5LSXA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
246
structure length
231
Chain Sequence
GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQREAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD2
total genus 53
structure length 231
sequence length 246
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lsxA00
2QPWA 3K5KA 1MVXA 3M55A 3MO2A 3M56A 3F9XA 3M5AA 3DALA 4RZ0A 3OXFA 3F9ZA 5F59A 3SW9A 4O6FA 4NVQA 4WUYA 1N3JA 4LDGA 3M54A 5CPRB 4BUPA 3CBOA 3KMAA 5EG2A 3S7FA 4AU7A 5CCMA 5KJLA 4YPUA 3VV0A 3RQ4A 3IHXA 4I51A 3MO0A 3RJWA 1ML9A 1ZKKA 3MEKA 2F69A 5LSZA 2G46A 1N6CA 3M58A 1O9SA 5JINA 3RAYA 3KMJA 2IGQA 3OXGA 4QEPA 4QEOA 3FPDA 5TEGA 3CBMA 5JIYA 4IJDA 4J7IA 3M57A 3M59A 1MUFA 3OOIA 4JDSA 3N71A 4E47A 1MVHA 5HQ8A 1N6AA 3OPEA 2BQZA 4O30A 3S7BA 5JJ0A 4QENA 3F9WA 3S7DA 4J7FA 3OS5A 4MI5A 2RFIA 5ARFA 1H3IA 2W5ZA 3TG5A 4Z4PA 5ARGA 5T0KA 2O8JA 4J8OA 3DB5A 3RU0A 4YNMA 3QWPA 3F9YA 3MO5A 4IJ8A 3TG4A 3M53A 4YNPA 5KJMA 2W5YA 5T0MA 1PEGA 4C1QA 2JV0A 3S8PA 3EP0A 4J83A 5F5EA 3BO5A 3CBPA 3SWCA 3S7JA 4JLGA 5F6KC 5KJNA 3HNAA 3KMTA 1MT6A 5LSXA 5HI7A 4FMUA 2R3AA 4YNDA 5EX0A 5TH7A 3QWVA 4NJ5A 4YPEA 5KJKA 4YPAA 4MI0A 3OXLA 5F6LA 3PDNA 5JHNA 5EX3A 5TTFA 1XQHA 5AYFA 3VUZA 3QWWA 4H12A 5CCLA 3RIBA 5T5GA
chains in the Genus database with same CATH superfamily
2QPWA 3K5KA 1MVXA 3M55A 3MO2A 3M56A 3F9XA 3M5AA 3DALA 4RZ0A 3OXFA 3F9ZA 5F59A 3SW9A 4O6FA 4NVQA 4WUYA 1N3JA 4LDGA 3M54A 5CPRB 4BUPA 3CBOA 3KMAA 5EG2A 3S7FA 4AU7A 5CCMA 5KJLA 4YPUA 3VV0A 3RQ4A 3IHXA 4I51A 3MO0A 3RJWA 1ML9A 1ZKKA 3MEKA 2F69A 5LSZA 2G46A 1N6CA 3M58A 1O9SA 5JINA 3RAYA 3KMJA 2IGQA 3OXGA 4QEPA 4QEOA 3FPDA 5TEGA 3CBMA 5JIYA 4IJDA 4J7IA 3M57A 3M59A 1MUFA 3OOIA 4JDSA 3N71A 4E47A 1MVHA 5HQ8A 1N6AA 3OPEA 2BQZA 4O30A 3S7BA 5JJ0A 4QENA 3F9WA 3S7DA 4J7FA 3OS5A 4MI5A 2RFIA 5ARFA 1H3IA 2W5ZA 3TG5A 4Z4PA 5ARGA 5T0KA 2O8JA 4J8OA 3DB5A 3RU0A 4YNMA 3QWPA 3F9YA 3MO5A 4IJ8A 3TG4A 3M53A 4YNPA 5KJMA 2W5YA 5T0MA 1PEGA 4C1QA 2JV0A 3S8PA 3EP0A 4J83A 5F5EA 3BO5A 3CBPA 3SWCA 3S7JA 4JLGA 5F6KC 5KJNA 3HNAA 3KMTA 1MT6A 5LSXA 5HI7A 4FMUA 2R3AA 4YNDA 5EX0A 5TH7A 3QWVA 4NJ5A 4YPEA 5KJKA 4YPAA 4MI0A 3OXLA 5F6LA 3PDNA 5JHNA 5EX3A 5TTFA 1XQHA 5AYFA 3VUZA 3QWWA 4H12A 5CCLA 3RIBA 5T5GA
chains in the Genus database with same CATH topology
2QPWA 3K5KA 1MVXA 3M55A 3MO2A 3M56A 3F9XA 3M5AA 3DALA 4RZ0A 3OXFA 3F9ZA 5F59A 3SW9A 4O6FA 4NVQA 4WUYA 1N3JA 4LDGA 3M54A 5CPRB 4BUPA 3CBOA 3KMAA 5EG2A 3S7FA 4AU7A 5CCMA 5KJLA 4YPUA 3VV0A 3RQ4A 3IHXA 4I51A 3MO0A 3RJWA 1ML9A 1ZKKA 3MEKA 2F69A 5LSZA 2G46A 1N6CA 3M58A 1O9SA 5JINA 3RAYA 3KMJA 2IGQA 3OXGA 4QEPA 4QEOA 3FPDA 5TEGA 3CBMA 5JIYA 4IJDA 4J7IA 3M57A 3M59A 1MUFA 3OOIA 4JDSA 3N71A 4E47A 1MVHA 5HQ8A 1N6AA 3OPEA 2BQZA 4O30A 3S7BA 5JJ0A 4QENA 3F9WA 3S7DA 4J7FA 3OS5A 4MI5A 2RFIA 5ARFA 1H3IA 2W5ZA 3TG5A 4Z4PA 5ARGA 5T0KA 2O8JA 4J8OA 3DB5A 3RU0A 4YNMA 3QWPA 3F9YA 3MO5A 4IJ8A 3TG4A 3M53A 4YNPA 5KJMA 2W5YA 5T0MA 1PEGA 4C1QA 2JV0A 3S8PA 3EP0A 4J83A 5F5EA 3BO5A 3CBPA 3SWCA 3S7JA 4JLGA 5F6KC 5KJNA 3HNAA 3KMTA 1MT6A 5LSXA 5HI7A 4FMUA 2R3AA 4YNDA 5EX0A 5TH7A 3QWVA 4NJ5A 4YPEA 5KJKA 4YPAA 4MI0A 3OXLA 5F6LA 3PDNA 5JHNA 5EX3A 5TTFA 1XQHA 5AYFA 3VUZA 3QWWA 4H12A 5CCLA 3RIBA 5T5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPW A;  3K5K A;  1MVX A;  3M55 A;  3MO2 A;  3M56 A;  3F9X A;  3M5A A;  3DAL A;  4RZ0 A;  3OXF A;  3F9Z A;  5F59 A;  3SW9 A;  4O6F A;  4NVQ A;  4WUY A;  1N3J A;  4LDG A;  3M54 A;  5CPR B;  4BUP A;  3CBO A;  3KMA A;  5EG2 A;  3S7F A;  4AU7 A;  5CCM A;  5KJL A;  4YPU A;  3VV0 A;  3RQ4 A;  3IHX A;  4I51 A;  3MO0 A;  3RJW A;  1ML9 A;  1ZKK A;  3MEK A;  2F69 A;  5LSZ A;  2G46 A;  1N6C A;  3M58 A;  1O9S A;  5JIN A;  3RAY A;  3KMJ A;  2IGQ A;  3OXG A;  4QEP A;  4QEO A;  3FPD A;  5TEG A;  3CBM A;  5JIY A;  4IJD A;  4J7I A;  3M57 A;  3M59 A;  1MUF A;  3OOI A;  4JDS A;  3N71 A;  4E47 A;  1MVH A;  5HQ8 A;  1N6A A;  3OPE A;  2BQZ A;  4O30 A;  3S7B A;  5JJ0 A;  4QEN A;  3F9W A;  3S7D A;  4J7F A;  3OS5 A;  4MI5 A;  2RFI A;  5ARF A;  1H3I A;  2W5Z A;  3TG5 A;  4Z4P A;  5ARG A;  5T0K A;  2O8J A;  4J8O A;  3DB5 A;  3RU0 A;  4YNM A;  3QWP A;  3F9Y A;  3MO5 A;  4IJ8 A;  3TG4 A;  3M53 A;  4YNP A;  5KJM A;  2W5Y A;  5T0M A;  1PEG A;  4C1Q A;  2JV0 A;  3S8P A;  3EP0 A;  4J83 A;  5F5E A;  3BO5 A;  3CBP A;  3SWC A;  3S7J A;  4JLG A;  5F6K C;  5KJN A;  3HNA A;  3KMT A;  1MT6 A;  5LSX A;  5HI7 A;  4FMU A;  2R3A A;  4YND A;  5EX0 A;  5TH7 A;  3QWV A;  4NJ5 A;  4YPE A;  5KJK A;  4YPA A;  4MI0 A;  3OXL A;  5F6L A;  3PDN A;  5JHN A;  5EX3 A;  5TTF A;  1XQH A;  5AYF A;  3VUZ A;  3QWW A;  4H12 A;  5CCL A;  3RIB A;  5T5G A; 
#chains in the Genus database with same CATH topology
 2QPW A;  3K5K A;  1MVX A;  3M55 A;  3MO2 A;  3M56 A;  3F9X A;  3M5A A;  3DAL A;  4RZ0 A;  3OXF A;  3F9Z A;  5F59 A;  3SW9 A;  4O6F A;  4NVQ A;  4WUY A;  1N3J A;  4LDG A;  3M54 A;  5CPR B;  4BUP A;  3CBO A;  3KMA A;  5EG2 A;  3S7F A;  4AU7 A;  5CCM A;  5KJL A;  4YPU A;  3VV0 A;  3RQ4 A;  3IHX A;  4I51 A;  3MO0 A;  3RJW A;  1ML9 A;  1ZKK A;  3MEK A;  2F69 A;  5LSZ A;  2G46 A;  1N6C A;  3M58 A;  1O9S A;  5JIN A;  3RAY A;  3KMJ A;  2IGQ A;  3OXG A;  4QEP A;  4QEO A;  3FPD A;  5TEG A;  3CBM A;  5JIY A;  4IJD A;  4J7I A;  3M57 A;  3M59 A;  1MUF A;  3OOI A;  4JDS A;  3N71 A;  4E47 A;  1MVH A;  5HQ8 A;  1N6A A;  3OPE A;  2BQZ A;  4O30 A;  3S7B A;  5JJ0 A;  4QEN A;  3F9W A;  3S7D A;  4J7F A;  3OS5 A;  4MI5 A;  2RFI A;  5ARF A;  1H3I A;  2W5Z A;  3TG5 A;  4Z4P A;  5ARG A;  5T0K A;  2O8J A;  4J8O A;  3DB5 A;  3RU0 A;  4YNM A;  3QWP A;  3F9Y A;  3MO5 A;  4IJ8 A;  3TG4 A;  3M53 A;  4YNP A;  5KJM A;  2W5Y A;  5T0M A;  1PEG A;  4C1Q A;  2JV0 A;  3S8P A;  3EP0 A;  4J83 A;  5F5E A;  3BO5 A;  3CBP A;  3SWC A;  3S7J A;  4JLG A;  5F6K C;  5KJN A;  3HNA A;  3KMT A;  1MT6 A;  5LSX A;  5HI7 A;  4FMU A;  2R3A A;  4YND A;  5EX0 A;  5TH7 A;  3QWV A;  4NJ5 A;  4YPE A;  5KJK A;  4YPA A;  4MI0 A;  3OXL A;  5F6L A;  3PDN A;  5JHN A;  5EX3 A;  5TTF A;  1XQH A;  5AYF A;  3VUZ A;  3QWW A;  4H12 A;  5CCL A;  3RIB A;  5T5G A; 
#chains in the Genus database with same CATH homology
 2QPW A;  3K5K A;  1MVX A;  3M55 A;  3MO2 A;  3M56 A;  3F9X A;  3M5A A;  3DAL A;  4RZ0 A;  3OXF A;  3F9Z A;  5F59 A;  3SW9 A;  4O6F A;  4NVQ A;  4WUY A;  1N3J A;  4LDG A;  3M54 A;  5CPR B;  4BUP A;  3CBO A;  3KMA A;  5EG2 A;  3S7F A;  4AU7 A;  5CCM A;  5KJL A;  4YPU A;  3VV0 A;  3RQ4 A;  3IHX A;  4I51 A;  3MO0 A;  3RJW A;  1ML9 A;  1ZKK A;  3MEK A;  2F69 A;  5LSZ A;  2G46 A;  1N6C A;  3M58 A;  1O9S A;  5JIN A;  3RAY A;  3KMJ A;  2IGQ A;  3OXG A;  4QEP A;  4QEO A;  3FPD A;  5TEG A;  3CBM A;  5JIY A;  4IJD A;  4J7I A;  3M57 A;  3M59 A;  1MUF A;  3OOI A;  4JDS A;  3N71 A;  4E47 A;  1MVH A;  5HQ8 A;  1N6A A;  3OPE A;  2BQZ A;  4O30 A;  3S7B A;  5JJ0 A;  4QEN A;  3F9W A;  3S7D A;  4J7F A;  3OS5 A;  4MI5 A;  2RFI A;  5ARF A;  1H3I A;  2W5Z A;  3TG5 A;  4Z4P A;  5ARG A;  5T0K A;  2O8J A;  4J8O A;  3DB5 A;  3RU0 A;  4YNM A;  3QWP A;  3F9Y A;  3MO5 A;  4IJ8 A;  3TG4 A;  3M53 A;  4YNP A;  5KJM A;  2W5Y A;  5T0M A;  1PEG A;  4C1Q A;  2JV0 A;  3S8P A;  3EP0 A;  4J83 A;  5F5E A;  3BO5 A;  3CBP A;  3SWC A;  3S7J A;  4JLG A;  5F6K C;  5KJN A;  3HNA A;  3KMT A;  1MT6 A;  5LSX A;  5HI7 A;  4FMU A;  2R3A A;  4YND A;  5EX0 A;  5TH7 A;  3QWV A;  4NJ5 A;  4YPE A;  5KJK A;  4YPA A;  4MI0 A;  3OXL A;  5F6L A;  3PDN A;  5JHN A;  5EX3 A;  5TTF A;  1XQH A;  5AYF A;  3VUZ A;  3QWW A;  4H12 A;  5CCL A;  3RIB A;  5T5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...