5LSXA

Structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
246
structure length
231
Chain Sequence
GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQREAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD2
total genus 53
structure length 231
sequence length 246
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5lsxA00
1H3IA 3OPEA 3M58A 3PDNA 4NJ5A 1N6CA 4FMUA 3M56A 5T0KA 3SWCA 5EX3A 5JJ0A 2BQZA 4J8OA 2R3AA 3M54A 3F9ZA 5KJNA 4QEOA 5KJMA 4YNMA 3K5KA 4QEPA 3RQ4A 3BO5A 3M55A 4IJ8A 5CCMA 3RAYA 3F9WA 4BUPA 5EX0A 3VUZA 3S7BA 3MEKA 4E47A 1N6AA 3IHXA 5TH7A 5JINA 4J7FA 3SW9A 4WUYA 4O30A 3DALA 3RIBA 1MVHA 5F59A 4J83A 3RU0A 4YPAA 4IJDA 5ARGA 3EP0A 3OXGA 4MI5A 2G46A 4C1QA 3F9XA 5TEGA 3OXLA 5HQ8A 5LSXA 1O9SA 3DB5A 4MI0A 5F6KC 3OS5A 3CBPA 3S7JA 2JV0A 1MUFA 3KMAA 4YNDA 2W5YA 3HNAA 4JDSA 2F69A 3M57A 5AYFA 2IGQA 1ZKKA 1XQHA 5KJLA 1ML9A 3S7DA 3TG5A 3QWPA 3CBOA 2QPWA 4YPEA 3TG4A 3VV0A 3QWVA 3RJWA 3OOIA 4I51A 3KMJA 4O6FA 5CCLA 5JHNA 3N71A 4YPUA 5KJKA 3KMTA 1MT6A 5CPRB 5HI7A 3OXFA 4RZ0A 3M5AA 3S7FA 4J7IA 2W5ZA 3QWWA 3MO2A 2RFIA 4JLGA 1PEGA 4AU7A 3MO5A 5ARFA 5T5GA 5T0MA 1N3JA 3MO0A 3M53A 5EG2A 3M59A 1MVXA 3CBMA 3FPDA 4LDGA 4NVQA 5LSZA 4Z4PA 5F5EA 3S8PA 3F9YA 5TTFA 2O8JA 4QENA 5F6LA 4H12A 5JIYA 4YNPA
chains in the Genus database with same CATH superfamily
1H3IA 3OPEA 3M58A 3PDNA 4NJ5A 1N6CA 4FMUA 3M56A 5T0KA 3SWCA 5EX3A 5JJ0A 2BQZA 4J8OA 2R3AA 3M54A 3F9ZA 5KJNA 4QEOA 5KJMA 4YNMA 3K5KA 4QEPA 3RQ4A 3BO5A 3M55A 4IJ8A 5CCMA 3RAYA 3F9WA 4BUPA 5EX0A 3VUZA 3S7BA 3MEKA 4E47A 1N6AA 3IHXA 5TH7A 5JINA 4J7FA 3SW9A 4WUYA 4O30A 3DALA 3RIBA 1MVHA 5F59A 4J83A 3RU0A 4YPAA 4IJDA 5ARGA 3EP0A 3OXGA 4MI5A 2G46A 4C1QA 3F9XA 5TEGA 3OXLA 5HQ8A 5LSXA 1O9SA 3DB5A 4MI0A 5F6KC 3OS5A 3CBPA 3S7JA 2JV0A 1MUFA 3KMAA 4YNDA 2W5YA 3HNAA 4JDSA 2F69A 3M57A 5AYFA 2IGQA 1ZKKA 1XQHA 5KJLA 1ML9A 3S7DA 3TG5A 3QWPA 3CBOA 2QPWA 4YPEA 3TG4A 3VV0A 3QWVA 3RJWA 3OOIA 4I51A 3KMJA 4O6FA 5CCLA 5JHNA 3N71A 4YPUA 5KJKA 3KMTA 1MT6A 5CPRB 5HI7A 3OXFA 4RZ0A 3M5AA 3S7FA 4J7IA 2W5ZA 3QWWA 3MO2A 2RFIA 4JLGA 1PEGA 4AU7A 3MO5A 5ARFA 5T5GA 5T0MA 1N3JA 3MO0A 3M53A 5EG2A 3M59A 1MVXA 3CBMA 3FPDA 4LDGA 4NVQA 5LSZA 4Z4PA 5F5EA 3S8PA 3F9YA 5TTFA 2O8JA 4QENA 5F6LA 4H12A 5JIYA 4YNPA
chains in the Genus database with same CATH topology
1H3IA 3OPEA 3M58A 3PDNA 4NJ5A 1N6CA 4FMUA 3M56A 5T0KA 3SWCA 5EX3A 5JJ0A 2BQZA 4J8OA 2R3AA 3M54A 3F9ZA 5KJNA 4QEOA 5KJMA 4YNMA 3K5KA 4QEPA 3RQ4A 3BO5A 3M55A 4IJ8A 5CCMA 3RAYA 3F9WA 4BUPA 5EX0A 3VUZA 3S7BA 3MEKA 4E47A 1N6AA 3IHXA 5TH7A 5JINA 4J7FA 3SW9A 4WUYA 4O30A 3DALA 3RIBA 1MVHA 5F59A 4J83A 3RU0A 4YPAA 4IJDA 5ARGA 3EP0A 3OXGA 4MI5A 2G46A 4C1QA 3F9XA 5TEGA 3OXLA 5HQ8A 5LSXA 1O9SA 3DB5A 4MI0A 5F6KC 3OS5A 3CBPA 3S7JA 2JV0A 1MUFA 3KMAA 4YNDA 2W5YA 3HNAA 4JDSA 2F69A 3M57A 5AYFA 2IGQA 1ZKKA 1XQHA 5KJLA 1ML9A 3S7DA 3TG5A 3QWPA 3CBOA 2QPWA 4YPEA 3TG4A 3VV0A 3QWVA 3RJWA 3OOIA 4I51A 3KMJA 4O6FA 5CCLA 5JHNA 3N71A 4YPUA 5KJKA 3KMTA 1MT6A 5CPRB 5HI7A 3OXFA 4RZ0A 3M5AA 3S7FA 4J7IA 2W5ZA 3QWWA 3MO2A 2RFIA 4JLGA 1PEGA 4AU7A 3MO5A 5ARFA 5T5GA 5T0MA 1N3JA 3MO0A 3M53A 5EG2A 3M59A 1MVXA 3CBMA 3FPDA 4LDGA 4NVQA 5LSZA 4Z4PA 5F5EA 3S8PA 3F9YA 5TTFA 2O8JA 4QENA 5F6LA 4H12A 5JIYA 4YNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3I A;  3OPE A;  3M58 A;  3PDN A;  4NJ5 A;  1N6C A;  4FMU A;  3M56 A;  5T0K A;  3SWC A;  5EX3 A;  5JJ0 A;  2BQZ A;  4J8O A;  2R3A A;  3M54 A;  3F9Z A;  5KJN A;  4QEO A;  5KJM A;  4YNM A;  3K5K A;  4QEP A;  3RQ4 A;  3BO5 A;  3M55 A;  4IJ8 A;  5CCM A;  3RAY A;  3F9W A;  4BUP A;  5EX0 A;  3VUZ A;  3S7B A;  3MEK A;  4E47 A;  1N6A A;  3IHX A;  5TH7 A;  5JIN A;  4J7F A;  3SW9 A;  4WUY A;  4O30 A;  3DAL A;  3RIB A;  1MVH A;  5F59 A;  4J83 A;  3RU0 A;  4YPA A;  4IJD A;  5ARG A;  3EP0 A;  3OXG A;  4MI5 A;  2G46 A;  4C1Q A;  3F9X A;  5TEG A;  3OXL A;  5HQ8 A;  5LSX A;  1O9S A;  3DB5 A;  4MI0 A;  5F6K C;  3OS5 A;  3CBP A;  3S7J A;  2JV0 A;  1MUF A;  3KMA A;  4YND A;  2W5Y A;  3HNA A;  4JDS A;  2F69 A;  3M57 A;  5AYF A;  2IGQ A;  1ZKK A;  1XQH A;  5KJL A;  1ML9 A;  3S7D A;  3TG5 A;  3QWP A;  3CBO A;  2QPW A;  4YPE A;  3TG4 A;  3VV0 A;  3QWV A;  3RJW A;  3OOI A;  4I51 A;  3KMJ A;  4O6F A;  5CCL A;  5JHN A;  3N71 A;  4YPU A;  5KJK A;  3KMT A;  1MT6 A;  5CPR B;  5HI7 A;  3OXF A;  4RZ0 A;  3M5A A;  3S7F A;  4J7I A;  2W5Z A;  3QWW A;  3MO2 A;  2RFI A;  4JLG A;  1PEG A;  4AU7 A;  3MO5 A;  5ARF A;  5T5G A;  5T0M A;  1N3J A;  3MO0 A;  3M53 A;  5EG2 A;  3M59 A;  1MVX A;  3CBM A;  3FPD A;  4LDG A;  4NVQ A;  5LSZ A;  4Z4P A;  5F5E A;  3S8P A;  3F9Y A;  5TTF A;  2O8J A;  4QEN A;  5F6L A;  4H12 A;  5JIY A;  4YNP A; 
#chains in the Genus database with same CATH topology
 1H3I A;  3OPE A;  3M58 A;  3PDN A;  4NJ5 A;  1N6C A;  4FMU A;  3M56 A;  5T0K A;  3SWC A;  5EX3 A;  5JJ0 A;  2BQZ A;  4J8O A;  2R3A A;  3M54 A;  3F9Z A;  5KJN A;  4QEO A;  5KJM A;  4YNM A;  3K5K A;  4QEP A;  3RQ4 A;  3BO5 A;  3M55 A;  4IJ8 A;  5CCM A;  3RAY A;  3F9W A;  4BUP A;  5EX0 A;  3VUZ A;  3S7B A;  3MEK A;  4E47 A;  1N6A A;  3IHX A;  5TH7 A;  5JIN A;  4J7F A;  3SW9 A;  4WUY A;  4O30 A;  3DAL A;  3RIB A;  1MVH A;  5F59 A;  4J83 A;  3RU0 A;  4YPA A;  4IJD A;  5ARG A;  3EP0 A;  3OXG A;  4MI5 A;  2G46 A;  4C1Q A;  3F9X A;  5TEG A;  3OXL A;  5HQ8 A;  5LSX A;  1O9S A;  3DB5 A;  4MI0 A;  5F6K C;  3OS5 A;  3CBP A;  3S7J A;  2JV0 A;  1MUF A;  3KMA A;  4YND A;  2W5Y A;  3HNA A;  4JDS A;  2F69 A;  3M57 A;  5AYF A;  2IGQ A;  1ZKK A;  1XQH A;  5KJL A;  1ML9 A;  3S7D A;  3TG5 A;  3QWP A;  3CBO A;  2QPW A;  4YPE A;  3TG4 A;  3VV0 A;  3QWV A;  3RJW A;  3OOI A;  4I51 A;  3KMJ A;  4O6F A;  5CCL A;  5JHN A;  3N71 A;  4YPU A;  5KJK A;  3KMT A;  1MT6 A;  5CPR B;  5HI7 A;  3OXF A;  4RZ0 A;  3M5A A;  3S7F A;  4J7I A;  2W5Z A;  3QWW A;  3MO2 A;  2RFI A;  4JLG A;  1PEG A;  4AU7 A;  3MO5 A;  5ARF A;  5T5G A;  5T0M A;  1N3J A;  3MO0 A;  3M53 A;  5EG2 A;  3M59 A;  1MVX A;  3CBM A;  3FPD A;  4LDG A;  4NVQ A;  5LSZ A;  4Z4P A;  5F5E A;  3S8P A;  3F9Y A;  5TTF A;  2O8J A;  4QEN A;  5F6L A;  4H12 A;  5JIY A;  4YNP A; 
#chains in the Genus database with same CATH homology
 1H3I A;  3OPE A;  3M58 A;  3PDN A;  4NJ5 A;  1N6C A;  4FMU A;  3M56 A;  5T0K A;  3SWC A;  5EX3 A;  5JJ0 A;  2BQZ A;  4J8O A;  2R3A A;  3M54 A;  3F9Z A;  5KJN A;  4QEO A;  5KJM A;  4YNM A;  3K5K A;  4QEP A;  3RQ4 A;  3BO5 A;  3M55 A;  4IJ8 A;  5CCM A;  3RAY A;  3F9W A;  4BUP A;  5EX0 A;  3VUZ A;  3S7B A;  3MEK A;  4E47 A;  1N6A A;  3IHX A;  5TH7 A;  5JIN A;  4J7F A;  3SW9 A;  4WUY A;  4O30 A;  3DAL A;  3RIB A;  1MVH A;  5F59 A;  4J83 A;  3RU0 A;  4YPA A;  4IJD A;  5ARG A;  3EP0 A;  3OXG A;  4MI5 A;  2G46 A;  4C1Q A;  3F9X A;  5TEG A;  3OXL A;  5HQ8 A;  5LSX A;  1O9S A;  3DB5 A;  4MI0 A;  5F6K C;  3OS5 A;  3CBP A;  3S7J A;  2JV0 A;  1MUF A;  3KMA A;  4YND A;  2W5Y A;  3HNA A;  4JDS A;  2F69 A;  3M57 A;  5AYF A;  2IGQ A;  1ZKK A;  1XQH A;  5KJL A;  1ML9 A;  3S7D A;  3TG5 A;  3QWP A;  3CBO A;  2QPW A;  4YPE A;  3TG4 A;  3VV0 A;  3QWV A;  3RJW A;  3OOI A;  4I51 A;  3KMJ A;  4O6F A;  5CCL A;  5JHN A;  3N71 A;  4YPU A;  5KJK A;  3KMT A;  1MT6 A;  5CPR B;  5HI7 A;  3OXF A;  4RZ0 A;  3M5A A;  3S7F A;  4J7I A;  2W5Z A;  3QWW A;  3MO2 A;  2RFI A;  4JLG A;  1PEG A;  4AU7 A;  3MO5 A;  5ARF A;  5T5G A;  5T0M A;  1N3J A;  3MO0 A;  3M53 A;  5EG2 A;  3M59 A;  1MVX A;  3CBM A;  3FPD A;  4LDG A;  4NVQ A;  5LSZ A;  4Z4P A;  5F5E A;  3S8P A;  3F9Y A;  5TTF A;  2O8J A;  4QEN A;  5F6L A;  4H12 A;  5JIY A;  4YNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...