5LSXA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
246
structure length
231
Chain Sequence
GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQREAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 53
structure length 231
sequence length 246
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lsxA00
3RU0A 3QWPA 4I51A 5TEGA 4QENA 5CCLA 4YPUA 3RJWA 4IJDA 3MO5A 5F6KC 5CPRB 5KJLA 1MVHA 2G46A 4FMUA 2W5ZA 3CBPA 3OXLA 1MUFA 5F5EA 5KJMA 3KMTA 4IJ8A 3DALA 4J8OA 3PDNA 3K5KA 5T0KA 3S7BA 3IHXA 5T0MA 2F69A 3M54A 3TG4A 2R3AA 5EX3A 1XQHA 5F59A 5LSXA 1N6AA 2RFIA 1PEGA 4YPEA 3SWCA 3OOIA 4AU7A 3KMAA 3F9YA 4NJ5A 3RQ4A 2JV0A 3CBMA 5JINA 3RIBA 3S7FA 3DB5A 3M58A 3MO2A 5KJNA 3CBOA 3MEKA 4MI0A 3M53A 4LDGA 1O9SA 4O6FA 4QEOA 5JHNA 4J7IA 4YNMA 4RZ0A 5KJKA 3KMJA 3OXGA 5AYFA 3F9XA 3QWVA 3HNAA 4E47A 2O8JA 2QPWA 1ML9A 4H12A 4YPAA 4QEPA 3RAYA 3S8PA 4JLGA 5EG2A 1ZKKA 3MO0A 4MI5A 3S7DA 5JJ0A 3VUZA 3OPEA 3N71A 3VV0A 5HQ8A 4J83A 1MT6A 3F9ZA 3BO5A 3M57A 4C1QA 1H3IA 3OXFA 5ARGA 3SW9A 3M59A 5ARFA 5LSZA 4Z4PA 1N6CA 5EX0A 5F6LA 3M5AA 2BQZA 3OS5A 2IGQA 5TH7A 3F9WA 3FPDA 4YNPA 3QWWA 3EP0A 5CCMA 1N3JA 5JIYA 4WUYA 4NVQA 3TG5A 4J7FA 4YNDA 3M55A 1MVXA 5TTFA 3M56A 4O30A 5T5GA 3S7JA 4BUPA 5HI7A 2W5YA 4JDSA
chains in the Genus database with same CATH superfamily
3RU0A 3QWPA 4I51A 5TEGA 4QENA 5CCLA 4YPUA 3RJWA 4IJDA 3MO5A 5F6KC 5CPRB 5KJLA 1MVHA 2G46A 4FMUA 2W5ZA 3CBPA 3OXLA 1MUFA 5F5EA 5KJMA 3KMTA 4IJ8A 3DALA 4J8OA 3PDNA 3K5KA 5T0KA 3S7BA 3IHXA 5T0MA 2F69A 3M54A 3TG4A 2R3AA 5EX3A 1XQHA 5F59A 5LSXA 1N6AA 2RFIA 1PEGA 4YPEA 3SWCA 3OOIA 4AU7A 3KMAA 3F9YA 4NJ5A 3RQ4A 2JV0A 3CBMA 5JINA 3RIBA 3S7FA 3DB5A 3M58A 3MO2A 5KJNA 3CBOA 3MEKA 4MI0A 3M53A 4LDGA 1O9SA 4O6FA 4QEOA 5JHNA 4J7IA 4YNMA 4RZ0A 5KJKA 3KMJA 3OXGA 5AYFA 3F9XA 3QWVA 3HNAA 4E47A 2O8JA 2QPWA 1ML9A 4H12A 4YPAA 4QEPA 3RAYA 3S8PA 4JLGA 5EG2A 1ZKKA 3MO0A 4MI5A 3S7DA 5JJ0A 3VUZA 3OPEA 3N71A 3VV0A 5HQ8A 4J83A 1MT6A 3F9ZA 3BO5A 3M57A 4C1QA 1H3IA 3OXFA 5ARGA 3SW9A 3M59A 5ARFA 5LSZA 4Z4PA 1N6CA 5EX0A 5F6LA 3M5AA 2BQZA 3OS5A 2IGQA 5TH7A 3F9WA 3FPDA 4YNPA 3QWWA 3EP0A 5CCMA 1N3JA 5JIYA 4WUYA 4NVQA 3TG5A 4J7FA 4YNDA 3M55A 1MVXA 5TTFA 3M56A 4O30A 5T5GA 3S7JA 4BUPA 5HI7A 2W5YA 4JDSA
chains in the Genus database with same CATH topology
3RU0A 3QWPA 4I51A 5TEGA 4QENA 5CCLA 4YPUA 3RJWA 4IJDA 3MO5A 5F6KC 5CPRB 5KJLA 1MVHA 2G46A 4FMUA 2W5ZA 3CBPA 3OXLA 1MUFA 5F5EA 5KJMA 3KMTA 4IJ8A 3DALA 4J8OA 3PDNA 3K5KA 5T0KA 3S7BA 3IHXA 5T0MA 2F69A 3M54A 3TG4A 2R3AA 5EX3A 1XQHA 5F59A 5LSXA 1N6AA 2RFIA 1PEGA 4YPEA 3SWCA 3OOIA 4AU7A 3KMAA 3F9YA 4NJ5A 3RQ4A 2JV0A 3CBMA 5JINA 3RIBA 3S7FA 3DB5A 3M58A 3MO2A 5KJNA 3CBOA 3MEKA 4MI0A 3M53A 4LDGA 1O9SA 4O6FA 4QEOA 5JHNA 4J7IA 4YNMA 4RZ0A 5KJKA 3KMJA 3OXGA 5AYFA 3F9XA 3QWVA 3HNAA 4E47A 2O8JA 2QPWA 1ML9A 4H12A 4YPAA 4QEPA 3RAYA 3S8PA 4JLGA 5EG2A 1ZKKA 3MO0A 4MI5A 3S7DA 5JJ0A 3VUZA 3OPEA 3N71A 3VV0A 5HQ8A 4J83A 1MT6A 3F9ZA 3BO5A 3M57A 4C1QA 1H3IA 3OXFA 5ARGA 3SW9A 3M59A 5ARFA 5LSZA 4Z4PA 1N6CA 5EX0A 5F6LA 3M5AA 2BQZA 3OS5A 2IGQA 5TH7A 3F9WA 3FPDA 4YNPA 3QWWA 3EP0A 5CCMA 1N3JA 5JIYA 4WUYA 4NVQA 3TG5A 4J7FA 4YNDA 3M55A 1MVXA 5TTFA 3M56A 4O30A 5T5GA 3S7JA 4BUPA 5HI7A 2W5YA 4JDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RU0 A;  3QWP A;  4I51 A;  5TEG A;  4QEN A;  5CCL A;  4YPU A;  3RJW A;  4IJD A;  3MO5 A;  5F6K C;  5CPR B;  5KJL A;  1MVH A;  2G46 A;  4FMU A;  2W5Z A;  3CBP A;  3OXL A;  1MUF A;  5F5E A;  5KJM A;  3KMT A;  4IJ8 A;  3DAL A;  4J8O A;  3PDN A;  3K5K A;  5T0K A;  3S7B A;  3IHX A;  5T0M A;  2F69 A;  3M54 A;  3TG4 A;  2R3A A;  5EX3 A;  1XQH A;  5F59 A;  5LSX A;  1N6A A;  2RFI A;  1PEG A;  4YPE A;  3SWC A;  3OOI A;  4AU7 A;  3KMA A;  3F9Y A;  4NJ5 A;  3RQ4 A;  2JV0 A;  3CBM A;  5JIN A;  3RIB A;  3S7F A;  3DB5 A;  3M58 A;  3MO2 A;  5KJN A;  3CBO A;  3MEK A;  4MI0 A;  3M53 A;  4LDG A;  1O9S A;  4O6F A;  4QEO A;  5JHN A;  4J7I A;  4YNM A;  4RZ0 A;  5KJK A;  3KMJ A;  3OXG A;  5AYF A;  3F9X A;  3QWV A;  3HNA A;  4E47 A;  2O8J A;  2QPW A;  1ML9 A;  4H12 A;  4YPA A;  4QEP A;  3RAY A;  3S8P A;  4JLG A;  5EG2 A;  1ZKK A;  3MO0 A;  4MI5 A;  3S7D A;  5JJ0 A;  3VUZ A;  3OPE A;  3N71 A;  3VV0 A;  5HQ8 A;  4J83 A;  1MT6 A;  3F9Z A;  3BO5 A;  3M57 A;  4C1Q A;  1H3I A;  3OXF A;  5ARG A;  3SW9 A;  3M59 A;  5ARF A;  5LSZ A;  4Z4P A;  1N6C A;  5EX0 A;  5F6L A;  3M5A A;  2BQZ A;  3OS5 A;  2IGQ A;  5TH7 A;  3F9W A;  3FPD A;  4YNP A;  3QWW A;  3EP0 A;  5CCM A;  1N3J A;  5JIY A;  4WUY A;  4NVQ A;  3TG5 A;  4J7F A;  4YND A;  3M55 A;  1MVX A;  5TTF A;  3M56 A;  4O30 A;  5T5G A;  3S7J A;  4BUP A;  5HI7 A;  2W5Y A;  4JDS A; 
#chains in the Genus database with same CATH topology
 3RU0 A;  3QWP A;  4I51 A;  5TEG A;  4QEN A;  5CCL A;  4YPU A;  3RJW A;  4IJD A;  3MO5 A;  5F6K C;  5CPR B;  5KJL A;  1MVH A;  2G46 A;  4FMU A;  2W5Z A;  3CBP A;  3OXL A;  1MUF A;  5F5E A;  5KJM A;  3KMT A;  4IJ8 A;  3DAL A;  4J8O A;  3PDN A;  3K5K A;  5T0K A;  3S7B A;  3IHX A;  5T0M A;  2F69 A;  3M54 A;  3TG4 A;  2R3A A;  5EX3 A;  1XQH A;  5F59 A;  5LSX A;  1N6A A;  2RFI A;  1PEG A;  4YPE A;  3SWC A;  3OOI A;  4AU7 A;  3KMA A;  3F9Y A;  4NJ5 A;  3RQ4 A;  2JV0 A;  3CBM A;  5JIN A;  3RIB A;  3S7F A;  3DB5 A;  3M58 A;  3MO2 A;  5KJN A;  3CBO A;  3MEK A;  4MI0 A;  3M53 A;  4LDG A;  1O9S A;  4O6F A;  4QEO A;  5JHN A;  4J7I A;  4YNM A;  4RZ0 A;  5KJK A;  3KMJ A;  3OXG A;  5AYF A;  3F9X A;  3QWV A;  3HNA A;  4E47 A;  2O8J A;  2QPW A;  1ML9 A;  4H12 A;  4YPA A;  4QEP A;  3RAY A;  3S8P A;  4JLG A;  5EG2 A;  1ZKK A;  3MO0 A;  4MI5 A;  3S7D A;  5JJ0 A;  3VUZ A;  3OPE A;  3N71 A;  3VV0 A;  5HQ8 A;  4J83 A;  1MT6 A;  3F9Z A;  3BO5 A;  3M57 A;  4C1Q A;  1H3I A;  3OXF A;  5ARG A;  3SW9 A;  3M59 A;  5ARF A;  5LSZ A;  4Z4P A;  1N6C A;  5EX0 A;  5F6L A;  3M5A A;  2BQZ A;  3OS5 A;  2IGQ A;  5TH7 A;  3F9W A;  3FPD A;  4YNP A;  3QWW A;  3EP0 A;  5CCM A;  1N3J A;  5JIY A;  4WUY A;  4NVQ A;  3TG5 A;  4J7F A;  4YND A;  3M55 A;  1MVX A;  5TTF A;  3M56 A;  4O30 A;  5T5G A;  3S7J A;  4BUP A;  5HI7 A;  2W5Y A;  4JDS A; 
#chains in the Genus database with same CATH homology
 3RU0 A;  3QWP A;  4I51 A;  5TEG A;  4QEN A;  5CCL A;  4YPU A;  3RJW A;  4IJD A;  3MO5 A;  5F6K C;  5CPR B;  5KJL A;  1MVH A;  2G46 A;  4FMU A;  2W5Z A;  3CBP A;  3OXL A;  1MUF A;  5F5E A;  5KJM A;  3KMT A;  4IJ8 A;  3DAL A;  4J8O A;  3PDN A;  3K5K A;  5T0K A;  3S7B A;  3IHX A;  5T0M A;  2F69 A;  3M54 A;  3TG4 A;  2R3A A;  5EX3 A;  1XQH A;  5F59 A;  5LSX A;  1N6A A;  2RFI A;  1PEG A;  4YPE A;  3SWC A;  3OOI A;  4AU7 A;  3KMA A;  3F9Y A;  4NJ5 A;  3RQ4 A;  2JV0 A;  3CBM A;  5JIN A;  3RIB A;  3S7F A;  3DB5 A;  3M58 A;  3MO2 A;  5KJN A;  3CBO A;  3MEK A;  4MI0 A;  3M53 A;  4LDG A;  1O9S A;  4O6F A;  4QEO A;  5JHN A;  4J7I A;  4YNM A;  4RZ0 A;  5KJK A;  3KMJ A;  3OXG A;  5AYF A;  3F9X A;  3QWV A;  3HNA A;  4E47 A;  2O8J A;  2QPW A;  1ML9 A;  4H12 A;  4YPA A;  4QEP A;  3RAY A;  3S8P A;  4JLG A;  5EG2 A;  1ZKK A;  3MO0 A;  4MI5 A;  3S7D A;  5JJ0 A;  3VUZ A;  3OPE A;  3N71 A;  3VV0 A;  5HQ8 A;  4J83 A;  1MT6 A;  3F9Z A;  3BO5 A;  3M57 A;  4C1Q A;  1H3I A;  3OXF A;  5ARG A;  3SW9 A;  3M59 A;  5ARF A;  5LSZ A;  4Z4P A;  1N6C A;  5EX0 A;  5F6L A;  3M5A A;  2BQZ A;  3OS5 A;  2IGQ A;  5TH7 A;  3F9W A;  3FPD A;  4YNP A;  3QWW A;  3EP0 A;  5CCM A;  1N3J A;  5JIY A;  4WUY A;  4NVQ A;  3TG5 A;  4J7F A;  4YND A;  3M55 A;  1MVX A;  5TTF A;  3M56 A;  4O30 A;  5T5G A;  3S7J A;  4BUP A;  5HI7 A;  2W5Y A;  4JDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...