3S7DA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 150
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7dA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7dA01
2C2LA 1ZKKA 4O30A 5D0OD 3AS5A 3CVLA 1W3BA 3LPZA 4JA9A 4AIFA 4WUYA 4YPUA 4G23A 4GCNA 3TGOA 3JYSA 2L6JA 5BT1A 3EDTB 1FCHA 4BWRA 3CKBA 2HYZA 5KJMA 3CK7A 4U0ZA 4YPAA 1TJCA 5ARFA 4AU7A 4KYOB 1HZ4A 2HO1A 4Y6CA 2JV0A 1QZ2A 3Q4AB 3CV0A 1KT1A 4GYOA 5T0KA 4GA0A 2IFUA 5G04J 3S8PA 3M57A 3CVQA 3LKUA 2BUGA 5FT9A 3E4BA 4RG9A 2VYIA 4N3AA 3ZHEA 5DIZA 2YQ8A 3FP3A 3NF1A 4O6FA 4GA1A 4RG6A 4J8FA 5HQ8A 3KMTA 3CBPA 4NQ0A 2AVPA 2C0LA 4MI0A 1HXIA 4WNDA 4N3BA 2VSNA 4CDRA 3GZ2A 2FBNA 2XPIA 5KJNA 5T0MA 4LDGA 3OXLA 5FZSA 4BT9A 2KATA 5JJ0A 3OXFA 3S7FA 4HOSA 2G46A 4G1TA 4QEPA 2F69A 4IJ8A 3DALA 1WM5A 5G05C 3KAEA 4N39A 4N5CA 3MV2B 4ME2A 4G26A 3CEQA 2UY1A 4IJDA 5FZRA 4J0UA 4APOA 4QENA 2KC7A 2UY1B 2OOEA 5C1DA 5JJTA 5KJKA 4I2WA 4UI9J 2VGXA 2FO7A 2R3AA 2FF4A 1ELWA 3U4TA 1MT6A 4YVQC 3M58A 3CK9A 3MO0A 5G05J 2GW1A 1MUFA 4F3VA 3ASFA 5JJ6A 3VUZA 3R9AB 1A17A 1XQHA 4XIFA 3LCAA 3KD7A 3S7JA 4JDSA 3OXGA 5A6CA 5ARGA 2P58C 4AY6A 4GA2A 1N6CA 5KJLA 4JHRA 1NZNA 4GYWA 3MEKA 4I2ZA 4BTAA 1PEGA 5G04C 4YNDA 4UI9C 3GZ1A 5CPRB 3M53A 1HH8A 2XCBA 4BT8A 3QWPA 2WQHA 3GW4A 3VV0A 2UWJG 2E2EA 2PQNA 5EX0A 4NVQA 3UUXA 4J83A 3QWWA 3MA5A 1IYGA 4MI5A 3TG4A 2PZIA 3SW9A 2KCKA 2R5SA 3VTYA 3FPDA 5CCMA 4J7FA 4ABNA 3PE4A 3MO2A 2FEZA 4UQZA 3ESKA 3QDNA 3RJWA 3Q5MA 5BW8C 3BO5A 4JLGA 5HI7A 1MVHA 4WNGA 4U04A 1ZBPA 5F59A 4HOUA 2PL2A 3UPVA 3RO3A 4N3CA 4I51A 4HOTA 1WAO1 3N71A 3PE3A 4GYYA 3ZGQA 2IF4A 3HYMB 3LYAA 4WNEA 3FWVA 5DBKA 2HR2A 4G2VA 4KBQA 3S7BA 3OPEA 4G24A 5FZQA 2VGYA 4N2SA 2VGXB 5LSXA 4KXKB 2VQ2A 2FI7A 2VSYA 5AYWD 3IHXA 5FTPA 5BNWA 3QWVA 2NC9A 1IHGA 4UI9K 5F6LA 5CCLA 2QFCA 3WXXA 1KLXA 4JL0A 5JIYA 1YA0A 1QQEA 4U0UA 3CK8A 4FMUA 2XGMA 5LCWC 5LSZA 1B89A 3RQ4A 3S7DA 1OUVA 3ASHA 4J8OA 3Q15A 2DBAA 2O8JA 4B94A 4Z4PA 2W5ZA 5F5EA 4CGVA 3O48A 5TH7A 3QKYA 4U07A 5FJYA 4J8EA 3URZA 5TEGA 1ZU2A 3K5KA 1KT0A 5LCWJ 2I6HA 1NA3A 1MVXA 5TTFA 4J7IA 2LSUA 3AS4A 3TG5A 4CGWA 3F9YA 4A1SA 4BTBA 3OS5A 2RFIA 2LSVA 4WNFA 1NA0A 4XI9A 3ZN3A 4YNPA 2PQRA 3LY9A 3BEEA 4YNMA 4H12A 3SWCA 3CVNA 3DB5A 4E47A 4GPKA 1H3IA 5JJ7A 4QEOA 2KCVA 3TAXA 3Q47B 4I9EA 2W5YA 2ONDA 4YVOA 3IEGA 4HORA 3SF4A 2QPWA 2MHKA 3U3WA 4G25A 4EQFA 5EG2A 3RKVA 2KCLA 3KMJA 2Y4TA 3ZFWA 4HOQA 4C1QA 4BUPA 3RJVA 5T5GA 5D0QD 2XEVA 5EKQD 3M59A 4I9CA 2IGQA 4XI0A 1E96B 2LNIA 4YPEA 3MO5A 2XGOA 3CKCA 4GCOA 4AY5A 3CBMA 4I1AA 4N2QA 3CVPA 5JHNA 2WPVA 5A7DB 3LY8A 3KMAA 2Q7FA 3RU0A 4Y6WA 3F9XA 3M54A 3RO2A 4RZ0A 4I17A 1N6AA 3M56A 4AM9A 1P5QA 3EP0A 3M5AA 1O9SA 4NJ5A 4H7YA 4NRHB 2XGSA 2BQZA 3KS2A 4IN3B 5CHEE 1N3JA 2C0MA 4GZ3A 3RIBA 1PC2A 2J9QA 3Q49B 2V5FA 4U0SA 2XCCA 3VTXA 3ASGA 4GZ6A 3ZHEB 3QOUA 3K9IA 1Y8MA 3PDNA 3SZ7A 2Y4UA 4LEUA 3UQ3A 3RAYA 3ZPJA 3OOIA 3MKRA 3FFLA 1XNFA 3LY7A 5EX3A 3F9ZA 5JINA 4GZ5A 5M72A 3CBOA 5AYFA 4UQXA 3ASDA 5F6KC 2YHCA 3MV3B 3F9WA 4JA7A 3ULQA 1ELRA 3GYZA 1ML9A 4H7XA 4W9RA 4UQYA 2JLBA 3AS8A 3M55A 4J8DA 3HNAA
chains in the Genus database with same CATH superfamily
2BF0X 4JC8A 4DX2A 1U3DA 2ZU6B 4AIFA 3EHNA 2L9BA 4F7AA 2WXPA 4KZCA 5BV1A 3NAWA 5CERB 4HQDA 1X5BA 3EDTB 1OCCE 2L0IA 3SNXA 2JABA 5ENSD 4U0ZA 1TJFA 1TJCA 4KYOB 1O1RA 3B95A 2HO1A 4Y6CA 3EUVA 4UWLA 1WY6A 3Q4AB 1N4QA 1KT1A 2P9IG 1S64A 4GYOA 2BTDA 2J08A 4LNBA 3E4BA 3CVYA 3WG7E 4N3AA 3ZHEA 2WQ7A 5DIZA 3Q9NC 2GRRB 3KMTA 3C5RA 3L13A 4CDNA 4FA6A 3QJZA 4NQ0A 3CVVA 4MI0A 3LJNA 4WNDA 2VSNA 1BPOA 2FBNA 1Y6IA 4UUCA 5T0MA 4LNGA 1MQSA 4A55A 2ZXWE 2IOSA 4XKCA 4G1TA 1N54A 4IJ8A 3DALA 3EHRA 3PNTB 3KAEA 4GMRA 2EIJE 1FPPA 4N39A 2X38A 4YDYA 5J08A 2GRNB 2F0YA 4U7EB 1WG0A 5LX8A 3KEAA 2DCPA 4IJDA 5FZRA 4AVXA 1HG2A 2KC7A 2UY1B 5C1DA 3DEPA 3UINC 3IHVA 4I2WA 5FQ8A 2FO7A 3U4TA 5JA4D 5KBAA 4F3VA 4I1MA 2QYJA 3VUZA 3HXCA 1BI8B 4HRMB 2WXNA 5A6CA 5ARGA 5KWDA 4CT0A 2BEDA 1N6CA 3EU9A 4I2ZA 4BTAA 3SI5A 1HF8A 4YNDA 5FQ6A 3FDHA 3UKUG 4ILHB 5EDSA 3QWPA 2WQHA 3VV0A 1UW4B 2QZAA 2E2EA 3B13A 3FH5A 2PQNA 3UX4A 3CHMA 4OAUC 3Q73A 4MI5A 2PZIA 3QAQA 2GGFA 5HS0A 2V4HC 5CCMA 5CECB 3APCA 2RFMA 4ABNA 2GROB 3ZYMA 4C0EA 3QDNA 1BU9A 1QNFA 2I2OA 3BO5A 4DX5D 4JLGA 3LDZA 1MVHA 4F1PA 3UM3A 4HOUA 2KZTB 1DCEA 3E32A 4I51A 1WAO1 4GTTA 4C9BB 3ZGQA 5EYLA 3ZUVB 3C98A 4QFVA 5FWQA 3L17A 2J07A 1ZB1A 3PEVB 4WNEA 2HR2A 2J49A 2IO2C 1JCRA 2VGYA 4N2SA 2R05A 3UIOC 1QYMA 3FH7A 1MHQA 3D9MA 2QC9A 1K3ZD 2FI7A 4FADA 1E8ZA 2J09A 4CYMD 3L9TA 1IHGA 3JQ1A 3SQVA 2V0PA 2FULA 4GU5A 5CRVA 1KLXA 1QQEA 2XZTG 4U0UA 4X8QA 1JPLA 2VSOE 1B89A 5IY5E 3S7DA 3TWRA 3U64A 4EBAG 5BUZA 3RQ4A 3UT7A 2LXMA 4B8AA 3EHQA 4B94A 4ILGA 3T5VA 2AW6A 4CGVA 4L2YA 2X6JA 3ZXPA 3QKYA 5FJYA 4E6HA 4OVVA 3URZA 1ZU2A 1DVPA 3TWSA 1MVXA 5TTFA 3VLDA 3ABME 1LF8A 1TNYA 4F1SA 2LSVA 4TXRA 1NA0A 4XI9A 1RZ4A 3OTNA 3PZ1A 2X6KA 3EU5A 2P9UG 3ZYKA 4KVOA 1YYHA 4GAAA 4ACKA 2EINE 2ILRA 3TAXA 1Z3YA 3Q47B 2W5YA 3KEZA 1H6PA 3JXIA 1N0QA 4JPSA 4G25A 1EF1C 4MRUA 2LUHA 5FINA 3L6AA 1IKND 1E7VA 4B8CB 1SA4A 5D0QD 5EKQD 3M59A 3ZRHA 3CR3A 3DWLG 4LERA 1OCZE 4U95D 1HFAA 4B93B 5BXUA 1MZCA 1N11A 3B7SA 5FQ4A 5H7PA 4HLLA 4CT4A 3EHMA 3J5QB 3RK6A 4AY5A 4N2QA 3CSTA 4ANVA 4LRZA 5JHNA 3TXMA 5CRUA 4GTMA 4ANXA 3HXEA 3VLFA 4FHKA 4FC8A 3PUKA 1MX4A 4I17A 3FUJA 5AQ9A 4AM9A 3DSXA 3EP0A 3PREA 1O9SA 4NRHB 2XGSA 2BQZA 4IN3B 1N3JA 1UG3A 1K1AA 4FJZA 1S70B 4HVBA 4LEUA 3ZPJA 3MKRA 3ASNE 3QARA 2V8SE 3NQPA 4CCAA 5EX3A 3F9ZA 5M72A 4UQXA 2YHCA 1QBQA 3MV3B 3ULQA 5ENQD 3D9NA 1IXVA 3L16A 4AEZC 4UWGA 3UXGA 2XEHA 2C2LA 4PUCA 2IEJA 2XQ0A 3CVLA 1W3BA 3P2BA 3R9MA 1L5JA 4NURA 2DYRE 3ABLE 4N5QA 4WUYA 4YPUA 4G23A 3ONLA 2P9PG 4I6EA 3RRUA 3PUJA 1FCHA 1DCQA 4BWRA 5KJMA 2A4ZA 2WXKA 3FTWA 4AU7A 1LD8A 1QZ2A 1H19A 2NXPA 3CV0A 3W9FA 4DRXE 1SZ9A 2A5UA 4GA0A 4ACLA 2BKGA 4ZFHA 2VTBB 4DI4A 3S8PA 3P1UA 3CVQA 3LKUA 3APDA 3TWWA 2VYIA 4LG6A 5FIOA 4LSZE 4O6FA 2DYSE 4RG6A 3QB2A 1SZAA 4JVSA 1SVXA 3MKQA 3FU5A 4MLPA 2AVPA 4XX5A 4J7WA 3CHQA 1ELKA 3FUKA 3SBSA 2ZGDA 2XPIA 3T8KA 4RVBA 2F37A 5JJ0A 4XE0A 1N4SA 2G46A 2XPYA 3MJWA 5G05C 2JEKA 5AQ7A 2DZNA 4TUMA 1HO8A 2VTBA 2CHXA 4BX8A 1LD7A 4G26A 3D9LA 3ZVVA 3FY4A 2H6FA 5KJKA 3ISMC 4UI9J 2VGXA 2R3AA 2FF4A 3SBTB 2MRIA 3M58A 3NB2A 2GW1A 3PS6A 3S2AA 2WXJA 4CZ2D 4XIFA 2E0IA 3ULYA 2CHZA 1H2TC 2GRPB 4AY6A 5KJLA 2J4BA 4JHRA 3I4RB 3CVWA 3FEXA 4UI9C 5CPRB 1LTXA 3CSFA 3FH8A 1U2VG 2XCBA 3SFZA 3BQOA 3LEWA 2J8SD 4NVQA 3UUXA 5CEDB 4J83A 3TG4A 1H2UA 2KCKA 2R5SA 3TXNA 1XGWA 4BERA 1N4RA 4RSYA 1OXJA 3PE4A 1EDUA 2IJGX 4M7CA 3ESKA 2GRMA 2F8XK 5ENNA 4JHJA 4MS6A 1NP7A 2M63A 1ZBPA 4EPZA 5F59A 2ETAA 4N3CA 4U8HA 5CBOA 5E76A 2X3MA 1N0RA 4XKBA 2ZISA 3LYAA 1MX6A 1TN8A 2VGXB 1JUQA 4HLEA 2KXPC 4AJWA 2B0OE 2VSYA 3C3OA 5FTPA 4Q69A 2WQ6A 3NZSA 1IQRA 3QWVA 3PVLA 3L82A 4UI9K 3AG1E 5CCLA 2QFCA 4JL0A 5JIYA 2GRLA 1E8XA 4FMUA 2ETBA 4DPRA 1OUVA 4J8OA 4GMJA 3IKOB 3UM0A 3DSTA 5ENRD 4Z4PA 4WWPA 2W5ZA 4V3IA 3BUAA 4URKA 5F5EA 1Z6TA 4B89A 1N9AA 3MYVA 4WAFA 3PZ3A 5AENA 3LXUX 5TEGA 1KPSB 3EIJA 5LCWJ 3MKQB 2I6HA 4KT6B 4KZ0A 4EHMA 1YMPA 2LSUA 4OVUA 3AS4A 3TG5A 2CFUA 3OS5A 2RFIA 3W9GA 1S0PA 3ZN3A 4YNPA 2XHEA 4YNMA 4M3OA 4A63B 3DB5A 2X6IA 1Q2ZA 5CEAA 4FJYA 3DSWA 2AXVA 4APFA 2WMOA 3RRMB 4BEPA 2ETCA 2QPWA 2EIME 5AQBA 2Y1LE 3U3WA 2R17C 5JHAA 2Y4TA 3ZFWA 1TEZA 4HOQA 1JWGA 4C1QA 3DSUA 4EBAA 4FULA 3SFYA 2R03A 3G2SA 2XEVA 3T8MA 4IRUA 3ABKE 2MOWA 2IGQA 3FUNA 2P2CP 1E90A 5EILA 2WB2A 4YPEA 1TNOA 3MO5A 2AXUA 3CKCA 4GCOA 3CVXA 1JCQA 1HG5A 3CBMA 5EYPF 4TV3A 2KZTA 4DUIA 2WM9A 3KMAA 3PNLB 1JWFA 3PZ4A 3D9HA 2L6BA 3F9XA 3CQCB 3RO2A 4RZ0A 4PS7A 4JB8P 1Z3XA 1P5QA 4GTQA 4JHKA 2XS1A 5ENOD 2I1JA 1G3NB 1TYQG 2P9LG 2J9QA 3Q49B 3RAUA 4U0SA 3ASGA 4PS3A 3SZ7A 3I3NA 3UQ3A 4A3VA 3OOIA 3Q78A 3FFLA 3ONKA 4G8LA 2VSXE 4JZYA 4Z68A 4GZ5A 5JINA 4TRQA 3ZYLA 1OT8A 1NFIE 3BG0B 3L08A 3UM1A 4OAVB 3AS8A 4L9PA 3HNAA 4PS8A 3MCXA 5CBNA 3B7TA 3SO8A 3U9WA 1MX2A 4DX1A 2RG8A 1EYHA 4GCNA 3TGOA 3CHPA 3JYSA 2V4LA 4U63A 4PDXA 2HYZA 3CK7A 1OWLA 4YPAA 1TR4A 2H6GA 2P9SG 1WDYA 2OCCE 1TNBA 4DX7D 2EQXA 2IFUA 5D2MC 5G04J 2PNNA 3M57A 5FT9A 1MJ0A 4RG9A 1OWMA 4Q94A 3FP3A 5T4YA 4GA1A 3V2XA 5AIJA 5ENTD 4J8FA 5HQ8A 3V31A 2L0TB 4AV7A 3AG3E 3CBPA 1V54E 2C0LA 4GB9A 3D9KA 4CDMA 4N3BA 3ZEFA 3FTVA 4BY6A 4KMOA 3CQGB 1S63A 1TN6A 5KJNA 4NACA 2WXMA 2WXFA 3L22A 3OXLA 5FZSA 4BT9A 2IU1A 2KATA 4DLOA 3OXFA 4HOSA 3SFXA 4QEPA 3ZIMA 3U66A 2F69A 1WM5A 2NSZA 4WWOA 3TWTA 3E33A 4N5CA 3I5PA 3Q75A 3SGHA 2XRYA 4E85A 4MBGA 1GW6A 1FVFA 2RD0A 4HNAD 4QENA 4C0MA 3CHOA 3JCKC 3TWVA 2HM8A 5JJTA 4TXQA 1OCRE 2KBXA 2WXRA 3JXJA 1MT6A 3D9PA 4GTOA 3CK9A 3DXMG 3HRAA 3TWQA 1MUFA 2DZOA 3HIZA 3ASFA 3DPDA 5JJ6A 4AP2A 4DX6D 3LCAA 4LCTA 3KD7A 3OXGA 3RSEG 3DPYA 4BFRA 5EN5D 3FUEA 4DI3A 2RKKA 3F6QA 1NZNA 4GYWA 4XEIG 3D9JA 1FVHA 3MZLB 4LNUD 3FUHA 2CG2A 3GZ1A 4KVMA 1KZOA 3R7RA 1PY1A 1HH8A 5AJLA 4BT8A 3DSVA 3FTXA 3ZXSA 3GW4A 4JD2G 3PZDA 5EX0A 3QWWA 3MA5A 1IYGA 2A5EA 1D8DA 2J4DA 5AN8A 3VTYA 3FPDA 4DK5A 5KNGA 3Q5MA 4EZLA 2OEVA 2EILE 5AQAA 5BW8C 2WVIA 4WNGA 4U04A 2XENA 3VLEA 2QYUA 2IQCA 1IQUA 3RO3A 3UMVA 4HOTA 3N71A 3FUDA 3PE3A 3HXFA 2IO3C 2IF4A 5A23A 2BKKB 3HYMB 1SW6A 5D66A 5BV0A 3FWVA 4KBQA 3S7BA 3OPEA 1D8EA 5JHBA 2DIWA 1N52A 5LSXA 4KXKB 2VQ2A 3X2QE 4ANUA 3IHXA 1MYOA 1OWNA 4DJAA 2CG3A 4BSZB 5CMYA 3FU0A 2IY0C 4HRLA 3CK8A 4O1PA 3HVEB 5B1BE 3Q15A 3AU5A 2DBAA 2O8JA 3NOCD 1N95A 3G2WA 3DSSA 3G2VA 3O48A 4IULA 4ILIA 5EIDA 4HB5A 2LAHA 3G2UA 4FHJA 4U8YD 4JEHA 3K5KA 1KT0A 2V5QC 3ZNGA 1VDYA 4J7IA 3NBNB 3C72A 3T5XA 3TWXA 4IYPA 2WXOA 3F9YA 3R7QA 1OWOA 1HU3A 3SD5A 4WNFA 3CHRA 1E8WA 4P29A 3LY9A 3BEEA 2OVBA 4YDWA 3SWCA 4CRWA 3CVNA 4GPKA 1H3IA 4GZDA 4QEOA 3FU6A 4I9EA 4JEUA 4EQFA 5EG2A 2KCLA 3E37A 3FUIA 4GZCA 4I9CA 4U96D 3MGBA 4XI0A 2Y0BG 3AJIA 1NL4A 4BESA 3LJ3A 2XGOA 3LVRE 1BD8A 4I6JA 3CVPA 2WPVA 3B7UX 3LY8A 5CMWA 2Q7FA 3RU0A 3FTSA 4A3TA 3ZU7B 4Y6WA 3M54A 1N6AA 4F53A 4R7LA 3M56A 2I9CA 5ANRA 2CFZA 1UN9A 4H7YA 3KS2A 3ZKJA 3AG4E 3RIBA 4GZ3A 2XCCA 2B6CA 5LP0A 3HXDA 4GZ6A 3ZW3A 3ZHEB 4GMLA 3K9IA 1Y8MA 1HS6A 5AARA 4C48B 3UM2A 1AP7A 1PAQA 2AWIA 3CLJA 3ULEG 3CBOA 5AYFA 4D10C 3JQ0A 4AXHA 2YINA 2H6IA 1ELRA 3GYZA 1ML9A 4H7XA 4UQYA 3KSQA 3L54A 3ESLA 2IONA 2JLBA 3CHSA 3FEYA 3UTMA 3M55A 4J8DA 1ZKKA 4O30A 4HS2A 5D0OD 3AS5A 3I4GA 4I43A 2WXIA 3LPZA 1E7UA 4JA9A 4EZKA 3CGHA 2R02A 2CHWA 2I1KA 2NYJA 2L6JA 5BT1A 3V2OA 2WMNA 5B1AE 3CKBA 3IXEA 5ARFA 2XPZA 2RFAA 1YCSB 1HZ4A 1H0AA 2ZGGA 2JV0A 1JCSA 3B7BA 4ATZD 5T0KA 3FUMA 5BPPA 2BUGA 3DBSA 4GTVA 2YQ8A 3NF1A 3EJNA 1TN7A 4EECA 4CEMA 3TJPA 4XZ4A 3UT8A 2PM7A 3SY2A 1FT2A 3FTYA 1IHBA 3SHFA 1HXIA 3LVQE 3D9OA 5LFAA 1D9SA 4CDRA 2QY7A 3GZ2A 4J6IA 2DWZA 4L2LA 4K5BA 2OVFA 4LDGA 4I1OB 3TWUA 1OWPA 3AAAC 4FU3A 3S7FA 3ASOE 1NI1A 4BETA 4F6RD 4WWNA 4G11A 1HX8A 3B7RL 1SA5A 2LO6A 4OYSA 3MV2B 4HXIA 4ME2A 2X6FA 3CEQA 2UY1A 5B3SE 4APOA 4J0UA 2OV8A 2OOEA 3KSLA 5T8IA 1N4PA 1RW2A 5G55A 1ELWA 4YVQC 3C3QA 2XS8A 3MO0A 2WXQA 5G05J 2GRQB 4ATGA 1KZPA 2VJ8A 3Q7AA 3GZSA 3R9AB 1A17A 1XQHA 3D3MA 5HKPA 3ML8A 4TUUA 2H6HA 3S7JA 4JDSA 3Q79A 1BI7B 2LAIA 1UJKA 4DLQA 2F8YA 2P58C 4GA2A 3HHMA 2R59A 3APFA 1TNUA 4L23A 3MEKA 4BX9A 2VGEA 1PEGA 5G04C 4BSXA 4O1OA 3M53A 3PZ2A 3UI2A 4K0RA 3V79K 2WXLA 1UN8A 5C2YA 4GTRA 3Q9UC 4Q96A 2UWJG 5E75A 1K1BA 3SW9A 1UOHA 3UT4A 4J7FA 1BLXB 3MO2A 2FEZA 4UQZA 2Y69E 3FTUA 3RJWA 1H2VC 5HI7A 1A5EA 4PH4B 3CVUA 2PL2A 3T9KA 3IHYA 1V55E 3UPVA 4ANWA 1OY3D 2DVWA 4GYYA 3QC1A 4JXTA 1O1SA 4L1BA 5ITZF 5G2NA 1UJJA 2MYOA 2P9KG 3NZUA 4A1GA 5DBKA 4G2VA 4HBDA 4G8KA 4G24A 5FZQA 3HG0D 5LOZA 5T3RA 1AWCB 4J8YA 5AYWD 2IOLA 1O5MA 4UWHA 5BNWA 3LS8A 4K5CA 4L7TA 1INZA 2NC9A 4EZJA 5F6LA 3WXXA 3V30A 4I6GA 1YA0A 4TXPA 2XGMA 5LCWC 5LSZA 3D9IA 4K03A 1O1TA 3ASHA 3G2TA 3PRZA 3HDXA 2X6HA 2YNQA 3Q7FA 2Y3AA 5TH7A 3JUIA 4U07A 3FU3A 1H6OA 4J8EA 4FP7A 2R2LA 3UIPC 5BXOA 1DNPA 1NA3A 2XZDG 4FLBA 3EIQC 4ZHBA 1H6KA 4CGWA 3E30A 4A1SA 4BTBA 5J90A 2HE0A 3AU4A 4UWFA 4B0ZA 2PQRA 1HE8A 2ZIRA 3FULA 1N94A 3BU8A 2FO1E 4H12A 4MKTA 4HI8A 5KNHD 4E47A 2PM6A 5JJ7A 1FT1A 2KCVA 3OAWA 3FTZA 2ONDA 4K5AB 4YVOA 4RLYA 3IEGA 4HORA 3SF4A 5HRYA 2OEWA 2MHKA 2P9NG 4HI9A 3J5PA 4LUNU 3E34A 3RKVA 3NOGD 3KMJA 3QNKA 3ZYQA 3IBEA 4UWKA 3ENEA 4BUPA 3RJVA 5T5GA 4GPMA 3PH0C 3BG1B 3TL5A 4HRNA 3DEOA 4J8SA 1DC2A 2AXZA 3FHEA 1E96B 5ANLA 2LNIA 1K8KG 3O4ZA 2WXHA 5ENPD 1EPUA 4I1AA 4AOFA 5JMND 2AJAA 5A7DB 3CIAA 4GTSA 3JUEA 3FUFA 4U8VD 2XRZA 5AJDA 3RRNB 4RQIA 2EIKE 1Z5SC 5KCMA 4QQIA 2WXGA 5FQ7A 3M5AA 4NJ5A 1U3CA 1E8YA 3MX3A 2XEEA 5CHEE 2LXLA 2C0MA 1PC2A 2V5FA 3VTXA 5AAOA 3IV0A 3QOUA 3AG2E 4HFGA 3PDNA 4FLHA 2Y4UA 4NIKA 3RAYA 1SQMA 3DXKG 2KM4A 1XNFA 2YHEA 3LY7A 4YDEA 1TNZA 4GTPA 4O60A 4JW1A 4YDOA 3ASDA 3C3RA 5F6KC 3F9WA 4JA7A 3UKRG 3DRAA 3HVEA 3QK0A 3PEUB 4W9RA 3HXBA 5EIBE 1X81A 1OCOE 3ML9A
chains in the Genus database with same CATH topology
2C2LA 1ZKKA 4HS2A 4O30A 5D0OD 4PUCA 3MCXA 2BF0X 3AS5A 3B7TA 2XQ0A 3CVLA 3I4GA 4I43A 1W3BA 3P2BA 2WXIA 4JC8A 3LPZA 3U9WA 1U3DA 2ZU6B 1E7UA 1L5JA 4JA9A 4AIFA 3EHNA 4NURA 4EZKA 3CGHA 2L9BA 2RG8A 4WUYA 1EYHA 4G23A 4GCNA 4F7AA 2CHWA 2I1KA 2WXPA 3CHPA 4KZCA 5BV1A 3ONLA 4I6EA 3JYSA 2L6JA 2V4LA 5BT1A 3RRUA 1X5BA 3EDTB 1FCHA 2WMNA 2L0IA 3PUJA 4BWRA 4U63A 4PDXA 3SNXA 3CKBA 2HYZA 5KJMA 3CK7A 1OWLA 2A4ZA 4U0ZA 2WXKA 1TJFA 4YPAA 1TJCA 3FTWA 5ARFA 4AU7A 4KYOB 2XPZA 1HZ4A 2HO1A 4Y6CA 1H0AA 4UWLA 2JV0A 1QZ2A 1H19A 1WY6A 3Q4AB 2NXPA 3CV0A 1KT1A 1SZ9A 4GYOA 2A5UA 5T0KA 4GA0A 3FUMA 5BPPA 2EQXA 4ACLA 2IFUA 2BTDA 5G04J 3TGOA 2VTBB 4DI4A 3S8PA 2J08A 3P1UA 3CVQA 3LKUA 2BUGA 5FT9A 3M57A 3APDA 3E4BA 3DBSA 4RG9A 2VYIA 3CVYA 4N3AA 3ZHEA 2WQ7A 1OWMA 2YQ8A 4Q94A 3FP3A 5DIZA 3NF1A 4O6FA 5T4YA 3EJNA 4GA1A 5AIJA 4RG6A 3QB2A 1SZAA 4J8FA 4CEMA 3TJPA 4EECA 4XZ4A 5HQ8A 3KMTA 4JVSA 3MKQA 3FU5A 3UT8A 3L13A 2L0TB 2PM7A 4AV7A 4CDNA 4FA6A 3CBPA 3QJZA 3FTYA 4MLPA 4NQ0A 3SHFA 2AVPA 4XX5A 2C0LA 3CVVA 4GB9A 3D9KA 1HXIA 3CHQA 4MI0A 3LVQE 3D9OA 4CDMA 4WNDA 5LFAA 4N3BA 1ELKA 2VSNA 3FUKA 4CDRA 3ZEFA 1BPOA 3SBSA 2QY7A 3FTVA 4BY6A 3GZ2A 4KMOA 2FBNA 4J6IA 1Y6IA 3CQGB 2XPIA 5KJNA 4NACA 2WXMA 2WXFA 3L22A 4L2LA 2OVFA 5T0MA 4RVBA 4LDGA 3OXLA 1MQSA 4A55A 4I1OB 5FZSA 4BT9A 2IU1A 1OWPA 2KATA 4DLOA 5JJ0A 3OXFA 4FU3A 3S7FA 4HOSA 2IOSA 4XE0A 4XKCA 2G46A 4G1TA 4QEPA 1N54A 2XPYA 3ZIMA 3U66A 2F69A 4IJ8A 3DALA 1WM5A 3MJWA 5G05C 3PNTB 2NSZA 2JEKA 3KAEA 4WWNA 4G11A 1HX8A 3B7RL 4WWOA 4N39A 4N5CA 2LO6A 3I5PA 1HO8A 2X38A 4OYSA 2VTBA 2CHXA 3MV2B 4HXIA 4BX8A 5J08A 4ME2A 4G26A 3CEQA 2X6FA 3SGHA 2XRYA 4E85A 2UY1A 1GW6A 5LX8A 2DCPA 1FVFA 3D9LA 3ZVVA 4IJDA 2RD0A 4J0UA 5FZRA 4APOA 4AVXA 4QENA 4C0MA 3FY4A 2OV8A 1HG2A 2KC7A 2UY1B 3CHOA 2OOEA 2HM8A 3JCKC 5C1DA 3IHVA 5JJTA 5KJKA 4I2WA 5T8IA 5FQ8A 4UI9J 2VGXA 2FO7A 2R3AA 2FF4A 2WXRA 3SBTB 5G55A 2MRIA 1ELWA 3U4TA 1MT6A 4YVQC 3D9PA 3M58A 3CK9A 3MO0A 2WXQA 5G05J 2GW1A 4ATGA 1MUFA 4F3VA 2VJ8A 3HIZA 3ASFA 3DPDA 4I1MA 3PS6A 5JJ6A 3S2AA 3GZSA 2WXJA 3VUZA 3R9AB 1A17A 4AP2A 1XQHA 3D3MA 4XIFA 3LCAA 2E0IA 4LCTA 3KD7A 2CHZA 3ML8A 4TUUA 3S7JA 1H2TC 4JDSA 3OXGA 2WXNA 5A6CA 5ARGA 4BFRA 2LAIA 1UJKA 4CT0A 3FUEA 4DLQA 4DI3A 2P58C 4AY6A 4GA2A 3HHMA 2R59A 1N6CA 5KJLA 2J4BA 1NZNA 3APFA 4GYWA 3I4RB 4JHRA 4L23A 4BX9A 3MEKA 4I2ZA 3D9JA 1FVHA 3FEXA 4BTAA 3MZLB 3CVWA 3SI5A 1PEGA 1HF8A 3FUHA 4YNDA 2CG2A 4UI9C 5FQ6A 3GZ1A 4KVMA 5G04C 4BSXA 3FDHA 5CPRB 4ILHB 3CSFA 3R7RA 1PY1A 5EDSA 3M53A 1HH8A 3FH8A 2XCBA 5AJLA 4K0RA 4BT8A 3QWPA 3FTXA 2WQHA 1UN8A 2WXLA 5C2YA 3SFZA 3ZXSA 3GW4A 3LEWA 3PZDA 4Q96A 3VV0A 2UWJG 1UW4B 2E2EA 3B13A 3FH5A 2PQNA 5EX0A 3UX4A 4NVQA 3UUXA 4J83A 3CHMA 3MA5A 3QWWA 5E75A 3TG4A 1IYGA 4MI5A 2PZIA 2J4DA 1H2UA 3SW9A 2KCKA 2R5SA 2GGFA 3QAQA 3TXNA 3VTYA 5CCMA 3FPDA 1XGWA 4DK5A 3UT4A 4RSYA 3APCA 4J7FA 4ABNA 3PE4A 1EDUA 2IJGX 3MO2A 2FEZA 4UQZA 3ZYMA 3ESKA 4C0EA 3QDNA 3FTUA 2GRMA 3RJWA 1QNFA 3Q5MA 2I2OA 4EZLA 5BW8C 5ENNA 1H2VC 3BO5A 4JLGA 2WVIA 3LDZA 4JHJA 5HI7A 4MS6A 1NP7A 4PH4B 2M63A 1MVHA 4WNGA 4U04A 1ZBPA 4EPZA 5F59A 4HOUA 3CVUA 2PL2A 3VLEA 2KZTB 3IHYA 2IQCA 1IQUA 3UPVA 3RO3A 3UMVA 4N3CA 4I51A 4ANWA 4HOTA 1WAO1 3N71A 3FUDA 3PE3A 4C9BB 4GYYA 3QC1A 4JXTA 4L1BA 4U8HA 3ZGQA 5E76A 1UJJA 5G2NA 2X3MA 2IF4A 4XKBA 3C98A 5A23A 4QFVA 3HYMB 3L17A 3LYAA 5FWQA 2J07A 5BV0A 3NZUA 3PEVB 3FWVA 4WNEA 5DBKA 2HR2A 4G2VA 4KBQA 2J49A 3S7BA 4A1GA 3OPEA 4G24A 5FZQA 2VGYA 4N2SA 2VGXB 5JHBA 2DIWA 1JUQA 1N52A 4HLEA 5LSXA 3FH7A 5LOZA 4KXKB 5T3RA 2VQ2A 1MHQA 3D9MA 4AJWA 4ANUA 2FI7A 2VSYA 5AYWD 3IHXA 2IOLA 4FADA 5FTPA 4UWHA 4Q69A 1OWNA 1IQRA 1E8ZA 3LS8A 3NZSA 5BNWA 2WQ6A 2J09A 3QWVA 4L7TA 3PVLA 4DJAA 2CG3A 1INZA 2NC9A 5CMYA 1IHGA 3JQ1A 4UI9K 4EZJA 2V0PA 3FU0A 2FULA 5F6LA 5CCLA 4YPUA 4GU5A 2QFCA 3WXXA 1KLXA 4JL0A 4I6GA 5JIYA 1YA0A 1QQEA 2GRLA 4U0UA 1JPLA 1E8XA 2VSOE 3CK8A 4FMUA 2XGMA 5LCWC 5LSZA 1B89A 3HVEB 4DPRA 3D9IA 3RQ4A 4K03A 3S7DA 3U64A 4EBAG 5BUZA 3UT7A 1OUVA 4B8AA 3ASHA 4J8OA 4GMJA 3IKOB 3G2TA 3Q15A 3AU5A 2DBAA 3PRZA 2O8JA 3HDXA 4B94A 4Z4PA 4ILGA 4WWPA 2W5ZA 4V3IA 3T5VA 2X6HA 4URKA 2YNQA 3G2WA 5F5EA 1Z6TA 2AW6A 3G2VA 4CGVA 4L2YA 2X6JA 3O48A 4IULA 4ILIA 2LAHA 2Y3AA 3G2UA 4B89A 4FHJA 3JUIA 3MYVA 3QKYA 4U07A 5TH7A 3FU3A 5FJYA 4E6HA 4OVVA 4WAFA 4J8EA 5AENA 4FP7A 4JEHA 3LXUX 3URZA 5TEGA 1ZU2A 3K5KA 1DVPA 1KT0A 1DNPA 3EIJA 5LCWJ 3MKQB 2I6HA 1NA3A 1VDYA 1MVXA 5TTFA 4KT6B 4J7IA 4KZ0A 2LSUA 4OVUA 3T5XA 3AS4A 3VLDA 4FLBA 4IYPA 3EIQC 1LF8A 2WXOA 3TG5A 2CFUA 1H6KA 4CGWA 3F9YA 4A1SA 3R7QA 4BTBA 5J90A 3OS5A 1OWOA 1HU3A 3SD5A 4F1SA 2RFIA 2LSVA 4WNFA 1S0PA 1NA0A 3CHRA 4XI9A 3AU4A 3ZN3A 1E8WA 3OTNA 4YNPA 4P29A 2XHEA 4UWFA 4B0ZA 2PQRA 2X6KA 1HE8A 3LY9A 3BEEA 4YNMA 3FULA 4M3OA 2OVBA 3ZYKA 4KVOA 4H12A 3SWCA 4GAAA 4ACKA 4CRWA 3CVNA 4MKTA 3DB5A 4E47A 2X6IA 4GPKA 4FJYA 1H3IA 4GZDA 2ILRA 2PM6A 5JJ7A 2AXVA 4APFA 2KCVA 1Z3YA 2WMOA 3FU6A 3OAWA 3FTZA 3Q47B 4I9EA 3RRMB 3TAXA 2W5YA 2ONDA 3KEZA 4YVOA 4JEUA 3IEGA 4HORA 3SF4A 2QPWA 4JPSA 2MHKA 3U3WA 2R17C 4LUNU 4G25A 1EF1C 4EQFA 5EG2A 3RKVA 4MRUA 5JHAA 2KCLA 3KMJA 2Y4TA 3QNKA 3ZFWA 1TEZA 4HOQA 1JWGA 3ZYQA 4C1QA 3IBEA 3L6AA 4UWKA 3ENEA 4EBAA 3RJVA 4BUPA 1E7VA 4FULA 5T5GA 4B8CB 5D0QD 3G2SA 2XEVA 3FUIA 4GZCA 3PH0C 4IRUA 5EKQD 3T8MA 3M59A 3ZRHA 3CR3A 3BG1B 4I9CA 2MOWA 3TL5A 2IGQA 3FUNA 3MGBA 4J8SA 4LERA 4XI0A 3HNAA 1HFAA 1E90A 2AXZA 3FHEA 1E96B 3B7SA 5ANLA 5FQ4A 2LNIA 3LJ3A 2WB2A 4YPEA 4CT4A 3MO5A 2AXUA 2XGOA 3CKCA 3EHMA 3LVRE 4GCOA 3O4ZA 3RK6A 2WXHA 3CVXA 4AY5A 1HG5A 1EPUA 3CBMA 4I1AA 4N2QA 3CSTA 4I6JA 4LRZA 4AOFA 4ANVA 3CVPA 5JHNA 4TV3A 2WPVA 3CIAA 3B7UX 5A7DB 3TXMA 2KZTA 3LY8A 5CMWA 4ANXA 2WM9A 3KMAA 3FUFA 2Q7FA 3RU0A 3PNLB 3FTSA 4A3TA 1JWFA 2XRZA 3VLFA 5AJDA 4FHKA 4Y6WA 4FC8A 3F9XA 3RRNB 3M54A 3CQCB 3PUKA 3RO2A 4RZ0A 4PS7A 4I17A 3FUJA 5KCMA 1N6AA 4F53A 2WXGA 1Z3XA 4R7LA 4AM9A 3M56A 2I9CA 5ANRA 1P5QA 2CFZA 5FQ7A 1UN9A 3EP0A 3M5AA 3PREA 1O9SA 4NJ5A 1U3CA 4H7YA 2XGSA 4NRHB 2BQZA 1E8YA 3MX3A 4JHKA 3KS2A 4IN3B 5CHEE 2I1JA 1N3JA 1UG3A 2C0MA 4GZ3A 1PC2A 2J9QA 3RIBA 3Q49B 2V5FA 4U0SA 2XCCA 4FJZA 3VTXA 3ASGA 5LP0A 4GZ6A 3ZW3A 3IV0A 3ZHEB 4HVBA 3QOUA 4GMLA 3K9IA 4PS3A 1Y8MA 4HFGA 3PDNA 1HS6A 3SZ7A 3I3NA 2Y4UA 4FLHA 4LEUA 3UQ3A 4A3VA 3RAYA 1SQMA 3ZPJA 3OOIA 3MKRA 3FFLA 3ONKA 3QARA 2KM4A 1XNFA 2V8SE 2YHEA 3LY7A 4QEOA 2VSXE 1PAQA 3NQPA 2AWIA 4JZYA 4CCAA 5EX3A 3F9ZA 4JW1A 3CLJA 5JINA 4GZ5A 5M72A 4TRQA 3CBOA 5AYFA 4D10C 3JQ0A 4AXHA 4UQXA 3ASDA 5F6KC 2YINA 2YHCA 3MV3B 3F9WA 4JA7A 3ULQA 3HVEA 1ELRA 3GYZA 3QK0A 1ML9A 4H7XA 3ZYLA 3PEUB 4W9RA 3D9NA 4UQYA 3L16A 3L54A 4AEZC 4UWGA 3BG0B 3ESLA 2IONA 2JLBA 3L08A 3CHSA 3FEYA 3AS8A 3M55A 4J8DA 3ML9A 4PS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2L A;  1ZKK A;  4O30 A;  5D0O D;  3AS5 A;  3CVL A;  1W3B A;  3LPZ A;  4JA9 A;  4AIF A;  4WUY A;  4YPU A;  4G23 A;  4GCN A;  3TGO A;  3JYS A;  2L6J A;  5BT1 A;  3EDT B;  1FCH A;  4BWR A;  3CKB A;  2HYZ A;  5KJM A;  3CK7 A;  4U0Z A;  4YPA A;  1TJC A;  5ARF A;  4AU7 A;  4KYO B;  1HZ4 A;  2HO1 A;  4Y6C A;  2JV0 A;  1QZ2 A;  3Q4A B;  3CV0 A;  1KT1 A;  4GYO A;  5T0K A;  4GA0 A;  2IFU A;  5G04 J;  3S8P A;  3M57 A;  3CVQ A;  3LKU A;  2BUG A;  5FT9 A;  3E4B A;  4RG9 A;  2VYI A;  4N3A A;  3ZHE A;  5DIZ A;  2YQ8 A;  3FP3 A;  3NF1 A;  4O6F A;  4GA1 A;  4RG6 A;  4J8F A;  5HQ8 A;  3KMT A;  3CBP A;  4NQ0 A;  2AVP A;  2C0L A;  4MI0 A;  1HXI A;  4WND A;  4N3B A;  2VSN A;  4CDR A;  3GZ2 A;  2FBN A;  2XPI A;  5KJN A;  5T0M A;  4LDG A;  3OXL A;  5FZS A;  4BT9 A;  2KAT A;  5JJ0 A;  3OXF A;  3S7F A;  4HOS A;  2G46 A;  4G1T A;  4QEP A;  2F69 A;  4IJ8 A;  3DAL A;  1WM5 A;  5G05 C;  3KAE A;  4N39 A;  4N5C A;  3MV2 B;  4ME2 A;  4G26 A;  3CEQ A;  2UY1 A;  4IJD A;  5FZR A;  4J0U A;  4APO A;  4QEN A;  2KC7 A;  2UY1 B;  2OOE A;  5C1D A;  5JJT A;  5KJK A;  4I2W A;  4UI9 J;  2VGX A;  2FO7 A;  2R3A A;  2FF4 A;  1ELW A;  3U4T A;  1MT6 A;  4YVQ C;  3M58 A;  3CK9 A;  3MO0 A;  5G05 J;  2GW1 A;  1MUF A;  4F3V A;  3ASF A;  5JJ6 A;  3VUZ A;  3R9A B;  1A17 A;  1XQH A;  4XIF A;  3LCA A;  3KD7 A;  3S7J A;  4JDS A;  3OXG A;  5A6C A;  5ARG A;  2P58 C;  4AY6 A;  4GA2 A;  1N6C A;  5KJL A;  4JHR A;  1NZN A;  4GYW A;  3MEK A;  4I2Z A;  4BTA A;  1PEG A;  5G04 C;  4YND A;  4UI9 C;  3GZ1 A;  5CPR B;  3M53 A;  1HH8 A;  2XCB A;  4BT8 A;  3QWP A;  2WQH A;  3GW4 A;  3VV0 A;  2UWJ G;  2E2E A;  2PQN A;  5EX0 A;  4NVQ A;  3UUX A;  4J83 A;  3QWW A;  3MA5 A;  1IYG A;  4MI5 A;  3TG4 A;  2PZI A;  3SW9 A;  2KCK A;  2R5S A;  3VTY A;  3FPD A;  5CCM A;  4J7F A;  4ABN A;  3PE4 A;  3MO2 A;  2FEZ A;  4UQZ A;  3ESK A;  3QDN A;  3RJW A;  3Q5M A;  5BW8 C;  3BO5 A;  4JLG A;  5HI7 A;  1MVH A;  4WNG A;  4U04 A;  1ZBP A;  5F59 A;  4HOU A;  2PL2 A;  3UPV A;  3RO3 A;  4N3C A;  4I51 A;  4HOT A;  1WAO 1;  3N71 A;  3PE3 A;  4GYY A;  3ZGQ A;  2IF4 A;  3HYM B;  3LYA A;  4WNE A;  3FWV A;  5DBK A;  2HR2 A;  4G2V A;  4KBQ A;  3S7B A;  3OPE A;  4G24 A;  5FZQ A;  2VGY A;  4N2S A;  2VGX B;  5LSX A;  4KXK B;  2VQ2 A;  2FI7 A;  2VSY A;  5AYW D;  3IHX A;  5FTP A;  5BNW A;  3QWV A;  2NC9 A;  1IHG A;  4UI9 K;  5F6L A;  5CCL A;  2QFC A;  3WXX A;  1KLX A;  4JL0 A;  5JIY A;  1YA0 A;  1QQE A;  4U0U A;  3CK8 A;  4FMU A;  2XGM A;  5LCW C;  5LSZ A;  1B89 A;  3RQ4 A;  3S7D A;  1OUV A;  3ASH A;  4J8O A;  3Q15 A;  2DBA A;  2O8J A;  4B94 A;  4Z4P A;  2W5Z A;  5F5E A;  4CGV A;  3O48 A;  5TH7 A;  3QKY A;  4U07 A;  5FJY A;  4J8E A;  3URZ A;  5TEG A;  1ZU2 A;  3K5K A;  1KT0 A;  5LCW J;  2I6H A;  1NA3 A;  1MVX A;  5TTF A;  4J7I A;  2LSU A;  3AS4 A;  3TG5 A;  4CGW A;  3F9Y A;  4A1S A;  4BTB A;  3OS5 A;  2RFI A;  2LSV A;  4WNF A;  1NA0 A;  4XI9 A;  3ZN3 A;  4YNP A;  2PQR A;  3LY9 A;  3BEE A;  4YNM A;  4H12 A;  3SWC A;  3CVN A;  3DB5 A;  4E47 A;  4GPK A;  1H3I A;  5JJ7 A;  4QEO A;  2KCV A;  3TAX A;  3Q47 B;  4I9E A;  2W5Y A;  2OND A;  4YVO A;  3IEG A;  4HOR A;  3SF4 A;  2QPW A;  2MHK A;  3U3W A;  4G25 A;  4EQF A;  5EG2 A;  3RKV A;  2KCL A;  3KMJ A;  2Y4T A;  3ZFW A;  4HOQ A;  4C1Q A;  4BUP A;  3RJV A;  5T5G A;  5D0Q D;  2XEV A;  5EKQ D;  3M59 A;  4I9C A;  2IGQ A;  4XI0 A;  1E96 B;  2LNI A;  4YPE A;  3MO5 A;  2XGO A;  3CKC A;  4GCO A;  4AY5 A;  3CBM A;  4I1A A;  4N2Q A;  3CVP A;  5JHN A;  2WPV A;  5A7D B;  3LY8 A;  3KMA A;  2Q7F A;  3RU0 A;  4Y6W A;  3F9X A;  3M54 A;  3RO2 A;  4RZ0 A;  4I17 A;  1N6A A;  3M56 A;  4AM9 A;  1P5Q A;  3EP0 A;  3M5A A;  1O9S A;  4NJ5 A;  4H7Y A;  4NRH B;  2XGS A;  2BQZ A;  3KS2 A;  4IN3 B;  5CHE E;  1N3J A;  2C0M A;  4GZ3 A;  3RIB A;  1PC2 A;  2J9Q A;  3Q49 B;  2V5F A;  4U0S A;  2XCC A;  3VTX A;  3ASG A;  4GZ6 A;  3ZHE B;  3QOU A;  3K9I A;  1Y8M A;  3PDN A;  3SZ7 A;  2Y4U A;  4LEU A;  3UQ3 A;  3RAY A;  3ZPJ A;  3OOI A;  3MKR A;  3FFL A;  1XNF A;  3LY7 A;  5EX3 A;  3F9Z A;  5JIN A;  4GZ5 A;  5M72 A;  3CBO A;  5AYF A;  4UQX A;  3ASD A;  5F6K C;  2YHC A;  3MV3 B;  3F9W A;  4JA7 A;  3ULQ A;  1ELR A;  3GYZ A;  1ML9 A;  4H7X A;  4W9R A;  4UQY A;  2JLB A;  3AS8 A;  3M55 A;  4J8D A;  3HNA A; 
#chains in the Genus database with same CATH topology
 2BF0 X;  4JC8 A;  4DX2 A;  1U3D A;  2ZU6 B;  4AIF A;  3EHN A;  2L9B A;  4F7A A;  2WXP A;  4KZC A;  5BV1 A;  3NAW A;  5CER B;  4HQD A;  1X5B A;  3EDT B;  1OCC E;  2L0I A;  3SNX A;  2JAB A;  5ENS D;  4U0Z A;  1TJF A;  1TJC A;  4KYO B;  1O1R A;  3B95 A;  2HO1 A;  4Y6C A;  3EUV A;  4UWL A;  1WY6 A;  3Q4A B;  1N4Q A;  1KT1 A;  2P9I G;  1S64 A;  4GYO A;  2BTD A;  2J08 A;  4LNB A;  3E4B A;  3CVY A;  3WG7 E;  4N3A A;  3ZHE A;  2WQ7 A;  5DIZ A;  3Q9N C;  2GRR B;  3KMT A;  3C5R A;  3L13 A;  4CDN A;  4FA6 A;  3QJZ A;  4NQ0 A;  3CVV A;  4MI0 A;  3LJN A;  4WND A;  2VSN A;  1BPO A;  2FBN A;  1Y6I A;  4UUC A;  5T0M A;  4LNG A;  1MQS A;  4A55 A;  2ZXW E;  2IOS A;  4XKC A;  4G1T A;  1N54 A;  4IJ8 A;  3DAL A;  3EHR A;  3PNT B;  3KAE A;  4GMR A;  2EIJ E;  1FPP A;  4N39 A;  2X38 A;  4YDY A;  5J08 A;  2GRN B;  2F0Y A;  4U7E B;  1WG0 A;  5LX8 A;  3KEA A;  2DCP A;  4IJD A;  5FZR A;  4AVX A;  1HG2 A;  2KC7 A;  2UY1 B;  5C1D A;  3DEP A;  3UIN C;  3IHV A;  4I2W A;  5FQ8 A;  2FO7 A;  3U4T A;  5JA4 D;  5KBA A;  4F3V A;  4I1M A;  2QYJ A;  3VUZ A;  3HXC A;  1BI8 B;  4HRM B;  2WXN A;  5A6C A;  5ARG A;  5KWD A;  4CT0 A;  2BED A;  1N6C A;  3EU9 A;  4I2Z A;  4BTA A;  3SI5 A;  1HF8 A;  4YND A;  5FQ6 A;  3FDH A;  3UKU G;  4ILH B;  5EDS A;  3QWP A;  2WQH A;  3VV0 A;  1UW4 B;  2QZA A;  2E2E A;  3B13 A;  3FH5 A;  2PQN A;  3UX4 A;  3CHM A;  4OAU C;  3Q73 A;  4MI5 A;  2PZI A;  3QAQ A;  2GGF A;  5HS0 A;  2V4H C;  5CCM A;  5CEC B;  3APC A;  2RFM A;  4ABN A;  2GRO B;  3ZYM A;  4C0E A;  3QDN A;  1BU9 A;  1QNF A;  2I2O A;  3BO5 A;  4DX5 D;  4JLG A;  3LDZ A;  1MVH A;  4F1P A;  3UM3 A;  4HOU A;  2KZT B;  1DCE A;  3E32 A;  4I51 A;  1WAO 1;  4GTT A;  4C9B B;  3ZGQ A;  5EYL A;  3ZUV B;  3C98 A;  4QFV A;  5FWQ A;  3L17 A;  2J07 A;  1ZB1 A;  3PEV B;  4WNE A;  2HR2 A;  2J49 A;  2IO2 C;  1JCR A;  2VGY A;  4N2S A;  2R05 A;  3UIO C;  1QYM A;  3FH7 A;  1MHQ A;  3D9M A;  2QC9 A;  1K3Z D;  2FI7 A;  4FAD A;  1E8Z A;  2J09 A;  4CYM D;  3L9T A;  1IHG A;  3JQ1 A;  3SQV A;  2V0P A;  2FUL A;  4GU5 A;  5CRV A;  1KLX A;  1QQE A;  2XZT G;  4U0U A;  4X8Q A;  1JPL A;  2VSO E;  1B89 A;  5IY5 E;  3S7D A;  3TWR A;  3U64 A;  4EBA G;  5BUZ A;  3RQ4 A;  3UT7 A;  2LXM A;  4B8A A;  3EHQ A;  4B94 A;  4ILG A;  3T5V A;  2AW6 A;  4CGV A;  4L2Y A;  2X6J A;  3ZXP A;  3QKY A;  5FJY A;  4E6H A;  4OVV A;  3URZ A;  1ZU2 A;  1DVP A;  3TWS A;  1MVX A;  5TTF A;  3VLD A;  3ABM E;  1LF8 A;  1TNY A;  4F1S A;  2LSV A;  4TXR A;  1NA0 A;  4XI9 A;  1RZ4 A;  3OTN A;  3PZ1 A;  2X6K A;  3EU5 A;  2P9U G;  3ZYK A;  4KVO A;  1YYH A;  4GAA A;  4ACK A;  2EIN E;  2ILR A;  3TAX A;  1Z3Y A;  3Q47 B;  2W5Y A;  3KEZ A;  1H6P A;  3JXI A;  1N0Q A;  4JPS A;  4G25 A;  1EF1 C;  4MRU A;  2LUH A;  5FIN A;  3L6A A;  1IKN D;  1E7V A;  4B8C B;  1SA4 A;  5D0Q D;  5EKQ D;  3M59 A;  3ZRH A;  3CR3 A;  3DWL G;  4LER A;  1OCZ E;  4U95 D;  1HFA A;  4B93 B;  5BXU A;  1MZC A;  1N11 A;  3B7S A;  5FQ4 A;  5H7P A;  4HLL A;  4CT4 A;  3EHM A;  3J5Q B;  3RK6 A;  4AY5 A;  4N2Q A;  3CST A;  4ANV A;  4LRZ A;  5JHN A;  3TXM A;  5CRU A;  4GTM A;  4ANX A;  3HXE A;  3VLF A;  4FHK A;  4FC8 A;  3PUK A;  1MX4 A;  4I17 A;  3FUJ A;  5AQ9 A;  4AM9 A;  3DSX A;  3EP0 A;  3PRE A;  1O9S A;  4NRH B;  2XGS A;  2BQZ A;  4IN3 B;  1N3J A;  1UG3 A;  1K1A A;  4FJZ A;  1S70 B;  4HVB A;  4LEU A;  3ZPJ A;  3MKR A;  3ASN E;  3QAR A;  2V8S E;  3NQP A;  4CCA A;  5EX3 A;  3F9Z A;  5M72 A;  4UQX A;  2YHC A;  1QBQ A;  3MV3 B;  3ULQ A;  5ENQ D;  3D9N A;  1IXV A;  3L16 A;  4AEZ C;  4UWG A;  3UXG A;  2XEH A;  2C2L A;  4PUC A;  2IEJ A;  2XQ0 A;  3CVL A;  1W3B A;  3P2B A;  3R9M A;  1L5J A;  4NUR A;  2DYR E;  3ABL E;  4N5Q A;  4WUY A;  4YPU A;  4G23 A;  3ONL A;  2P9P G;  4I6E A;  3RRU A;  3PUJ A;  1FCH A;  1DCQ A;  4BWR A;  5KJM A;  2A4Z A;  2WXK A;  3FTW A;  4AU7 A;  1LD8 A;  1QZ2 A;  1H19 A;  2NXP A;  3CV0 A;  3W9F A;  4DRX E;  1SZ9 A;  2A5U A;  4GA0 A;  4ACL A;  2BKG A;  4ZFH A;  2VTB B;  4DI4 A;  3S8P A;  3P1U A;  3CVQ A;  3LKU A;  3APD A;  3TWW A;  2VYI A;  4LG6 A;  5FIO A;  4LSZ E;  4O6F A;  2DYS E;  4RG6 A;  3QB2 A;  1SZA A;  4JVS A;  1SVX A;  3MKQ A;  3FU5 A;  4MLP A;  2AVP A;  4XX5 A;  4J7W A;  3CHQ A;  1ELK A;  3FUK A;  3SBS A;  2ZGD A;  2XPI A;  3T8K A;  4RVB A;  2F37 A;  5JJ0 A;  4XE0 A;  1N4S A;  2G46 A;  2XPY A;  3MJW A;  5G05 C;  2JEK A;  5AQ7 A;  2DZN A;  4TUM A;  1HO8 A;  2VTB A;  2CHX A;  4BX8 A;  1LD7 A;  4G26 A;  3D9L A;  3ZVV A;  3FY4 A;  2H6F A;  5KJK A;  3ISM C;  4UI9 J;  2VGX A;  2R3A A;  2FF4 A;  3SBT B;  2MRI A;  3M58 A;  3NB2 A;  2GW1 A;  3PS6 A;  3S2A A;  2WXJ A;  4CZ2 D;  4XIF A;  2E0I A;  3ULY A;  2CHZ A;  1H2T C;  2GRP B;  4AY6 A;  5KJL A;  2J4B A;  4JHR A;  3I4R B;  3CVW A;  3FEX A;  4UI9 C;  5CPR B;  1LTX A;  3CSF A;  3FH8 A;  1U2V G;  2XCB A;  3SFZ A;  3BQO A;  3LEW A;  2J8S D;  4NVQ A;  3UUX A;  5CED B;  4J83 A;  3TG4 A;  1H2U A;  2KCK A;  2R5S A;  3TXN A;  1XGW A;  4BER A;  1N4R A;  4RSY A;  1OXJ A;  3PE4 A;  1EDU A;  2IJG X;  4M7C A;  3ESK A;  2GRM A;  2F8X K;  5ENN A;  4JHJ A;  4MS6 A;  1NP7 A;  2M63 A;  1ZBP A;  4EPZ A;  5F59 A;  2ETA A;  4N3C A;  4U8H A;  5CBO A;  5E76 A;  2X3M A;  1N0R A;  4XKB A;  2ZIS A;  3LYA A;  1MX6 A;  1TN8 A;  2VGX B;  1JUQ A;  4HLE A;  2KXP C;  4AJW A;  2B0O E;  2VSY A;  3C3O A;  5FTP A;  4Q69 A;  2WQ6 A;  3NZS A;  1IQR A;  3QWV A;  3PVL A;  3L82 A;  4UI9 K;  3AG1 E;  5CCL A;  2QFC A;  4JL0 A;  5JIY A;  2GRL A;  1E8X A;  4FMU A;  2ETB A;  4DPR A;  1OUV A;  4J8O A;  4GMJ A;  3IKO B;  3UM0 A;  3DST A;  5ENR D;  4Z4P A;  4WWP A;  2W5Z A;  4V3I A;  3BUA A;  4URK A;  5F5E A;  1Z6T A;  4B89 A;  1N9A A;  3MYV A;  4WAF A;  3PZ3 A;  5AEN A;  3LXU X;  5TEG A;  1KPS B;  3EIJ A;  5LCW J;  3MKQ B;  2I6H A;  4KT6 B;  4KZ0 A;  4EHM A;  1YMP A;  2LSU A;  4OVU A;  3AS4 A;  3TG5 A;  2CFU A;  3OS5 A;  2RFI A;  3W9G A;  1S0P A;  3ZN3 A;  4YNP A;  2XHE A;  4YNM A;  4M3O A;  4A63 B;  3DB5 A;  2X6I A;  1Q2Z A;  5CEA A;  4FJY A;  3DSW A;  2AXV A;  4APF A;  2WMO A;  3RRM B;  4BEP A;  2ETC A;  2QPW A;  2EIM E;  5AQB A;  2Y1L E;  3U3W A;  2R17 C;  5JHA A;  2Y4T A;  3ZFW A;  1TEZ A;  4HOQ A;  1JWG A;  4C1Q A;  3DSU A;  4EBA A;  4FUL A;  3SFY A;  2R03 A;  3G2S A;  2XEV A;  3T8M A;  4IRU A;  3ABK E;  2MOW A;  2IGQ A;  3FUN A;  2P2C P;  1E90 A;  5EIL A;  2WB2 A;  4YPE A;  1TNO A;  3MO5 A;  2AXU A;  3CKC A;  4GCO A;  3CVX A;  1JCQ A;  1HG5 A;  3CBM A;  5EYP F;  4TV3 A;  2KZT A;  4DUI A;  2WM9 A;  3KMA A;  3PNL B;  1JWF A;  3PZ4 A;  3D9H A;  2L6B A;  3F9X A;  3CQC B;  3RO2 A;  4RZ0 A;  4PS7 A;  4JB8 P;  1Z3X A;  1P5Q A;  4GTQ A;  4JHK A;  2XS1 A;  5ENO D;  2I1J A;  1G3N B;  1TYQ G;  2P9L G;  2J9Q A;  3Q49 B;  3RAU A;  4U0S A;  3ASG A;  4PS3 A;  3SZ7 A;  3I3N A;  3UQ3 A;  4A3V A;  3OOI A;  3Q78 A;  3FFL A;  3ONK A;  4G8L A;  2VSX E;  4JZY A;  4Z68 A;  4GZ5 A;  5JIN A;  4TRQ A;  3ZYL A;  1OT8 A;  1NFI E;  3BG0 B;  3L08 A;  3UM1 A;  4OAV B;  3AS8 A;  4L9P A;  3HNA A;  4PS8 A;  3MCX A;  5CBN A;  3B7T A;  3SO8 A;  3U9W A;  1MX2 A;  4DX1 A;  2RG8 A;  1EYH A;  4GCN A;  3TGO A;  3CHP A;  3JYS A;  2V4L A;  4U63 A;  4PDX A;  2HYZ A;  3CK7 A;  1OWL A;  4YPA A;  1TR4 A;  2H6G A;  2P9S G;  1WDY A;  2OCC E;  1TNB A;  4DX7 D;  2EQX A;  2IFU A;  5D2M C;  5G04 J;  2PNN A;  3M57 A;  5FT9 A;  1MJ0 A;  4RG9 A;  1OWM A;  4Q94 A;  3FP3 A;  5T4Y A;  4GA1 A;  3V2X A;  5AIJ A;  5ENT D;  4J8F A;  5HQ8 A;  3V31 A;  2L0T B;  4AV7 A;  3AG3 E;  3CBP A;  1V54 E;  2C0L A;  4GB9 A;  3D9K A;  4CDM A;  4N3B A;  3ZEF A;  3FTV A;  4BY6 A;  4KMO A;  3CQG B;  1S63 A;  1TN6 A;  5KJN A;  4NAC A;  2WXM A;  2WXF A;  3L22 A;  3OXL A;  5FZS A;  4BT9 A;  2IU1 A;  2KAT A;  4DLO A;  3OXF A;  4HOS A;  3SFX A;  4QEP A;  3ZIM A;  3U66 A;  2F69 A;  1WM5 A;  2NSZ A;  4WWO A;  3TWT A;  3E33 A;  4N5C A;  3I5P A;  3Q75 A;  3SGH A;  2XRY A;  4E85 A;  4MBG A;  1GW6 A;  1FVF A;  2RD0 A;  4HNA D;  4QEN A;  4C0M A;  3CHO A;  3JCK C;  3TWV A;  2HM8 A;  5JJT A;  4TXQ A;  1OCR E;  2KBX A;  2WXR A;  3JXJ A;  1MT6 A;  3D9P A;  4GTO A;  3CK9 A;  3DXM G;  3HRA A;  3TWQ A;  1MUF A;  2DZO A;  3HIZ A;  3ASF A;  3DPD A;  5JJ6 A;  4AP2 A;  4DX6 D;  3LCA A;  4LCT A;  3KD7 A;  3OXG A;  3RSE G;  3DPY A;  4BFR A;  5EN5 D;  3FUE A;  4DI3 A;  2RKK A;  3F6Q A;  1NZN A;  4GYW A;  4XEI G;  3D9J A;  1FVH A;  3MZL B;  4LNU D;  3FUH A;  2CG2 A;  3GZ1 A;  4KVM A;  1KZO A;  3R7R A;  1PY1 A;  1HH8 A;  5AJL A;  4BT8 A;  3DSV A;  3FTX A;  3ZXS A;  3GW4 A;  4JD2 G;  3PZD A;  5EX0 A;  3QWW A;  3MA5 A;  1IYG A;  2A5E A;  1D8D A;  2J4D A;  5AN8 A;  3VTY A;  3FPD A;  4DK5 A;  5KNG A;  3Q5M A;  4EZL A;  2OEV A;  2EIL E;  5AQA A;  5BW8 C;  2WVI A;  4WNG A;  4U04 A;  2XEN A;  3VLE A;  2QYU A;  2IQC A;  1IQU A;  3RO3 A;  3UMV A;  4HOT A;  3N71 A;  3FUD A;  3PE3 A;  3HXF A;  2IO3 C;  2IF4 A;  5A23 A;  2BKK B;  3HYM B;  1SW6 A;  5D66 A;  5BV0 A;  3FWV A;  4KBQ A;  3S7B A;  3OPE A;  1D8E A;  5JHB A;  2DIW A;  1N52 A;  5LSX A;  4KXK B;  2VQ2 A;  3X2Q E;  4ANU A;  3IHX A;  1MYO A;  1OWN A;  4DJA A;  2CG3 A;  4BSZ B;  5CMY A;  3FU0 A;  2IY0 C;  4HRL A;  3CK8 A;  4O1P A;  3HVE B;  5B1B E;  3Q15 A;  3AU5 A;  2DBA A;  2O8J A;  3NOC D;  1N95 A;  3G2W A;  3DSS A;  3G2V A;  3O48 A;  4IUL A;  4ILI A;  5EID A;  4HB5 A;  2LAH A;  3G2U A;  4FHJ A;  4U8Y D;  4JEH A;  3K5K A;  1KT0 A;  2V5Q C;  3ZNG A;  1VDY A;  4J7I A;  3NBN B;  3C72 A;  3T5X A;  3TWX A;  4IYP A;  2WXO A;  3F9Y A;  3R7Q A;  1OWO A;  1HU3 A;  3SD5 A;  4WNF A;  3CHR A;  1E8W A;  4P29 A;  3LY9 A;  3BEE A;  2OVB A;  4YDW A;  3SWC A;  4CRW A;  3CVN A;  4GPK A;  1H3I A;  4GZD A;  4QEO A;  3FU6 A;  4I9E A;  4JEU A;  4EQF A;  5EG2 A;  2KCL A;  3E37 A;  3FUI A;  4GZC A;  4I9C A;  4U96 D;  3MGB A;  4XI0 A;  2Y0B G;  3AJI A;  1NL4 A;  4BES A;  3LJ3 A;  2XGO A;  3LVR E;  1BD8 A;  4I6J A;  3CVP A;  2WPV A;  3B7U X;  3LY8 A;  5CMW A;  2Q7F A;  3RU0 A;  3FTS A;  4A3T A;  3ZU7 B;  4Y6W A;  3M54 A;  1N6A A;  4F53 A;  4R7L A;  3M56 A;  2I9C A;  5ANR A;  2CFZ A;  1UN9 A;  4H7Y A;  3KS2 A;  3ZKJ A;  3AG4 E;  3RIB A;  4GZ3 A;  2XCC A;  2B6C A;  5LP0 A;  3HXD A;  4GZ6 A;  3ZW3 A;  3ZHE B;  4GML A;  3K9I A;  1Y8M A;  1HS6 A;  5AAR A;  4C48 B;  3UM2 A;  1AP7 A;  1PAQ A;  2AWI A;  3CLJ A;  3ULE G;  3CBO A;  5AYF A;  4D10 C;  3JQ0 A;  4AXH A;  2YIN A;  2H6I A;  1ELR A;  3GYZ A;  1ML9 A;  4H7X A;  4UQY A;  3KSQ A;  3L54 A;  3ESL A;  2ION A;  2JLB A;  3CHS A;  3FEY A;  3UTM A;  3M55 A;  4J8D A;  1ZKK A;  4O30 A;  4HS2 A;  5D0O D;  3AS5 A;  3I4G A;  4I43 A;  2WXI A;  3LPZ A;  1E7U A;  4JA9 A;  4EZK A;  3CGH A;  2R02 A;  2CHW A;  2I1K A;  2NYJ A;  2L6J A;  5BT1 A;  3V2O A;  2WMN A;  5B1A E;  3CKB A;  3IXE A;  5ARF A;  2XPZ A;  2RFA A;  1YCS B;  1HZ4 A;  1H0A A;  2ZGG A;  2JV0 A;  1JCS A;  3B7B A;  4ATZ D;  5T0K A;  3FUM A;  5BPP A;  2BUG A;  3DBS A;  4GTV A;  2YQ8 A;  3NF1 A;  3EJN A;  1TN7 A;  4EEC A;  4CEM A;  3TJP A;  4XZ4 A;  3UT8 A;  2PM7 A;  3SY2 A;  1FT2 A;  3FTY A;  1IHB A;  3SHF A;  1HXI A;  3LVQ E;  3D9O A;  5LFA A;  1D9S A;  4CDR A;  2QY7 A;  3GZ2 A;  4J6I A;  2DWZ A;  4L2L A;  4K5B A;  2OVF A;  4LDG A;  4I1O B;  3TWU A;  1OWP A;  3AAA C;  4FU3 A;  3S7F A;  3ASO E;  1NI1 A;  4BET A;  4F6R D;  4WWN A;  4G11 A;  1HX8 A;  3B7R L;  1SA5 A;  2LO6 A;  4OYS A;  3MV2 B;  4HXI A;  4ME2 A;  2X6F A;  3CEQ A;  2UY1 A;  5B3S E;  4APO A;  4J0U A;  2OV8 A;  2OOE A;  3KSL A;  5T8I A;  1N4P A;  1RW2 A;  5G55 A;  1ELW A;  4YVQ C;  3C3Q A;  2XS8 A;  3MO0 A;  2WXQ A;  5G05 J;  2GRQ B;  4ATG A;  1KZP A;  2VJ8 A;  3Q7A A;  3GZS A;  3R9A B;  1A17 A;  1XQH A;  3D3M A;  5HKP A;  3ML8 A;  4TUU A;  2H6H A;  3S7J A;  4JDS A;  3Q79 A;  1BI7 B;  2LAI A;  1UJK A;  4DLQ A;  2F8Y A;  2P58 C;  4GA2 A;  3HHM A;  2R59 A;  3APF A;  1TNU A;  4L23 A;  3MEK A;  4BX9 A;  2VGE A;  1PEG A;  5G04 C;  4BSX A;  4O1O A;  3M53 A;  3PZ2 A;  3UI2 A;  4K0R A;  3V79 K;  2WXL A;  1UN8 A;  5C2Y A;  4GTR A;  3Q9U C;  4Q96 A;  2UWJ G;  5E75 A;  1K1B A;  3SW9 A;  1UOH A;  3UT4 A;  4J7F A;  1BLX B;  3MO2 A;  2FEZ A;  4UQZ A;  2Y69 E;  3FTU A;  3RJW A;  1H2V C;  5HI7 A;  1A5E A;  4PH4 B;  3CVU A;  2PL2 A;  3T9K A;  3IHY A;  1V55 E;  3UPV A;  4ANW A;  1OY3 D;  2DVW A;  4GYY A;  3QC1 A;  4JXT A;  1O1S A;  4L1B A;  5ITZ F;  5G2N A;  1UJJ A;  2MYO A;  2P9K G;  3NZU A;  4A1G A;  5DBK A;  4G2V A;  4HBD A;  4G8K A;  4G24 A;  5FZQ A;  3HG0 D;  5LOZ A;  5T3R A;  1AWC B;  4J8Y A;  5AYW D;  2IOL A;  1O5M A;  4UWH A;  5BNW A;  3LS8 A;  4K5C A;  4L7T A;  1INZ A;  2NC9 A;  4EZJ A;  5F6L A;  3WXX A;  3V30 A;  4I6G A;  1YA0 A;  4TXP A;  2XGM A;  5LCW C;  5LSZ A;  3D9I A;  4K03 A;  1O1T A;  3ASH A;  3G2T A;  3PRZ A;  3HDX A;  2X6H A;  2YNQ A;  3Q7F A;  2Y3A A;  5TH7 A;  3JUI A;  4U07 A;  3FU3 A;  1H6O A;  4J8E A;  4FP7 A;  2R2L A;  3UIP C;  5BXO A;  1DNP A;  1NA3 A;  2XZD G;  4FLB A;  3EIQ C;  4ZHB A;  1H6K A;  4CGW A;  3E30 A;  4A1S A;  4BTB A;  5J90 A;  2HE0 A;  3AU4 A;  4UWF A;  4B0Z A;  2PQR A;  1HE8 A;  2ZIR A;  3FUL A;  1N94 A;  3BU8 A;  2FO1 E;  4H12 A;  4MKT A;  4HI8 A;  5KNH D;  4E47 A;  2PM6 A;  5JJ7 A;  1FT1 A;  2KCV A;  3OAW A;  3FTZ A;  2OND A;  4K5A B;  4YVO A;  4RLY A;  3IEG A;  4HOR A;  3SF4 A;  5HRY A;  2OEW A;  2MHK A;  2P9N G;  4HI9 A;  3J5P A;  4LUN U;  3E34 A;  3RKV A;  3NOG D;  3KMJ A;  3QNK A;  3ZYQ A;  3IBE A;  4UWK A;  3ENE A;  4BUP A;  3RJV A;  5T5G A;  4GPM A;  3PH0 C;  3BG1 B;  3TL5 A;  4HRN A;  3DEO A;  4J8S A;  1DC2 A;  2AXZ A;  3FHE A;  1E96 B;  5ANL A;  2LNI A;  1K8K G;  3O4Z A;  2WXH A;  5ENP D;  1EPU A;  4I1A A;  4AOF A;  5JMN D;  2AJA A;  5A7D B;  3CIA A;  4GTS A;  3JUE A;  3FUF A;  4U8V D;  2XRZ A;  5AJD A;  3RRN B;  4RQI A;  2EIK E;  1Z5S C;  5KCM A;  4QQI A;  2WXG A;  5FQ7 A;  3M5A A;  4NJ5 A;  1U3C A;  1E8Y A;  3MX3 A;  2XEE A;  5CHE E;  2LXL A;  2C0M A;  1PC2 A;  2V5F A;  3VTX A;  5AAO A;  3IV0 A;  3QOU A;  3AG2 E;  4HFG A;  3PDN A;  4FLH A;  2Y4U A;  4NIK A;  3RAY A;  1SQM A;  3DXK G;  2KM4 A;  1XNF A;  2YHE A;  3LY7 A;  4YDE A;  1TNZ A;  4GTP A;  4O60 A;  4JW1 A;  4YDO A;  3ASD A;  3C3R A;  5F6K C;  3F9W A;  4JA7 A;  3UKR G;  3DRA A;  3HVE A;  3QK0 A;  3PEU B;  4W9R A;  3HXB A;  5EIB E;  1X81 A;  1OCO E;  3ML9 A; 
#chains in the Genus database with same CATH homology
 2C2L A;  1ZKK A;  4HS2 A;  4O30 A;  5D0O D;  4PUC A;  3MCX A;  2BF0 X;  3AS5 A;  3B7T A;  2XQ0 A;  3CVL A;  3I4G A;  4I43 A;  1W3B A;  3P2B A;  2WXI A;  4JC8 A;  3LPZ A;  3U9W A;  1U3D A;  2ZU6 B;  1E7U A;  1L5J A;  4JA9 A;  4AIF A;  3EHN A;  4NUR A;  4EZK A;  3CGH A;  2L9B A;  2RG8 A;  4WUY A;  1EYH A;  4G23 A;  4GCN A;  4F7A A;  2CHW A;  2I1K A;  2WXP A;  3CHP A;  4KZC A;  5BV1 A;  3ONL A;  4I6E A;  3JYS A;  2L6J A;  2V4L A;  5BT1 A;  3RRU A;  1X5B A;  3EDT B;  1FCH A;  2WMN A;  2L0I A;  3PUJ A;  4BWR A;  4U63 A;  4PDX A;  3SNX A;  3CKB A;  2HYZ A;  5KJM A;  3CK7 A;  1OWL A;  2A4Z A;  4U0Z A;  2WXK A;  1TJF A;  4YPA A;  1TJC A;  3FTW A;  5ARF A;  4AU7 A;  4KYO B;  2XPZ A;  1HZ4 A;  2HO1 A;  4Y6C A;  1H0A A;  4UWL A;  2JV0 A;  1QZ2 A;  1H19 A;  1WY6 A;  3Q4A B;  2NXP A;  3CV0 A;  1KT1 A;  1SZ9 A;  4GYO A;  2A5U A;  5T0K A;  4GA0 A;  3FUM A;  5BPP A;  2EQX A;  4ACL A;  2IFU A;  2BTD A;  5G04 J;  3TGO A;  2VTB B;  4DI4 A;  3S8P A;  2J08 A;  3P1U A;  3CVQ A;  3LKU A;  2BUG A;  5FT9 A;  3M57 A;  3APD A;  3E4B A;  3DBS A;  4RG9 A;  2VYI A;  3CVY A;  4N3A A;  3ZHE A;  2WQ7 A;  1OWM A;  2YQ8 A;  4Q94 A;  3FP3 A;  5DIZ A;  3NF1 A;  4O6F A;  5T4Y A;  3EJN A;  4GA1 A;  5AIJ A;  4RG6 A;  3QB2 A;  1SZA A;  4J8F A;  4CEM A;  3TJP A;  4EEC A;  4XZ4 A;  5HQ8 A;  3KMT A;  4JVS A;  3MKQ A;  3FU5 A;  3UT8 A;  3L13 A;  2L0T B;  2PM7 A;  4AV7 A;  4CDN A;  4FA6 A;  3CBP A;  3QJZ A;  3FTY A;  4MLP A;  4NQ0 A;  3SHF A;  2AVP A;  4XX5 A;  2C0L A;  3CVV A;  4GB9 A;  3D9K A;  1HXI A;  3CHQ A;  4MI0 A;  3LVQ E;  3D9O A;  4CDM A;  4WND A;  5LFA A;  4N3B A;  1ELK A;  2VSN A;  3FUK A;  4CDR A;  3ZEF A;  1BPO A;  3SBS A;  2QY7 A;  3FTV A;  4BY6 A;  3GZ2 A;  4KMO A;  2FBN A;  4J6I A;  1Y6I A;  3CQG B;  2XPI A;  5KJN A;  4NAC A;  2WXM A;  2WXF A;  3L22 A;  4L2L A;  2OVF A;  5T0M A;  4RVB A;  4LDG A;  3OXL A;  1MQS A;  4A55 A;  4I1O B;  5FZS A;  4BT9 A;  2IU1 A;  1OWP A;  2KAT A;  4DLO A;  5JJ0 A;  3OXF A;  4FU3 A;  3S7F A;  4HOS A;  2IOS A;  4XE0 A;  4XKC A;  2G46 A;  4G1T A;  4QEP A;  1N54 A;  2XPY A;  3ZIM A;  3U66 A;  2F69 A;  4IJ8 A;  3DAL A;  1WM5 A;  3MJW A;  5G05 C;  3PNT B;  2NSZ A;  2JEK A;  3KAE A;  4WWN A;  4G11 A;  1HX8 A;  3B7R L;  4WWO A;  4N39 A;  4N5C A;  2LO6 A;  3I5P A;  1HO8 A;  2X38 A;  4OYS A;  2VTB A;  2CHX A;  3MV2 B;  4HXI A;  4BX8 A;  5J08 A;  4ME2 A;  4G26 A;  3CEQ A;  2X6F A;  3SGH A;  2XRY A;  4E85 A;  2UY1 A;  1GW6 A;  5LX8 A;  2DCP A;  1FVF A;  3D9L A;  3ZVV A;  4IJD A;  2RD0 A;  4J0U A;  5FZR A;  4APO A;  4AVX A;  4QEN A;  4C0M A;  3FY4 A;  2OV8 A;  1HG2 A;  2KC7 A;  2UY1 B;  3CHO A;  2OOE A;  2HM8 A;  3JCK C;  5C1D A;  3IHV A;  5JJT A;  5KJK A;  4I2W A;  5T8I A;  5FQ8 A;  4UI9 J;  2VGX A;  2FO7 A;  2R3A A;  2FF4 A;  2WXR A;  3SBT B;  5G55 A;  2MRI A;  1ELW A;  3U4T A;  1MT6 A;  4YVQ C;  3D9P A;  3M58 A;  3CK9 A;  3MO0 A;  2WXQ A;  5G05 J;  2GW1 A;  4ATG A;  1MUF A;  4F3V A;  2VJ8 A;  3HIZ A;  3ASF A;  3DPD A;  4I1M A;  3PS6 A;  5JJ6 A;  3S2A A;  3GZS A;  2WXJ A;  3VUZ A;  3R9A B;  1A17 A;  4AP2 A;  1XQH A;  3D3M A;  4XIF A;  3LCA A;  2E0I A;  4LCT A;  3KD7 A;  2CHZ A;  3ML8 A;  4TUU A;  3S7J A;  1H2T C;  4JDS A;  3OXG A;  2WXN A;  5A6C A;  5ARG A;  4BFR A;  2LAI A;  1UJK A;  4CT0 A;  3FUE A;  4DLQ A;  4DI3 A;  2P58 C;  4AY6 A;  4GA2 A;  3HHM A;  2R59 A;  1N6C A;  5KJL A;  2J4B A;  1NZN A;  3APF A;  4GYW A;  3I4R B;  4JHR A;  4L23 A;  4BX9 A;  3MEK A;  4I2Z A;  3D9J A;  1FVH A;  3FEX A;  4BTA A;  3MZL B;  3CVW A;  3SI5 A;  1PEG A;  1HF8 A;  3FUH A;  4YND A;  2CG2 A;  4UI9 C;  5FQ6 A;  3GZ1 A;  4KVM A;  5G04 C;  4BSX A;  3FDH A;  5CPR B;  4ILH B;  3CSF A;  3R7R A;  1PY1 A;  5EDS A;  3M53 A;  1HH8 A;  3FH8 A;  2XCB A;  5AJL A;  4K0R A;  4BT8 A;  3QWP A;  3FTX A;  2WQH A;  1UN8 A;  2WXL A;  5C2Y A;  3SFZ A;  3ZXS A;  3GW4 A;  3LEW A;  3PZD A;  4Q96 A;  3VV0 A;  2UWJ G;  1UW4 B;  2E2E A;  3B13 A;  3FH5 A;  2PQN A;  5EX0 A;  3UX4 A;  4NVQ A;  3UUX A;  4J83 A;  3CHM A;  3MA5 A;  3QWW A;  5E75 A;  3TG4 A;  1IYG A;  4MI5 A;  2PZI A;  2J4D A;  1H2U A;  3SW9 A;  2KCK A;  2R5S A;  2GGF A;  3QAQ A;  3TXN A;  3VTY A;  5CCM A;  3FPD A;  1XGW A;  4DK5 A;  3UT4 A;  4RSY A;  3APC A;  4J7F A;  4ABN A;  3PE4 A;  1EDU A;  2IJG X;  3MO2 A;  2FEZ A;  4UQZ A;  3ZYM A;  3ESK A;  4C0E A;  3QDN A;  3FTU A;  2GRM A;  3RJW A;  1QNF A;  3Q5M A;  2I2O A;  4EZL A;  5BW8 C;  5ENN A;  1H2V C;  3BO5 A;  4JLG A;  2WVI A;  3LDZ A;  4JHJ A;  5HI7 A;  4MS6 A;  1NP7 A;  4PH4 B;  2M63 A;  1MVH A;  4WNG A;  4U04 A;  1ZBP A;  4EPZ A;  5F59 A;  4HOU A;  3CVU A;  2PL2 A;  3VLE A;  2KZT B;  3IHY A;  2IQC A;  1IQU A;  3UPV A;  3RO3 A;  3UMV A;  4N3C A;  4I51 A;  4ANW A;  4HOT A;  1WAO 1;  3N71 A;  3FUD A;  3PE3 A;  4C9B B;  4GYY A;  3QC1 A;  4JXT A;  4L1B A;  4U8H A;  3ZGQ A;  5E76 A;  1UJJ A;  5G2N A;  2X3M A;  2IF4 A;  4XKB A;  3C98 A;  5A23 A;  4QFV A;  3HYM B;  3L17 A;  3LYA A;  5FWQ A;  2J07 A;  5BV0 A;  3NZU A;  3PEV B;  3FWV A;  4WNE A;  5DBK A;  2HR2 A;  4G2V A;  4KBQ A;  2J49 A;  3S7B A;  4A1G A;  3OPE A;  4G24 A;  5FZQ A;  2VGY A;  4N2S A;  2VGX B;  5JHB A;  2DIW A;  1JUQ A;  1N52 A;  4HLE A;  5LSX A;  3FH7 A;  5LOZ A;  4KXK B;  5T3R A;  2VQ2 A;  1MHQ A;  3D9M A;  4AJW A;  4ANU A;  2FI7 A;  2VSY A;  5AYW D;  3IHX A;  2IOL A;  4FAD A;  5FTP A;  4UWH A;  4Q69 A;  1OWN A;  1IQR A;  1E8Z A;  3LS8 A;  3NZS A;  5BNW A;  2WQ6 A;  2J09 A;  3QWV A;  4L7T A;  3PVL A;  4DJA A;  2CG3 A;  1INZ A;  2NC9 A;  5CMY A;  1IHG A;  3JQ1 A;  4UI9 K;  4EZJ A;  2V0P A;  3FU0 A;  2FUL A;  5F6L A;  5CCL A;  4YPU A;  4GU5 A;  2QFC A;  3WXX A;  1KLX A;  4JL0 A;  4I6G A;  5JIY A;  1YA0 A;  1QQE A;  2GRL A;  4U0U A;  1JPL A;  1E8X A;  2VSO E;  3CK8 A;  4FMU A;  2XGM A;  5LCW C;  5LSZ A;  1B89 A;  3HVE B;  4DPR A;  3D9I A;  3RQ4 A;  4K03 A;  3S7D A;  3U64 A;  4EBA G;  5BUZ A;  3UT7 A;  1OUV A;  4B8A A;  3ASH A;  4J8O A;  4GMJ A;  3IKO B;  3G2T A;  3Q15 A;  3AU5 A;  2DBA A;  3PRZ A;  2O8J A;  3HDX A;  4B94 A;  4Z4P A;  4ILG A;  4WWP A;  2W5Z A;  4V3I A;  3T5V A;  2X6H A;  4URK A;  2YNQ A;  3G2W A;  5F5E A;  1Z6T A;  2AW6 A;  3G2V A;  4CGV A;  4L2Y A;  2X6J A;  3O48 A;  4IUL A;  4ILI A;  2LAH A;  2Y3A A;  3G2U A;  4B89 A;  4FHJ A;  3JUI A;  3MYV A;  3QKY A;  4U07 A;  5TH7 A;  3FU3 A;  5FJY A;  4E6H A;  4OVV A;  4WAF A;  4J8E A;  5AEN A;  4FP7 A;  4JEH A;  3LXU X;  3URZ A;  5TEG A;  1ZU2 A;  3K5K A;  1DVP A;  1KT0 A;  1DNP A;  3EIJ A;  5LCW J;  3MKQ B;  2I6H A;  1NA3 A;  1VDY A;  1MVX A;  5TTF A;  4KT6 B;  4J7I A;  4KZ0 A;  2LSU A;  4OVU A;  3T5X A;  3AS4 A;  3VLD A;  4FLB A;  4IYP A;  3EIQ C;  1LF8 A;  2WXO A;  3TG5 A;  2CFU A;  1H6K A;  4CGW A;  3F9Y A;  4A1S A;  3R7Q A;  4BTB A;  5J90 A;  3OS5 A;  1OWO A;  1HU3 A;  3SD5 A;  4F1S A;  2RFI A;  2LSV A;  4WNF A;  1S0P A;  1NA0 A;  3CHR A;  4XI9 A;  3AU4 A;  3ZN3 A;  1E8W A;  3OTN A;  4YNP A;  4P29 A;  2XHE A;  4UWF A;  4B0Z A;  2PQR A;  2X6K A;  1HE8 A;  3LY9 A;  3BEE A;  4YNM A;  3FUL A;  4M3O A;  2OVB A;  3ZYK A;  4KVO A;  4H12 A;  3SWC A;  4GAA A;  4ACK A;  4CRW A;  3CVN A;  4MKT A;  3DB5 A;  4E47 A;  2X6I A;  4GPK A;  4FJY A;  1H3I A;  4GZD A;  2ILR A;  2PM6 A;  5JJ7 A;  2AXV A;  4APF A;  2KCV A;  1Z3Y A;  2WMO A;  3FU6 A;  3OAW A;  3FTZ A;  3Q47 B;  4I9E A;  3RRM B;  3TAX A;  2W5Y A;  2OND A;  3KEZ A;  4YVO A;  4JEU A;  3IEG A;  4HOR A;  3SF4 A;  2QPW A;  4JPS A;  2MHK A;  3U3W A;  2R17 C;  4LUN U;  4G25 A;  1EF1 C;  4EQF A;  5EG2 A;  3RKV A;  4MRU A;  5JHA A;  2KCL A;  3KMJ A;  2Y4T A;  3QNK A;  3ZFW A;  1TEZ A;  4HOQ A;  1JWG A;  3ZYQ A;  4C1Q A;  3IBE A;  3L6A A;  4UWK A;  3ENE A;  4EBA A;  3RJV A;  4BUP A;  1E7V A;  4FUL A;  5T5G A;  4B8C B;  5D0Q D;  3G2S A;  2XEV A;  3FUI A;  4GZC A;  3PH0 C;  4IRU A;  5EKQ D;  3T8M A;  3M59 A;  3ZRH A;  3CR3 A;  3BG1 B;  4I9C A;  2MOW A;  3TL5 A;  2IGQ A;  3FUN A;  3MGB A;  4J8S A;  4LER A;  4XI0 A;  3HNA A;  1HFA A;  1E90 A;  2AXZ A;  3FHE A;  1E96 B;  3B7S A;  5ANL A;  5FQ4 A;  2LNI A;  3LJ3 A;  2WB2 A;  4YPE A;  4CT4 A;  3MO5 A;  2AXU A;  2XGO A;  3CKC A;  3EHM A;  3LVR E;  4GCO A;  3O4Z A;  3RK6 A;  2WXH A;  3CVX A;  4AY5 A;  1HG5 A;  1EPU A;  3CBM A;  4I1A A;  4N2Q A;  3CST A;  4I6J A;  4LRZ A;  4AOF A;  4ANV A;  3CVP A;  5JHN A;  4TV3 A;  2WPV A;  3CIA A;  3B7U X;  5A7D B;  3TXM A;  2KZT A;  3LY8 A;  5CMW A;  4ANX A;  2WM9 A;  3KMA A;  3FUF A;  2Q7F A;  3RU0 A;  3PNL B;  3FTS A;  4A3T A;  1JWF A;  2XRZ A;  3VLF A;  5AJD A;  4FHK A;  4Y6W A;  4FC8 A;  3F9X A;  3RRN B;  3M54 A;  3CQC B;  3PUK A;  3RO2 A;  4RZ0 A;  4PS7 A;  4I17 A;  3FUJ A;  5KCM A;  1N6A A;  4F53 A;  2WXG A;  1Z3X A;  4R7L A;  4AM9 A;  3M56 A;  2I9C A;  5ANR A;  1P5Q A;  2CFZ A;  5FQ7 A;  1UN9 A;  3EP0 A;  3M5A A;  3PRE A;  1O9S A;  4NJ5 A;  1U3C A;  4H7Y A;  2XGS A;  4NRH B;  2BQZ A;  1E8Y A;  3MX3 A;  4JHK A;  3KS2 A;  4IN3 B;  5CHE E;  2I1J A;  1N3J A;  1UG3 A;  2C0M A;  4GZ3 A;  1PC2 A;  2J9Q A;  3RIB A;  3Q49 B;  2V5F A;  4U0S A;  2XCC A;  4FJZ A;  3VTX A;  3ASG A;  5LP0 A;  4GZ6 A;  3ZW3 A;  3IV0 A;  3ZHE B;  4HVB A;  3QOU A;  4GML A;  3K9I A;  4PS3 A;  1Y8M A;  4HFG A;  3PDN A;  1HS6 A;  3SZ7 A;  3I3N A;  2Y4U A;  4FLH A;  4LEU A;  3UQ3 A;  4A3V A;  3RAY A;  1SQM A;  3ZPJ A;  3OOI A;  3MKR A;  3FFL A;  3ONK A;  3QAR A;  2KM4 A;  1XNF A;  2V8S E;  2YHE A;  3LY7 A;  4QEO A;  2VSX E;  1PAQ A;  3NQP A;  2AWI A;  4JZY A;  4CCA A;  5EX3 A;  3F9Z A;  4JW1 A;  3CLJ A;  5JIN A;  4GZ5 A;  5M72 A;  4TRQ A;  3CBO A;  5AYF A;  4D10 C;  3JQ0 A;  4AXH A;  4UQX A;  3ASD A;  5F6K C;  2YIN A;  2YHC A;  3MV3 B;  3F9W A;  4JA7 A;  3ULQ A;  3HVE A;  1ELR A;  3GYZ A;  3QK0 A;  1ML9 A;  4H7X A;  3ZYL A;  3PEU B;  4W9R A;  3D9N A;  4UQY A;  3L16 A;  3L54 A;  4AEZ C;  4UWG A;  3BG0 B;  3ESL A;  2ION A;  2JLB A;  3L08 A;  3CHS A;  3FEY A;  3AS8 A;  3M55 A;  4J8D A;  3ML9 A;  4PS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...