5LSXA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
246
structure length
231
Chain Sequence
GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQREAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 231
sequence length 246
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lsxA00
3QWPA 3KMTA 5CPRB 3M58A 5JJ0A 4IJ8A 3N71A 3M59A 2W5ZA 4YNPA 4H12A 3KMJA 4YPUA 5LSXA 4NJ5A 5CCMA 3M55A 2W5YA 1N6CA 5LSZA 1PEGA 2IGQA 5EX0A 3S7DA 5JIYA 4WUYA 4YNMA 5F5EA 3F9XA 3MO2A 3OXFA 5TTFA 4LDGA 3S8PA 3RAYA 3QWWA 1N3JA 3FPDA 3TG4A 5ARFA 2BQZA 4BUPA 5EX3A 3DB5A 4JLGA 4QEPA 4J83A 3M56A 4NVQA 4YNDA 4Z4PA 3DALA 2JV0A 5TEGA 3S7BA 5T0MA 5JINA 4J7IA 2QPWA 3F9YA 3IHXA 4QEOA 3M54A 2R3AA 3HNAA 5KJLA 4FMUA 5HQ8A 3MEKA 4JDSA 1MT6A 2G46A 5T0KA 5KJNA 5CCLA 3CBPA 2F69A 3EP0A 4C1QA 3TG5A 5EG2A 3M5AA 3MO5A 3RQ4A 5AYFA 4O30A 1ZKKA 3M57A 4MI0A 4RZ0A 1XQHA 5JHNA 3SWCA 4IJDA 3OXLA 5ARGA 3QWVA 4O6FA 1ML9A 4YPAA 4I51A 4MI5A 3K5KA 3CBOA 4AU7A 2RFIA 2O8JA 5KJKA 3RU0A 3S7JA 3CBMA 5T5GA 3OPEA 5F6LA 3OXGA 3OS5A 4YPEA 3S7FA 5F59A 1MUFA 5KJMA 4J8OA 3RIBA 1N6AA 4QENA 5F6KC 1MVHA 5HI7A 3KMAA 3VV0A 3OOIA 1H3IA 3F9ZA 3F9WA 3BO5A 3RJWA 4J7FA 3PDNA 5TH7A 3VUZA 1O9SA 3M53A 4E47A 3SW9A 1MVXA 3MO0A
chains in the Genus database with same CATH superfamily
3QWPA 3KMTA 5CPRB 3M58A 5JJ0A 4IJ8A 3N71A 3M59A 2W5ZA 4YNPA 4H12A 3KMJA 4YPUA 5LSXA 4NJ5A 5CCMA 3M55A 2W5YA 1N6CA 5LSZA 1PEGA 2IGQA 5EX0A 3S7DA 5JIYA 4WUYA 4YNMA 5F5EA 3F9XA 3MO2A 3OXFA 5TTFA 4LDGA 3S8PA 3RAYA 3QWWA 1N3JA 3FPDA 3TG4A 5ARFA 2BQZA 4BUPA 5EX3A 3DB5A 4JLGA 4QEPA 4J83A 3M56A 4NVQA 4YNDA 4Z4PA 3DALA 2JV0A 5TEGA 3S7BA 5T0MA 5JINA 4J7IA 2QPWA 3F9YA 3IHXA 4QEOA 3M54A 2R3AA 3HNAA 5KJLA 4FMUA 5HQ8A 3MEKA 4JDSA 1MT6A 2G46A 5T0KA 5KJNA 5CCLA 3CBPA 2F69A 3EP0A 4C1QA 3TG5A 5EG2A 3M5AA 3MO5A 3RQ4A 5AYFA 4O30A 1ZKKA 3M57A 4MI0A 4RZ0A 1XQHA 5JHNA 3SWCA 4IJDA 3OXLA 5ARGA 3QWVA 4O6FA 1ML9A 4YPAA 4I51A 4MI5A 3K5KA 3CBOA 4AU7A 2RFIA 2O8JA 5KJKA 3RU0A 3S7JA 3CBMA 5T5GA 3OPEA 5F6LA 3OXGA 3OS5A 4YPEA 3S7FA 5F59A 1MUFA 5KJMA 4J8OA 3RIBA 1N6AA 4QENA 5F6KC 1MVHA 5HI7A 3KMAA 3VV0A 3OOIA 1H3IA 3F9ZA 3F9WA 3BO5A 3RJWA 4J7FA 3PDNA 5TH7A 3VUZA 1O9SA 3M53A 4E47A 3SW9A 1MVXA 3MO0A
chains in the Genus database with same CATH topology
3QWPA 3KMTA 5CPRB 3M58A 5JJ0A 4IJ8A 3N71A 3M59A 2W5ZA 4YNPA 4H12A 3KMJA 4YPUA 5LSXA 4NJ5A 5CCMA 3M55A 2W5YA 1N6CA 5LSZA 1PEGA 2IGQA 5EX0A 3S7DA 5JIYA 4WUYA 4YNMA 5F5EA 3F9XA 3MO2A 3OXFA 5TTFA 4LDGA 3S8PA 3RAYA 3QWWA 1N3JA 3FPDA 3TG4A 5ARFA 2BQZA 4BUPA 5EX3A 3DB5A 4JLGA 4QEPA 4J83A 3M56A 4NVQA 4YNDA 4Z4PA 3DALA 2JV0A 5TEGA 3S7BA 5T0MA 5JINA 4J7IA 2QPWA 3F9YA 3IHXA 4QEOA 3M54A 2R3AA 3HNAA 5KJLA 4FMUA 5HQ8A 3MEKA 4JDSA 1MT6A 2G46A 5T0KA 5KJNA 5CCLA 3CBPA 2F69A 3EP0A 4C1QA 3TG5A 5EG2A 3M5AA 3MO5A 3RQ4A 5AYFA 4O30A 1ZKKA 3M57A 4MI0A 4RZ0A 1XQHA 5JHNA 3SWCA 4IJDA 3OXLA 5ARGA 3QWVA 4O6FA 1ML9A 4YPAA 4I51A 4MI5A 3K5KA 3CBOA 4AU7A 2RFIA 2O8JA 5KJKA 3RU0A 3S7JA 3CBMA 5T5GA 3OPEA 5F6LA 3OXGA 3OS5A 4YPEA 3S7FA 5F59A 1MUFA 5KJMA 4J8OA 3RIBA 1N6AA 4QENA 5F6KC 1MVHA 5HI7A 3KMAA 3VV0A 3OOIA 1H3IA 3F9ZA 3F9WA 3BO5A 3RJWA 4J7FA 3PDNA 5TH7A 3VUZA 1O9SA 3M53A 4E47A 3SW9A 1MVXA 3MO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWP A;  3KMT A;  5CPR B;  3M58 A;  5JJ0 A;  4IJ8 A;  3N71 A;  3M59 A;  2W5Z A;  4YNP A;  4H12 A;  3KMJ A;  4YPU A;  5LSX A;  4NJ5 A;  5CCM A;  3M55 A;  2W5Y A;  1N6C A;  5LSZ A;  1PEG A;  2IGQ A;  5EX0 A;  3S7D A;  5JIY A;  4WUY A;  4YNM A;  5F5E A;  3F9X A;  3MO2 A;  3OXF A;  5TTF A;  4LDG A;  3S8P A;  3RAY A;  3QWW A;  1N3J A;  3FPD A;  3TG4 A;  5ARF A;  2BQZ A;  4BUP A;  5EX3 A;  3DB5 A;  4JLG A;  4QEP A;  4J83 A;  3M56 A;  4NVQ A;  4YND A;  4Z4P A;  3DAL A;  2JV0 A;  5TEG A;  3S7B A;  5T0M A;  5JIN A;  4J7I A;  2QPW A;  3F9Y A;  3IHX A;  4QEO A;  3M54 A;  2R3A A;  3HNA A;  5KJL A;  4FMU A;  5HQ8 A;  3MEK A;  4JDS A;  1MT6 A;  2G46 A;  5T0K A;  5KJN A;  5CCL A;  3CBP A;  2F69 A;  3EP0 A;  4C1Q A;  3TG5 A;  5EG2 A;  3M5A A;  3MO5 A;  3RQ4 A;  5AYF A;  4O30 A;  1ZKK A;  3M57 A;  4MI0 A;  4RZ0 A;  1XQH A;  5JHN A;  3SWC A;  4IJD A;  3OXL A;  5ARG A;  3QWV A;  4O6F A;  1ML9 A;  4YPA A;  4I51 A;  4MI5 A;  3K5K A;  3CBO A;  4AU7 A;  2RFI A;  2O8J A;  5KJK A;  3RU0 A;  3S7J A;  3CBM A;  5T5G A;  3OPE A;  5F6L A;  3OXG A;  3OS5 A;  4YPE A;  3S7F A;  5F59 A;  1MUF A;  5KJM A;  4J8O A;  3RIB A;  1N6A A;  4QEN A;  5F6K C;  1MVH A;  5HI7 A;  3KMA A;  3VV0 A;  3OOI A;  1H3I A;  3F9Z A;  3F9W A;  3BO5 A;  3RJW A;  4J7F A;  3PDN A;  5TH7 A;  3VUZ A;  1O9S A;  3M53 A;  4E47 A;  3SW9 A;  1MVX A;  3MO0 A; 
#chains in the Genus database with same CATH topology
 3QWP A;  3KMT A;  5CPR B;  3M58 A;  5JJ0 A;  4IJ8 A;  3N71 A;  3M59 A;  2W5Z A;  4YNP A;  4H12 A;  3KMJ A;  4YPU A;  5LSX A;  4NJ5 A;  5CCM A;  3M55 A;  2W5Y A;  1N6C A;  5LSZ A;  1PEG A;  2IGQ A;  5EX0 A;  3S7D A;  5JIY A;  4WUY A;  4YNM A;  5F5E A;  3F9X A;  3MO2 A;  3OXF A;  5TTF A;  4LDG A;  3S8P A;  3RAY A;  3QWW A;  1N3J A;  3FPD A;  3TG4 A;  5ARF A;  2BQZ A;  4BUP A;  5EX3 A;  3DB5 A;  4JLG A;  4QEP A;  4J83 A;  3M56 A;  4NVQ A;  4YND A;  4Z4P A;  3DAL A;  2JV0 A;  5TEG A;  3S7B A;  5T0M A;  5JIN A;  4J7I A;  2QPW A;  3F9Y A;  3IHX A;  4QEO A;  3M54 A;  2R3A A;  3HNA A;  5KJL A;  4FMU A;  5HQ8 A;  3MEK A;  4JDS A;  1MT6 A;  2G46 A;  5T0K A;  5KJN A;  5CCL A;  3CBP A;  2F69 A;  3EP0 A;  4C1Q A;  3TG5 A;  5EG2 A;  3M5A A;  3MO5 A;  3RQ4 A;  5AYF A;  4O30 A;  1ZKK A;  3M57 A;  4MI0 A;  4RZ0 A;  1XQH A;  5JHN A;  3SWC A;  4IJD A;  3OXL A;  5ARG A;  3QWV A;  4O6F A;  1ML9 A;  4YPA A;  4I51 A;  4MI5 A;  3K5K A;  3CBO A;  4AU7 A;  2RFI A;  2O8J A;  5KJK A;  3RU0 A;  3S7J A;  3CBM A;  5T5G A;  3OPE A;  5F6L A;  3OXG A;  3OS5 A;  4YPE A;  3S7F A;  5F59 A;  1MUF A;  5KJM A;  4J8O A;  3RIB A;  1N6A A;  4QEN A;  5F6K C;  1MVH A;  5HI7 A;  3KMA A;  3VV0 A;  3OOI A;  1H3I A;  3F9Z A;  3F9W A;  3BO5 A;  3RJW A;  4J7F A;  3PDN A;  5TH7 A;  3VUZ A;  1O9S A;  3M53 A;  4E47 A;  3SW9 A;  1MVX A;  3MO0 A; 
#chains in the Genus database with same CATH homology
 3QWP A;  3KMT A;  5CPR B;  3M58 A;  5JJ0 A;  4IJ8 A;  3N71 A;  3M59 A;  2W5Z A;  4YNP A;  4H12 A;  3KMJ A;  4YPU A;  5LSX A;  4NJ5 A;  5CCM A;  3M55 A;  2W5Y A;  1N6C A;  5LSZ A;  1PEG A;  2IGQ A;  5EX0 A;  3S7D A;  5JIY A;  4WUY A;  4YNM A;  5F5E A;  3F9X A;  3MO2 A;  3OXF A;  5TTF A;  4LDG A;  3S8P A;  3RAY A;  3QWW A;  1N3J A;  3FPD A;  3TG4 A;  5ARF A;  2BQZ A;  4BUP A;  5EX3 A;  3DB5 A;  4JLG A;  4QEP A;  4J83 A;  3M56 A;  4NVQ A;  4YND A;  4Z4P A;  3DAL A;  2JV0 A;  5TEG A;  3S7B A;  5T0M A;  5JIN A;  4J7I A;  2QPW A;  3F9Y A;  3IHX A;  4QEO A;  3M54 A;  2R3A A;  3HNA A;  5KJL A;  4FMU A;  5HQ8 A;  3MEK A;  4JDS A;  1MT6 A;  2G46 A;  5T0K A;  5KJN A;  5CCL A;  3CBP A;  2F69 A;  3EP0 A;  4C1Q A;  3TG5 A;  5EG2 A;  3M5A A;  3MO5 A;  3RQ4 A;  5AYF A;  4O30 A;  1ZKK A;  3M57 A;  4MI0 A;  4RZ0 A;  1XQH A;  5JHN A;  3SWC A;  4IJD A;  3OXL A;  5ARG A;  3QWV A;  4O6F A;  1ML9 A;  4YPA A;  4I51 A;  4MI5 A;  3K5K A;  3CBO A;  4AU7 A;  2RFI A;  2O8J A;  5KJK A;  3RU0 A;  3S7J A;  3CBM A;  5T5G A;  3OPE A;  5F6L A;  3OXG A;  3OS5 A;  4YPE A;  3S7F A;  5F59 A;  1MUF A;  5KJM A;  4J8O A;  3RIB A;  1N6A A;  4QEN A;  5F6K C;  1MVH A;  5HI7 A;  3KMA A;  3VV0 A;  3OOI A;  1H3I A;  3F9Z A;  3F9W A;  3BO5 A;  3RJW A;  4J7F A;  3PDN A;  5TH7 A;  3VUZ A;  1O9S A;  3M53 A;  4E47 A;  3SW9 A;  1MVX A;  3MO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...