3S7DA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 150
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7dA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7dA01
4B94A 4XI9A 3ZPJA 3MV3B 5JJ0A 3KS2A 5JIYA 3GZ1A 2VSYA 5F59A 3Q4AB 3CVPA 3RO2A 3U3WA 3CKCA 2P58C 4N3BA 3ESKA 4NVQA 2HR2A 2IFUA 5FT9A 4WNGA 4N3CA 4WUYA 4JL0A 1PEGA 2XCCA 2HO1A 3M58A 3QDNA 5KJLA 4UI9C 3RIBA 4G1TA 3SZ7A 3UQ3A 4GPKA 4ABNA 5JJ7A 4N5CA 4GCOA 1MUFA 4UI9K 1YA0A 1XNFA 3M55A 5AYWD 4APOA 1IYGA 3N71A 1H3IA 4GA0A 1Y8MA 4J8FA 4A1SA 4QEOA 5G04J 2XEVA 3NF1A 4GYWA 4BT8A 4YNDA 3LYAA 4GA2A 1QZ2A 3VV0A 3EDTB 4J8EA 3PDNA 5ARGA 3MO0A 4J7FA 4XI0A 3CK8A 3AS8A 4NJ5A 3FFLA 4NQ0A 2VGYA 2RFIA 5G04C 3CV0A 4U0ZA 3F9XA 1NZNA 1A17A 2JLBA 4CGWA 4I51A 3SF4A 3OPEA 4N2QA 3IHXA 4QENA 3BO5A 2LSVA 4E47A 4U0SA 4I9CA 1ZU2A 5G05C 3S7JA 2R3AA 4WNEA 3AS5A 4CDRA 4UQYA 3QOUA 4O30A 1MVHA 4U0UA 5DIZA 2YHCA 3MV2B 5KJNA 4YVQC 4GA1A 3URZA 5LCWC 5DBKA 3GW4A 4KXKB 4GZ6A 3CVLA 3F9ZA 4G23A 1WAO1 3PE3A 1KLXA 5FJYA 3DB5A 3F9YA 3LY7A 2G46A 5KJMA 4GYOA 4BT9A 2ONDA 4YNPA 2VGXB 3CKBA 1W3BA 4YPEA 2XCBA 3OXGA 4RG6A 1NA3A 5EX0A 3ZGQA 3M5AA 2O8JA 2UY1A 3BEEA 1MVXA 1WM5A 5FTPA 4BUPA 3CEQA 2FBNA 5JINA 3UPVA 3QKYA 4G2VA 1N6CA 2W5ZA 3Q49B 3M53A 4HOTA 4BTAA 4YVOA 3PE4A 4H7YA 4IJDA 3RAYA 2QFCA 4O6FA 3OXLA 1HZ4A 3ASDA 3VTYA 5AYFA 1TJCA 5M72A 2VYIA 3KMJA 2KCKA 2FF4A 3CVQA 2Q7FA 4YNMA 1OUVA 5A7DB 4BWRA 4N3AA 1XQHA 5A6CA 3ZFWA 1QQEA 3GYZA 3ZN3A 1FCHA 2MHKA 4FMUA 4MI5A 3CK9A 2Y4TA 4JLGA 4KBQA 1E96B 4HOUA 4I9EA 3TG5A 4I2ZA 3JYSA 5JHNA 3OXFA 5G05J 3KAEA 4AU7A 3VUZA 4GCNA 1KT0A 3MEKA 2PL2A 3LY8A 4C1QA 3MA5A 4J8DA 3SWCA 4U04A 4Y6CA 2I6HA 2BQZA 3RKVA 3HNAA 4G25A 3EP0A 2PZIA 4Z4PA 4GZ5A 2Y4UA 4UQXA 5CPRB 4QEPA 2WPVA 1O9SA 3CBOA 5T0KA 3OOIA 4G26A 4RZ0A 3U4TA 4CGVA 3OS5A 3Q5MA 1B89A 3FPDA 3S7FA 2FI7A 2KCVA 2VGXA 1IHGA 2WQHA 4LEUA 3R9AB 3O48A 3QWPA 4NRHB 3S7DA 3CK7A 3K5KA 5T0MA 5HQ8A 2V5FA 1PC2A 4IJ8A 2C0LA 2KATA 3VTXA 2DBAA 4I1AA 4UI9J 2OOEA 1N6AA 2W5YA 5HI7A 4N39A 2XGSA 3CBMA 1ML9A 4Y6WA 2AVPA 5EKQD 4F3VA 2JV0A 3FP3A 3SW9A 4N2SA 1NA0A 2UWJG 2L6JA 4I17A 3MO2A 2PQRA 3S8PA 4GYYA 5LSXA 5T5GA 3Q15A 3RO3A 3KMAA 3CBPA 3ZHEA 4U07A 5F6LA 4I2WA 4H12A 3M54A 4RG9A 3ASGA 3DALA 1HH8A 2IGQA 2R5SA 3KMTA 5BNWA 3S7BA 3GZ2A 3ULQA 2KCLA 2C2LA 5CCLA 4WNFA 5FZSA 2VQ2A 5BW8C 2PQNA 5EG2A 2UY1B 3M59A 2XPIA 3E4BA 3RJVA 3MO5A 4AM9A 2FEZA 5JJ6A 4WNDA 3QWVA 4JHRA 2VSNA 4GZ3A 3CVNA 4J8OA 4G24A 5F5EA 5F6KC 4JA7A 4KYOB 2QPWA 4H7XA 4J0UA 3ZHEB 3IEGA 5D0OD 3HYMB 2BUGA 5CCMA 5ARFA 4LDGA 4AY6A 5LCWJ 1ZKKA 2NC9A 3AS4A 1ZBPA 3LCAA 4W9RA 4YPUA 4EQFA 2F69A 3ASHA 2KC7A 2E2EA 4AY5A 5EX3A 3M56A 4HOSA 1P5QA 5C1DA 3LPZA 2J9QA 2LNIA 2XGMA 4IN3B 3Q47B 4XIFA 5TTFA 4HOQA 1ELRA 5JJTA 3TGOA 3F9WA 4J83A 4MI0A 3WXXA 1HXIA 2C0MA 3RQ4A 5D0QD 4BTBA 3QWWA 3TG4A 5FZRA 1MT6A 4AIFA 3FWVA 3UUXA 5BT1A 2IF4A 3K9IA 3KD7A 4JA9A 2HYZA 5LSZA 3MKRA 4J7IA 3RU0A 5TEGA 1ELWA 3TAXA 2LSUA 2YQ8A 5CHEE 5TH7A 5KJKA 3RJWA 4YPAA 4HORA 1KT1A 2FO7A 4UQZA 5FZQA 3LY9A 2XGOA 4JDSA 3ASFA 2GW1A 3LKUA 1N3JA 4ME2A 3M57A
chains in the Genus database with same CATH superfamily
1JWGA 3ZPJA 5JJ0A 5AJLA 3KS2A 1O5MA 2VSYA 2A4ZA 3Q4AB 3PH0C 3TWUA 3U3WA 2Y3AA 2P58C 4NVQA 1SVXA 5AQ9A 2IFUA 3LJ3A 5ANRA 4WUYA 4GTRA 1PEGA 3HRAA 3QDNA 1Y6IA 5KJLA 1L5JA 4UI9C 3UQ3A 1TNOA 3FUJA 3MYVA 5JJ7A 3IV0A 4GCOA 4B93B 3QC1A 3WG7E 3FUIA 4UI9K 4GZDA 1YA0A 4U63A 3D9JA 1XNFA 4U8HA 4JC8A 1D9SA 3L9TA 3N71A 4ANVA 1V55E 3QARA 3CVVA 1NL4A 3PZ2A 4YNDA 2IU1A 3SFXA 3HXBA 4MLPA 3VV0A 4FLHA 4J8EA 4I1OB 3ZRHA 3DSXA 4J7FA 3MO0A 3CK8A 5LFAA 4HI9A 3TWWA 3Q7FA 3RK6A 4NJ5A 1E8YA 5J08A 5ENQD 3IKOB 4C48B 5CECB 2P9KG 5G04C 4OVVA 2B0OE 3F9XA 3IHXA 1E8XA 4GU5A 3JCKC 3TWXA 3T8MA 2LSVA 4U0SA 1E7VA 4GMRA 3UT7A 5G05C 2V0PA 3AS5A 4UQYA 4MBGA 4TV3A 3DSUA 3HHMA 4O30A 2XQ0A 2YHCA 3MV2B 3HXFA 4YVQC 3PUKA 4KVMA 4KXKB 4G23A 3BUAA 1WAO1 3RAUA 5B3SE 4DPRA 3ZIMA 2G46A 4I1MA 4BT9A 2OEWA 1OWNA 3L08A 4X8QA 4GTVA 2WMOA 4RG6A 1NA3A 3M5AA 2O8JA 3BEEA 4GZCA 1HFAA 1MVXA 1WM5A 2GRRB 4WAFA 4AV7A 3HXCA 2VGEA 4NURA 4EHMA 5CBNA 3ZYKA 3Q49B 3M53A 2NXPA 4BTAA 3BG1B 3CQCB 4YVOA 3KSLA 4F53A 3B7TA 3Q9NC 3B7RL 1OWLA 5IY5E 4OAUC 3DXKG 5G2NA 2BKKB 3F6QA 3CVWA 1MX2A 4MKTA 2DVWA 3KMJA 2KCKA 2FF4A 3CVQA 2Q7FA 5HS0A 4N3AA 4J7WA 2VTBA 4Q69A 4GB9A 3ZFWA 4E6HA 4QFVA 2L0TB 4JB8P 4PUCA 1TNUA 2MHKA 1HG5A 1D8EA 3CHOA 5D2MC 5T3RA 4MI5A 2Y4TA 5ENSD 4WWNA 4DLQA 3L6AA 2DYRE 3U9WA 1E96B 2H6GA 4LG6A 3JYSA 5JHNA 4LNGA 5G05J 4UWGA 3KAEA 3VUZA 3B7BA 2PL2A 2BTDA 4C1QA 4J8DA 3D9LA 1HF8A 4Y6CA 3VLFA 3BU8A 3HIZA 1KZPA 2PZIA 5EILA 3TL5A 4LCTA 5CPRB 4NIKA 2WPVA 1KZOA 4GTQA 3OOIA 1LD7A 3AG1E 1S63A 2DZOA 3SD5A 4CGVA 3OS5A 3Q5MA 1TNYA 2YINA 5CBOA 2YHEA 4DJAA 5FWQA 5BPPA 3O48A 3HG0D 3QWPA 5KWDA 1S0PA 2V4LA 4NRHB 3CK7A 4CRWA 3FUNA 4IRUA 3CSFA 2OVBA 3MKQB 4ATZD 1E7UA 2DBAA 1OWPA 4Q94A 4N39A 2XGSA 1ML9A 1E8WA 3E34A 3IHYA 1H19A 5CEAA 1YMPA 1BPOA 2GGFA 3FP3A 3NAWA 3V2OA 3JQ0A 4N2SA 1UN8A 4GTSA 2WXLA 2H6FA 3HXEA 2PQRA 2DCPA 3RO3A 2IEJA 3SBTB 3RSEG 3TXMA 3G2VA 2WXMA 1TEZA 1BU9A 3ASGA 1HH8A 2IOLA 4RSYA 1H6KA 1JCRA 2YNQA 4IYPA 4I6JA 4O1PA 3ULQA 1K1BA 2VQ2A 1IKND 4QQIA 5HRYA 5BV1A 2Y69E 3MO5A 5B1BE 3HVEA 1U3DA 3C3RA 1IXVA 1SA5A 3CVNA 4G24A 5F5EA 3EHRA 4JA7A 4PS3A 4KYOB 5CRUA 5D0OD 5CCMA 5ARFA 4A1GA 1KPSB 4AY6A 4JPSA 3C3QA 3CHMA 4FU3A 1MYOA 1ZKKA 2NC9A 3ZUVB 3LCAA 4YPUA 3ASHA 4GTTA 1OWOA 2EIKE 1BI8B 3ULYA 4FJZA 1N0QA 3UI2A 2J8SD 5CEDB 5EX3A 4XEIG 4HOSA 1HX8A 2P9NG 1SA4A 4PS7A 2XGMA 3FDHA 2C0MA 3PZ4A 3RQ4A 4O60A 5D0QD 1TN8A 4CT4A 4BTBA 2J4BA 2ILRA 2X38A 3FWVA 1LTXA 4R7LA 3TWTA 2J09A 4DLOA 2WXPA 2XPYA 2R59A 3KD7A 4I6GA 3U64A 1IHBA 3TAXA 1OY3D 2E0IA 1KT1A 2IOSA 4UQZA 4IULA 5FZQA 2AW6A 1JWFA 4B8CB 5D66A 3DSSA 3T9KA 3Q75A 3C5RA 1A5EA 3E32A 4AJWA 2NYJA 2ZU6B 3FULA 3ZYMA 4U8VD 5F59A 2DYSE 3AG2E 4FULA 4XKBA 3CKCA 1Z5SC 1O1TA 3ZKJA 4N5QA 2HR2A 4HBDA 1O1RA 5FT9A 4JL0A 2HO1A 1TYQG 1UOHA 2KZTA 2F0YA 2CHWA 3W9FA 4G1TA 3SZ7A 4N5CA 5B1AE 1U3CA 2RFMA 1MUFA 2GROB 1IQRA 4LNUD 1MZCA 2I1JA 3G2UA 2R2LA 1IYGA 1JCQA 4A1SA 5G04J 2XEVA 3NF1A 5AENA 4BT8A 3LYAA 3CVYA 2PNNA 4GA2A 3KEAA 1QZ2A 2PM7A 3EDTB 3R7RA 3ZNGA 3EU9A 3PDNA 3CHRA 4XI0A 3Q78A 3PZ1A 2X6JA 2J4DA 4U0ZA 3BQOA 3SF4A 3OPEA 4QENA 3ZXSA 4UWLA 4GTPA 2RKKA 3ZXPA 3O4ZA 2XPZA 3SI5A 4OYSA 3JUEA 2ZISA 1MVHA 1K3ZD 4U0UA 4DX7D 2XEHA 3R9MA 3URZA 5LCWC 5DBKA 1TN7A 3GW4A 5T4YA 3VLEA 4HRNA 2ETCA 2MRIA 3CLJA 3CIAA 3PREA 3DEOA 1KLXA 3DB5A 4HLLA 4J6IA 4GYOA 3ESLA 3ZEFA 1TR4A 1EPUA 1FT2A 4YNPA 2VGXB 2EINE 2P9IG 4GMJA 5CMYA 2IONA 4BEPA 2I1KA 1INZA 1N4QA 5FTPA 3CEQA 2R02A 4PH4B 3HVEB 2RG8A 2OEVA 2J07A 2ZGDA 4HOTA 3FH8A 2WXRA 1MHQA 4JEUA 3PE4A 3RAYA 2WXFA 3FUHA 4CDNA 2LAIA 1N95A 5AYFA 2OCCE 3FU3A 4YNMA 3UX4A 3SHFA 5A6CA 3ZN3A 5KBAA 2M63A 3CK9A 4KBQA 4U7EB 5KNGA 2B6CA 4JHJA 1LD8A 4LNBA 4BX8A 3EHQA 4B8AA 3OXFA 5AJDA 4LSZE 2CHXA 2CG3A 2AXUA 2F8YA 3MA5A 5AN8A 2EILE 3SWCA 3EUVA 4LRZA 1DNPA 4U04A 3ZYQA 3HNAA 2OV8A 3CVXA 1PY1A 5LP0A 3FTXA 3RRUA 4UQXA 2F37A 3I3NA 3L22A 2ZXWE 5T0KA 1N11A 3L54A 3PNTB 4L23A 4FADA 2F8XK 3S7FA 4EBAA 1ELKA 2FI7A 2KCVA 4KZCA 2H6HA 1GW6A 3PZDA 3S7DA 5T0MA 1EYHA 3ISMC 5HQ8A 2P9UG 1OCRE 5AQAA 4APFA 1PC2A 4EPZA 3DSWA 3PEUB 3TJPA 3VTXA 1OCCE 2RFAA 5T8IA 2P9LG 4UI9J 1N6AA 2W5YA 5HI7A 4K5CA 3DRAA 5EKQD 4F3VA 3SW9A 1QNFA 2WXQA 2WXHA 3UIOC 4C0EA 1NA0A 3QB2A 1YCSB 2UWJG 2L6JA 3SQVA 4I17A 1X5BA 3ONKA 4F6RD 1HG2A 3S8PA 3X2QE 5T5GA 1RZ4A 2IO3C 2P9PG 5F6LA 2QY7A 3AG4E 2Y0BG 1FPPA 3GZSA 4L7TA 3M54A 4RG9A 3UT4A 5BXOA 2R5SA 2AXVA 4DX2A 3GZ2A 2X6IA 2KCLA 5E76A 2C2LA 2LAHA 5EIBE 5BW8C 2PQNA 5EG2A 4RQIA 2XPIA 3D9PA 3RJVA 3IXEA 5ENTD 4AM9A 3L16A 4JHRA 3Q7AA 3AU5A 2VSNA 4EZKA 2X6HA 2QPWA 4YDYA 2EIJE 4J0UA 4BESA 4FLBA 2BUGA 3UIPC 4LDGA 2V8SE 5LCWJ 3AS4A 2IY0C 3FU5A 4ZHBA 3LDZA 3DEPA 2HM8A 4AEZC 2E2EA 3L13A 4ILIA 1P5QA 4IN3B 3Q47B 5EN5D 4B0ZA 5TTFA 3HDXA 3TGOA 3C3OA 1G3NB 3FTVA 3WXXA 2XRYA 4UWFA 5A23A 2VJ8A 4DK5A 5FZRA 2R05A 4JVSA 2QYJA 5AQ7A 3TWQA 5AIJA 4GAAA 5BT1A 4JA9A 2HYZA 4G8KA 5LSZA 2WVIA 4F1SA 2YQ8A 4FHJA 3D9NA 4YDWA 4ZFHA 4G11A 4L9PA 3R7QA 2XGOA 4JDSA 3ABME 3LKUA 3LVRE 4XI9A 5JIYA 3MV3B 4CT0A 3PS6A 3Q73A 3PRZA 4N3BA 3EJNA 4WNGA 4HS2A 4N3CA 4C9BB 4JXTA 2XCCA 3NQPA 4HNAD 3AG3E 1OXJA 4GPKA 3E33A 5LOZA 3MKQA 5J90A 2WM9A 4BSZB 3SO8A 2AJAA 3FHEA 3AJIA 4A3TA 4QEOA 1EF1C 4WWOA 5AQBA 1H2VC 3RRMB 4ACKA 3DSVA 1VDYA 5ARGA 2VTBB 5EDSA 4TXRA 3FFLA 5G55A 2VGYA 4KT6B 4DX5D 4JZYA 2LXMA 4I6EA 1N4RA 2JLBA 2XZTG 4N2QA 3ZYLA 3FEYA 3BO5A 4E47A 4I9CA 4TUMA 1ZU2A 3S7JA 2R3AA 1SW6A 4K03A 4CDRA 4DX6D 3QOUA 4MRUA 2V5QC 5DIZA 1E8ZA 4FA6A 3F9ZA 3CVLA 1BLXB 1HU3A 3PE3A 1X81A 3D9HA 4DX1A 3F9YA 3LY7A 3V31A 3EIJA 2WXOA 2KBXA 2OVFA 4U96D 1W3BA 2XCBA 3OXGA 3FTUA 5EX0A 2EIME 1QBQA 2WQ6A 2DWZA 3G2TA 3FH7A 1UW4B 3TXNA 1HE8A 2FBNA 5JINA 4K5BA 4G2VA 2W5ZA 4V3IA 4G8LA 4BERA 4IJDA 1TN6A 3OXLA 3G2SA 1SZ9A 1TJCA 2R03A 5M72A 2VYIA 4AVXA 4HVBA 3NOGD 3L17A 4UUCA 1XGWA 4DUIA 1XQHA 4BSXA 3TWSA 3E37A 5LX8A 2WB2A 1FCHA 4FMUA 3SBSA 1H2TC 4JLGA 2P2CP 4HOUA 1Z3YA 4I9EA 3MJWA 3TG5A 3FTSA 3Q79A 5HKPA 3ZW3A 1MX6A 4AU7A 5BXUA 1KT0A 2LXLA 2BF0X 4F7AA 2KZTB 3PNLB 4PDXA 1EDUA 2I6HA 3NBNB 2BQZA 3RKVA 1MJ0A 3RRNB 2QZAA 3EP0A 4GZ5A 4XZ4A 2Y4UA 4AXHA 5FINA 3CHPA 3IHVA 4ANXA 4RZ0A 1UN9A 1DCQA 3B13A 1B89A 4JD2G 2RD0A 1K8KG 1Z3XA 3DSTA 2WQHA 4U95D 5ENRD 4LEUA 3FY4A 3I4GA 3R9AB 2L9BA 1N54A 3K5KA 3UM2A 2MOWA 3T8KA 3SY2A 5H7PA 2C0LA 1FVFA 2OOEA 4HI8A 3FTYA 1Z6TA 5CERB 2CFUA 4Z68A 2AVPA 5KNHD 3PUJA 3V30A 5ANLA 4BFRA 2KXPC 3UM0A 2XHEA 3ZU7B 1DCEA 2QYUA 4K0RA 3MO2A 4GYYA 5LSXA 3Q15A 1LF8A 3LS8A 1NP7A 4O1OA 4A3VA 5FIOA 3BG0B 4I2WA 1AWCB 2XS1A 4JW1A 3DALA 4XKCA 2H6IA 5KCMA 3UM3A 3E30A 3S7BA 3UT8A 2WXNA 3J5QB 4HB5A 5CCLA 1JCSA 4GTOA 4WNFA 2IQCA 2UY1B 3M59A 2DIWA 3SFZA 3J5PA 4FP7A 1H6PA 5FQ7A 4ACLA 5JJ6A 3QAQA 4WNDA 4DI3A 3QWVA 4J8OA 4FJYA 3FUMA 3B7SA 5F6KC 1OCZE 3UKRG 1Q2ZA 3ZHEB 3C72A 1D8DA 4RVBA 4GMLA 4JHKA 1ZBPA 4W9RA 1O1SA 2LUHA 2BKGA 4EQFA 2HE0A 2ZIRA 3EIQC 2LO6A 2KC7A 4AY5A 1UJJA 5EYLA 2EQXA 3SNXA 3LPZA 2J9QA 2LNIA 4F1PA 4XIFA 5JJTA 3CR3A 3V2XA 3V79K 3CSTA 3C98A 3F9WA 4J83A 3TWVA 1HXIA 3I4RB 3P2BA 3PZ3A 2I9CA 3JXIA 5JHBA 2P9SG 1OWMA 2X3MA 2CHZA 3TG4A 4BY6A 4E85A 3UUXA 1BD8A 2IF4A 3CQGB 1ZB1A 1AP7A 4J7IA 4K5AB 3OTNA 3RU0A 1YYHA 5TEGA 1ELWA 1NFIE 3LXUX 4J8SA 5KJKA 1N4PA 3RJWA 3L82A 4YPAA 4JEHA 4HORA 5ENPD 3AU4A 4HLEA 4ATGA 3ASFA 1V54E 2GW1A 1N3JA 3IBEA 3B7UX 2WQ7A 4B94A 1S70B 3GZ1A 1QYMA 1H6OA 3CVPA 3RO2A 4XX5A 3UINC 3ESKA 3U66A 3SGHA 5ENNA 3T5XA 2R17C 3W9GA 3M58A 2GRPB 3RIBA 3MX3A 3FU6A 3FUDA 3ML8A 4ABNA 4RLYA 2J49A 1U2VG 3D9IA 4HFGA 3M55A 5AYWD 2X6FA 4APOA 3CHQA 1H3IA 4GA0A 1Y8MA 4J8FA 4B89A 4GYWA 2WXIA 3DPYA 4EECA 3FH5A 3AAAC 4EZJA 4UWKA 1WG0A 3AS8A 4PS8A 3APDA 2L0IA 3UKUG 4NQ0A 2RFIA 2GRMA 2BEDA 1N4SA 4CEMA 1HS6A 1TNBA 3CV0A 3ABLE 1NZNA 1A17A 4KVOA 4I51A 4CGWA 4XE0A 3MZLB 3NOCD 3CGHA 2JEKA 4ANUA 1SZAA 4WNEA 3LJNA 1NI1A 1N9AA 3D9OA 1PAQA 5KJNA 2KM4A 4GA1A 4GZ6A 4DI4A 2I2OA 5FJYA 3JQ1A 5KJMA 4KZ0A 4OAVB 2ONDA 4URKA 2MYOA 3CKBA 1DC2A 4YPEA 1MX4A 3ZGQA 2UY1A 3ASOE 4BUPA 1WY6A 3UPVA 3QKYA 1N6CA 1UJKA 4UWHA 4FC8A 4MS6A 3LVQE 5BUZA 3CHSA 5JHAA 5ITZF 2PM6A 4H7YA 2QFCA 4O6FA 5CRVA 2WXKA 3QNKA 3B95A 4LERA 1HZ4A 3ASDA 3Q9UC 5EIDA 3VTYA 3QK0A 3LEWA 5BV0A 3T5VA 2Y1LE 1OUVA 5A7DB 4BWRA 2ETAA 2GRNB 3MCXA 4C0MA 3HXDA 1QQEA 3GYZA 3D9MA 3EU5A 2JABA 2V4HC 3ONLA 3JUIA 3DXMG 4I2ZA 2AXZA 3FUEA 5JA4D 4GCNA 1IQUA 3MEKA 3LY8A 4ANWA 1FT1A 2CG2A 2WXJA 3I5PA 2IO2C 4BETA 3DBSA 4CCAA 3ABKE 3CVUA 5EYPF 2NSZA 4G25A 2XS8A 4Z4PA 5JMND 4QEPA 1O9SA 3CBOA 1E90A 4G26A 4YDEA 3U4TA 1MQSA 1RW2A 4WWPA 3FPDA 3NZUA 1DVPA 1H0AA 3UM1A 4L2LA 2VGXA 4TXPA 1IHGA 4Q96A 1TJFA 3PVLA 3MGBA 4GPMA 2V5FA 3QJZA 5AARA 3D3MA 5FQ8A 2A5EA 2AWIA 2WXGA 4IJ8A 1FVHA 2KATA 4A63B 4I1AA 1JPLA 3OAWA 3CBMA 4Y6WA 4A55A 1N52A 4L1BA 2JV0A 1UG3A 3FUKA 2VSOE 4YDOA 3UTMA 4BX9A 3FTZA 3P1UA 1OT8A 4CDMA 3FTWA 2X6KA 3KMAA 5ENOD 3CBPA 3ZHEA 4U07A 3ASNE 3FU0A 4CYMD 3DPDA 4H12A 4NACA 4TXQA 4D10C 4FHKA 2IGQA 3PEVB 3KMTA 5BNWA 2ETBA 4HQDA 4AOFA 2XZDG 5FZSA 4P29A 2L6BA 2A5UA 1S64A 3ML9A 4CZ2D 4HRMB 2VSXE 3E4BA 1OCOE 4EZLA 2FEZA 3FUFA 2GRQB 3ENEA 1K1AA 1WDYA 4GZ3A 3FEXA 4GTMA 1H2UA 1N94A 4M7CA 4H7XA 3KEZA 3IEGA 2FULA 3HYMB 4KMOA 2QC9A 3TWRA 4DRXE 3NB2A 2ZGGA 4U8YD 4EBAG 3JXJA 2F69A 5CMWA 2XEEA 4J8YA 5AAOA 1SQMA 3VLDA 2IJGX 3S2AA 5E75A 3M56A 2XRZA 5C2YA 3KSQA 3UMVA 3ULEG 5C1DA 4AP2A 3UXGA 3G2WA 4TRQA 4HOQA 1ELRA 2DZNA 3ZVVA 4MI0A 4HXIA 3QWWA 4I43A 1MT6A 4AIFA 4ILGA 1HO8A 2FO1E 4TUUA 1TNZA 3NZSA 3APFA 2WMNA 5FQ6A 3K9IA 3APCA 5FQ4A 4OVUA 1JUQA 4ILHB 1N0RA 3DWLG 3MKRA 2GRLA 4L2YA 3EHNA 3D9KA 4M3OA 2LSUA 1BI7B 5CHEE 5TH7A 3SFYA 2J08A 2FO7A 3EHMA 3LY9A 2XENA 4LUNU 4HRLA 2CFZA 4ME2A 3M57A
chains in the Genus database with same CATH topology
3B7UX 3LVRE 1JWGA 4B94A 2WQ7A 4XI9A 3ZPJA 3MV3B 5AJLA 3KS2A 4CT0A 3FULA 3GZ1A 2VSYA 3ZYMA 3PS6A 2A4ZA 3Q4AB 5F59A 3CVPA 3PH0C 3RO2A 4FULA 3PRZA 5JJ0A 4XKBA 3U3WA 3CKCA 4XX5A 2Y3AA 2P58C 4N3BA 3EJNA 3ESKA 3U66A 4NVQA 2HR2A 2IFUA 3LJ3A 5ANRA 5FT9A 3SGHA 4WNGA 4HS2A 4N3CA 4WUYA 4C9BB 5ENNA 3T5XA 4JXTA 2R17C 4JL0A 1PEGA 2XCCA 3NQPA 2HO1A 3M58A 2KZTA 1Y6IA 3QDNA 5KJLA 1L5JA 2CHWA 4UI9C 3RIBA 3MX3A 3FU6A 4G1TA 3SZ7A 3FUDA 3UQ3A 3FUJA 3MYVA 3ML8A 4GPKA 4ABNA 5JJ7A 4N5CA 3IV0A 4GCOA 3QC1A 1U3CA 1MUFA 3FUIA 5LOZA 4UI9K 2J49A 3MKQA 4GZDA 3D9IA 1IQRA 1YA0A 4U63A 5J90A 2WM9A 3D9JA 1XNFA 2I1JA 3G2UA 4HFGA 4U8HA 3M55A 5AYWD 2X6FA 4APOA 4JC8A 1IYGA 3N71A 4ANVA 3CHQA 1H3IA 3QARA 3FHEA 4GA0A 1Y8MA 4J8FA 4B89A 4A1SA 4A3TA 4QEOA 5G04J 1EF1C 3CVVA 2XEVA 3NF1A 4GYWA 2WXIA 5AENA 4BT8A 4WWOA 4YNDA 3LYAA 2IU1A 4EECA 3CVYA 1H2VC 4GA2A 3RRMB 3FH5A 1QZ2A 2PM7A 4MLPA 4EZJA 3VV0A 4FLHA 3EDTB 4J8EA 4I1OB 3R7RA 3ZRHA 4ACKA 4UWKA 3PDNA 5ARGA 1VDYA 3CHRA 4XI0A 3MO0A 2VTBB 4J7FA 5EDSA 3CK8A 3AS8A 4PS8A 5LFAA 3RK6A 2X6JA 3APDA 4NJ5A 2L0IA 3FFLA 1E8YA 4NQ0A 5G55A 5J08A 3IKOB 2VGYA 2RFIA 2GRMA 2J4DA 4KT6B 4CEMA 1HS6A 5G04C 4JZYA 3CV0A 4U0ZA 4OVVA 4I6EA 3F9XA 1NZNA 1A17A 4KVOA 2JLBA 4CGWA 4XE0A 3MZLB 3SF4A 3OPEA 4I51A 4N2QA 3IHXA 1E8XA 4QENA 3ZYLA 3FEYA 4GU5A 3ZXSA 3CGHA 3JCKC 3BO5A 3T8MA 2JEKA 4UWLA 2LSVA 4E47A 4U0SA 1E7VA 4I9CA 3UT7A 1ZU2A 5G05C 3S7JA 4ANUA 2V0PA 1SZAA 2R3AA 3O4ZA 4WNEA 2XPZA 3AS5A 3SI5A 4K03A 4CDRA 4UQYA 4TV3A 3QOUA 4OYSA 3HHMA 4MRUA 3D9OA 4O30A 2XQ0A 1MVHA 4U0UA 1PAQA 2YHCA 1E8ZA 5DIZA 3MV2B 5KJNA 2KM4A 4YVQC 3PUKA 4FA6A 4GA1A 3URZA 5LCWC 5DBKA 3GW4A 5T4YA 3VLEA 4KVMA 4KXKB 3CVLA 2MRIA 4GZ6A 4DI4A 3F9ZA 4G23A 2I2OA 3CLJA 1WAO1 1HU3A 3CIAA 3PE3A 3PREA 1KLXA 5FJYA 3DB5A 4DPRA 3F9YA 3JQ1A 3LY7A 3ZIMA 2G46A 4J6IA 5KJMA 4KZ0A 3EIJA 4GYOA 4I1MA 4BT9A 3ESLA 3ZEFA 1OWNA 2WXOA 3L08A 1EPUA 2ONDA 2OVFA 4YNPA 4URKA 2VGXB 3CKBA 1W3BA 4GMJA 4YPEA 2XCBA 3OXGA 2WMOA 4RG6A 1NA3A 3FTUA 5EX0A 3ZGQA 5CMYA 3M5AA 2IONA 2O8JA 2UY1A 3BEEA 4GZCA 1HFAA 1MVXA 2I1KA 1INZA 2WQ6A 1WM5A 3G2TA 3FH7A 1UW4B 4WAFA 5FTPA 4BUPA 3CEQA 4AV7A 1WY6A 1HE8A 3TXNA 2FBNA 4NURA 5JINA 4PH4B 3HVEB 2RG8A 3UPVA 3QKYA 2J07A 4G2VA 1N6CA 1UJKA 2W5ZA 4UWHA 3ZYKA 3Q49B 3M53A 2NXPA 4HOTA 4V3IA 4FC8A 3FH8A 3LVQE 4MS6A 2WXRA 3BG1B 4BTAA 5BUZA 3CHSA 1MHQA 3CQCB 5JHAA 4YVOA 4JEUA 3PE4A 2PM6A 4H7YA 3B7TA 4F53A 4IJDA 3RAYA 2QFCA 4O6FA 2WXFA 3B7RL 1OWLA 3FUHA 3OXLA 5G2NA 4CDNA 2WXKA 3G2SA 2LAIA 3QNKA 1SZ9A 3CVWA 4LERA 4MKTA 1HZ4A 3ASDA 3VTYA 5AYFA 1TJCA 5M72A 2VYIA 4AVXA 3KMJA 2KCKA 2FF4A 3CVQA 3QK0A 2Q7FA 3LEWA 5BV0A 4HVBA 3T5VA 3L17A 3FU3A 4YNMA 1OUVA 1XGWA 5A7DB 4BWRA 4N3AA 2VTBA 1XQHA 3UX4A 3SHFA 4BSXA 4Q69A 5A6CA 4GB9A 3MCXA 3ZFWA 4C0MA 4E6HA 4QFVA 2L0TB 1QQEA 3GYZA 5LX8A 3ZN3A 4PUCA 2WB2A 3D9MA 1FCHA 2MHKA 1HG5A 5T3RA 3CHOA 4FMUA 2M63A 3SBSA 4MI5A 3CK9A 2Y4TA 3ONLA 3JUIA 4WWNA 1H2TC 3L6AA 4DLQA 4JLGA 4KBQA 3U9WA 1E96B 1Z3YA 4HOUA 4I9EA 3MJWA 3TG5A 4JHJA 4I2ZA 2AXZA 3FTSA 3FUEA 3JYSA 4BX8A 5JHNA 4B8AA 3ZW3A 3OXFA 5AJDA 5G05J 2CHXA 4UWGA 3KAEA 2CG3A 4AU7A 3VUZA 2AXUA 4GCNA 1IQUA 1KT0A 3MEKA 2PL2A 3LY8A 2BF0X 4ANWA 2BTDA 2CG2A 4F7AA 4C1QA 3MA5A 4J8DA 2KZTB 3D9LA 3PNLB 4PDXA 2WXJA 3I5PA 1HF8A 3SWCA 4LRZA 1EDUA 1DNPA 3DBSA 4U04A 4Y6CA 2I6HA 3ZYQA 4CCAA 2BQZA 3CVUA 3RKVA 3HNAA 3VLFA 2NSZA 2OV8A 3HIZA 3CVXA 3RRNB 4G25A 1PY1A 3EP0A 5LP0A 2PZIA 4Z4PA 3FTXA 4GZ5A 4XZ4A 3RRUA 3TL5A 2Y4UA 4LCTA 4UQXA 4AXHA 5CPRB 3I3NA 2WPVA 3L22A 1O9SA 4QEPA 3CHPA 3CBOA 1E90A 5T0KA 3IHVA 4G26A 3OOIA 4ANXA 4RZ0A 3U4TA 1UN9A 3L54A 3PNTB 1MQSA 3SD5A 4CGVA 4L23A 3B13A 3OS5A 3Q5MA 4WWPA 1B89A 4FADA 3NZUA 1DVPA 3FPDA 3S7FA 4EBAA 1ELKA 2YINA 2RD0A 1H0AA 2FI7A 2YHEA 4L2LA 2KCVA 4DJAA 2VGXA 5FWQA 1IHGA 1Z3XA 4KZCA 2WQHA 4LEUA 3FY4A 5BPPA 3I4GA 3R9AB 4Q96A 3O48A 3QWPA 2L9BA 1N54A 1GW6A 1TJFA 3PZDA 1S0PA 2V4LA 4NRHB 3PVLA 3S7DA 3CK7A 4CRWA 3MGBA 3K5KA 5T0MA 1EYHA 3FUNA 5HQ8A 2V5FA 3QJZA 4IRUA 2MOWA 3D3MA 4APFA 5FQ8A 3CSFA 2OVBA 1PC2A 2AWIA 3MKQB 1E7UA 2WXGA 4EPZA 4IJ8A 3PEUB 1FVHA 2C0LA 2KATA 3TJPA 3VTXA 2DBAA 1FVFA 1OWPA 4I1AA 1JPLA 5T8IA 4UI9J 2OOEA 3OAWA 3FTYA 4Q94A 5HI7A 1N6AA 2W5YA 1Z6TA 4N39A 2XGSA 3CBMA 2CFUA 1ML9A 1E8WA 4Y6WA 2AVPA 4A55A 3IHYA 1H19A 1N52A 5EKQD 4L1BA 1BPOA 2GGFA 4F3VA 2JV0A 3FP3A 3SW9A 3PUJA 1UG3A 3JQ0A 4N2SA 1QNFA 3FUKA 1UN8A 2VSOE 5ANLA 2WXQA 2WXHA 4C0EA 4BFRA 1NA0A 3QB2A 2UWJG 2L6JA 2XHEA 4BX9A 3FTZA 3P1UA 4CDMA 2WXLA 3FTWA 4K0RA 4I17A 2X6KA 1X5BA 3MO2A 3ONKA 1HG2A 2PQRA 3S8PA 4GYYA 5LSXA 2DCPA 5T5GA 3Q15A 3RO3A 3KMAA 1LF8A 3LS8A 1NP7A 3SBTB 3ZHEA 3CBPA 4U07A 4A3VA 5F6LA 3TXMA 3FU0A 3G2VA 2QY7A 2WXMA 3BG0B 3DPDA 3GZSA 4I2WA 4L7TA 1TEZA 4H12A 4JW1A 4NACA 4RG9A 3ASGA 4D10C 3M54A 3UT4A 3DALA 4XKCA 4FHKA 1HH8A 5KCMA 2IOLA 2IGQA 5JIYA 3PEVB 4RSYA 1H6KA 2R5SA 2AXVA 2YNQA 3KMTA 4IYPA 4I6JA 3S7BA 3UT8A 3GZ2A 5BNWA 3ULQA 2WXNA 2X6IA 2KCLA 5E76A 2C2LA 2LAHA 5CCLA 4WNFA 4AOFA 5FZSA 2IQCA 2VQ2A 5BW8C 2PQNA 4P29A 5EG2A 2A5UA 2UY1B 3ML9A 3M59A 2DIWA 2XPIA 3SFZA 2VSXE 4FP7A 3E4BA 3D9PA 3RJVA 5BV1A 3MO5A 4AM9A 4EZLA 2FEZA 3HVEA 5FQ7A 1U3DA 3L16A 4ACLA 5JJ6A 3QAQA 4WNDA 4DI3A 3FUFA 3QWVA 4JHRA 3ENEA 3AU5A 2VSNA 4GZ3A 3CVNA 4EZKA 3FEXA 2X6HA 4FJYA 3FUMA 3B7SA 4G24A 4JA7A 4PS3A 5F5EA 5F6KC 4KYOB 2QPWA 1H2UA 4H7XA 3KEZA 4J0UA 3ZHEB 3IEGA 2FULA 3HYMB 4FLBA 5D0OD 2BUGA 5CCMA 5ARFA 4A1GA 4KMOA 4LDGA 4RVBA 4AY6A 4JPSA 4GMLA 2V8SE 3CHMA 4FU3A 5LCWJ 1ZKKA 4JHKA 2NC9A 3AS4A 1ZBPA 3FU5A 3LCAA 4W9RA 4YPUA 3LDZA 4EBAG 2HM8A 4EQFA 2F69A 5CMWA 3EIQC 3ASHA 2LO6A 1OWOA 4AEZC 4FJZA 1SQMA 2KC7A 3VLDA 2E2EA 2IJGX 3S2AA 4AY5A 5E75A 5EX3A 1UJJA 3L13A 2XRZA 5C2YA 3M56A 3UMVA 2EQXA 4HOSA 3SNXA 4ILIA 1HX8A 1P5QA 5C1DA 3LPZA 2J9QA 2LNIA 4PS7A 4AP2A 2XGMA 4IN3B 3Q47B 4XIFA 3FDHA 3G2WA 4B0ZA 4TRQA 5TTFA 4HOQA 1ELRA 3HDXA 5JJTA 3CR3A 3ZVVA 3TGOA 3CSTA 3C98A 3F9WA 4J83A 4MI0A 3FTVA 3WXXA 1HXIA 2XRYA 2C0MA 3I4RB 3P2BA 4UWFA 5A23A 3RQ4A 2I9CA 5D0QD 4CT4A 5JHBA 1OWMA 2J4BA 2CHZA 2VJ8A 2X3MA 3QWWA 4HXIA 4BTBA 4DK5A 3TG4A 4I43A 5FZRA 4BY6A 2ILRA 2X38A 4JVSA 1MT6A 4AIFA 4ILGA 1HO8A 3FWVA 4TUUA 4R7LA 4E85A 5AIJA 4GAAA 3UUXA 2J09A 3NZSA 4DLOA 2WXPA 5BT1A 2XPYA 2R59A 3APFA 2IF4A 2WMNA 3CQGB 5FQ6A 3K9IA 3APCA 3KD7A 2HYZA 4JA9A 4OVUA 5FQ4A 1JUQA 4ILHB 4J8OA 4I6GA 5LSZA 3MKRA 3U64A 4J7IA 3OTNA 2GRLA 4L2YA 3RU0A 3EHNA 2WVIA 5TEGA 3D9KA 1ELWA 3LXUX 4M3OA 4J8SA 3TAXA 4F1SA 2LSUA 2YQ8A 4FHJA 5CHEE 5TH7A 5KJKA 3RJWA 3D9NA 2J08A 2E0IA 1KT1A 4JEHA 4HORA 2IOSA 2FO7A 4UQZA 4YPAA 3AU4A 4IULA 4G11A 5FZQA 3EHMA 3LY9A 2AW6A 1JWFA 4LUNU 3R7QA 4HLEA 4B8CB 2XGOA 4ATGA 2CFZA 4JDSA 3ASFA 2GW1A 3LKUA 1N3JA 4ME2A 3IBEA 3M57A 4AJWA 2ZU6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B94 A;  4XI9 A;  3ZPJ A;  3MV3 B;  5JJ0 A;  3KS2 A;  5JIY A;  3GZ1 A;  2VSY A;  5F59 A;  3Q4A B;  3CVP A;  3RO2 A;  3U3W A;  3CKC A;  2P58 C;  4N3B A;  3ESK A;  4NVQ A;  2HR2 A;  2IFU A;  5FT9 A;  4WNG A;  4N3C A;  4WUY A;  4JL0 A;  1PEG A;  2XCC A;  2HO1 A;  3M58 A;  3QDN A;  5KJL A;  4UI9 C;  3RIB A;  4G1T A;  3SZ7 A;  3UQ3 A;  4GPK A;  4ABN A;  5JJ7 A;  4N5C A;  4GCO A;  1MUF A;  4UI9 K;  1YA0 A;  1XNF A;  3M55 A;  5AYW D;  4APO A;  1IYG A;  3N71 A;  1H3I A;  4GA0 A;  1Y8M A;  4J8F A;  4A1S A;  4QEO A;  5G04 J;  2XEV A;  3NF1 A;  4GYW A;  4BT8 A;  4YND A;  3LYA A;  4GA2 A;  1QZ2 A;  3VV0 A;  3EDT B;  4J8E A;  3PDN A;  5ARG A;  3MO0 A;  4J7F A;  4XI0 A;  3CK8 A;  3AS8 A;  4NJ5 A;  3FFL A;  4NQ0 A;  2VGY A;  2RFI A;  5G04 C;  3CV0 A;  4U0Z A;  3F9X A;  1NZN A;  1A17 A;  2JLB A;  4CGW A;  4I51 A;  3SF4 A;  3OPE A;  4N2Q A;  3IHX A;  4QEN A;  3BO5 A;  2LSV A;  4E47 A;  4U0S A;  4I9C A;  1ZU2 A;  5G05 C;  3S7J A;  2R3A A;  4WNE A;  3AS5 A;  4CDR A;  4UQY A;  3QOU A;  4O30 A;  1MVH A;  4U0U A;  5DIZ A;  2YHC A;  3MV2 B;  5KJN A;  4YVQ C;  4GA1 A;  3URZ A;  5LCW C;  5DBK A;  3GW4 A;  4KXK B;  4GZ6 A;  3CVL A;  3F9Z A;  4G23 A;  1WAO 1;  3PE3 A;  1KLX A;  5FJY A;  3DB5 A;  3F9Y A;  3LY7 A;  2G46 A;  5KJM A;  4GYO A;  4BT9 A;  2OND A;  4YNP A;  2VGX B;  3CKB A;  1W3B A;  4YPE A;  2XCB A;  3OXG A;  4RG6 A;  1NA3 A;  5EX0 A;  3ZGQ A;  3M5A A;  2O8J A;  2UY1 A;  3BEE A;  1MVX A;  1WM5 A;  5FTP A;  4BUP A;  3CEQ A;  2FBN A;  5JIN A;  3UPV A;  3QKY A;  4G2V A;  1N6C A;  2W5Z A;  3Q49 B;  3M53 A;  4HOT A;  4BTA A;  4YVO A;  3PE4 A;  4H7Y A;  4IJD A;  3RAY A;  2QFC A;  4O6F A;  3OXL A;  1HZ4 A;  3ASD A;  3VTY A;  5AYF A;  1TJC A;  5M72 A;  2VYI A;  3KMJ A;  2KCK A;  2FF4 A;  3CVQ A;  2Q7F A;  4YNM A;  1OUV A;  5A7D B;  4BWR A;  4N3A A;  1XQH A;  5A6C A;  3ZFW A;  1QQE A;  3GYZ A;  3ZN3 A;  1FCH A;  2MHK A;  4FMU A;  4MI5 A;  3CK9 A;  2Y4T A;  4JLG A;  4KBQ A;  1E96 B;  4HOU A;  4I9E A;  3TG5 A;  4I2Z A;  3JYS A;  5JHN A;  3OXF A;  5G05 J;  3KAE A;  4AU7 A;  3VUZ A;  4GCN A;  1KT0 A;  3MEK A;  2PL2 A;  3LY8 A;  4C1Q A;  3MA5 A;  4J8D A;  3SWC A;  4U04 A;  4Y6C A;  2I6H A;  2BQZ A;  3RKV A;  3HNA A;  4G25 A;  3EP0 A;  2PZI A;  4Z4P A;  4GZ5 A;  2Y4U A;  4UQX A;  5CPR B;  4QEP A;  2WPV A;  1O9S A;  3CBO A;  5T0K A;  3OOI A;  4G26 A;  4RZ0 A;  3U4T A;  4CGV A;  3OS5 A;  3Q5M A;  1B89 A;  3FPD A;  3S7F A;  2FI7 A;  2KCV A;  2VGX A;  1IHG A;  2WQH A;  4LEU A;  3R9A B;  3O48 A;  3QWP A;  4NRH B;  3S7D A;  3CK7 A;  3K5K A;  5T0M A;  5HQ8 A;  2V5F A;  1PC2 A;  4IJ8 A;  2C0L A;  2KAT A;  3VTX A;  2DBA A;  4I1A A;  4UI9 J;  2OOE A;  1N6A A;  2W5Y A;  5HI7 A;  4N39 A;  2XGS A;  3CBM A;  1ML9 A;  4Y6W A;  2AVP A;  5EKQ D;  4F3V A;  2JV0 A;  3FP3 A;  3SW9 A;  4N2S A;  1NA0 A;  2UWJ G;  2L6J A;  4I17 A;  3MO2 A;  2PQR A;  3S8P A;  4GYY A;  5LSX A;  5T5G A;  3Q15 A;  3RO3 A;  3KMA A;  3CBP A;  3ZHE A;  4U07 A;  5F6L A;  4I2W A;  4H12 A;  3M54 A;  4RG9 A;  3ASG A;  3DAL A;  1HH8 A;  2IGQ A;  2R5S A;  3KMT A;  5BNW A;  3S7B A;  3GZ2 A;  3ULQ A;  2KCL A;  2C2L A;  5CCL A;  4WNF A;  5FZS A;  2VQ2 A;  5BW8 C;  2PQN A;  5EG2 A;  2UY1 B;  3M59 A;  2XPI A;  3E4B A;  3RJV A;  3MO5 A;  4AM9 A;  2FEZ A;  5JJ6 A;  4WND A;  3QWV A;  4JHR A;  2VSN A;  4GZ3 A;  3CVN A;  4J8O A;  4G24 A;  5F5E A;  5F6K C;  4JA7 A;  4KYO B;  2QPW A;  4H7X A;  4J0U A;  3ZHE B;  3IEG A;  5D0O D;  3HYM B;  2BUG A;  5CCM A;  5ARF A;  4LDG A;  4AY6 A;  5LCW J;  1ZKK A;  2NC9 A;  3AS4 A;  1ZBP A;  3LCA A;  4W9R A;  4YPU A;  4EQF A;  2F69 A;  3ASH A;  2KC7 A;  2E2E A;  4AY5 A;  5EX3 A;  3M56 A;  4HOS A;  1P5Q A;  5C1D A;  3LPZ A;  2J9Q A;  2LNI A;  2XGM A;  4IN3 B;  3Q47 B;  4XIF A;  5TTF A;  4HOQ A;  1ELR A;  5JJT A;  3TGO A;  3F9W A;  4J83 A;  4MI0 A;  3WXX A;  1HXI A;  2C0M A;  3RQ4 A;  5D0Q D;  4BTB A;  3QWW A;  3TG4 A;  5FZR A;  1MT6 A;  4AIF A;  3FWV A;  3UUX A;  5BT1 A;  2IF4 A;  3K9I A;  3KD7 A;  4JA9 A;  2HYZ A;  5LSZ A;  3MKR A;  4J7I A;  3RU0 A;  5TEG A;  1ELW A;  3TAX A;  2LSU A;  2YQ8 A;  5CHE E;  5TH7 A;  5KJK A;  3RJW A;  4YPA A;  4HOR A;  1KT1 A;  2FO7 A;  4UQZ A;  5FZQ A;  3LY9 A;  2XGO A;  4JDS A;  3ASF A;  2GW1 A;  3LKU A;  1N3J A;  4ME2 A;  3M57 A; 
#chains in the Genus database with same CATH topology
 1JWG A;  3ZPJ A;  5JJ0 A;  5AJL A;  3KS2 A;  1O5M A;  2VSY A;  2A4Z A;  3Q4A B;  3PH0 C;  3TWU A;  3U3W A;  2Y3A A;  2P58 C;  4NVQ A;  1SVX A;  5AQ9 A;  2IFU A;  3LJ3 A;  5ANR A;  4WUY A;  4GTR A;  1PEG A;  3HRA A;  3QDN A;  1Y6I A;  5KJL A;  1L5J A;  4UI9 C;  3UQ3 A;  1TNO A;  3FUJ A;  3MYV A;  5JJ7 A;  3IV0 A;  4GCO A;  4B93 B;  3QC1 A;  3WG7 E;  3FUI A;  4UI9 K;  4GZD A;  1YA0 A;  4U63 A;  3D9J A;  1XNF A;  4U8H A;  4JC8 A;  1D9S A;  3L9T A;  3N71 A;  4ANV A;  1V55 E;  3QAR A;  3CVV A;  1NL4 A;  3PZ2 A;  4YND A;  2IU1 A;  3SFX A;  3HXB A;  4MLP A;  3VV0 A;  4FLH A;  4J8E A;  4I1O B;  3ZRH A;  3DSX A;  4J7F A;  3MO0 A;  3CK8 A;  5LFA A;  4HI9 A;  3TWW A;  3Q7F A;  3RK6 A;  4NJ5 A;  1E8Y A;  5J08 A;  5ENQ D;  3IKO B;  4C48 B;  5CEC B;  2P9K G;  5G04 C;  4OVV A;  2B0O E;  3F9X A;  3IHX A;  1E8X A;  4GU5 A;  3JCK C;  3TWX A;  3T8M A;  2LSV A;  4U0S A;  1E7V A;  4GMR A;  3UT7 A;  5G05 C;  2V0P A;  3AS5 A;  4UQY A;  4MBG A;  4TV3 A;  3DSU A;  3HHM A;  4O30 A;  2XQ0 A;  2YHC A;  3MV2 B;  3HXF A;  4YVQ C;  3PUK A;  4KVM A;  4KXK B;  4G23 A;  3BUA A;  1WAO 1;  3RAU A;  5B3S E;  4DPR A;  3ZIM A;  2G46 A;  4I1M A;  4BT9 A;  2OEW A;  1OWN A;  3L08 A;  4X8Q A;  4GTV A;  2WMO A;  4RG6 A;  1NA3 A;  3M5A A;  2O8J A;  3BEE A;  4GZC A;  1HFA A;  1MVX A;  1WM5 A;  2GRR B;  4WAF A;  4AV7 A;  3HXC A;  2VGE A;  4NUR A;  4EHM A;  5CBN A;  3ZYK A;  3Q49 B;  3M53 A;  2NXP A;  4BTA A;  3BG1 B;  3CQC B;  4YVO A;  3KSL A;  4F53 A;  3B7T A;  3Q9N C;  3B7R L;  1OWL A;  5IY5 E;  4OAU C;  3DXK G;  5G2N A;  2BKK B;  3F6Q A;  3CVW A;  1MX2 A;  4MKT A;  2DVW A;  3KMJ A;  2KCK A;  2FF4 A;  3CVQ A;  2Q7F A;  5HS0 A;  4N3A A;  4J7W A;  2VTB A;  4Q69 A;  4GB9 A;  3ZFW A;  4E6H A;  4QFV A;  2L0T B;  4JB8 P;  4PUC A;  1TNU A;  2MHK A;  1HG5 A;  1D8E A;  3CHO A;  5D2M C;  5T3R A;  4MI5 A;  2Y4T A;  5ENS D;  4WWN A;  4DLQ A;  3L6A A;  2DYR E;  3U9W A;  1E96 B;  2H6G A;  4LG6 A;  3JYS A;  5JHN A;  4LNG A;  5G05 J;  4UWG A;  3KAE A;  3VUZ A;  3B7B A;  2PL2 A;  2BTD A;  4C1Q A;  4J8D A;  3D9L A;  1HF8 A;  4Y6C A;  3VLF A;  3BU8 A;  3HIZ A;  1KZP A;  2PZI A;  5EIL A;  3TL5 A;  4LCT A;  5CPR B;  4NIK A;  2WPV A;  1KZO A;  4GTQ A;  3OOI A;  1LD7 A;  3AG1 E;  1S63 A;  2DZO A;  3SD5 A;  4CGV A;  3OS5 A;  3Q5M A;  1TNY A;  2YIN A;  5CBO A;  2YHE A;  4DJA A;  5FWQ A;  5BPP A;  3O48 A;  3HG0 D;  3QWP A;  5KWD A;  1S0P A;  2V4L A;  4NRH B;  3CK7 A;  4CRW A;  3FUN A;  4IRU A;  3CSF A;  2OVB A;  3MKQ B;  4ATZ D;  1E7U A;  2DBA A;  1OWP A;  4Q94 A;  4N39 A;  2XGS A;  1ML9 A;  1E8W A;  3E34 A;  3IHY A;  1H19 A;  5CEA A;  1YMP A;  1BPO A;  2GGF A;  3FP3 A;  3NAW A;  3V2O A;  3JQ0 A;  4N2S A;  1UN8 A;  4GTS A;  2WXL A;  2H6F A;  3HXE A;  2PQR A;  2DCP A;  3RO3 A;  2IEJ A;  3SBT B;  3RSE G;  3TXM A;  3G2V A;  2WXM A;  1TEZ A;  1BU9 A;  3ASG A;  1HH8 A;  2IOL A;  4RSY A;  1H6K A;  1JCR A;  2YNQ A;  4IYP A;  4I6J A;  4O1P A;  3ULQ A;  1K1B A;  2VQ2 A;  1IKN D;  4QQI A;  5HRY A;  5BV1 A;  2Y69 E;  3MO5 A;  5B1B E;  3HVE A;  1U3D A;  3C3R A;  1IXV A;  1SA5 A;  3CVN A;  4G24 A;  5F5E A;  3EHR A;  4JA7 A;  4PS3 A;  4KYO B;  5CRU A;  5D0O D;  5CCM A;  5ARF A;  4A1G A;  1KPS B;  4AY6 A;  4JPS A;  3C3Q A;  3CHM A;  4FU3 A;  1MYO A;  1ZKK A;  2NC9 A;  3ZUV B;  3LCA A;  4YPU A;  3ASH A;  4GTT A;  1OWO A;  2EIK E;  1BI8 B;  3ULY A;  4FJZ A;  1N0Q A;  3UI2 A;  2J8S D;  5CED B;  5EX3 A;  4XEI G;  4HOS A;  1HX8 A;  2P9N G;  1SA4 A;  4PS7 A;  2XGM A;  3FDH A;  2C0M A;  3PZ4 A;  3RQ4 A;  4O60 A;  5D0Q D;  1TN8 A;  4CT4 A;  4BTB A;  2J4B A;  2ILR A;  2X38 A;  3FWV A;  1LTX A;  4R7L A;  3TWT A;  2J09 A;  4DLO A;  2WXP A;  2XPY A;  2R59 A;  3KD7 A;  4I6G A;  3U64 A;  1IHB A;  3TAX A;  1OY3 D;  2E0I A;  1KT1 A;  2IOS A;  4UQZ A;  4IUL A;  5FZQ A;  2AW6 A;  1JWF A;  4B8C B;  5D66 A;  3DSS A;  3T9K A;  3Q75 A;  3C5R A;  1A5E A;  3E32 A;  4AJW A;  2NYJ A;  2ZU6 B;  3FUL A;  3ZYM A;  4U8V D;  5F59 A;  2DYS E;  3AG2 E;  4FUL A;  4XKB A;  3CKC A;  1Z5S C;  1O1T A;  3ZKJ A;  4N5Q A;  2HR2 A;  4HBD A;  1O1R A;  5FT9 A;  4JL0 A;  2HO1 A;  1TYQ G;  1UOH A;  2KZT A;  2F0Y A;  2CHW A;  3W9F A;  4G1T A;  3SZ7 A;  4N5C A;  5B1A E;  1U3C A;  2RFM A;  1MUF A;  2GRO B;  1IQR A;  4LNU D;  1MZC A;  2I1J A;  3G2U A;  2R2L A;  1IYG A;  1JCQ A;  4A1S A;  5G04 J;  2XEV A;  3NF1 A;  5AEN A;  4BT8 A;  3LYA A;  3CVY A;  2PNN A;  4GA2 A;  3KEA A;  1QZ2 A;  2PM7 A;  3EDT B;  3R7R A;  3ZNG A;  3EU9 A;  3PDN A;  3CHR A;  4XI0 A;  3Q78 A;  3PZ1 A;  2X6J A;  2J4D A;  4U0Z A;  3BQO A;  3SF4 A;  3OPE A;  4QEN A;  3ZXS A;  4UWL A;  4GTP A;  2RKK A;  3ZXP A;  3O4Z A;  2XPZ A;  3SI5 A;  4OYS A;  3JUE A;  2ZIS A;  1MVH A;  1K3Z D;  4U0U A;  4DX7 D;  2XEH A;  3R9M A;  3URZ A;  5LCW C;  5DBK A;  1TN7 A;  3GW4 A;  5T4Y A;  3VLE A;  4HRN A;  2ETC A;  2MRI A;  3CLJ A;  3CIA A;  3PRE A;  3DEO A;  1KLX A;  3DB5 A;  4HLL A;  4J6I A;  4GYO A;  3ESL A;  3ZEF A;  1TR4 A;  1EPU A;  1FT2 A;  4YNP A;  2VGX B;  2EIN E;  2P9I G;  4GMJ A;  5CMY A;  2ION A;  4BEP A;  2I1K A;  1INZ A;  1N4Q A;  5FTP A;  3CEQ A;  2R02 A;  4PH4 B;  3HVE B;  2RG8 A;  2OEV A;  2J07 A;  2ZGD A;  4HOT A;  3FH8 A;  2WXR A;  1MHQ A;  4JEU A;  3PE4 A;  3RAY A;  2WXF A;  3FUH A;  4CDN A;  2LAI A;  1N95 A;  5AYF A;  2OCC E;  3FU3 A;  4YNM A;  3UX4 A;  3SHF A;  5A6C A;  3ZN3 A;  5KBA A;  2M63 A;  3CK9 A;  4KBQ A;  4U7E B;  5KNG A;  2B6C A;  4JHJ A;  1LD8 A;  4LNB A;  4BX8 A;  3EHQ A;  4B8A A;  3OXF A;  5AJD A;  4LSZ E;  2CHX A;  2CG3 A;  2AXU A;  2F8Y A;  3MA5 A;  5AN8 A;  2EIL E;  3SWC A;  3EUV A;  4LRZ A;  1DNP A;  4U04 A;  3ZYQ A;  3HNA A;  2OV8 A;  3CVX A;  1PY1 A;  5LP0 A;  3FTX A;  3RRU A;  4UQX A;  2F37 A;  3I3N A;  3L22 A;  2ZXW E;  5T0K A;  1N11 A;  3L54 A;  3PNT B;  4L23 A;  4FAD A;  2F8X K;  3S7F A;  4EBA A;  1ELK A;  2FI7 A;  2KCV A;  4KZC A;  2H6H A;  1GW6 A;  3PZD A;  3S7D A;  5T0M A;  1EYH A;  3ISM C;  5HQ8 A;  2P9U G;  1OCR E;  5AQA A;  4APF A;  1PC2 A;  4EPZ A;  3DSW A;  3PEU B;  3TJP A;  3VTX A;  1OCC E;  2RFA A;  5T8I A;  2P9L G;  4UI9 J;  1N6A A;  2W5Y A;  5HI7 A;  4K5C A;  3DRA A;  5EKQ D;  4F3V A;  3SW9 A;  1QNF A;  2WXQ A;  2WXH A;  3UIO C;  4C0E A;  1NA0 A;  3QB2 A;  1YCS B;  2UWJ G;  2L6J A;  3SQV A;  4I17 A;  1X5B A;  3ONK A;  4F6R D;  1HG2 A;  3S8P A;  3X2Q E;  5T5G A;  1RZ4 A;  2IO3 C;  2P9P G;  5F6L A;  2QY7 A;  3AG4 E;  2Y0B G;  1FPP A;  3GZS A;  4L7T A;  3M54 A;  4RG9 A;  3UT4 A;  5BXO A;  2R5S A;  2AXV A;  4DX2 A;  3GZ2 A;  2X6I A;  2KCL A;  5E76 A;  2C2L A;  2LAH A;  5EIB E;  5BW8 C;  2PQN A;  5EG2 A;  4RQI A;  2XPI A;  3D9P A;  3RJV A;  3IXE A;  5ENT D;  4AM9 A;  3L16 A;  4JHR A;  3Q7A A;  3AU5 A;  2VSN A;  4EZK A;  2X6H A;  2QPW A;  4YDY A;  2EIJ E;  4J0U A;  4BES A;  4FLB A;  2BUG A;  3UIP C;  4LDG A;  2V8S E;  5LCW J;  3AS4 A;  2IY0 C;  3FU5 A;  4ZHB A;  3LDZ A;  3DEP A;  2HM8 A;  4AEZ C;  2E2E A;  3L13 A;  4ILI A;  1P5Q A;  4IN3 B;  3Q47 B;  5EN5 D;  4B0Z A;  5TTF A;  3HDX A;  3TGO A;  3C3O A;  1G3N B;  3FTV A;  3WXX A;  2XRY A;  4UWF A;  5A23 A;  2VJ8 A;  4DK5 A;  5FZR A;  2R05 A;  4JVS A;  2QYJ A;  5AQ7 A;  3TWQ A;  5AIJ A;  4GAA A;  5BT1 A;  4JA9 A;  2HYZ A;  4G8K A;  5LSZ A;  2WVI A;  4F1S A;  2YQ8 A;  4FHJ A;  3D9N A;  4YDW A;  4ZFH A;  4G11 A;  4L9P A;  3R7Q A;  2XGO A;  4JDS A;  3ABM E;  3LKU A;  3LVR E;  4XI9 A;  5JIY A;  3MV3 B;  4CT0 A;  3PS6 A;  3Q73 A;  3PRZ A;  4N3B A;  3EJN A;  4WNG A;  4HS2 A;  4N3C A;  4C9B B;  4JXT A;  2XCC A;  3NQP A;  4HNA D;  3AG3 E;  1OXJ A;  4GPK A;  3E33 A;  5LOZ A;  3MKQ A;  5J90 A;  2WM9 A;  4BSZ B;  3SO8 A;  2AJA A;  3FHE A;  3AJI A;  4A3T A;  4QEO A;  1EF1 C;  4WWO A;  5AQB A;  1H2V C;  3RRM B;  4ACK A;  3DSV A;  1VDY A;  5ARG A;  2VTB B;  5EDS A;  4TXR A;  3FFL A;  5G55 A;  2VGY A;  4KT6 B;  4DX5 D;  4JZY A;  2LXM A;  4I6E A;  1N4R A;  2JLB A;  2XZT G;  4N2Q A;  3ZYL A;  3FEY A;  3BO5 A;  4E47 A;  4I9C A;  4TUM A;  1ZU2 A;  3S7J A;  2R3A A;  1SW6 A;  4K03 A;  4CDR A;  4DX6 D;  3QOU A;  4MRU A;  2V5Q C;  5DIZ A;  1E8Z A;  4FA6 A;  3F9Z A;  3CVL A;  1BLX B;  1HU3 A;  3PE3 A;  1X81 A;  3D9H A;  4DX1 A;  3F9Y A;  3LY7 A;  3V31 A;  3EIJ A;  2WXO A;  2KBX A;  2OVF A;  4U96 D;  1W3B A;  2XCB A;  3OXG A;  3FTU A;  5EX0 A;  2EIM E;  1QBQ A;  2WQ6 A;  2DWZ A;  3G2T A;  3FH7 A;  1UW4 B;  3TXN A;  1HE8 A;  2FBN A;  5JIN A;  4K5B A;  4G2V A;  2W5Z A;  4V3I A;  4G8L A;  4BER A;  4IJD A;  1TN6 A;  3OXL A;  3G2S A;  1SZ9 A;  1TJC A;  2R03 A;  5M72 A;  2VYI A;  4AVX A;  4HVB A;  3NOG D;  3L17 A;  4UUC A;  1XGW A;  4DUI A;  1XQH A;  4BSX A;  3TWS A;  3E37 A;  5LX8 A;  2WB2 A;  1FCH A;  4FMU A;  3SBS A;  1H2T C;  4JLG A;  2P2C P;  4HOU A;  1Z3Y A;  4I9E A;  3MJW A;  3TG5 A;  3FTS A;  3Q79 A;  5HKP A;  3ZW3 A;  1MX6 A;  4AU7 A;  5BXU A;  1KT0 A;  2LXL A;  2BF0 X;  4F7A A;  2KZT B;  3PNL B;  4PDX A;  1EDU A;  2I6H A;  3NBN B;  2BQZ A;  3RKV A;  1MJ0 A;  3RRN B;  2QZA A;  3EP0 A;  4GZ5 A;  4XZ4 A;  2Y4U A;  4AXH A;  5FIN A;  3CHP A;  3IHV A;  4ANX A;  4RZ0 A;  1UN9 A;  1DCQ A;  3B13 A;  1B89 A;  4JD2 G;  2RD0 A;  1K8K G;  1Z3X A;  3DST A;  2WQH A;  4U95 D;  5ENR D;  4LEU A;  3FY4 A;  3I4G A;  3R9A B;  2L9B A;  1N54 A;  3K5K A;  3UM2 A;  2MOW A;  3T8K A;  3SY2 A;  5H7P A;  2C0L A;  1FVF A;  2OOE A;  4HI8 A;  3FTY A;  1Z6T A;  5CER B;  2CFU A;  4Z68 A;  2AVP A;  5KNH D;  3PUJ A;  3V30 A;  5ANL A;  4BFR A;  2KXP C;  3UM0 A;  2XHE A;  3ZU7 B;  1DCE A;  2QYU A;  4K0R A;  3MO2 A;  4GYY A;  5LSX A;  3Q15 A;  1LF8 A;  3LS8 A;  1NP7 A;  4O1O A;  4A3V A;  5FIO A;  3BG0 B;  4I2W A;  1AWC B;  2XS1 A;  4JW1 A;  3DAL A;  4XKC A;  2H6I A;  5KCM A;  3UM3 A;  3E30 A;  3S7B A;  3UT8 A;  2WXN A;  3J5Q B;  4HB5 A;  5CCL A;  1JCS A;  4GTO A;  4WNF A;  2IQC A;  2UY1 B;  3M59 A;  2DIW A;  3SFZ A;  3J5P A;  4FP7 A;  1H6P A;  5FQ7 A;  4ACL A;  5JJ6 A;  3QAQ A;  4WND A;  4DI3 A;  3QWV A;  4J8O A;  4FJY A;  3FUM A;  3B7S A;  5F6K C;  1OCZ E;  3UKR G;  1Q2Z A;  3ZHE B;  3C72 A;  1D8D A;  4RVB A;  4GML A;  4JHK A;  1ZBP A;  4W9R A;  1O1S A;  2LUH A;  2BKG A;  4EQF A;  2HE0 A;  2ZIR A;  3EIQ C;  2LO6 A;  2KC7 A;  4AY5 A;  1UJJ A;  5EYL A;  2EQX A;  3SNX A;  3LPZ A;  2J9Q A;  2LNI A;  4F1P A;  4XIF A;  5JJT A;  3CR3 A;  3V2X A;  3V79 K;  3CST A;  3C98 A;  3F9W A;  4J83 A;  3TWV A;  1HXI A;  3I4R B;  3P2B A;  3PZ3 A;  2I9C A;  3JXI A;  5JHB A;  2P9S G;  1OWM A;  2X3M A;  2CHZ A;  3TG4 A;  4BY6 A;  4E85 A;  3UUX A;  1BD8 A;  2IF4 A;  3CQG B;  1ZB1 A;  1AP7 A;  4J7I A;  4K5A B;  3OTN A;  3RU0 A;  1YYH A;  5TEG A;  1ELW A;  1NFI E;  3LXU X;  4J8S A;  5KJK A;  1N4P A;  3RJW A;  3L82 A;  4YPA A;  4JEH A;  4HOR A;  5ENP D;  3AU4 A;  4HLE A;  4ATG A;  3ASF A;  1V54 E;  2GW1 A;  1N3J A;  3IBE A;  3B7U X;  2WQ7 A;  4B94 A;  1S70 B;  3GZ1 A;  1QYM A;  1H6O A;  3CVP A;  3RO2 A;  4XX5 A;  3UIN C;  3ESK A;  3U66 A;  3SGH A;  5ENN A;  3T5X A;  2R17 C;  3W9G A;  3M58 A;  2GRP B;  3RIB A;  3MX3 A;  3FU6 A;  3FUD A;  3ML8 A;  4ABN A;  4RLY A;  2J49 A;  1U2V G;  3D9I A;  4HFG A;  3M55 A;  5AYW D;  2X6F A;  4APO A;  3CHQ A;  1H3I A;  4GA0 A;  1Y8M A;  4J8F A;  4B89 A;  4GYW A;  2WXI A;  3DPY A;  4EEC A;  3FH5 A;  3AAA C;  4EZJ A;  4UWK A;  1WG0 A;  3AS8 A;  4PS8 A;  3APD A;  2L0I A;  3UKU G;  4NQ0 A;  2RFI A;  2GRM A;  2BED A;  1N4S A;  4CEM A;  1HS6 A;  1TNB A;  3CV0 A;  3ABL E;  1NZN A;  1A17 A;  4KVO A;  4I51 A;  4CGW A;  4XE0 A;  3MZL B;  3NOC D;  3CGH A;  2JEK A;  4ANU A;  1SZA A;  4WNE A;  3LJN A;  1NI1 A;  1N9A A;  3D9O A;  1PAQ A;  5KJN A;  2KM4 A;  4GA1 A;  4GZ6 A;  4DI4 A;  2I2O A;  5FJY A;  3JQ1 A;  5KJM A;  4KZ0 A;  4OAV B;  2OND A;  4URK A;  2MYO A;  3CKB A;  1DC2 A;  4YPE A;  1MX4 A;  3ZGQ A;  2UY1 A;  3ASO E;  4BUP A;  1WY6 A;  3UPV A;  3QKY A;  1N6C A;  1UJK A;  4UWH A;  4FC8 A;  4MS6 A;  3LVQ E;  5BUZ A;  3CHS A;  5JHA A;  5ITZ F;  2PM6 A;  4H7Y A;  2QFC A;  4O6F A;  5CRV A;  2WXK A;  3QNK A;  3B95 A;  4LER A;  1HZ4 A;  3ASD A;  3Q9U C;  5EID A;  3VTY A;  3QK0 A;  3LEW A;  5BV0 A;  3T5V A;  2Y1L E;  1OUV A;  5A7D B;  4BWR A;  2ETA A;  2GRN B;  3MCX A;  4C0M A;  3HXD A;  1QQE A;  3GYZ A;  3D9M A;  3EU5 A;  2JAB A;  2V4H C;  3ONL A;  3JUI A;  3DXM G;  4I2Z A;  2AXZ A;  3FUE A;  5JA4 D;  4GCN A;  1IQU A;  3MEK A;  3LY8 A;  4ANW A;  1FT1 A;  2CG2 A;  2WXJ A;  3I5P A;  2IO2 C;  4BET A;  3DBS A;  4CCA A;  3ABK E;  3CVU A;  5EYP F;  2NSZ A;  4G25 A;  2XS8 A;  4Z4P A;  5JMN D;  4QEP A;  1O9S A;  3CBO A;  1E90 A;  4G26 A;  4YDE A;  3U4T A;  1MQS A;  1RW2 A;  4WWP A;  3FPD A;  3NZU A;  1DVP A;  1H0A A;  3UM1 A;  4L2L A;  2VGX A;  4TXP A;  1IHG A;  4Q96 A;  1TJF A;  3PVL A;  3MGB A;  4GPM A;  2V5F A;  3QJZ A;  5AAR A;  3D3M A;  5FQ8 A;  2A5E A;  2AWI A;  2WXG A;  4IJ8 A;  1FVH A;  2KAT A;  4A63 B;  4I1A A;  1JPL A;  3OAW A;  3CBM A;  4Y6W A;  4A55 A;  1N52 A;  4L1B A;  2JV0 A;  1UG3 A;  3FUK A;  2VSO E;  4YDO A;  3UTM A;  4BX9 A;  3FTZ A;  3P1U A;  1OT8 A;  4CDM A;  3FTW A;  2X6K A;  3KMA A;  5ENO D;  3CBP A;  3ZHE A;  4U07 A;  3ASN E;  3FU0 A;  4CYM D;  3DPD A;  4H12 A;  4NAC A;  4TXQ A;  4D10 C;  4FHK A;  2IGQ A;  3PEV B;  3KMT A;  5BNW A;  2ETB A;  4HQD A;  4AOF A;  2XZD G;  5FZS A;  4P29 A;  2L6B A;  2A5U A;  1S64 A;  3ML9 A;  4CZ2 D;  4HRM B;  2VSX E;  3E4B A;  1OCO E;  4EZL A;  2FEZ A;  3FUF A;  2GRQ B;  3ENE A;  1K1A A;  1WDY A;  4GZ3 A;  3FEX A;  4GTM A;  1H2U A;  1N94 A;  4M7C A;  4H7X A;  3KEZ A;  3IEG A;  2FUL A;  3HYM B;  4KMO A;  2QC9 A;  3TWR A;  4DRX E;  3NB2 A;  2ZGG A;  4U8Y D;  4EBA G;  3JXJ A;  2F69 A;  5CMW A;  2XEE A;  4J8Y A;  5AAO A;  1SQM A;  3VLD A;  2IJG X;  3S2A A;  5E75 A;  3M56 A;  2XRZ A;  5C2Y A;  3KSQ A;  3UMV A;  3ULE G;  5C1D A;  4AP2 A;  3UXG A;  3G2W A;  4TRQ A;  4HOQ A;  1ELR A;  2DZN A;  3ZVV A;  4MI0 A;  4HXI A;  3QWW A;  4I43 A;  1MT6 A;  4AIF A;  4ILG A;  1HO8 A;  2FO1 E;  4TUU A;  1TNZ A;  3NZS A;  3APF A;  2WMN A;  5FQ6 A;  3K9I A;  3APC A;  5FQ4 A;  4OVU A;  1JUQ A;  4ILH B;  1N0R A;  3DWL G;  3MKR A;  2GRL A;  4L2Y A;  3EHN A;  3D9K A;  4M3O A;  2LSU A;  1BI7 B;  5CHE E;  5TH7 A;  3SFY A;  2J08 A;  2FO7 A;  3EHM A;  3LY9 A;  2XEN A;  4LUN U;  4HRL A;  2CFZ A;  4ME2 A;  3M57 A; 
#chains in the Genus database with same CATH homology
 3B7U X;  3LVR E;  1JWG A;  4B94 A;  2WQ7 A;  4XI9 A;  3ZPJ A;  3MV3 B;  5AJL A;  3KS2 A;  4CT0 A;  3FUL A;  3GZ1 A;  2VSY A;  3ZYM A;  3PS6 A;  2A4Z A;  3Q4A B;  5F59 A;  3CVP A;  3PH0 C;  3RO2 A;  4FUL A;  3PRZ A;  5JJ0 A;  4XKB A;  3U3W A;  3CKC A;  4XX5 A;  2Y3A A;  2P58 C;  4N3B A;  3EJN A;  3ESK A;  3U66 A;  4NVQ A;  2HR2 A;  2IFU A;  3LJ3 A;  5ANR A;  5FT9 A;  3SGH A;  4WNG A;  4HS2 A;  4N3C A;  4WUY A;  4C9B B;  5ENN A;  3T5X A;  4JXT A;  2R17 C;  4JL0 A;  1PEG A;  2XCC A;  3NQP A;  2HO1 A;  3M58 A;  2KZT A;  1Y6I A;  3QDN A;  5KJL A;  1L5J A;  2CHW A;  4UI9 C;  3RIB A;  3MX3 A;  3FU6 A;  4G1T A;  3SZ7 A;  3FUD A;  3UQ3 A;  3FUJ A;  3MYV A;  3ML8 A;  4GPK A;  4ABN A;  5JJ7 A;  4N5C A;  3IV0 A;  4GCO A;  3QC1 A;  1U3C A;  1MUF A;  3FUI A;  5LOZ A;  4UI9 K;  2J49 A;  3MKQ A;  4GZD A;  3D9I A;  1IQR A;  1YA0 A;  4U63 A;  5J90 A;  2WM9 A;  3D9J A;  1XNF A;  2I1J A;  3G2U A;  4HFG A;  4U8H A;  3M55 A;  5AYW D;  2X6F A;  4APO A;  4JC8 A;  1IYG A;  3N71 A;  4ANV A;  3CHQ A;  1H3I A;  3QAR A;  3FHE A;  4GA0 A;  1Y8M A;  4J8F A;  4B89 A;  4A1S A;  4A3T A;  4QEO A;  5G04 J;  1EF1 C;  3CVV A;  2XEV A;  3NF1 A;  4GYW A;  2WXI A;  5AEN A;  4BT8 A;  4WWO A;  4YND A;  3LYA A;  2IU1 A;  4EEC A;  3CVY A;  1H2V C;  4GA2 A;  3RRM B;  3FH5 A;  1QZ2 A;  2PM7 A;  4MLP A;  4EZJ A;  3VV0 A;  4FLH A;  3EDT B;  4J8E A;  4I1O B;  3R7R A;  3ZRH A;  4ACK A;  4UWK A;  3PDN A;  5ARG A;  1VDY A;  3CHR A;  4XI0 A;  3MO0 A;  2VTB B;  4J7F A;  5EDS A;  3CK8 A;  3AS8 A;  4PS8 A;  5LFA A;  3RK6 A;  2X6J A;  3APD A;  4NJ5 A;  2L0I A;  3FFL A;  1E8Y A;  4NQ0 A;  5G55 A;  5J08 A;  3IKO B;  2VGY A;  2RFI A;  2GRM A;  2J4D A;  4KT6 B;  4CEM A;  1HS6 A;  5G04 C;  4JZY A;  3CV0 A;  4U0Z A;  4OVV A;  4I6E A;  3F9X A;  1NZN A;  1A17 A;  4KVO A;  2JLB A;  4CGW A;  4XE0 A;  3MZL B;  3SF4 A;  3OPE A;  4I51 A;  4N2Q A;  3IHX A;  1E8X A;  4QEN A;  3ZYL A;  3FEY A;  4GU5 A;  3ZXS A;  3CGH A;  3JCK C;  3BO5 A;  3T8M A;  2JEK A;  4UWL A;  2LSV A;  4E47 A;  4U0S A;  1E7V A;  4I9C A;  3UT7 A;  1ZU2 A;  5G05 C;  3S7J A;  4ANU A;  2V0P A;  1SZA A;  2R3A A;  3O4Z A;  4WNE A;  2XPZ A;  3AS5 A;  3SI5 A;  4K03 A;  4CDR A;  4UQY A;  4TV3 A;  3QOU A;  4OYS A;  3HHM A;  4MRU A;  3D9O A;  4O30 A;  2XQ0 A;  1MVH A;  4U0U A;  1PAQ A;  2YHC A;  1E8Z A;  5DIZ A;  3MV2 B;  5KJN A;  2KM4 A;  4YVQ C;  3PUK A;  4FA6 A;  4GA1 A;  3URZ A;  5LCW C;  5DBK A;  3GW4 A;  5T4Y A;  3VLE A;  4KVM A;  4KXK B;  3CVL A;  2MRI A;  4GZ6 A;  4DI4 A;  3F9Z A;  4G23 A;  2I2O A;  3CLJ A;  1WAO 1;  1HU3 A;  3CIA A;  3PE3 A;  3PRE A;  1KLX A;  5FJY A;  3DB5 A;  4DPR A;  3F9Y A;  3JQ1 A;  3LY7 A;  3ZIM A;  2G46 A;  4J6I A;  5KJM A;  4KZ0 A;  3EIJ A;  4GYO A;  4I1M A;  4BT9 A;  3ESL A;  3ZEF A;  1OWN A;  2WXO A;  3L08 A;  1EPU A;  2OND A;  2OVF A;  4YNP A;  4URK A;  2VGX B;  3CKB A;  1W3B A;  4GMJ A;  4YPE A;  2XCB A;  3OXG A;  2WMO A;  4RG6 A;  1NA3 A;  3FTU A;  5EX0 A;  3ZGQ A;  5CMY A;  3M5A A;  2ION A;  2O8J A;  2UY1 A;  3BEE A;  4GZC A;  1HFA A;  1MVX A;  2I1K A;  1INZ A;  2WQ6 A;  1WM5 A;  3G2T A;  3FH7 A;  1UW4 B;  4WAF A;  5FTP A;  4BUP A;  3CEQ A;  4AV7 A;  1WY6 A;  1HE8 A;  3TXN A;  2FBN A;  4NUR A;  5JIN A;  4PH4 B;  3HVE B;  2RG8 A;  3UPV A;  3QKY A;  2J07 A;  4G2V A;  1N6C A;  1UJK A;  2W5Z A;  4UWH A;  3ZYK A;  3Q49 B;  3M53 A;  2NXP A;  4HOT A;  4V3I A;  4FC8 A;  3FH8 A;  3LVQ E;  4MS6 A;  2WXR A;  3BG1 B;  4BTA A;  5BUZ A;  3CHS A;  1MHQ A;  3CQC B;  5JHA A;  4YVO A;  4JEU A;  3PE4 A;  2PM6 A;  4H7Y A;  3B7T A;  4F53 A;  4IJD A;  3RAY A;  2QFC A;  4O6F A;  2WXF A;  3B7R L;  1OWL A;  3FUH A;  3OXL A;  5G2N A;  4CDN A;  2WXK A;  3G2S A;  2LAI A;  3QNK A;  1SZ9 A;  3CVW A;  4LER A;  4MKT A;  1HZ4 A;  3ASD A;  3VTY A;  5AYF A;  1TJC A;  5M72 A;  2VYI A;  4AVX A;  3KMJ A;  2KCK A;  2FF4 A;  3CVQ A;  3QK0 A;  2Q7F A;  3LEW A;  5BV0 A;  4HVB A;  3T5V A;  3L17 A;  3FU3 A;  4YNM A;  1OUV A;  1XGW A;  5A7D B;  4BWR A;  4N3A A;  2VTB A;  1XQH A;  3UX4 A;  3SHF A;  4BSX A;  4Q69 A;  5A6C A;  4GB9 A;  3MCX A;  3ZFW A;  4C0M A;  4E6H A;  4QFV A;  2L0T B;  1QQE A;  3GYZ A;  5LX8 A;  3ZN3 A;  4PUC A;  2WB2 A;  3D9M A;  1FCH A;  2MHK A;  1HG5 A;  5T3R A;  3CHO A;  4FMU A;  2M63 A;  3SBS A;  4MI5 A;  3CK9 A;  2Y4T A;  3ONL A;  3JUI A;  4WWN A;  1H2T C;  3L6A A;  4DLQ A;  4JLG A;  4KBQ A;  3U9W A;  1E96 B;  1Z3Y A;  4HOU A;  4I9E A;  3MJW A;  3TG5 A;  4JHJ A;  4I2Z A;  2AXZ A;  3FTS A;  3FUE A;  3JYS A;  4BX8 A;  5JHN A;  4B8A A;  3ZW3 A;  3OXF A;  5AJD A;  5G05 J;  2CHX A;  4UWG A;  3KAE A;  2CG3 A;  4AU7 A;  3VUZ A;  2AXU A;  4GCN A;  1IQU A;  1KT0 A;  3MEK A;  2PL2 A;  3LY8 A;  2BF0 X;  4ANW A;  2BTD A;  2CG2 A;  4F7A A;  4C1Q A;  3MA5 A;  4J8D A;  2KZT B;  3D9L A;  3PNL B;  4PDX A;  2WXJ A;  3I5P A;  1HF8 A;  3SWC A;  4LRZ A;  1EDU A;  1DNP A;  3DBS A;  4U04 A;  4Y6C A;  2I6H A;  3ZYQ A;  4CCA A;  2BQZ A;  3CVU A;  3RKV A;  3HNA A;  3VLF A;  2NSZ A;  2OV8 A;  3HIZ A;  3CVX A;  3RRN B;  4G25 A;  1PY1 A;  3EP0 A;  5LP0 A;  2PZI A;  4Z4P A;  3FTX A;  4GZ5 A;  4XZ4 A;  3RRU A;  3TL5 A;  2Y4U A;  4LCT A;  4UQX A;  4AXH A;  5CPR B;  3I3N A;  2WPV A;  3L22 A;  1O9S A;  4QEP A;  3CHP A;  3CBO A;  1E90 A;  5T0K A;  3IHV A;  4G26 A;  3OOI A;  4ANX A;  4RZ0 A;  3U4T A;  1UN9 A;  3L54 A;  3PNT B;  1MQS A;  3SD5 A;  4CGV A;  4L23 A;  3B13 A;  3OS5 A;  3Q5M A;  4WWP A;  1B89 A;  4FAD A;  3NZU A;  1DVP A;  3FPD A;  3S7F A;  4EBA A;  1ELK A;  2YIN A;  2RD0 A;  1H0A A;  2FI7 A;  2YHE A;  4L2L A;  2KCV A;  4DJA A;  2VGX A;  5FWQ A;  1IHG A;  1Z3X A;  4KZC A;  2WQH A;  4LEU A;  3FY4 A;  5BPP A;  3I4G A;  3R9A B;  4Q96 A;  3O48 A;  3QWP A;  2L9B A;  1N54 A;  1GW6 A;  1TJF A;  3PZD A;  1S0P A;  2V4L A;  4NRH B;  3PVL A;  3S7D A;  3CK7 A;  4CRW A;  3MGB A;  3K5K A;  5T0M A;  1EYH A;  3FUN A;  5HQ8 A;  2V5F A;  3QJZ A;  4IRU A;  2MOW A;  3D3M A;  4APF A;  5FQ8 A;  3CSF A;  2OVB A;  1PC2 A;  2AWI A;  3MKQ B;  1E7U A;  2WXG A;  4EPZ A;  4IJ8 A;  3PEU B;  1FVH A;  2C0L A;  2KAT A;  3TJP A;  3VTX A;  2DBA A;  1FVF A;  1OWP A;  4I1A A;  1JPL A;  5T8I A;  4UI9 J;  2OOE A;  3OAW A;  3FTY A;  4Q94 A;  5HI7 A;  1N6A A;  2W5Y A;  1Z6T A;  4N39 A;  2XGS A;  3CBM A;  2CFU A;  1ML9 A;  1E8W A;  4Y6W A;  2AVP A;  4A55 A;  3IHY A;  1H19 A;  1N52 A;  5EKQ D;  4L1B A;  1BPO A;  2GGF A;  4F3V A;  2JV0 A;  3FP3 A;  3SW9 A;  3PUJ A;  1UG3 A;  3JQ0 A;  4N2S A;  1QNF A;  3FUK A;  1UN8 A;  2VSO E;  5ANL A;  2WXQ A;  2WXH A;  4C0E A;  4BFR A;  1NA0 A;  3QB2 A;  2UWJ G;  2L6J A;  2XHE A;  4BX9 A;  3FTZ A;  3P1U A;  4CDM A;  2WXL A;  3FTW A;  4K0R A;  4I17 A;  2X6K A;  1X5B A;  3MO2 A;  3ONK A;  1HG2 A;  2PQR A;  3S8P A;  4GYY A;  5LSX A;  2DCP A;  5T5G A;  3Q15 A;  3RO3 A;  3KMA A;  1LF8 A;  3LS8 A;  1NP7 A;  3SBT B;  3ZHE A;  3CBP A;  4U07 A;  4A3V A;  5F6L A;  3TXM A;  3FU0 A;  3G2V A;  2QY7 A;  2WXM A;  3BG0 B;  3DPD A;  3GZS A;  4I2W A;  4L7T A;  1TEZ A;  4H12 A;  4JW1 A;  4NAC A;  4RG9 A;  3ASG A;  4D10 C;  3M54 A;  3UT4 A;  3DAL A;  4XKC A;  4FHK A;  1HH8 A;  5KCM A;  2IOL A;  2IGQ A;  5JIY A;  3PEV B;  4RSY A;  1H6K A;  2R5S A;  2AXV A;  2YNQ A;  3KMT A;  4IYP A;  4I6J A;  3S7B A;  3UT8 A;  3GZ2 A;  5BNW A;  3ULQ A;  2WXN A;  2X6I A;  2KCL A;  5E76 A;  2C2L A;  2LAH A;  5CCL A;  4WNF A;  4AOF A;  5FZS A;  2IQC A;  2VQ2 A;  5BW8 C;  2PQN A;  4P29 A;  5EG2 A;  2A5U A;  2UY1 B;  3ML9 A;  3M59 A;  2DIW A;  2XPI A;  3SFZ A;  2VSX E;  4FP7 A;  3E4B A;  3D9P A;  3RJV A;  5BV1 A;  3MO5 A;  4AM9 A;  4EZL A;  2FEZ A;  3HVE A;  5FQ7 A;  1U3D A;  3L16 A;  4ACL A;  5JJ6 A;  3QAQ A;  4WND A;  4DI3 A;  3FUF A;  3QWV A;  4JHR A;  3ENE A;  3AU5 A;  2VSN A;  4GZ3 A;  3CVN A;  4EZK A;  3FEX A;  2X6H A;  4FJY A;  3FUM A;  3B7S A;  4G24 A;  4JA7 A;  4PS3 A;  5F5E A;  5F6K C;  4KYO B;  2QPW A;  1H2U A;  4H7X A;  3KEZ A;  4J0U A;  3ZHE B;  3IEG A;  2FUL A;  3HYM B;  4FLB A;  5D0O D;  2BUG A;  5CCM A;  5ARF A;  4A1G A;  4KMO A;  4LDG A;  4RVB A;  4AY6 A;  4JPS A;  4GML A;  2V8S E;  3CHM A;  4FU3 A;  5LCW J;  1ZKK A;  4JHK A;  2NC9 A;  3AS4 A;  1ZBP A;  3FU5 A;  3LCA A;  4W9R A;  4YPU A;  3LDZ A;  4EBA G;  2HM8 A;  4EQF A;  2F69 A;  5CMW A;  3EIQ C;  3ASH A;  2LO6 A;  1OWO A;  4AEZ C;  4FJZ A;  1SQM A;  2KC7 A;  3VLD A;  2E2E A;  2IJG X;  3S2A A;  4AY5 A;  5E75 A;  5EX3 A;  1UJJ A;  3L13 A;  2XRZ A;  5C2Y A;  3M56 A;  3UMV A;  2EQX A;  4HOS A;  3SNX A;  4ILI A;  1HX8 A;  1P5Q A;  5C1D A;  3LPZ A;  2J9Q A;  2LNI A;  4PS7 A;  4AP2 A;  2XGM A;  4IN3 B;  3Q47 B;  4XIF A;  3FDH A;  3G2W A;  4B0Z A;  4TRQ A;  5TTF A;  4HOQ A;  1ELR A;  3HDX A;  5JJT A;  3CR3 A;  3ZVV A;  3TGO A;  3CST A;  3C98 A;  3F9W A;  4J83 A;  4MI0 A;  3FTV A;  3WXX A;  1HXI A;  2XRY A;  2C0M A;  3I4R B;  3P2B A;  4UWF A;  5A23 A;  3RQ4 A;  2I9C A;  5D0Q D;  4CT4 A;  5JHB A;  1OWM A;  2J4B A;  2CHZ A;  2VJ8 A;  2X3M A;  3QWW A;  4HXI A;  4BTB A;  4DK5 A;  3TG4 A;  4I43 A;  5FZR A;  4BY6 A;  2ILR A;  2X38 A;  4JVS A;  1MT6 A;  4AIF A;  4ILG A;  1HO8 A;  3FWV A;  4TUU A;  4R7L A;  4E85 A;  5AIJ A;  4GAA A;  3UUX A;  2J09 A;  3NZS A;  4DLO A;  2WXP A;  5BT1 A;  2XPY A;  2R59 A;  3APF A;  2IF4 A;  2WMN A;  3CQG B;  5FQ6 A;  3K9I A;  3APC A;  3KD7 A;  2HYZ A;  4JA9 A;  4OVU A;  5FQ4 A;  1JUQ A;  4ILH B;  4J8O A;  4I6G A;  5LSZ A;  3MKR A;  3U64 A;  4J7I A;  3OTN A;  2GRL A;  4L2Y A;  3RU0 A;  3EHN A;  2WVI A;  5TEG A;  3D9K A;  1ELW A;  3LXU X;  4M3O A;  4J8S A;  3TAX A;  4F1S A;  2LSU A;  2YQ8 A;  4FHJ A;  5CHE E;  5TH7 A;  5KJK A;  3RJW A;  3D9N A;  2J08 A;  2E0I A;  1KT1 A;  4JEH A;  4HOR A;  2IOS A;  2FO7 A;  4UQZ A;  4YPA A;  3AU4 A;  4IUL A;  4G11 A;  5FZQ A;  3EHM A;  3LY9 A;  2AW6 A;  1JWF A;  4LUN U;  3R7Q A;  4HLE A;  4B8C B;  2XGO A;  4ATG A;  2CFZ A;  4JDS A;  3ASF A;  2GW1 A;  3LKU A;  1N3J A;  4ME2 A;  3IBE A;  3M57 A;  4AJW A;  2ZU6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...