ0A 2W5ZA 4J7FA 5T0KA 5EX0A 4NVQA 4QEPA 3QWWA 3S7DA 4YPUA 3TG4A 4C1QA 1H3IA 1O9SA 3F9WA 4JDSA 4J7IA 4J83A 5EG2A 4I51A 5EX3A 3RU0A 3OPEA 3S7JA 3SW9A 3FPDA 5KJKA 2W5YA 3RJWA 3QWPA 4YNPA 3N71A 3RIBA 5F6KC 3OS5A 3OXFA 3M56A 3OXLA 3M59A 5AYFA 4YPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O30 A;  3TG5 A;  3M5A A;  4BUP A;  4IJD A;  4WUY A;  5LSX A;  3CBP A;  3S7F A;  2F69 A;  5CPR B;  1XQH A;  5F5E A;  4AU7 A;  3M53 A;  5JHN A;  5CCM A;  5ARF A;  4YND A;  5CCL A;  4LDG A;  3MO0 A;  3IHX A;  3MEK A;  3PDN A;  5JIY A;  3EP0 A;  5T0M A;  2RFI A;  3HNA A;  5KJL A;  3CBM A;  5ARG A;  5HQ8 A;  5KJN A;  3OXG A;  4E47 A;  3VUZ A;  3F9Z A;  3F9X A;  2JV0 A;  3RQ4 A;  2BQZ A;  4MI0 A;  4Z4P A;  3VV0 A;  3KMJ A;  3KMT A;  3S8P A;  5JIN A;  4JLG A;  4IJ8 A;  5TH7 A;  2IGQ A;  3F9Y A;  3DAL A;  4RZ0 A;  4MI5 A;  5F59 A;  3M57 A;  1PEG A;  2R3A A;  5TTF A;  2O8J A;  3SWC A;  3OOI A;  5T5G A;  3KMA A;  3MO5 A;  1N6C A;  1ML9 A;  3M58 A;  4NJ5 A;  5HI7 A;  5TEG A;  3QWV A;  4O6F A;  3BO5 A;  4YPE A;  2QPW A;  3K5K A;  5KJM A;  5LSZ A;  1MVX A;  4QEN A;  3MO2 A;  1ZKK A;  3M54 A;  1N6A A;  4QEO A;  3M55 A;  1MVH A;  4FMU A;  3RAY A;  3DB5 A;  4J8O A;  4YNM A;  1MT6 A;  3CBO A;  5F6L A;  3S7B A;  2G46 A;  1MUF A;  4H12 A;  1N3J A;  5JJ0 A;  2W5Z A;  4J7F A;  5T0K A;  5EX0 A;  4NVQ A;  4QEP A;  3QWW A;  3S7D A;  4YPU A;  3TG4 A;  4C1Q A;  1H3I A;  1O9S A;  3F9W A;  4JDS A;  4J7I A;  4J83 A;  5EG2 A;  4I51 A;  5EX3 A;  3RU0 A;  3OPE A;  3S7J A;  3SW9 A;  3FPD A;  5KJK A;  2W5Y A;  3RJW A;  3QWP A;  4YNP A;  3N71 A;  3RIB A;  5F6K C;  3OS5 A;  3OXF A;  3M56 A;  3OXL A;  3M59 A;  5AYF A;  4YPA A; 
#chains in the Genus database with same CATH topology
 4O30 A;  3TG5 A;  3M5A A;  4BUP A;  4IJD A;  4WUY A;  5LSX A;  3CBP A;  3S7F A;  2F69 A;  5CPR B;  1XQH A;  5F5E A;  4AU7 A;  3M53 A;  5JHN A;  5CCM A;  5ARF A;  4YND A;  5CCL A;  4LDG A;  3MO0 A;  3IHX A;  3MEK A;  3PDN A;  5JIY A;  3EP0 A;  5T0M A;  2RFI A;  3HNA A;  5KJL A;  3CBM A;  5ARG A;  5HQ8 A;  5KJN A;  3OXG A;  4E47 A;  3VUZ A;  3F9Z A;  3F9X A;  2JV0 A;  3RQ4 A;  2BQZ A;  4MI0 A;  4Z4P A;  3VV0 A;  3KMJ A;  3KMT A;  3S8P A;  5JIN A;  4JLG A;  4IJ8 A;  5TH7 A;  2IGQ A;  3F9Y A;  3DAL A;  4RZ0 A;  4MI5 A;  5F59 A;  3M57 A;  1PEG A;  2R3A A;  5TTF A;  2O8J A;  3SWC A;  3OOI A;  5T5G A;  3KMA A;  3MO5 A;  1N6C A;  1ML9 A;  3M58 A;  4NJ5 A;  5HI7 A;  5TEG A;  3QWV A;  4O6F A;  3BO5 A;  4YPE A;  2QPW A;  3K5K A;  5KJM A;  5LSZ A;  1MVX A;  4QEN A;  3MO2 A;  1ZKK A;  3M54 A;  1N6A A;  4QEO A;  3M55 A;  1MVH A;  4FMU A;  3RAY A;  3DB5 A;  4J8O A;  4YNM A;  1MT6 A;  3CBO A;  5F6L A;  3S7B A;  2G46 A;  1MUF A;  4H12 A;  1N3J A;  5JJ0 A;  2W5Z A;  4J7F A;  5T0K A;  5EX0 A;  4NVQ A;  4QEP A;  3QWW A;  3S7D A;  4YPU A;  3TG4 A;  4C1Q A;  1H3I A;  1O9S A;  3F9W A;  4JDS A;  4J7I A;  4J83 A;  5EG2 A;  4I51 A;  5EX3 A;  3RU0 A;  3OPE A;  3S7J A;  3SW9 A;  3FPD A;  5KJK A;  2W5Y A;  3RJW A;  3QWP A;  4YNP A;  3N71 A;  3RIB A;  5F6K C;  3OS5 A;  3OXF A;  3M56 A;  3OXL A;  3M59 A;  5AYF A;  4YPA A; 
#chains in the Genus database with same CATH homology
 4O30 A;  3TG5 A;  3M5A A;  4BUP A;  4IJD A;  4WUY A;  5LSX A;  3CBP A;  3S7F A;  2F69 A;  5CPR B;  1XQH A;  5F5E A;  4AU7 A;  3M53 A;  5JHN A;  5CCM A;  5ARF A;  4YND A;  5CCL A;  4LDG A;  3MO0 A;  3IHX A;  3MEK A;  3PDN A;  5JIY A;  3EP0 A;  5T0M A;  2RFI A;  3HNA A;  5KJL A;  3CBM A;  5ARG A;  5HQ8 A;  5KJN A;  3OXG A;  4E47 A;  3VUZ A;  3F9Z A;  3F9X A;  2JV0 A;  3RQ4 A;  2BQZ A;  4MI0 A;  4Z4P A;  3VV0 A;  3KMJ A;  3KMT A;  3S8P A;  5JIN A;  4JLG A;  4IJ8 A;  5TH7 A;  2IGQ A;  3F9Y A;  3DAL A;  4RZ0 A;  4MI5 A;  5F59 A;  3M57 A;  1PEG A;  2R3A A;  5TTF A;  2O8J A;  3SWC A;  3OOI A;  5T5G A;  3KMA A;  3MO5 A;  1N6C A;  1ML9 A;  3M58 A;  4NJ5 A;  5HI7 A;  5TEG A;  3QWV A;  4O6F A;  3BO5 A;  4YPE A;  2QPW A;  3K5K A;  5KJM A;  5LSZ A;  1MVX A;  4QEN A;  3MO2 A;  1ZKK A;  3M54 A;  1N6A A;  4QEO A;  3M55 A;  1MVH A;  4FMU A;  3RAY A;  3DB5 A;  4J8O A;  4YNM A;  1MT6 A;  3CBO A;  5F6L A;  3S7B A;  2G46 A;  1MUF A;  4H12 A;  1N3J A;  5JJ0 A;  2W5Z A;  4J7F A;  5T0K A;  5EX0 A;  4NVQ A;  4QEP A;  3QWW A;  3S7D A;  4YPU A;  3TG4 A;  4C1Q A;  1H3I A;  1O9S A;  3F9W A;  4JDS A;  4J7I A;  4J83 A;  5EG2 A;  4I51 A;  5EX3 A;  3RU0 A;  3OPE A;  3S7J A;  3SW9 A;  3FPD A;  5KJK A;  2W5Y A;  3RJW A;  3QWP A;  4YNP A;  3N71 A;  3RIB A;  5F6K C;  3OS5 A;  3OXF A;  3M56 A;  3OXL A;  3M59 A;  5AYF A;  4YPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...