5LSXA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
246
structure length
231
Chain Sequence
GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQREAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 53
structure length 231
sequence length 246
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lsxA00
3MO5A 1MUFA 5ARGA 3QWWA 1ML9A 5EG2A 5T0KA 5JJ0A 2IGQA 1MT6A 3OXLA 4NVQA 3OXFA 3BO5A 4NJ5A 1H3IA 1N6CA 3SWCA 4H12A 2RFIA 3MO2A 3SW9A 5KJKA 5F59A 5T5GA 3OPEA 3OXGA 3OS5A 5T0MA 5EX0A 1N3JA 3KMJA 1O9SA 3K5KA 2F69A 3HNAA 3QWPA 1MVXA 3M53A 4IJDA 4RZ0A 4J7IA 2JV0A 4O6FA 4QEPA 3TG5A 4I51A 4YPEA 5TEGA 3F9YA 5F6KC 3KMAA 2G46A 3F9WA 4JLGA 1ZKKA 3M58A 5JIYA 2W5ZA 3CBPA 4J7FA 5CCMA 2QPWA 3KMTA 3IHXA 4O30A 2BQZA 2W5YA 3VV0A 5JINA 3DB5A 5LSZA 5KJLA 4YPUA 5LSXA 4MI5A 4BUPA 5HI7A 4YNDA 1MVHA 3FPDA 4J8OA 5F6LA 3QWVA 3CBOA 3M59A 4QENA 5KJMA 4QEOA 3M57A 3RJWA 3M55A 3RAYA 3S7BA 3M56A 4IJ8A 1N6AA 3EP0A 4LDGA 5F5EA 3S7JA 4YNPA 1PEGA 2O8JA 4JDSA 3MEKA 3S7DA 3PDNA 5CCLA 4AU7A 4YPAA 4Z4PA 3M54A 4WUYA 3VUZA 3F9XA 3CBMA 5AYFA 4YNMA 5EX3A 4C1QA 4MI0A 3DALA 3N71A 3F9ZA 5TTFA 3M5AA 5ARFA 4FMUA 4J83A 5CPRB 3S8PA 3RU0A 3MO0A 3RIBA 3RQ4A 5HQ8A 2R3AA 3OOIA 3TG4A 4E47A 5TH7A 5KJNA 5JHNA 3S7FA 1XQHA
chains in the Genus database with same CATH superfamily
3MO5A 1MUFA 5ARGA 3QWWA 1ML9A 5EG2A 5T0KA 5JJ0A 2IGQA 1MT6A 3OXLA 4NVQA 3OXFA 3BO5A 4NJ5A 1H3IA 1N6CA 3SWCA 4H12A 2RFIA 3MO2A 3SW9A 5KJKA 5F59A 5T5GA 3OPEA 3OXGA 3OS5A 5T0MA 5EX0A 1N3JA 3KMJA 1O9SA 3K5KA 2F69A 3HNAA 3QWPA 1MVXA 3M53A 4IJDA 4RZ0A 4J7IA 2JV0A 4O6FA 4QEPA 3TG5A 4I51A 4YPEA 5TEGA 3F9YA 5F6KC 3KMAA 2G46A 3F9WA 4JLGA 1ZKKA 3M58A 5JIYA 2W5ZA 3CBPA 4J7FA 5CCMA 2QPWA 3KMTA 3IHXA 4O30A 2BQZA 2W5YA 3VV0A 5JINA 3DB5A 5LSZA 5KJLA 4YPUA 5LSXA 4MI5A 4BUPA 5HI7A 4YNDA 1MVHA 3FPDA 4J8OA 5F6LA 3QWVA 3CBOA 3M59A 4QENA 5KJMA 4QEOA 3M57A 3RJWA 3M55A 3RAYA 3S7BA 3M56A 4IJ8A 1N6AA 3EP0A 4LDGA 5F5EA 3S7JA 4YNPA 1PEGA 2O8JA 4JDSA 3MEKA 3S7DA 3PDNA 5CCLA 4AU7A 4YPAA 4Z4PA 3M54A 4WUYA 3VUZA 3F9XA 3CBMA 5AYFA 4YNMA 5EX3A 4C1QA 4MI0A 3DALA 3N71A 3F9ZA 5TTFA 3M5AA 5ARFA 4FMUA 4J83A 5CPRB 3S8PA 3RU0A 3MO0A 3RIBA 3RQ4A 5HQ8A 2R3AA 3OOIA 3TG4A 4E47A 5TH7A 5KJNA 5JHNA 3S7FA 1XQHA
chains in the Genus database with same CATH topology
3MO5A 1MUFA 5ARGA 3QWWA 1ML9A 5EG2A 5T0KA 5JJ0A 2IGQA 1MT6A 3OXLA 4NVQA 3OXFA 3BO5A 4NJ5A 1H3IA 1N6CA 3SWCA 4H12A 2RFIA 3MO2A 3SW9A 5KJKA 5F59A 5T5GA 3OPEA 3OXGA 3OS5A 5T0MA 5EX0A 1N3JA 3KMJA 1O9SA 3K5KA 2F69A 3HNAA 3QWPA 1MVXA 3M53A 4IJDA 4RZ0A 4J7IA 2JV0A 4O6FA 4QEPA 3TG5A 4I51A 4YPEA 5TEGA 3F9YA 5F6KC 3KMAA 2G46A 3F9WA 4JLGA 1ZKKA 3M58A 5JIYA 2W5ZA 3CBPA 4J7FA 5CCMA 2QPWA 3KMTA 3IHXA 4O30A 2BQZA 2W5YA 3VV0A 5JINA 3DB5A 5LSZA 5KJLA 4YPUA 5LSXA 4MI5A 4BUPA 5HI7A 4YNDA 1MVHA 3FPDA 4J8OA 5F6LA 3QWVA 3CBOA 3M59A 4QENA 5KJMA 4QEOA 3M57A 3RJWA 3M55A 3RAYA 3S7BA 3M56A 4IJ8A 1N6AA 3EP0A 4LDGA 5F5EA 3S7JA 4YNPA 1PEGA 2O8JA 4JDSA 3MEKA 3S7DA 3PDNA 5CCLA 4AU7A 4YPAA 4Z4PA 3M54A 4WUYA 3VUZA 3F9XA 3CBMA 5AYFA 4YNMA 5EX3A 4C1QA 4MI0A 3DALA 3N71A 3F9ZA 5TTFA 3M5AA 5ARFA 4FMUA 4J83A 5CPRB 3S8PA 3RU0A 3MO0A 3RIBA 3RQ4A 5HQ8A 2R3AA 3OOIA 3TG4A 4E47A 5TH7A 5KJNA 5JHNA 3S7FA 1XQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MO5 A;  1MUF A;  5ARG A;  3QWW A;  1ML9 A;  5EG2 A;  5T0K A;  5JJ0 A;  2IGQ A;  1MT6 A;  3OXL A;  4NVQ A;  3OXF A;  3BO5 A;  4NJ5 A;  1H3I A;  1N6C A;  3SWC A;  4H12 A;  2RFI A;  3MO2 A;  3SW9 A;  5KJK A;  5F59 A;  5T5G A;  3OPE A;  3OXG A;  3OS5 A;  5T0M A;  5EX0 A;  1N3J A;  3KMJ A;  1O9S A;  3K5K A;  2F69 A;  3HNA A;  3QWP A;  1MVX A;  3M53 A;  4IJD A;  4RZ0 A;  4J7I A;  2JV0 A;  4O6F A;  4QEP A;  3TG5 A;  4I51 A;  4YPE A;  5TEG A;  3F9Y A;  5F6K C;  3KMA A;  2G46 A;  3F9W A;  4JLG A;  1ZKK A;  3M58 A;  5JIY A;  2W5Z A;  3CBP A;  4J7F A;  5CCM A;  2QPW A;  3KMT A;  3IHX A;  4O30 A;  2BQZ A;  2W5Y A;  3VV0 A;  5JIN A;  3DB5 A;  5LSZ A;  5KJL A;  4YPU A;  5LSX A;  4MI5 A;  4BUP A;  5HI7 A;  4YND A;  1MVH A;  3FPD A;  4J8O A;  5F6L A;  3QWV A;  3CBO A;  3M59 A;  4QEN A;  5KJM A;  4QEO A;  3M57 A;  3RJW A;  3M55 A;  3RAY A;  3S7B A;  3M56 A;  4IJ8 A;  1N6A A;  3EP0 A;  4LDG A;  5F5E A;  3S7J A;  4YNP A;  1PEG A;  2O8J A;  4JDS A;  3MEK A;  3S7D A;  3PDN A;  5CCL A;  4AU7 A;  4YPA A;  4Z4P A;  3M54 A;  4WUY A;  3VUZ A;  3F9X A;  3CBM A;  5AYF A;  4YNM A;  5EX3 A;  4C1Q A;  4MI0 A;  3DAL A;  3N71 A;  3F9Z A;  5TTF A;  3M5A A;  5ARF A;  4FMU A;  4J83 A;  5CPR B;  3S8P A;  3RU0 A;  3MO0 A;  3RIB A;  3RQ4 A;  5HQ8 A;  2R3A A;  3OOI A;  3TG4 A;  4E47 A;  5TH7 A;  5KJN A;  5JHN A;  3S7F A;  1XQH A; 
#chains in the Genus database with same CATH topology
 3MO5 A;  1MUF A;  5ARG A;  3QWW A;  1ML9 A;  5EG2 A;  5T0K A;  5JJ0 A;  2IGQ A;  1MT6 A;  3OXL A;  4NVQ A;  3OXF A;  3BO5 A;  4NJ5 A;  1H3I A;  1N6C A;  3SWC A;  4H12 A;  2RFI A;  3MO2 A;  3SW9 A;  5KJK A;  5F59 A;  5T5G A;  3OPE A;  3OXG A;  3OS5 A;  5T0M A;  5EX0 A;  1N3J A;  3KMJ A;  1O9S A;  3K5K A;  2F69 A;  3HNA A;  3QWP A;  1MVX A;  3M53 A;  4IJD A;  4RZ0 A;  4J7I A;  2JV0 A;  4O6F A;  4QEP A;  3TG5 A;  4I51 A;  4YPE A;  5TEG A;  3F9Y A;  5F6K C;  3KMA A;  2G46 A;  3F9W A;  4JLG A;  1ZKK A;  3M58 A;  5JIY A;  2W5Z A;  3CBP A;  4J7F A;  5CCM A;  2QPW A;  3KMT A;  3IHX A;  4O30 A;  2BQZ A;  2W5Y A;  3VV0 A;  5JIN A;  3DB5 A;  5LSZ A;  5KJL A;  4YPU A;  5LSX A;  4MI5 A;  4BUP A;  5HI7 A;  4YND A;  1MVH A;  3FPD A;  4J8O A;  5F6L A;  3QWV A;  3CBO A;  3M59 A;  4QEN A;  5KJM A;  4QEO A;  3M57 A;  3RJW A;  3M55 A;  3RAY A;  3S7B A;  3M56 A;  4IJ8 A;  1N6A A;  3EP0 A;  4LDG A;  5F5E A;  3S7J A;  4YNP A;  1PEG A;  2O8J A;  4JDS A;  3MEK A;  3S7D A;  3PDN A;  5CCL A;  4AU7 A;  4YPA A;  4Z4P A;  3M54 A;  4WUY A;  3VUZ A;  3F9X A;  3CBM A;  5AYF A;  4YNM A;  5EX3 A;  4C1Q A;  4MI0 A;  3DAL A;  3N71 A;  3F9Z A;  5TTF A;  3M5A A;  5ARF A;  4FMU A;  4J83 A;  5CPR B;  3S8P A;  3RU0 A;  3MO0 A;  3RIB A;  3RQ4 A;  5HQ8 A;  2R3A A;  3OOI A;  3TG4 A;  4E47 A;  5TH7 A;  5KJN A;  5JHN A;  3S7F A;  1XQH A; 
#chains in the Genus database with same CATH homology
 3MO5 A;  1MUF A;  5ARG A;  3QWW A;  1ML9 A;  5EG2 A;  5T0K A;  5JJ0 A;  2IGQ A;  1MT6 A;  3OXL A;  4NVQ A;  3OXF A;  3BO5 A;  4NJ5 A;  1H3I A;  1N6C A;  3SWC A;  4H12 A;  2RFI A;  3MO2 A;  3SW9 A;  5KJK A;  5F59 A;  5T5G A;  3OPE A;  3OXG A;  3OS5 A;  5T0M A;  5EX0 A;  1N3J A;  3KMJ A;  1O9S A;  3K5K A;  2F69 A;  3HNA A;  3QWP A;  1MVX A;  3M53 A;  4IJD A;  4RZ0 A;  4J7I A;  2JV0 A;  4O6F A;  4QEP A;  3TG5 A;  4I51 A;  4YPE A;  5TEG A;  3F9Y A;  5F6K C;  3KMA A;  2G46 A;  3F9W A;  4JLG A;  1ZKK A;  3M58 A;  5JIY A;  2W5Z A;  3CBP A;  4J7F A;  5CCM A;  2QPW A;  3KMT A;  3IHX A;  4O30 A;  2BQZ A;  2W5Y A;  3VV0 A;  5JIN A;  3DB5 A;  5LSZ A;  5KJL A;  4YPU A;  5LSX A;  4MI5 A;  4BUP A;  5HI7 A;  4YND A;  1MVH A;  3FPD A;  4J8O A;  5F6L A;  3QWV A;  3CBO A;  3M59 A;  4QEN A;  5KJM A;  4QEO A;  3M57 A;  3RJW A;  3M55 A;  3RAY A;  3S7B A;  3M56 A;  4IJ8 A;  1N6A A;  3EP0 A;  4LDG A;  5F5E A;  3S7J A;  4YNP A;  1PEG A;  2O8J A;  4JDS A;  3MEK A;  3S7D A;  3PDN A;  5CCL A;  4AU7 A;  4YPA A;  4Z4P A;  3M54 A;  4WUY A;  3VUZ A;  3F9X A;  3CBM A;  5AYF A;  4YNM A;  5EX3 A;  4C1Q A;  4MI0 A;  3DAL A;  3N71 A;  3F9Z A;  5TTF A;  3M5A A;  5ARF A;  4FMU A;  4J83 A;  5CPR B;  3S8P A;  3RU0 A;  3MO0 A;  3RIB A;  3RQ4 A;  5HQ8 A;  2R3A A;  3OOI A;  3TG4 A;  4E47 A;  5TH7 A;  5KJN A;  5JHN A;  3S7F A;  1XQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...