1ZKKA

Crystal structure of hset8 in ternary complex with h4 peptide (16-24) and adohcy
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H4 lysine-20 specific
publication title Structural and functional analysis of SET8, a histone H4 Lys-20 methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1zkkA00
5AYFA 4AU7A 3M55A 4IJ8A 5LSZA 4JLGA 4H12A 3VV0A 3OXLA 4MI5A 3KMTA 3QWVA 4QEPA 1O9SA 5T0KA 3HNAA 3QWPA 5ARFA 3MO0A 5CCMA 3VUZA 3RQ4A 1ZKKA 1ML9A 3M59A 1MVXA 3CBOA 3N71A 4O6FA 5KJMA 3RAYA 3M57A 4YPEA 4YNPA 3OOIA 3DALA 3F9YA 5CCLA 3OS5A 4JDSA 2RFIA 4J83A 3KMJA 5HI7A 1MUFA 4NVQA 5ARGA 5CPRB 3RU0A 1N6CA 2F69A 1H3IA 2G46A 5TEGA 2W5YA 3S8PA 3TG5A 1PEGA 3CBMA 4I51A 3F9ZA 5T5GA 3OPEA 4QENA 3M56A 5F6KC 3M54A 3OXGA 3M58A 4LDGA 4O30A 3FPDA 3K5KA 3TG4A 4YNMA 4FMUA 5TH7A 2O8JA 5F5EA 4Z4PA 2BQZA 3KMAA 3DB5A 5HQ8A 3EP0A 4BUPA 4YPUA 5LSXA 3M53A 2QPWA 3F9WA 1XQHA 4MI0A 1N6AA 4IJDA 5KJLA 3MO2A 4RZ0A 4J7IA 4NJ5A 3IHXA 4WUYA 5EX0A 4E47A 3QWWA 4YPAA 3PDNA 3S7FA 3S7BA 1MT6A 5KJKA 3SWCA 4QEOA 3RIBA 1MVHA 5EX3A 2R3AA 4J8OA 5JIYA 5TTFA 5JINA 3OXFA 5EG2A 5F6LA 3SW9A 3F9XA 2W5ZA 5JHNA 4J7FA 3MEKA 3MO5A 4C1QA 2IGQA 5T0MA 3RJWA 3BO5A 5JJ0A 4YNDA 5F59A 2JV0A 3CBPA 3S7DA 3S7JA 3M5AA 1N3JA 5KJNA
chains in the Genus database with same CATH superfamily
5AYFA 4AU7A 3M55A 4IJ8A 5LSZA 4JLGA 4H12A 3VV0A 3OXLA 4MI5A 3KMTA 3QWVA 4QEPA 1O9SA 5T0KA 3HNAA 3QWPA 5ARFA 3MO0A 5CCMA 3VUZA 3RQ4A 1ZKKA 1ML9A 3M59A 1MVXA 3CBOA 3N71A 4O6FA 5KJMA 3RAYA 3M57A 4YPEA 4YNPA 3OOIA 3DALA 3F9YA 5CCLA 3OS5A 4JDSA 2RFIA 4J83A 3KMJA 5HI7A 1MUFA 4NVQA 5ARGA 5CPRB 3RU0A 1N6CA 2F69A 1H3IA 2G46A 5TEGA 2W5YA 3S8PA 3TG5A 1PEGA 3CBMA 4I51A 3F9ZA 5T5GA 3OPEA 4QENA 3M56A 5F6KC 3M54A 3OXGA 3M58A 4LDGA 4O30A 3FPDA 3K5KA 3TG4A 4YNMA 4FMUA 5TH7A 2O8JA 5F5EA 4Z4PA 2BQZA 3KMAA 3DB5A 5HQ8A 3EP0A 4BUPA 4YPUA 5LSXA 3M53A 2QPWA 3F9WA 1XQHA 4MI0A 1N6AA 4IJDA 5KJLA 3MO2A 4RZ0A 4J7IA 4NJ5A 3IHXA 4WUYA 5EX0A 4E47A 3QWWA 4YPAA 3PDNA 3S7FA 3S7BA 1MT6A 5KJKA 3SWCA 4QEOA 3RIBA 1MVHA 5EX3A 2R3AA 4J8OA 5JIYA 5TTFA 5JINA 3OXFA 5EG2A 5F6LA 3SW9A 3F9XA 2W5ZA 5JHNA 4J7FA 3MEKA 3MO5A 4C1QA 2IGQA 5T0MA 3RJWA 3BO5A 5JJ0A 4YNDA 5F59A 2JV0A 3CBPA 3S7DA 3S7JA 3M5AA 1N3JA 5KJNA
chains in the Genus database with same CATH topology
5AYFA 4AU7A 3M55A 4IJ8A 5LSZA 4JLGA 4H12A 3VV0A 3OXLA 4MI5A 3KMTA 3QWVA 4QEPA 1O9SA 5T0KA 3HNAA 3QWPA 5ARFA 3MO0A 5CCMA 3VUZA 3RQ4A 1ZKKA 1ML9A 3M59A 1MVXA 3CBOA 3N71A 4O6FA 5KJMA 3RAYA 3M57A 4YPEA 4YNPA 3OOIA 3DALA 3F9YA 5CCLA 3OS5A 4JDSA 2RFIA 4J83A 3KMJA 5HI7A 1MUFA 4NVQA 5ARGA 5CPRB 3RU0A 1N6CA 2F69A 1H3IA 2G46A 5TEGA 2W5YA 3S8PA 3TG5A 1PEGA 3CBMA 4I51A 3F9ZA 5T5GA 3OPEA 4QENA 3M56A 5F6KC 3M54A 3OXGA 3M58A 4LDGA 4O30A 3FPDA 3K5KA 3TG4A 4YNMA 4FMUA 5TH7A 2O8JA 5F5EA 4Z4PA 2BQZA 3KMAA 3DB5A 5HQ8A 3EP0A 4BUPA 4YPUA 5LSXA 3M53A 2QPWA 3F9WA 1XQHA 4MI0A 1N6AA 4IJDA 5KJLA 3MO2A 4RZ0A 4J7IA 4NJ5A 3IHXA 4WUYA 5EX0A 4E47A 3QWWA 4YPAA 3PDNA 3S7FA 3S7BA 1MT6A 5KJKA 3SWCA 4QEOA 3RIBA 1MVHA 5EX3A 2R3AA 4J8OA 5JIYA 5TTFA 5JINA 3OXFA 5EG2A 5F6LA 3SW9A 3F9XA 2W5ZA 5JHNA 4J7FA 3MEKA 3MO5A 4C1QA 2IGQA 5T0MA 3RJWA 3BO5A 5JJ0A 4YNDA 5F59A 2JV0A 3CBPA 3S7DA 3S7JA 3M5AA 1N3JA 5KJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYF A;  4AU7 A;  3M55 A;  4IJ8 A;  5LSZ A;  4JLG A;  4H12 A;  3VV0 A;  3OXL A;  4MI5 A;  3KMT A;  3QWV A;  4QEP A;  1O9S A;  5T0K A;  3HNA A;  3QWP A;  5ARF A;  3MO0 A;  5CCM A;  3VUZ A;  3RQ4 A;  1ZKK A;  1ML9 A;  3M59 A;  1MVX A;  3CBO A;  3N71 A;  4O6F A;  5KJM A;  3RAY A;  3M57 A;  4YPE A;  4YNP A;  3OOI A;  3DAL A;  3F9Y A;  5CCL A;  3OS5 A;  4JDS A;  2RFI A;  4J83 A;  3KMJ A;  5HI7 A;  1MUF A;  4NVQ A;  5ARG A;  5CPR B;  3RU0 A;  1N6C A;  2F69 A;  1H3I A;  2G46 A;  5TEG A;  2W5Y A;  3S8P A;  3TG5 A;  1PEG A;  3CBM A;  4I51 A;  3F9Z A;  5T5G A;  3OPE A;  4QEN A;  3M56 A;  5F6K C;  3M54 A;  3OXG A;  3M58 A;  4LDG A;  4O30 A;  3FPD A;  3K5K A;  3TG4 A;  4YNM A;  4FMU A;  5TH7 A;  2O8J A;  5F5E A;  4Z4P A;  2BQZ A;  3KMA A;  3DB5 A;  5HQ8 A;  3EP0 A;  4BUP A;  4YPU A;  5LSX A;  3M53 A;  2QPW A;  3F9W A;  1XQH A;  4MI0 A;  1N6A A;  4IJD A;  5KJL A;  3MO2 A;  4RZ0 A;  4J7I A;  4NJ5 A;  3IHX A;  4WUY A;  5EX0 A;  4E47 A;  3QWW A;  4YPA A;  3PDN A;  3S7F A;  3S7B A;  1MT6 A;  5KJK A;  3SWC A;  4QEO A;  3RIB A;  1MVH A;  5EX3 A;  2R3A A;  4J8O A;  5JIY A;  5TTF A;  5JIN A;  3OXF A;  5EG2 A;  5F6L A;  3SW9 A;  3F9X A;  2W5Z A;  5JHN A;  4J7F A;  3MEK A;  3MO5 A;  4C1Q A;  2IGQ A;  5T0M A;  3RJW A;  3BO5 A;  5JJ0 A;  4YND A;  5F59 A;  2JV0 A;  3CBP A;  3S7D A;  3S7J A;  3M5A A;  1N3J A;  5KJN A; 
#chains in the Genus database with same CATH topology
 5AYF A;  4AU7 A;  3M55 A;  4IJ8 A;  5LSZ A;  4JLG A;  4H12 A;  3VV0 A;  3OXL A;  4MI5 A;  3KMT A;  3QWV A;  4QEP A;  1O9S A;  5T0K A;  3HNA A;  3QWP A;  5ARF A;  3MO0 A;  5CCM A;  3VUZ A;  3RQ4 A;  1ZKK A;  1ML9 A;  3M59 A;  1MVX A;  3CBO A;  3N71 A;  4O6F A;  5KJM A;  3RAY A;  3M57 A;  4YPE A;  4YNP A;  3OOI A;  3DAL A;  3F9Y A;  5CCL A;  3OS5 A;  4JDS A;  2RFI A;  4J83 A;  3KMJ A;  5HI7 A;  1MUF A;  4NVQ A;  5ARG A;  5CPR B;  3RU0 A;  1N6C A;  2F69 A;  1H3I A;  2G46 A;  5TEG A;  2W5Y A;  3S8P A;  3TG5 A;  1PEG A;  3CBM A;  4I51 A;  3F9Z A;  5T5G A;  3OPE A;  4QEN A;  3M56 A;  5F6K C;  3M54 A;  3OXG A;  3M58 A;  4LDG A;  4O30 A;  3FPD A;  3K5K A;  3TG4 A;  4YNM A;  4FMU A;  5TH7 A;  2O8J A;  5F5E A;  4Z4P A;  2BQZ A;  3KMA A;  3DB5 A;  5HQ8 A;  3EP0 A;  4BUP A;  4YPU A;  5LSX A;  3M53 A;  2QPW A;  3F9W A;  1XQH A;  4MI0 A;  1N6A A;  4IJD A;  5KJL A;  3MO2 A;  4RZ0 A;  4J7I A;  4NJ5 A;  3IHX A;  4WUY A;  5EX0 A;  4E47 A;  3QWW A;  4YPA A;  3PDN A;  3S7F A;  3S7B A;  1MT6 A;  5KJK A;  3SWC A;  4QEO A;  3RIB A;  1MVH A;  5EX3 A;  2R3A A;  4J8O A;  5JIY A;  5TTF A;  5JIN A;  3OXF A;  5EG2 A;  5F6L A;  3SW9 A;  3F9X A;  2W5Z A;  5JHN A;  4J7F A;  3MEK A;  3MO5 A;  4C1Q A;  2IGQ A;  5T0M A;  3RJW A;  3BO5 A;  5JJ0 A;  4YND A;  5F59 A;  2JV0 A;  3CBP A;  3S7D A;  3S7J A;  3M5A A;  1N3J A;  5KJN A; 
#chains in the Genus database with same CATH homology
 5AYF A;  4AU7 A;  3M55 A;  4IJ8 A;  5LSZ A;  4JLG A;  4H12 A;  3VV0 A;  3OXL A;  4MI5 A;  3KMT A;  3QWV A;  4QEP A;  1O9S A;  5T0K A;  3HNA A;  3QWP A;  5ARF A;  3MO0 A;  5CCM A;  3VUZ A;  3RQ4 A;  1ZKK A;  1ML9 A;  3M59 A;  1MVX A;  3CBO A;  3N71 A;  4O6F A;  5KJM A;  3RAY A;  3M57 A;  4YPE A;  4YNP A;  3OOI A;  3DAL A;  3F9Y A;  5CCL A;  3OS5 A;  4JDS A;  2RFI A;  4J83 A;  3KMJ A;  5HI7 A;  1MUF A;  4NVQ A;  5ARG A;  5CPR B;  3RU0 A;  1N6C A;  2F69 A;  1H3I A;  2G46 A;  5TEG A;  2W5Y A;  3S8P A;  3TG5 A;  1PEG A;  3CBM A;  4I51 A;  3F9Z A;  5T5G A;  3OPE A;  4QEN A;  3M56 A;  5F6K C;  3M54 A;  3OXG A;  3M58 A;  4LDG A;  4O30 A;  3FPD A;  3K5K A;  3TG4 A;  4YNM A;  4FMU A;  5TH7 A;  2O8J A;  5F5E A;  4Z4P A;  2BQZ A;  3KMA A;  3DB5 A;  5HQ8 A;  3EP0 A;  4BUP A;  4YPU A;  5LSX A;  3M53 A;  2QPW A;  3F9W A;  1XQH A;  4MI0 A;  1N6A A;  4IJD A;  5KJL A;  3MO2 A;  4RZ0 A;  4J7I A;  4NJ5 A;  3IHX A;  4WUY A;  5EX0 A;  4E47 A;  3QWW A;  4YPA A;  3PDN A;  3S7F A;  3S7B A;  1MT6 A;  5KJK A;  3SWC A;  4QEO A;  3RIB A;  1MVH A;  5EX3 A;  2R3A A;  4J8O A;  5JIY A;  5TTF A;  5JIN A;  3OXF A;  5EG2 A;  5F6L A;  3SW9 A;  3F9X A;  2W5Z A;  5JHN A;  4J7F A;  3MEK A;  3MO5 A;  4C1Q A;  2IGQ A;  5T0M A;  3RJW A;  3BO5 A;  5JJ0 A;  4YND A;  5F59 A;  2JV0 A;  3CBP A;  3S7D A;  3S7J A;  3M5A A;  1N3J A;  5KJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...