5LSXA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
246
structure length
231
Chain Sequence
b'GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQREAQKCFCGSANCRGYLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
molecule tags Transferase
source organism Homo sapiens
publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
total genus 53
structure length 231
sequence length 246
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lsxA00
3KMAA 4O30A 5EX3A 2RFIA 4WUYA 4O6FA 4QENA 3DALA 1XQHA 3MO5A 3KMJA 3S7JA 1H3IA 5KJKA 2QPWA 4J83A 1MVXA 1MT6A 5F5EA 5CPRB 5F6LA 5CCMA 5AYFA 5ARGA 3VV0A 5LSXA 4LDGA 3RQ4A 5ARFA 3N71A 2BQZA 1N6CA 3DB5A 4JDSA 4E47A 3M57A 4MI5A 5HQ8A 5JHNA 3MO2A 3S7FA 1O9SA 4YPEA 5TTFA 3IHXA 5T0MA 4AU7A 4QEOA 4YPAA 5T0KA 3RJWA 4IJ8A 3S8PA 3QWVA 3TG4A 1N6AA 3F9YA 3K5KA 3SW9A 4YPUA 2W5ZA 1MUFA 4Z4PA 3TG5A 3M58A 3RAYA 3OXFA 3OXLA 5TEGA 3QWPA 4J7IA 4J7FA 4MI0A 4YNDA 5KJLA 1ML9A 2F69A 3RU0A 1N3JA 4YNPA 3F9ZA 4FMUA 2G46A 3OS5A 3MEKA 3PDNA 3EP0A 3F9WA 3M54A 5JINA 4QEPA 2W5YA 5HI7A 3QWWA 2IGQA 5EG2A 4NJ5A 3S7DA 5KJMA 5T5GA 3M5AA 5JJ0A 3M59A 4RZ0A 4NVQA 1PEGA 2JV0A 3OOIA 4BUPA 2O8JA 4H12A 4J8OA 3BO5A 3FPDA 4IJDA 5KJNA 3CBOA 3CBPA 5TH7A 3RIBA 3S7BA 3MO0A 3F9XA 3KMTA 3OXGA 3M53A 3SWCA 1ZKKA 5CCLA 4JLGA 4I51A 5LSZA 3M55A 4YNMA 5F59A 3VUZA 3CBMA 3OPEA 5F6KC 4C1QA 3HNAA 5JIYA 3M56A 1MVHA 5EX0A 2R3AA
chains in the Genus database with same CATH superfamily
3KMAA 4O30A 5EX3A 2RFIA 4WUYA 4O6FA 4QENA 3DALA 1XQHA 3MO5A 3KMJA 3S7JA 1H3IA 5KJKA 2QPWA 4J83A 1MVXA 1MT6A 5F5EA 5CPRB 5F6LA 5CCMA 5AYFA 5ARGA 3VV0A 5LSXA 4LDGA 3RQ4A 5ARFA 3N71A 2BQZA 1N6CA 3DB5A 4JDSA 4E47A 3M57A 4MI5A 5HQ8A 5JHNA 3MO2A 3S7FA 1O9SA 4YPEA 5TTFA 3IHXA 5T0MA 4AU7A 4QEOA 4YPAA 5T0KA 3RJWA 4IJ8A 3S8PA 3QWVA 3TG4A 1N6AA 3F9YA 3K5KA 3SW9A 4YPUA 2W5ZA 1MUFA 4Z4PA 3TG5A 3M58A 3RAYA 3OXFA 3OXLA 5TEGA 3QWPA 4J7IA 4J7FA 4MI0A 4YNDA 5KJLA 1ML9A 2F69A 3RU0A 1N3JA 4YNPA 3F9ZA 4FMUA 2G46A 3OS5A 3MEKA 3PDNA 3EP0A 3F9WA 3M54A 5JINA 4QEPA 2W5YA 5HI7A 3QWWA 2IGQA 5EG2A 4NJ5A 3S7DA 5KJMA 5T5GA 3M5AA 5JJ0A 3M59A 4RZ0A 4NVQA 1PEGA 2JV0A 3OOIA 4BUPA 2O8JA 4H12A 4J8OA 3BO5A 3FPDA 4IJDA 5KJNA 3CBOA 3CBPA 5TH7A 3RIBA 3S7BA 3MO0A 3F9XA 3KMTA 3OXGA 3M53A 3SWCA 1ZKKA 5CCLA 4JLGA 4I51A 5LSZA 3M55A 4YNMA 5F59A 3VUZA 3CBMA 3OPEA 5F6KC 4C1QA 3HNAA 5JIYA 3M56A 1MVHA 5EX0A 2R3AA
chains in the Genus database with same CATH topology
3KMAA 4O30A 5EX3A 2RFIA 4WUYA 4O6FA 4QENA 3DALA 1XQHA 3MO5A 3KMJA 3S7JA 1H3IA 5KJKA 2QPWA 4J83A 1MVXA 1MT6A 5F5EA 5CPRB 5F6LA 5CCMA 5AYFA 5ARGA 3VV0A 5LSXA 4LDGA 3RQ4A 5ARFA 3N71A 2BQZA 1N6CA 3DB5A 4JDSA 4E47A 3M57A 4MI5A 5HQ8A 5JHNA 3MO2A 3S7FA 1O9SA 4YPEA 5TTFA 3IHXA 5T0MA 4AU7A 4QEOA 4YPAA 5T0KA 3RJWA 4IJ8A 3S8PA 3QWVA 3TG4A 1N6AA 3F9YA 3K5KA 3SW9A 4YPUA 2W5ZA 1MUFA 4Z4PA 3TG5A 3M58A 3RAYA 3OXFA 3OXLA 5TEGA 3QWPA 4J7IA 4J7FA 4MI0A 4YNDA 5KJLA 1ML9A 2F69A 3RU0A 1N3JA 4YNPA 3F9ZA 4FMUA 2G46A 3OS5A 3MEKA 3PDNA 3EP0A 3F9WA 3M54A 5JINA 4QEPA 2W5YA 5HI7A 3QWWA 2IGQA 5EG2A 4NJ5A 3S7DA 5KJMA 5T5GA 3M5AA 5JJ0A 3M59A 4RZ0A 4NVQA 1PEGA 2JV0A 3OOIA 4BUPA 2O8JA 4H12A 4J8OA 3BO5A 3FPDA 4IJDA 5KJNA 3CBOA 3CBPA 5TH7A 3RIBA 3S7BA 3MO0A 3F9XA 3KMTA 3OXGA 3M53A 3SWCA 1ZKKA 5CCLA 4JLGA 4I51A 5LSZA 3M55A 4YNMA 5F59A 3VUZA 3CBMA 3OPEA 5F6KC 4C1QA 3HNAA 5JIYA 3M56A 1MVHA 5EX0A 2R3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KMA A;  4O30 A;  5EX3 A;  2RFI A;  4WUY A;  4O6F A;  4QEN A;  3DAL A;  1XQH A;  3MO5 A;  3KMJ A;  3S7J A;  1H3I A;  5KJK A;  2QPW A;  4J83 A;  1MVX A;  1MT6 A;  5F5E A;  5CPR B;  5F6L A;  5CCM A;  5AYF A;  5ARG A;  3VV0 A;  5LSX A;  4LDG A;  3RQ4 A;  5ARF A;  3N71 A;  2BQZ A;  1N6C A;  3DB5 A;  4JDS A;  4E47 A;  3M57 A;  4MI5 A;  5HQ8 A;  5JHN A;  3MO2 A;  3S7F A;  1O9S A;  4YPE A;  5TTF A;  3IHX A;  5T0M A;  4AU7 A;  4QEO A;  4YPA A;  5T0K A;  3RJW A;  4IJ8 A;  3S8P A;  3QWV A;  3TG4 A;  1N6A A;  3F9Y A;  3K5K A;  3SW9 A;  4YPU A;  2W5Z A;  1MUF A;  4Z4P A;  3TG5 A;  3M58 A;  3RAY A;  3OXF A;  3OXL A;  5TEG A;  3QWP A;  4J7I A;  4J7F A;  4MI0 A;  4YND A;  5KJL A;  1ML9 A;  2F69 A;  3RU0 A;  1N3J A;  4YNP A;  3F9Z A;  4FMU A;  2G46 A;  3OS5 A;  3MEK A;  3PDN A;  3EP0 A;  3F9W A;  3M54 A;  5JIN A;  4QEP A;  2W5Y A;  5HI7 A;  3QWW A;  2IGQ A;  5EG2 A;  4NJ5 A;  3S7D A;  5KJM A;  5T5G A;  3M5A A;  5JJ0 A;  3M59 A;  4RZ0 A;  4NVQ A;  1PEG A;  2JV0 A;  3OOI A;  4BUP A;  2O8J A;  4H12 A;  4J8O A;  3BO5 A;  3FPD A;  4IJD A;  5KJN A;  3CBO A;  3CBP A;  5TH7 A;  3RIB A;  3S7B A;  3MO0 A;  3F9X A;  3KMT A;  3OXG A;  3M53 A;  3SWC A;  1ZKK A;  5CCL A;  4JLG A;  4I51 A;  5LSZ A;  3M55 A;  4YNM A;  5F59 A;  3VUZ A;  3CBM A;  3OPE A;  5F6K C;  4C1Q A;  3HNA A;  5JIY A;  3M56 A;  1MVH A;  5EX0 A;  2R3A A; 
#chains in the Genus database with same CATH topology
 3KMA A;  4O30 A;  5EX3 A;  2RFI A;  4WUY A;  4O6F A;  4QEN A;  3DAL A;  1XQH A;  3MO5 A;  3KMJ A;  3S7J A;  1H3I A;  5KJK A;  2QPW A;  4J83 A;  1MVX A;  1MT6 A;  5F5E A;  5CPR B;  5F6L A;  5CCM A;  5AYF A;  5ARG A;  3VV0 A;  5LSX A;  4LDG A;  3RQ4 A;  5ARF A;  3N71 A;  2BQZ A;  1N6C A;  3DB5 A;  4JDS A;  4E47 A;  3M57 A;  4MI5 A;  5HQ8 A;  5JHN A;  3MO2 A;  3S7F A;  1O9S A;  4YPE A;  5TTF A;  3IHX A;  5T0M A;  4AU7 A;  4QEO A;  4YPA A;  5T0K A;  3RJW A;  4IJ8 A;  3S8P A;  3QWV A;  3TG4 A;  1N6A A;  3F9Y A;  3K5K A;  3SW9 A;  4YPU A;  2W5Z A;  1MUF A;  4Z4P A;  3TG5 A;  3M58 A;  3RAY A;  3OXF A;  3OXL A;  5TEG A;  3QWP A;  4J7I A;  4J7F A;  4MI0 A;  4YND A;  5KJL A;  1ML9 A;  2F69 A;  3RU0 A;  1N3J A;  4YNP A;  3F9Z A;  4FMU A;  2G46 A;  3OS5 A;  3MEK A;  3PDN A;  3EP0 A;  3F9W A;  3M54 A;  5JIN A;  4QEP A;  2W5Y A;  5HI7 A;  3QWW A;  2IGQ A;  5EG2 A;  4NJ5 A;  3S7D A;  5KJM A;  5T5G A;  3M5A A;  5JJ0 A;  3M59 A;  4RZ0 A;  4NVQ A;  1PEG A;  2JV0 A;  3OOI A;  4BUP A;  2O8J A;  4H12 A;  4J8O A;  3BO5 A;  3FPD A;  4IJD A;  5KJN A;  3CBO A;  3CBP A;  5TH7 A;  3RIB A;  3S7B A;  3MO0 A;  3F9X A;  3KMT A;  3OXG A;  3M53 A;  3SWC A;  1ZKK A;  5CCL A;  4JLG A;  4I51 A;  5LSZ A;  3M55 A;  4YNM A;  5F59 A;  3VUZ A;  3CBM A;  3OPE A;  5F6K C;  4C1Q A;  3HNA A;  5JIY A;  3M56 A;  1MVH A;  5EX0 A;  2R3A A; 
#chains in the Genus database with same CATH homology
 3KMA A;  4O30 A;  5EX3 A;  2RFI A;  4WUY A;  4O6F A;  4QEN A;  3DAL A;  1XQH A;  3MO5 A;  3KMJ A;  3S7J A;  1H3I A;  5KJK A;  2QPW A;  4J83 A;  1MVX A;  1MT6 A;  5F5E A;  5CPR B;  5F6L A;  5CCM A;  5AYF A;  5ARG A;  3VV0 A;  5LSX A;  4LDG A;  3RQ4 A;  5ARF A;  3N71 A;  2BQZ A;  1N6C A;  3DB5 A;  4JDS A;  4E47 A;  3M57 A;  4MI5 A;  5HQ8 A;  5JHN A;  3MO2 A;  3S7F A;  1O9S A;  4YPE A;  5TTF A;  3IHX A;  5T0M A;  4AU7 A;  4QEO A;  4YPA A;  5T0K A;  3RJW A;  4IJ8 A;  3S8P A;  3QWV A;  3TG4 A;  1N6A A;  3F9Y A;  3K5K A;  3SW9 A;  4YPU A;  2W5Z A;  1MUF A;  4Z4P A;  3TG5 A;  3M58 A;  3RAY A;  3OXF A;  3OXL A;  5TEG A;  3QWP A;  4J7I A;  4J7F A;  4MI0 A;  4YND A;  5KJL A;  1ML9 A;  2F69 A;  3RU0 A;  1N3J A;  4YNP A;  3F9Z A;  4FMU A;  2G46 A;  3OS5 A;  3MEK A;  3PDN A;  3EP0 A;  3F9W A;  3M54 A;  5JIN A;  4QEP A;  2W5Y A;  5HI7 A;  3QWW A;  2IGQ A;  5EG2 A;  4NJ5 A;  3S7D A;  5KJM A;  5T5G A;  3M5A A;  5JJ0 A;  3M59 A;  4RZ0 A;  4NVQ A;  1PEG A;  2JV0 A;  3OOI A;  4BUP A;  2O8J A;  4H12 A;  4J8O A;  3BO5 A;  3FPD A;  4IJD A;  5KJN A;  3CBO A;  3CBP A;  5TH7 A;  3RIB A;  3S7B A;  3MO0 A;  3F9X A;  3KMT A;  3OXG A;  3M53 A;  3SWC A;  1ZKK A;  5CCL A;  4JLG A;  4I51 A;  5LSZ A;  3M55 A;  4YNM A;  5F59 A;  3VUZ A;  3CBM A;  3OPE A;  5F6K C;  4C1Q A;  3HNA A;  5JIY A;  3M56 A;  1MVH A;  5EX0 A;  2R3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...