3S7DA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 150
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7dA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7dA01
1IHGA 4HOTA 5LCWC 3FPDA 4E47A 2VGXB 3KS2A 1HZ4A 1ZBPA 4XIFA 3M5AA 2PQRA 4NQ0A 5F5EA 3E4BA 5TTFA 2KC7A 4U0SA 5CCLA 1QZ2A 3MO5A 5CPRB 5EG2A 3DB5A 1MVXA 3CEQA 3RO2A 3KMJA 2YQ8A 2PZIA 5FJYA 4RZ0A 4J7IA 3LY9A 4LDGA 3ASHA 3Q47B 4G25A 3CBPA 2LSVA 1O9SA 3MO0A 2IF4A 1HH8A 5G05J 5KJMA 4HOQA 4ME2A 2XGSA 2VSNA 1YA0A 4QEPA 4U0UA 3ULQA 2KCKA 4GZ3A 5FZQA 4GA1A 3ESKA 4JA7A 5T0MA 3MA5A 3ZPJA 2RFIA 2FF4A 2V5FA 3RO3A 4UI9J 4A1SA 2UWJG 4I9EA 2C0MA 2XCCA 3EDTB 5T0KA 3ZN3A 4AY6A 3CV0A 3VV0A 4I2ZA 4RG6A 3AS4A 4U0ZA 3F9XA 2XGOA 3M59A 3U4TA 5G04C 3LCAA 4CGVA 2Q7FA 1HXIA 4BTAA 5EX0A 1N3JA 4KYOB 2XEVA 5FTPA 1OUVA 3OPEA 3AS8A 5JINA 4UQZA 4QENA 2FBNA 3RAYA 2I6HA 4GA0A 3F9YA 3TG4A 4C1QA 5TEGA 3ZFWA 4XI9A 4UQXA 5A7DB 4Z4PA 3TGOA 3SWCA 1Y8MA 1MUFA 2JLBA 1ELWA 4LEUA 4U07A 4JA9A 5G04J 5HQ8A 4G23A 2QFCA 4N2QA 3CBOA 4AY5A 4HOUA 3UQ3A 1WAO1 3MV2B 4GYYA 5G05C 4GYOA 5JIYA 1B89A 3KAEA 5M72A 3Q4AB 4N3AA 5AYFA 2P58C 2WPVA 3FP3A 3K5KA 5CCMA 5CHEE 5F6LA 3ASGA 4YNPA 2VSYA 3FWVA 4UI9C 3NF1A 2Y4UA 5JJ0A 3BEEA 3S8PA 3CK9A 1KT0A 2XPIA 2HYZA 4APOA 3CKCA 4N3CA 1NA0A 2E2EA 3BO5A 3OS5A 3MO2A 3F9WA 4N5CA 3IHXA 3KD7A 2IGQA 4G1TA 3U3WA 3M55A 1W3BA 1XNFA 5JJTA 3Q15A 4BT9A 2C2LA 4FMUA 4MI5A 2FO7A 3OXGA 4YPUA 3S7JA 3IEGA 1E96B 4BUPA 4I17A 4H12A 3RU0A 4CDRA 4EQFA 3CVQA 3S7FA 2PL2A 3RKVA 5D0QD 3CVPA 5JJ7A 3S7BA 3M56A 3HYMB 4YVOA 4AM9A 4GZ6A 4IN3B 1IYGA 3CVNA 4JHRA 4GCNA 5FT9A 4JDSA 2G46A 1NZNA 1MVHA 4GPKA 5TH7A 1KT1A 3MKRA 2HR2A 1H3IA 5LSZA 2O8JA 3RIBA 5F6KC 3RJWA 2LNIA 3O48A 3HNAA 5BNWA 5D0OD 2R3AA 3CK7A 3RQ4A 4QEOA 4N2SA 2KATA 2NC9A 3ASFA 5JHNA 4KXKB 4ABNA 3LY8A 4RG9A 2BQZA 2JV0A 2IFUA 5KJNA 4U04A 3ZHEA 5ARGA 1N6AA 4I1AA 3LKUA 2UY1A 4NVQA 4I51A 3DALA 3ZHEB 4F3VA 4WNFA 5KJLA 3LY7A 4HOSA 5FZRA 3CK8A 4I2WA 2UY1B 3MV3B 5HI7A 4H7XA 3CVLA 2R5SA 2VGYA 4H7YA 3KMAA 2AVPA 4G26A 3OOIA 1ZU2A 1ZKKA 3Q5MA 2XGMA 4J8EA 5F59A 4BTBA 3QDNA 1FCHA 2BUGA 3QWPA 3UPVA 2WQHA 4J83A 4I9CA 1ELRA 1ML9A 4KBQA 4GZ5A 3Q49B 4JL0A 3QOUA 1XQHA 3SW9A 3LYAA 2C0LA 4O30A 3QWWA 3ZGQA 3AS5A 5DBKA 3VUZA 4YNDA 4XI0A 4J8OA 2MHKA 3SF4A 4AU7A 3M53A 2F69A 3M54A 5BW8C 3S7DA 2YHCA 3M57A 3EP0A 2GW1A 3PDNA 4J8FA 4YPEA 3R9AB 4N39A 4YPAA 3URZA 1MT6A 3CKBA 4Y6WA 4O6FA 5T5GA 1N6CA 4YVQC 3CBMA 3M58A 5LSXA 4AIFA 2VYIA 5LCWJ 2FI7A 1P5QA 3JYSA 3GW4A 2ONDA 1PC2A 4BWRA 2OOEA 3QKYA 3RJVA 4J7FA 1PEGA 4WNDA 2KCLA 3GYZA 3SZ7A 4HORA 3N71A 4W9RA 4UQYA 1QQEA 3PE4A 4WNEA 3OXFA 4G2VA 4GYWA 1A17A 4WUYA 3GZ1A 3FFLA 4Y6CA 4B94A 2W5YA 4NRHB 5A6CA 4MI0A 4BT8A 4WNGA 2L6JA 2HO1A 5EX3A 2KCVA 3TAXA 3ASDA 4N3BA 4CGWA 3KMTA 5JJ6A 4NJ5A 2VQ2A 3VTYA 3PE3A 2W5ZA 2QPWA 3WXXA 1TJCA 4IJ8A 1NA3A 2J9QA 5FZSA 5AYWD 4GA2A 3K9IA 3QWVA 1WM5A 4G24A 4JLGA 4UI9K 2DBAA 3OXLA 3TG5A 2FEZA 5KJKA 4YNMA 3GZ2A 5EKQD 2PQNA 3UUXA 1KLXA 3F9ZA 5C1DA 4GCOA 3LPZA 5DIZA 5ARFA 4IJDA 2LSUA 4J0UA 3VTXA 5BT1A 2Y4TA 2XCBA 2VGXA 4J8DA 3MEKA
chains in the Genus database with same CATH superfamily
1IHGA 1S64A 4J8YA 3EU9A 4AOFA 3FPDA 4E47A 3Q7FA 2EIKE 3KSLA 2J49A 3FHEA 2OVFA 2PQRA 4NQ0A 4RLYA 3CIAA 2KC7A 2RKKA 3OAWA 1MVXA 2LO6A 2P9IG 3FUNA 4XEIG 4I6JA 3AG4E 4I43A 5AQ9A 2LSVA 4GMRA 1FT2A 4DI3A 3DBSA 5KJMA 4AJWA 3P1UA 1YA0A 3ULQA 2BKKB 1E8YA 5FZQA 3ESKA 2I1JA 3ZYLA 5T0MA 4LNGA 1H2TC 3ZPJA 4TXPA 2L0IA 1JCSA 2XPYA 3EDTB 4BX9A 2X6FA 1BU9A 3AS4A 4JD2G 3JQ1A 3D3MA 4U0ZA 3F9XA 2CHZA 3NOGD 1KPSB 4KMOA 3F6QA 4X8QA 1G3NB 4DLQA 3T5XA 3D9JA 1HF8A 3FU0A 4LSZE 1HO8A 1HXIA 3FUJA 4BTAA 2WXFA 2KZTA 5EX0A 2XENA 4R7LA 4EPZA 2XZDG 1TN8A 3PEUB 4UQZA 3LVQE 2FBNA 3RAYA 1YCSB 5ENNA 3ASNE 2OVBA 4GZCA 3SBSA 4C1QA 3T5VA 1Z6TA 3VLFA 2WMOA 4Z4PA 1Y8MA 1MUFA 1TNOA 4F7AA 5HQ8A 4G23A 2QFCA 5BXOA 2L0TB 5LOZA 5JIYA 1B89A 3SNXA 3Q4AB 4N3AA 5ENQD 5EDSA 2GRLA 4ZFHA 3J5QB 1D8DA 2WXLA 4MBGA 4F53A 2AJAA 5LX8A 3K5KA 5JA4D 5F6LA 4YNPA 2F8YA 3E37A 4GTMA 3FWVA 5AQBA 1NI1A 3S8PA 2DCPA 2HYZA 4DX1A 2OCCE 3DSWA 4ACKA 2E2EA 5AARA 3R7RA 4I1MA 4PUCA 1H6PA 3M55A 1XNFA 3KEAA 2GRNB 1N94A 3Q15A 4Z68A 3P2BA 2Y3AA 4FMUA 4XKBA 3OXGA 4YPUA 3IEGA 3PNTB 2A5UA 4I17A 4CDRA 2OV8A 3G2VA 5J08A 3FUEA 1H6OA 5JJ7A 1TNUA 3EHNA 4CT4A 3DXMG 3ZVVA 4AEZC 4U96D 1DC2A 3UT7A 4GPKA 3FH5A 2HR2A 2WXMA 3RIBA 4PS3A 5F6KC 4JZYA 3SQVA 3RJWA 3O48A 4XE0A 5LFAA 3HNAA 2R3AA 3CK7A 3ISMC 3IKOB 2NC9A 4GPMA 2WM9A 4YDWA 1O1TA 3CHRA 2J4DA 2CHWA 3U66A 5T4YA 3HHMA 4A3VA 2L9BA 1OY3D 1E7UA 4I1AA 3EU5A 3TWUA 3AU5A 4HI9A 4NVQA 1Z5SC 1VDYA 3DALA 1EPUA 1AP7A 3TJPA 3CSTA 3MV3B 3APFA 3ZEFA 4H7XA 2R5SA 2VGYA 3HIZA 4B89A 4C48B 4C9BB 3DSTA 4AP2A 4J8EA 1UJKA 4ANXA 3ZUVB 5F59A 4BTBA 4BX8A 3EIJA 3Q79A 1DNPA 2X6IA 3PH0C 4DX6D 4I9CA 2H6HA 1ELRA 4KBQA 4FHJA 2WXNA 4U63A 2BKGA 2I9CA 3QOUA 2C0LA 2CG3A 3SFXA 4D10C 2PNNA 3DWLG 5DBKA 3C5RA 4L23A 3D9LA 3SF4A 4DRXE 4AU7A 2F69A 5BW8C 3S7DA 3M57A 3FUFA 2GW1A 2FO1E 1QBQA 4N39A 3FUKA 3URZA 1K1BA 4O6FA 2LXLA 2WXHA 4O1PA 3M58A 1TJFA 2VYIA 5LCWJ 2FI7A 1H2VC 1FVFA 3CVVA 3QKYA 3HXEA 4LNBA 3VLEA 3RJVA 5HS0A 2A4ZA 4J7FA 1TEZA 1PEGA 4U7EB 3UM0A 1QYMA 3EHMA 5AQAA 4W9RA 3ENEA 1QQEA 2ZU6B 3B7BA 3PE4A 4WNEA 4DX7D 4IYPA 2Y69E 4C0EA 1OWPA 4GMJA 4ZHBA 4RSYA 4CRWA 4NRHB 3L16A 2VGEA 4K0RA 4WNGA 2HO1A 3ASDA 4CGWA 1JUQA 3VTYA 2W5ZA 4V3IA 2QPWA 3U9WA 1N9AA 2J9QA 3NOCD 5AYWD 2A5EA 3QWVA 3V31A 4L1BA 2VTBB 4G24A 2XHEA 2X3MA 3OXLA 4ILGA 4YNMA 2QYJA 4BERA 3D9OA 5C1DA 3EIQC 3LPZA 3DPDA 3LS8A 1UJJA 2R59A 5EIDA 3VTXA 4BY6A 3UM2A 3PNLB 3B7TA 5LCWC 4M7CA 5ANLA 2VGXB 2Y1LE 3KS2A 3MX3A 1HZ4A 1ZBPA 3DSUA 3M5AA 5TTFA 2OEWA 4U0SA 5CCLA 5IY5E 3V30A 1QZ2A 4E85A 3LEWA 5EG2A 3DB5A 1HG2A 2ETBA 5FJYA 4DX5D 4UWHA 4GMLA 3LY9A 4J7IA 3DEOA 2AXZA 4NACA 3ASHA 3Q47B 4KZ0A 3UI2A 4FLHA 2B6CA 2EQXA 2J4BA 2IF4A 1X5BA 2F0YA 2P9KG 5FQ8A 4HOQA 4ME2A 4DPRA 4G8KA 2VSNA 4GZ3A 4GA1A 4JA7A 3ULYA 4GTRA 5JHBA 2RFIA 2FF4A 4DX2A 1KZOA 3EHRA 3E30A 3SO8A 3FEYA 5FQ4A 1MYOA 5T0KA 3ZN3A 5T8IA 1UOHA 3UTMA 3M59A 2DIWA 2P9SG 3OTNA 1IHBA 2Q7FA 3CHQA 5D2MC 5AENA 3ABKE 2ZGGA 3ZNGA 4GTOA 1H2UA 3AU4A 3TL5A 4UWFA 4ILIA 5CEDB 4DUIA 3F9YA 4LCTA 2J08A 3D9MA 1TYQG 3APCA 5TEGA 4TXRA 4HI8A 1OWLA 4UQXA 5A7DB 5EILA 3TGOA 3SWCA 2XS8A 1UN9A 1BI8B 4Q96A 2JLBA 1N11A 4LEUA 4OAVB 3X2QE 3CBOA 4OAUC 4B0ZA 4LERA 3UQ3A 1WAO1 3AG3E 4FJYA 2WXIA 5CRUA 3RRMB 3IBEA 4JHJA 3QB2A 2WPVA 3FP3A 3CSFA 3HVEB 3T9KA 1OWMA 2VSYA 1EYHA 1FT1A 3NF1A 1O1RA 5JJ0A 2VSOE 3JUIA 3CK9A 1KT0A 3D9PA 5FIOA 3SY2A 3CKCA 1LF8A 3FU6A 3MO2A 1YYHA 3F9WA 1V55E 1DCEA 3KD7A 2IGQA 4G1TA 5ENRD 1W3BA 1N4RA 2V4HC 3FTSA 4JC8A 1MZCA 1N52A 3BUAA 3UINC 2GRQB 1E96B 1RW2A 4AVXA 1K8KG 2P9NG 2ETAA 3RU0A 1TR4A 3S7FA 2PL2A 3DPYA 4HBDA 2JABA 2XRYA 3CVPA 1K1AA 1NFIE 2QYUA 5BV0A 3LDZA 4J8SA 3UM3A 4JXTA 5FQ7A 1U2VG 3FU3A 4M3OA 2HM8A 5LSZA 2O8JA 1IQRA 4HRNA 2DVWA 4A3TA 2ZIRA 4QEOA 1HX8A 3PRZA 3ABME 4N2SA 3MKQB 4WWNA 2P9PG 3ASFA 2WQ7A 3C98A 4PH4B 3FTXA 4RG9A 2JV0A 2IFUA 1S63A 5KJNA 4U04A 3IXEA 3UMVA 3LKUA 1OT8A 1LTXA 3W9FA 3D9NA 2BEDA 3LXUX 5KJLA 3JXJA 3CK8A 3FU5A 2UY1B 2X6JA 1OWOA 1MHQA 4HS2A 2IO3C 4J6IA 2RFAA 3Q5MA 3QDNA 3FTUA 1FCHA 3IHYA 3FUHA 3QWPA 2MRIA 3CR3A 1ML9A 1HS6A 2CFZA 2ETCA 3CHOA 4JB8P 5T3RA 1XQHA 3SW9A 3KSQA 3C3QA 4TUUA 3FY4A 3Q9UC 1MX4A 3AS5A 2YHEA 3B7UX 4YNDA 3FEXA 3FTYA 3I4GA 3O4ZA 3M53A 4K5BA 3PZ3A 3M54A 1DVPA 3BU8A 3D9KA 5HKPA 3EP0A 4NIKA 3R9AB 3G2UA 4YPAA 4Y6WA 3ASOE 5T5GA 5LSXA 2XEEA 5EYPF 4BEPA 4UUCA 2P9LG 3W9GA 4MKTA 2AW6A 4CDNA 1SZ9A 4EZJA 4WNDA 3GYZA 1IQUA 3L22A 5CMWA 1HFAA 5AAOA 4G2VA 1SQMA 2AWIA 4DLOA 1A17A 2V5QC 5G2NA 1HG5A 1ELKA 1JPLA 2PM6A 3G2SA 4GTVA 5G55A 4BT8A 2X6KA 2L6JA 1MQSA 2RG8A 5ANRA 2RD0A 3TAXA 3IHVA 4N3BA 4GTSA 1U3CA 3DEPA 4N5QA 2XRZA 5ENOD 3UXGA 3EUVA 2VTBA 3WXXA 1TJCA 1NA3A 3B7SA 3L13A 3CHPA 3HXDA 3L54A 1WM5A 2KZTB 5AQ7A 4JLGA 4UI9K 2DBAA 5D66A 3TG5A 4KVMA 4BETA 1JCRA 5EKQD 2IEJA 1KLXA 4GCOA 5ARFA 3JXIA 2LSUA 2VJ8A 2WMNA 5FQ6A 1SVXA 2VGXA 2P2CP 4DK5A 1N95A 3FTWA 3TWSA 1E8XA 4QQIA 1YMPA 5F5EA 1TN7A 3E4BA 1JCQA 2X38A 2OEVA 2KBXA 2NYJA 2CFUA 2WQ6A 3SGHA 3C3RA 5CPRB 3CEQA 3RO2A 3KMJA 2WXRA 2YQ8A 5CERB 2PZIA 3RSEG 4JEHA 3FUDA 4GTQA 4CZ2D 4HVBA 3UX4A 4FA6A 1O9SA 4IULA 1UG3A 1HH8A 5G05J 4F1SA 4WWOA 2WXKA 2DYRE 4U0UA 3RRNB 3I5PA 2CHXA 2BF0X 5CRVA 3MA5A 4YDYA 2IONA 2V5FA 3RO3A 3PEVB 3V2XA 2Y0BG 4A1SA 2UWJG 4U95D 4I9EA 1K3ZD 2XCCA 1WG0A 3CV0A 3VV0A 5E75A 4L2YA 2XQ0A 4HLEA 4ILHB 2XGOA 3U4TA 5JHAA 5G04C 3LCAA 4CGVA 4HRLA 3SFYA 4HQDA 3ZYMA 2AXVA 4FP7A 4XZ4A 3QNKA 3T8MA 3JQ0A 2XEVA 4NURA 5FTPA 3OPEA 5JINA 3MCXA 5HRYA 2I6HA 4GA0A 4BSXA 1Z3XA 3PZ4A 3ZFWA 4GB9A 4XI9A 4B8AA 1BLXB 1H19A 4OVVA 1ELWA 4U07A 4UWGA 2XS1A 3FUIA 2L6BA 4CDMA 5G05C 4GU5A 4GYOA 3UKRG 5AYFA 2QY7A 5KCMA 3DSSA 5ENPD 4U8YD 3L82A 3APDA 1E7VA 4EZKA 3CQCB 4MS6A 4KVOA 4HXIA 5CCMA 3ML9A 4I6GA 3CVYA 3I4RB 2V4LA 2DWZA 5KWDA 3BEEA 5BV1A 4FULA 3PUJA 1NA0A 5B1BE 4MLPA 3OS5A 4N5CA 5CEAA 4FADA 1JWFA 5JJTA 4BT9A 3SI5A 2FO7A 4BUPA 2F8XK 1OCZE 4H12A 3NQPA 4RQIA 3NBNB 1OCOE 1MX6A 3MJWA 2KXPC 2R2LA 4LRZA 4YDOA 3S7BA 3HYMB 4YVOA 4AM9A 1N4QA 2WXQA 4GZ6A 4IN3B 1IYGA 1AWCB 4IRUA 1IXVA 1IKND 4K5AB 4JDSA 4PS8A 1NZNA 4A1GA 1MVHA 1E8ZA 4EBAA 4I1OB 4WAFA 1SW6A 4ANWA 1KT1A 2H6FA 2LNIA 5D0OD 1SA5A 3RQ4A 2CG2A 3V79K 1WDYA 2NSZA 5JHNA 4KXKB 2LAHA 3LY8A 4GTTA 4HNAD 2LAIA 4MRUA 3KEZA 5ARGA 3TWVA 1N6AA 4APFA 1RZ4A 1OWNA 2IOLA 2YNQA 3RAUA 5BPPA 1TNYA 2UY1A 2QZAA 3TWWA 3ZHEB 4WNFA 3LY7A 2I2OA 3BQOA 5FZRA 3NAWA 4LNUD 1E8WA 3D9HA 3G2WA 4H7YA 4C0MA 3HDXA 3ZXSA 1JWGA 2AVPA 4G26A 2EIME 1TNBA 1ZU2A 4PDXA 3G2TA 1NP7A 2BUGA 3NB2A 4K5CA 1S70B 3UPVA 2WQHA 2R05A 3JUEA 4L7TA 5EIBE 3Q75A 4DI4A 4Q69A 3BG0B 4GZ5A 3SBTB 1UN8A 4JPSA 2ZGDA 3I3NA 2X6HA 1MX2A 2GGFA 1EF1C 4LUNU 4TRQA 1FVHA 1SA4A 3BG1B 5CBNA 5BXUA 3UIPC 2YHCA 2B0OE 4JVSA 4J8FA 3SD5A 4YPEA 3PVLA 3PZ1A 3PZ2A 5B1AE 1MT6A 3CKBA 1BD8A 1N6CA 4AIFA 2V0PA 3GW4A 1PC2A 4BWRA 2OOEA 1LD7A 2MOWA 4WWPA 3Q9NC 3R7QA 3SFZA 3TXNA 4E6HA 2MYOA 4FLBA 2KCLA 3SZ7A 4HORA 3QJZA 3N71A 3TWTA 3L17A 4UQYA 3OXFA 4GYWA 3HXFA 4L2LA 1V54E 3ZRHA 4WUYA 1HU3A 3GZ1A 3CHSA 4HRMB 4Y6CA 3ONLA 4B94A 2W5YA 5A6CA 4B93B 4MI0A 3B95A 4J7WA 5CBOA 4OVUA 1MJ0A 1PAQA 2LUHA 4NJ5A 3UM1A 4HFGA 1NL4A 3TWQA 4GA2A 3K9IA 2HE0A 3QC1A 3CGHA 2DZNA 1KZPA 2EINE 5KNHD 5KJKA 3L08A 3PREA 3QAQA 2IOSA 3HG0D 2PQNA 3B7RL 2H6IA 3SHFA 1GW6A 3Q7AA 4YDEA 1LD8A 4ACLA 2ILRA 2IY0C 2Y4TA 3MEKA 1EDUA 2PM7A 2M63A 4HOTA 3Q73A 1PY1A 3E34A 4BSZB 3L6AA 2J8SD 3FTZA 3CVUA 2J07A 1XGWA 1Y6IA 4XIFA 2DZOA 3S2AA 1QNFA 2QC9A 3MO5A 3CQGB 2YINA 4HB5A 3E33A 4O1OA 4RZ0A 1L5JA 2WXGA 4LDGA 4G25A 3CBPA 3FH8A 3AG2E 4Q94A 4XKCA 5B3SE 3MO0A 3MZLB 2EIJE 5E76A 2IQCA 3ZXPA 3DSVA 2NXPA 3FUMA 2XGSA 5FINA 2H6GA 4QEPA 2KCKA 4RVBA 1FPPA 5CMYA 4UI9J 4UWKA 2C0MA 1OCRE 3LJNA 4TUMA 3NZSA 3Q78A 3UT8A 3CVXA 4AY6A 4I2ZA 3HXCA 4RG6A 3FH7A 4EZLA 3GZSA 4ANUA 3L9TA 3QK0A 1H0AA 2ZISA 1D8EA 4K03A 4QFVA 4JHKA 1N3JA 1ZB1A 1INZA 4BESA 4KYOB 5A23A 1U3DA 3VLDA 1OUVA 3AS8A 5ENSD 2XPZA 4QENA 3D9IA 4JW1A 2XZTG 1OCCE 1S0PA 3FTVA 4I6EA 1TN6A 3TG4A 2GRMA 1N54A 3PS6A 4AXHA 4FC8A 5BUZA 2LXMA 2V8SE 2WXPA 4JA9A 5G04J 4CEMA 4G11A 4N2QA 4AY5A 4HOUA 1BPOA 3MV2B 4GYYA 3TXMA 3C72A 3KAEA 5KBAA 5M72A 3DRAA 2P58C 1A5EA 3MYVA 5CHEE 4XX5A 2F37A 3ASGA 5EN5D 3TWXA 4UI9C 2Y4UA 4URKA 2XPIA 4APOA 4N3CA 5H7PA 3CVWA 4FU3A 3JCKC 3BO5A 3IHXA 5FWQA 3E32A 3J5PA 2JEKA 3AG1E 2R17C 3U3WA 3ZKJA 4GZDA 2C2LA 4MI5A 4TV3A 2BTDA 3S7JA 3FULA 4CT0A 5KNGA 4EQFA 3CVQA 3ZU7B 3RKVA 5D0QD 1OXJA 1UW4B 3M56A 2J09A 3PUKA 3HXBA 1SZAA 5J90A 3CVNA 4JHRA 4GCNA 5FT9A 4F6RD 3U64A 2G46A 1Q2ZA 1BI7B 5TH7A 3ML8A 3ABLE 3LJ3A 3MKRA 2P9UG 3UT4A 1H3IA 1H6KA 2EILE 5BNWA 5AJLA 2KATA 3R9MA 2R03A 3ZW3A 4L9PA 4ANVA 2I1KA 3RRUA 2WXJA 4ABNA 4A55A 3ULEG 5JMND 2BQZA 3EJNA 4UWLA 5AIJA 3ZHEA 4U8HA 4A63B 3ZIMA 5LP0A 4G8LA 3CLJA 4I51A 1DCQA 2ZXWE 4F3VA 1WY6A 1N4PA 2KM4A 4O60A 3MGBA 4HOSA 3HRAA 4I2WA 5HI7A 3RK6A 3CVLA 3KMAA 3AJIA 1D9SA 3OOIA 3HVEA 3FDHA 1ZKKA 4BFRA 2XGMA 4TXQA 2R02A 1O1SA 2IU1A 4J83A 1N0QA 2WVIA 3Q49B 4JL0A 4OYSA 3CHMA 4KZCA 3LYAA 3DSXA 4O30A 3QWWA 3ZGQA 3VUZA 1E90A 4XI0A 4EBAG 5EYLA 4J8OA 2MHKA 3DXKG 3UIOC 5CECB 3ZYKA 3IV0A 3TWRA 3V2OA 2IJGX 3PDNA 1Z3YA 4PS7A 4YVQC 3CBMA 5C2YA 3ONKA 2IO2C 4CCAA 4FJZA 1P5QA 4LG6A 3JYSA 3PZDA 2ONDA 2RFMA 5AN8A 3C3OA 1N4SA 4AV7A 3LVRE 2WB2A 2FULA 5ITZF 4B8CB 2VSXE 4U8VD 1HE8A 4P29A 3UKUG 3MKQA 2XEHA 4ATGA 2GROB 3ESLA 4CYMD 4GTPA 3FFLA 3QARA 4ATZD 4FHKA 5EX3A 2GRRB 1N0RA 2KCVA 3WG7E 3KMTA 4DJAA 2AXUA 5JJ6A 1O5MA 2VQ2A 3NZUA 3PE3A 3AAAC 3B13A 2DYSE 2WXOA 3EHQA 4IJ8A 1TNZA 5FZSA 4GAAA 4F1PA 5AJDA 3ZYQA 1X81A 2FEZA 4EECA 4JEUA 3GZ2A 4KT6B 3UUXA 3F9ZA 2E0IA 3T8KA 2GRPB 5DIZA 5ENTD 4EHMA 4IJDA 4J0UA 5BT1A 4HLLA 2XCBA 4J8DA
chains in the Genus database with same CATH topology
1IHGA 3B7TA 2PM7A 2M63A 4HOTA 3FTWA 5LCWC 1PY1A 4AOFA 3FPDA 3L6AA 5ANLA 3FTZA 4E47A 3CVUA 1E8XA 2J07A 2J49A 3FHEA 1XGWA 2VGXB 3MX3A 3KS2A 1Y6IA 2OVFA 1HZ4A 1ZBPA 4XIFA 3M5AA 2PQRA 4NQ0A 5F5EA 3S2AA 3E4BA 5TTFA 3CIAA 2X38A 1QNFA 2KC7A 4U0SA 2CFUA 2WQ6A 5CCLA 1QZ2A 4E85A 3SGHA 3OAWA 3LEWA 3MO5A 5CPRB 5EG2A 3CQGB 3DB5A 1MVXA 3CEQA 1HG2A 2LO6A 3RO2A 3KMJA 2WXRA 2YINA 2YQ8A 3FUNA 2PZIA 5FJYA 4RZ0A 4UWHA 4GMLA 3LY9A 4JEHA 4J7IA 1L5JA 3FUDA 4I6JA 2AXZA 2WXGA 4LDGA 4NACA 4HVBA 3ASHA 3Q47B 4KZ0A 4I43A 4G25A 3UX4A 3CBPA 4FA6A 3FH8A 4FLHA 2LSVA 1O9SA 4Q94A 4IULA 4XKCA 1UG3A 3MO0A 2EQXA 2J4BA 2IF4A 1HH8A 3MZLB 1X5BA 5G05J 4DI3A 5E76A 4F1SA 4WWOA 3DBSA 2IQCA 5KJMA 4AJWA 5FQ8A 3P1UA 4HOQA 4ME2A 2NXPA 2WXKA 3FUMA 2XGSA 4DPRA 2VSNA 1YA0A 4QEPA 4U0UA 3ULQA 2KCKA 4GZ3A 1E8YA 4RVBA 5FZQA 3RRNB 4GA1A 3I5PA 2CHXA 3ESKA 2BF0X 4JA7A 2I1JA 3ZYLA 5T0MA 1H2TC 3MA5A 3ZPJA 2L0IA 5JHBA 2RFIA 2FF4A 2IONA 2V5FA 3RO3A 3PEVB 5CMYA 4UI9J 4UWKA 4A1SA 2UWJG 4I9EA 2C0MA 3FEYA 5FQ4A 2XPYA 2XCCA 3EDTB 3NZSA 5T0KA 4BX9A 3ZN3A 2X6FA 3UT8A 3CVXA 5T8IA 4AY6A 3CV0A 3VV0A 4I2ZA 5E75A 4RG6A 4L2YA 3AS4A 2XQ0A 3D3MA 3FH7A 3JQ1A 4EZLA 4HLEA 4U0ZA 3GZSA 4ILHB 4ANUA 3F9XA 2XGOA 2CHZA 2DIWA 3M59A 3QK0A 4KMOA 1H0AA 4DLQA 3U4TA 3MEKA 3OTNA 5G04C 5JHAA 3LCAA 4CGVA 3T5XA 3D9JA 1HF8A 3FU0A 2Q7FA 3CHQA 1HO8A 5AENA 1HXIA 3FUJA 4K03A 4BTAA 3ZYMA 2WXFA 2KZTA 4QFVA 4JHKA 5EX0A 1H2UA 2AXVA 3AU4A 4FP7A 4R7LA 3QNKA 4XZ4A 4EPZA 3T8MA 3JQ0A 1INZA 1N3JA 2XEVA 4KYOB 5A23A 4NURA 1U3DA 3PEUB 4UWFA 3TL5A 3VLDA 5FTPA 1OUVA 3OPEA 4ILIA 3AS8A 5JINA 4UQZA 2XPZA 3MCXA 3LVQE 4QENA 3D9IA 4JW1A 2FBNA 3RAYA 2I6HA 4GA0A 3F9YA 4LCTA 1S0PA 3FTVA 2J08A 3D9MA 5ENNA 4I6EA 1Z3XA 4BSXA 3APCA 2OVBA 4GZCA 3SBSA 3TG4A 3T5VA 5TEGA 3ZFWA 4C1QA 2GRMA 1Z6TA 4GB9A 1N54A 4XI9A 1OWLA 3PS6A 4UQXA 3VLFA 2WMOA 5A7DB 4AXHA 4Z4PA 4B8AA 4FC8A 3TGOA 3SWCA 5BUZA 1Y8MA 1MUFA 2V8SE 1H19A 4OVVA 1UN9A 4Q96A 2WXPA 2JLBA 1ELWA 4LEUA 4U07A 4JA9A 4UWGA 5G04J 3FUIA 4CEMA 4F7AA 4G11A 5HQ8A 4G23A 2QFCA 4N2QA 3CBOA 4AY5A 4B0ZA 4HOUA 4LERA 3UQ3A 4CDMA 1BPOA 1WAO1 3MV2B 4GYYA 4FJYA 5G05C 3TXMA 2WXIA 4GU5A 4GYOA 2L0TB 5LOZA 5JIYA 1B89A 3KAEA 3SNXA 5M72A 3Q4AB 4N3AA 2QY7A 3RRMB 5AYFA 5KCMA 5EDSA 2GRLA 3IBEA 4JHJA 3APDA 2P58C 1E7VA 4EZKA 3QB2A 3MYVA 2WPVA 3FP3A 3CSFA 2WXLA 4F53A 3CQCB 5LX8A 4MS6A 3K5KA 4KVOA 4HXIA 3HVEB 5CCMA 5CHEE 3ML9A 4XX5A 1OWMA 5F6LA 4I6GA 3ASGA 4YNPA 3CVYA 2VSYA 3FWVA 3I4RB 2V4LA 1EYHA 4UI9C 3NF1A 2Y4UA 5JJ0A 4URKA 3BEEA 2VSOE 3JUIA 3CK9A 1KT0A 2DCPA 3D9PA 3S8PA 2XPIA 2HYZA 5BV1A 4FULA 4APOA 3CKCA 3PUJA 1LF8A 3FU6A 4N3CA 4ACKA 1NA0A 2E2EA 3JCKC 4FU3A 3R7RA 3CVWA 3BO5A 3OS5A 4MLPA 3MO2A 3F9WA 4N5CA 3IHXA 5FWQA 3KD7A 4I1MA 4PUCA 2IGQA 2JEKA 4FADA 2R17C 4G1TA 3U3WA 3M55A 1W3BA 1XNFA 4GZDA 1JWFA 5JJTA 3Q15A 4BT9A 3FTSA 3P2BA 4JC8A 2C2LA 2Y3AA 1N52A 3SI5A 4FMUA 4MI5A 4TV3A 4XKBA 2BTDA 2FO7A 3OXGA 4YPUA 3S7JA 3IEGA 3FULA 1E96B 4BUPA 3PNTB 4AVXA 2A5UA 4I17A 4H12A 4CT0A 3RU0A 4CDRA 3NQPA 2OV8A 3G2VA 4EQFA 3CVQA 3S7FA 2PL2A 3MJWA 5J08A 3FUEA 3RKVA 2XRYA 5D0QD 3CVPA 4LRZA 1UW4B 5JJ7A 3S7BA 3M56A 3HYMB 2J09A 3EHNA 4YVOA 4CT4A 4AM9A 3PUKA 3ZVVA 5BV0A 2WXQA 1SZAA 4GZ6A 3LDZA 4IN3B 1IYGA 5J90A 3CVNA 4AEZC 4JHRA 4IRUA 4GCNA 4J8SA 4JXTA 5FT9A 4JDSA 4PS8A 3U64A 5FQ7A 2G46A 3UT7A 1NZNA 4A1GA 1MVHA 4GPKA 1E8ZA 5TH7A 3ML8A 4EBAA 4I1OB 4WAFA 3LJ3A 4ANWA 3FH5A 1KT1A 3FU3A 3MKRA 2HR2A 2WXMA 2HM8A 4M3OA 3UT4A 1H3IA 2O8JA 5LSZA 1H6KA 3RIBA 4PS3A 5F6KC 4JZYA 1IQRA 3RJWA 2LNIA 3O48A 4XE0A 5LFAA 5BNWA 4A3TA 3HNAA 5D0OD 2R3AA 3CK7A 3RQ4A 4QEOA 1HX8A 3PRZA 2CG2A 4N2SA 5AJLA 3IKOB 2KATA 2NC9A 3MKQB 4WWNA 3ZW3A 3ASFA 2NSZA 4ANVA 2I1KA 2WM9A 2WQ7A 5JHNA 4KXKB 3C98A 4PH4B 3RRUA 2WXJA 4ABNA 4A55A 3FTXA 2LAHA 2J4DA 3CHRA 2CHWA 3LY8A 3U66A 4RG9A 2BQZA 2JV0A 5T4YA 2IFUA 3EJNA 3HHMA 4UWLA 5AIJA 5KJNA 4U04A 2LAIA 3ZHEA 4MRUA 4U8HA 3KEZA 5ARGA 1N6AA 4APFA 4A3VA 2L9BA 1E7UA 1OWNA 4I1AA 2IOLA 3UMVA 3LKUA 3ZIMA 2YNQA 5BPPA 5LP0A 2UY1A 3AU5A 3CLJA 4NVQA 4I51A 1VDYA 3ZHEB 3DALA 3D9NA 4F3VA 1EPUA 1WY6A 3LXUX 4WNFA 2KM4A 5KJLA 3LY7A 2I2OA 3MGBA 3VUZA 4HOSA 5FZRA 3CK8A 3FU5A 4I2WA 3TJPA 1E8WA 2UY1B 3CSTA 3MV3B 3APFA 5HI7A 3RK6A 3ZEFA 2X6JA 4H7XA 3CVLA 2R5SA 2VGYA 3G2WA 3HDXA 4H7YA 3ZXSA 1OWOA 3HIZA 4C0MA 3KMAA 1JWGA 4B89A 1MHQA 2AVPA 4HS2A 4G26A 3OOIA 4J6IA 3HVEA 3FDHA 4C9BB 1ZU2A 4AP2A 3Q5MA 1ZKKA 4BFRA 2XGMA 1UJKA 4J8EA 4ANXA 4PDXA 5F59A 4BTBA 4BX8A 3QDNA 3G2TA 3EIJA 3FTUA 1FCHA 1NP7A 2BUGA 3IHYA 3FUHA 3QWPA 1DNPA 2IU1A 2MRIA 3UPVA 2WQHA 2X6IA 3CR3A 3PH0C 4L7TA 4J83A 4I9CA 1ELRA 1ML9A 4DI4A 1HS6A 4Q69A 3BG0B 4KBQA 2CFZA 4FHJA 2WXNA 4GZ5A 2WVIA 4U63A 3CHOA 3Q49B 2I9CA 3QOUA 4JL0A 4OYSA 5T3RA 1XQHA 3CHMA 4KZCA 3SBTB 3SW9A 1UN8A 3LYAA 2C0LA 4JPSA 4TUUA 3I3NA 2CG3A 2GGFA 2X6HA 3FY4A 4O30A 3QWWA 1EF1C 4D10C 4LUNU 3ZGQA 3AS5A 2YHEA 5DBKA 3B7UX 3FTYA 3FEXA 1E90A 4L23A 1FVHA 3D9LA 4TRQA 4XI0A 4YNDA 2MHKA 4EBAG 4J8OA 3SF4A 3BG1B 4AU7A 3I4GA 3ZYKA 3O4ZA 3IV0A 3M53A 2F69A 3M54A 1DVPA 3D9KA 5BW8C 2YHCA 3S7DA 3M57A 3EP0A 3FUFA 2IJGX 2GW1A 3PDNA 4JVSA 4J8FA 3SD5A 4YPEA 3R9AB 1Z3YA 3PVLA 4N39A 3G2UA 4YPAA 3FUKA 3URZA 1MT6A 3CKBA 4Y6WA 4O6FA 2WXHA 5T5GA 4PS7A 1N6CA 4YVQC 3CBMA 5C2YA 3M58A 5LSXA 1TJFA 3ONKA 4AIFA 2VYIA 4CCAA 5LCWJ 4FJZA 2FI7A 1P5QA 1H2VC 2V0PA 3JYSA 3GW4A 1FVFA 3PZDA 3CVVA 2ONDA 1PC2A 4BWRA 2OOEA 2MOWA 3QKYA 4WWPA 3VLEA 3RJVA 3R7QA 3SFZA 3TXNA 2A4ZA 4E6HA 4J7FA 4MKTA 2AW6A 1TEZA 1PEGA 4CDNA 1SZ9A 4AV7A 4WNDA 4EZJA 3LVRE 4FLBA 2WB2A 2FULA 2KCLA 3GYZA 1IQUA 3SZ7A 4HORA 3QJZA 4B8CB 2VSXE 3EHMA 3L22A 1HE8A 3N71A 4P29A 3L17A 1HFAA 5CMWA 4W9RA 4UQYA 3ENEA 3MKQA 1QQEA 2ZU6B 3PE4A 4WNEA 4IYPA 3OXFA 4ATGA 4G2VA 4GYWA 1SQMA 2AWIA 4L2LA 4C0EA 3ZRHA 1OWPA 3ESLA 4GMJA 4DLOA 1A17A 4WUYA 1HU3A 3GZ1A 3FFLA 3CHSA 4Y6CA 4RSYA 3ONLA 3QARA 4B94A 5G2NA 2W5YA 4CRWA 4NRHB 3L16A 1HG5A 1ELKA 1JPLA 2PM6A 3G2SA 4FHKA 4K0RA 5G55A 5A6CA 4MI0A 4WNGA 4BT8A 2X6KA 2L6JA 2HO1A 5EX3A 1MQSA 2RG8A 5ANRA 2RD0A 2KCVA 4OVUA 3TAXA 3ASDA 3IHVA 4N3BA 4CGWA 3KMTA 4DJAA 1U3CA 2AXUA 1JUQA 5JJ6A 2XRZA 1PAQA 4NJ5A 2VQ2A 3NZUA 3PE3A 3VTYA 2W5ZA 3B13A 4HFGA 4V3IA 2VTBA 3WXXA 2QPWA 2WXOA 1TJCA 3U9WA 4IJ8A 1NA3A 2J9QA 5FZSA 3B7SA 5AYWD 4GA2A 3K9IA 3L13A 3QWVA 3CHPA 4GAAA 4L1BA 3L54A 3QC1A 1WM5A 2KZTB 3CGHA 2VTBB 4G24A 4JLGA 2XHEA 4UI9K 2X3MA 5AJDA 2DBAA 3ZYQA 3OXLA 3TG5A 4KVMA 2FEZA 4ILGA 3L08A 5KJKA 4YNMA 3PREA 3QAQA 4EECA 2IOSA 4JEUA 3GZ2A 5EKQD 4KT6B 2PQNA 3UUXA 3D9OA 1KLXA 3F9ZA 5C1DA 3B7RL 2E0IA 3EIQC 4GCOA 3SHFA 1GW6A 3LPZA 3DPDA 3LS8A 1UJJA 5DIZA 2R59A 5ARFA 4ACLA 4IJDA 2LSUA 2ILRA 4J0UA 2VJ8A 3VTXA 5BT1A 2Y4TA 2WMNA 2XCBA 5FQ6A 4BY6A 2VGXA 4J8DA 4DK5A 1EDUA 3PNLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHG A;  4HOT A;  5LCW C;  3FPD A;  4E47 A;  2VGX B;  3KS2 A;  1HZ4 A;  1ZBP A;  4XIF A;  3M5A A;  2PQR A;  4NQ0 A;  5F5E A;  3E4B A;  5TTF A;  2KC7 A;  4U0S A;  5CCL A;  1QZ2 A;  3MO5 A;  5CPR B;  5EG2 A;  3DB5 A;  1MVX A;  3CEQ A;  3RO2 A;  3KMJ A;  2YQ8 A;  2PZI A;  5FJY A;  4RZ0 A;  4J7I A;  3LY9 A;  4LDG A;  3ASH A;  3Q47 B;  4G25 A;  3CBP A;  2LSV A;  1O9S A;  3MO0 A;  2IF4 A;  1HH8 A;  5G05 J;  5KJM A;  4HOQ A;  4ME2 A;  2XGS A;  2VSN A;  1YA0 A;  4QEP A;  4U0U A;  3ULQ A;  2KCK A;  4GZ3 A;  5FZQ A;  4GA1 A;  3ESK A;  4JA7 A;  5T0M A;  3MA5 A;  3ZPJ A;  2RFI A;  2FF4 A;  2V5F A;  3RO3 A;  4UI9 J;  4A1S A;  2UWJ G;  4I9E A;  2C0M A;  2XCC A;  3EDT B;  5T0K A;  3ZN3 A;  4AY6 A;  3CV0 A;  3VV0 A;  4I2Z A;  4RG6 A;  3AS4 A;  4U0Z A;  3F9X A;  2XGO A;  3M59 A;  3U4T A;  5G04 C;  3LCA A;  4CGV A;  2Q7F A;  1HXI A;  4BTA A;  5EX0 A;  1N3J A;  4KYO B;  2XEV A;  5FTP A;  1OUV A;  3OPE A;  3AS8 A;  5JIN A;  4UQZ A;  4QEN A;  2FBN A;  3RAY A;  2I6H A;  4GA0 A;  3F9Y A;  3TG4 A;  4C1Q A;  5TEG A;  3ZFW A;  4XI9 A;  4UQX A;  5A7D B;  4Z4P A;  3TGO A;  3SWC A;  1Y8M A;  1MUF A;  2JLB A;  1ELW A;  4LEU A;  4U07 A;  4JA9 A;  5G04 J;  5HQ8 A;  4G23 A;  2QFC A;  4N2Q A;  3CBO A;  4AY5 A;  4HOU A;  3UQ3 A;  1WAO 1;  3MV2 B;  4GYY A;  5G05 C;  4GYO A;  5JIY A;  1B89 A;  3KAE A;  5M72 A;  3Q4A B;  4N3A A;  5AYF A;  2P58 C;  2WPV A;  3FP3 A;  3K5K A;  5CCM A;  5CHE E;  5F6L A;  3ASG A;  4YNP A;  2VSY A;  3FWV A;  4UI9 C;  3NF1 A;  2Y4U A;  5JJ0 A;  3BEE A;  3S8P A;  3CK9 A;  1KT0 A;  2XPI A;  2HYZ A;  4APO A;  3CKC A;  4N3C A;  1NA0 A;  2E2E A;  3BO5 A;  3OS5 A;  3MO2 A;  3F9W A;  4N5C A;  3IHX A;  3KD7 A;  2IGQ A;  4G1T A;  3U3W A;  3M55 A;  1W3B A;  1XNF A;  5JJT A;  3Q15 A;  4BT9 A;  2C2L A;  4FMU A;  4MI5 A;  2FO7 A;  3OXG A;  4YPU A;  3S7J A;  3IEG A;  1E96 B;  4BUP A;  4I17 A;  4H12 A;  3RU0 A;  4CDR A;  4EQF A;  3CVQ A;  3S7F A;  2PL2 A;  3RKV A;  5D0Q D;  3CVP A;  5JJ7 A;  3S7B A;  3M56 A;  3HYM B;  4YVO A;  4AM9 A;  4GZ6 A;  4IN3 B;  1IYG A;  3CVN A;  4JHR A;  4GCN A;  5FT9 A;  4JDS A;  2G46 A;  1NZN A;  1MVH A;  4GPK A;  5TH7 A;  1KT1 A;  3MKR A;  2HR2 A;  1H3I A;  5LSZ A;  2O8J A;  3RIB A;  5F6K C;  3RJW A;  2LNI A;  3O48 A;  3HNA A;  5BNW A;  5D0O D;  2R3A A;  3CK7 A;  3RQ4 A;  4QEO A;  4N2S A;  2KAT A;  2NC9 A;  3ASF A;  5JHN A;  4KXK B;  4ABN A;  3LY8 A;  4RG9 A;  2BQZ A;  2JV0 A;  2IFU A;  5KJN A;  4U04 A;  3ZHE A;  5ARG A;  1N6A A;  4I1A A;  3LKU A;  2UY1 A;  4NVQ A;  4I51 A;  3DAL A;  3ZHE B;  4F3V A;  4WNF A;  5KJL A;  3LY7 A;  4HOS A;  5FZR A;  3CK8 A;  4I2W A;  2UY1 B;  3MV3 B;  5HI7 A;  4H7X A;  3CVL A;  2R5S A;  2VGY A;  4H7Y A;  3KMA A;  2AVP A;  4G26 A;  3OOI A;  1ZU2 A;  1ZKK A;  3Q5M A;  2XGM A;  4J8E A;  5F59 A;  4BTB A;  3QDN A;  1FCH A;  2BUG A;  3QWP A;  3UPV A;  2WQH A;  4J83 A;  4I9C A;  1ELR A;  1ML9 A;  4KBQ A;  4GZ5 A;  3Q49 B;  4JL0 A;  3QOU A;  1XQH A;  3SW9 A;  3LYA A;  2C0L A;  4O30 A;  3QWW A;  3ZGQ A;  3AS5 A;  5DBK A;  3VUZ A;  4YND A;  4XI0 A;  4J8O A;  2MHK A;  3SF4 A;  4AU7 A;  3M53 A;  2F69 A;  3M54 A;  5BW8 C;  3S7D A;  2YHC A;  3M57 A;  3EP0 A;  2GW1 A;  3PDN A;  4J8F A;  4YPE A;  3R9A B;  4N39 A;  4YPA A;  3URZ A;  1MT6 A;  3CKB A;  4Y6W A;  4O6F A;  5T5G A;  1N6C A;  4YVQ C;  3CBM A;  3M58 A;  5LSX A;  4AIF A;  2VYI A;  5LCW J;  2FI7 A;  1P5Q A;  3JYS A;  3GW4 A;  2OND A;  1PC2 A;  4BWR A;  2OOE A;  3QKY A;  3RJV A;  4J7F A;  1PEG A;  4WND A;  2KCL A;  3GYZ A;  3SZ7 A;  4HOR A;  3N71 A;  4W9R A;  4UQY A;  1QQE A;  3PE4 A;  4WNE A;  3OXF A;  4G2V A;  4GYW A;  1A17 A;  4WUY A;  3GZ1 A;  3FFL A;  4Y6C A;  4B94 A;  2W5Y A;  4NRH B;  5A6C A;  4MI0 A;  4BT8 A;  4WNG A;  2L6J A;  2HO1 A;  5EX3 A;  2KCV A;  3TAX A;  3ASD A;  4N3B A;  4CGW A;  3KMT A;  5JJ6 A;  4NJ5 A;  2VQ2 A;  3VTY A;  3PE3 A;  2W5Z A;  2QPW A;  3WXX A;  1TJC A;  4IJ8 A;  1NA3 A;  2J9Q A;  5FZS A;  5AYW D;  4GA2 A;  3K9I A;  3QWV A;  1WM5 A;  4G24 A;  4JLG A;  4UI9 K;  2DBA A;  3OXL A;  3TG5 A;  2FEZ A;  5KJK A;  4YNM A;  3GZ2 A;  5EKQ D;  2PQN A;  3UUX A;  1KLX A;  3F9Z A;  5C1D A;  4GCO A;  3LPZ A;  5DIZ A;  5ARF A;  4IJD A;  2LSU A;  4J0U A;  3VTX A;  5BT1 A;  2Y4T A;  2XCB A;  2VGX A;  4J8D A;  3MEK A; 
#chains in the Genus database with same CATH topology
 1IHG A;  1S64 A;  4J8Y A;  3EU9 A;  4AOF A;  3FPD A;  4E47 A;  3Q7F A;  2EIK E;  3KSL A;  2J49 A;  3FHE A;  2OVF A;  2PQR A;  4NQ0 A;  4RLY A;  3CIA A;  2KC7 A;  2RKK A;  3OAW A;  1MVX A;  2LO6 A;  2P9I G;  3FUN A;  4XEI G;  4I6J A;  3AG4 E;  4I43 A;  5AQ9 A;  2LSV A;  4GMR A;  1FT2 A;  4DI3 A;  3DBS A;  5KJM A;  4AJW A;  3P1U A;  1YA0 A;  3ULQ A;  2BKK B;  1E8Y A;  5FZQ A;  3ESK A;  2I1J A;  3ZYL A;  5T0M A;  4LNG A;  1H2T C;  3ZPJ A;  4TXP A;  2L0I A;  1JCS A;  2XPY A;  3EDT B;  4BX9 A;  2X6F A;  1BU9 A;  3AS4 A;  4JD2 G;  3JQ1 A;  3D3M A;  4U0Z A;  3F9X A;  2CHZ A;  3NOG D;  1KPS B;  4KMO A;  3F6Q A;  4X8Q A;  1G3N B;  4DLQ A;  3T5X A;  3D9J A;  1HF8 A;  3FU0 A;  4LSZ E;  1HO8 A;  1HXI A;  3FUJ A;  4BTA A;  2WXF A;  2KZT A;  5EX0 A;  2XEN A;  4R7L A;  4EPZ A;  2XZD G;  1TN8 A;  3PEU B;  4UQZ A;  3LVQ E;  2FBN A;  3RAY A;  1YCS B;  5ENN A;  3ASN E;  2OVB A;  4GZC A;  3SBS A;  4C1Q A;  3T5V A;  1Z6T A;  3VLF A;  2WMO A;  4Z4P A;  1Y8M A;  1MUF A;  1TNO A;  4F7A A;  5HQ8 A;  4G23 A;  2QFC A;  5BXO A;  2L0T B;  5LOZ A;  5JIY A;  1B89 A;  3SNX A;  3Q4A B;  4N3A A;  5ENQ D;  5EDS A;  2GRL A;  4ZFH A;  3J5Q B;  1D8D A;  2WXL A;  4MBG A;  4F53 A;  2AJA A;  5LX8 A;  3K5K A;  5JA4 D;  5F6L A;  4YNP A;  2F8Y A;  3E37 A;  4GTM A;  3FWV A;  5AQB A;  1NI1 A;  3S8P A;  2DCP A;  2HYZ A;  4DX1 A;  2OCC E;  3DSW A;  4ACK A;  2E2E A;  5AAR A;  3R7R A;  4I1M A;  4PUC A;  1H6P A;  3M55 A;  1XNF A;  3KEA A;  2GRN B;  1N94 A;  3Q15 A;  4Z68 A;  3P2B A;  2Y3A A;  4FMU A;  4XKB A;  3OXG A;  4YPU A;  3IEG A;  3PNT B;  2A5U A;  4I17 A;  4CDR A;  2OV8 A;  3G2V A;  5J08 A;  3FUE A;  1H6O A;  5JJ7 A;  1TNU A;  3EHN A;  4CT4 A;  3DXM G;  3ZVV A;  4AEZ C;  4U96 D;  1DC2 A;  3UT7 A;  4GPK A;  3FH5 A;  2HR2 A;  2WXM A;  3RIB A;  4PS3 A;  5F6K C;  4JZY A;  3SQV A;  3RJW A;  3O48 A;  4XE0 A;  5LFA A;  3HNA A;  2R3A A;  3CK7 A;  3ISM C;  3IKO B;  2NC9 A;  4GPM A;  2WM9 A;  4YDW A;  1O1T A;  3CHR A;  2J4D A;  2CHW A;  3U66 A;  5T4Y A;  3HHM A;  4A3V A;  2L9B A;  1OY3 D;  1E7U A;  4I1A A;  3EU5 A;  3TWU A;  3AU5 A;  4HI9 A;  4NVQ A;  1Z5S C;  1VDY A;  3DAL A;  1EPU A;  1AP7 A;  3TJP A;  3CST A;  3MV3 B;  3APF A;  3ZEF A;  4H7X A;  2R5S A;  2VGY A;  3HIZ A;  4B89 A;  4C48 B;  4C9B B;  3DST A;  4AP2 A;  4J8E A;  1UJK A;  4ANX A;  3ZUV B;  5F59 A;  4BTB A;  4BX8 A;  3EIJ A;  3Q79 A;  1DNP A;  2X6I A;  3PH0 C;  4DX6 D;  4I9C A;  2H6H A;  1ELR A;  4KBQ A;  4FHJ A;  2WXN A;  4U63 A;  2BKG A;  2I9C A;  3QOU A;  2C0L A;  2CG3 A;  3SFX A;  4D10 C;  2PNN A;  3DWL G;  5DBK A;  3C5R A;  4L23 A;  3D9L A;  3SF4 A;  4DRX E;  4AU7 A;  2F69 A;  5BW8 C;  3S7D A;  3M57 A;  3FUF A;  2GW1 A;  2FO1 E;  1QBQ A;  4N39 A;  3FUK A;  3URZ A;  1K1B A;  4O6F A;  2LXL A;  2WXH A;  4O1P A;  3M58 A;  1TJF A;  2VYI A;  5LCW J;  2FI7 A;  1H2V C;  1FVF A;  3CVV A;  3QKY A;  3HXE A;  4LNB A;  3VLE A;  3RJV A;  5HS0 A;  2A4Z A;  4J7F A;  1TEZ A;  1PEG A;  4U7E B;  3UM0 A;  1QYM A;  3EHM A;  5AQA A;  4W9R A;  3ENE A;  1QQE A;  2ZU6 B;  3B7B A;  3PE4 A;  4WNE A;  4DX7 D;  4IYP A;  2Y69 E;  4C0E A;  1OWP A;  4GMJ A;  4ZHB A;  4RSY A;  4CRW A;  4NRH B;  3L16 A;  2VGE A;  4K0R A;  4WNG A;  2HO1 A;  3ASD A;  4CGW A;  1JUQ A;  3VTY A;  2W5Z A;  4V3I A;  2QPW A;  3U9W A;  1N9A A;  2J9Q A;  3NOC D;  5AYW D;  2A5E A;  3QWV A;  3V31 A;  4L1B A;  2VTB B;  4G24 A;  2XHE A;  2X3M A;  3OXL A;  4ILG A;  4YNM A;  2QYJ A;  4BER A;  3D9O A;  5C1D A;  3EIQ C;  3LPZ A;  3DPD A;  3LS8 A;  1UJJ A;  2R59 A;  5EID A;  3VTX A;  4BY6 A;  3UM2 A;  3PNL B;  3B7T A;  5LCW C;  4M7C A;  5ANL A;  2VGX B;  2Y1L E;  3KS2 A;  3MX3 A;  1HZ4 A;  1ZBP A;  3DSU A;  3M5A A;  5TTF A;  2OEW A;  4U0S A;  5CCL A;  5IY5 E;  3V30 A;  1QZ2 A;  4E85 A;  3LEW A;  5EG2 A;  3DB5 A;  1HG2 A;  2ETB A;  5FJY A;  4DX5 D;  4UWH A;  4GML A;  3LY9 A;  4J7I A;  3DEO A;  2AXZ A;  4NAC A;  3ASH A;  3Q47 B;  4KZ0 A;  3UI2 A;  4FLH A;  2B6C A;  2EQX A;  2J4B A;  2IF4 A;  1X5B A;  2F0Y A;  2P9K G;  5FQ8 A;  4HOQ A;  4ME2 A;  4DPR A;  4G8K A;  2VSN A;  4GZ3 A;  4GA1 A;  4JA7 A;  3ULY A;  4GTR A;  5JHB A;  2RFI A;  2FF4 A;  4DX2 A;  1KZO A;  3EHR A;  3E30 A;  3SO8 A;  3FEY A;  5FQ4 A;  1MYO A;  5T0K A;  3ZN3 A;  5T8I A;  1UOH A;  3UTM A;  3M59 A;  2DIW A;  2P9S G;  3OTN A;  1IHB A;  2Q7F A;  3CHQ A;  5D2M C;  5AEN A;  3ABK E;  2ZGG A;  3ZNG A;  4GTO A;  1H2U A;  3AU4 A;  3TL5 A;  4UWF A;  4ILI A;  5CED B;  4DUI A;  3F9Y A;  4LCT A;  2J08 A;  3D9M A;  1TYQ G;  3APC A;  5TEG A;  4TXR A;  4HI8 A;  1OWL A;  4UQX A;  5A7D B;  5EIL A;  3TGO A;  3SWC A;  2XS8 A;  1UN9 A;  1BI8 B;  4Q96 A;  2JLB A;  1N11 A;  4LEU A;  4OAV B;  3X2Q E;  3CBO A;  4OAU C;  4B0Z A;  4LER A;  3UQ3 A;  1WAO 1;  3AG3 E;  4FJY A;  2WXI A;  5CRU A;  3RRM B;  3IBE A;  4JHJ A;  3QB2 A;  2WPV A;  3FP3 A;  3CSF A;  3HVE B;  3T9K A;  1OWM A;  2VSY A;  1EYH A;  1FT1 A;  3NF1 A;  1O1R A;  5JJ0 A;  2VSO E;  3JUI A;  3CK9 A;  1KT0 A;  3D9P A;  5FIO A;  3SY2 A;  3CKC A;  1LF8 A;  3FU6 A;  3MO2 A;  1YYH A;  3F9W A;  1V55 E;  1DCE A;  3KD7 A;  2IGQ A;  4G1T A;  5ENR D;  1W3B A;  1N4R A;  2V4H C;  3FTS A;  4JC8 A;  1MZC A;  1N52 A;  3BUA A;  3UIN C;  2GRQ B;  1E96 B;  1RW2 A;  4AVX A;  1K8K G;  2P9N G;  2ETA A;  3RU0 A;  1TR4 A;  3S7F A;  2PL2 A;  3DPY A;  4HBD A;  2JAB A;  2XRY A;  3CVP A;  1K1A A;  1NFI E;  2QYU A;  5BV0 A;  3LDZ A;  4J8S A;  3UM3 A;  4JXT A;  5FQ7 A;  1U2V G;  3FU3 A;  4M3O A;  2HM8 A;  5LSZ A;  2O8J A;  1IQR A;  4HRN A;  2DVW A;  4A3T A;  2ZIR A;  4QEO A;  1HX8 A;  3PRZ A;  3ABM E;  4N2S A;  3MKQ B;  4WWN A;  2P9P G;  3ASF A;  2WQ7 A;  3C98 A;  4PH4 B;  3FTX A;  4RG9 A;  2JV0 A;  2IFU A;  1S63 A;  5KJN A;  4U04 A;  3IXE A;  3UMV A;  3LKU A;  1OT8 A;  1LTX A;  3W9F A;  3D9N A;  2BED A;  3LXU X;  5KJL A;  3JXJ A;  3CK8 A;  3FU5 A;  2UY1 B;  2X6J A;  1OWO A;  1MHQ A;  4HS2 A;  2IO3 C;  4J6I A;  2RFA A;  3Q5M A;  3QDN A;  3FTU A;  1FCH A;  3IHY A;  3FUH A;  3QWP A;  2MRI A;  3CR3 A;  1ML9 A;  1HS6 A;  2CFZ A;  2ETC A;  3CHO A;  4JB8 P;  5T3R A;  1XQH A;  3SW9 A;  3KSQ A;  3C3Q A;  4TUU A;  3FY4 A;  3Q9U C;  1MX4 A;  3AS5 A;  2YHE A;  3B7U X;  4YND A;  3FEX A;  3FTY A;  3I4G A;  3O4Z A;  3M53 A;  4K5B A;  3PZ3 A;  3M54 A;  1DVP A;  3BU8 A;  3D9K A;  5HKP A;  3EP0 A;  4NIK A;  3R9A B;  3G2U A;  4YPA A;  4Y6W A;  3ASO E;  5T5G A;  5LSX A;  2XEE A;  5EYP F;  4BEP A;  4UUC A;  2P9L G;  3W9G A;  4MKT A;  2AW6 A;  4CDN A;  1SZ9 A;  4EZJ A;  4WND A;  3GYZ A;  1IQU A;  3L22 A;  5CMW A;  1HFA A;  5AAO A;  4G2V A;  1SQM A;  2AWI A;  4DLO A;  1A17 A;  2V5Q C;  5G2N A;  1HG5 A;  1ELK A;  1JPL A;  2PM6 A;  3G2S A;  4GTV A;  5G55 A;  4BT8 A;  2X6K A;  2L6J A;  1MQS A;  2RG8 A;  5ANR A;  2RD0 A;  3TAX A;  3IHV A;  4N3B A;  4GTS A;  1U3C A;  3DEP A;  4N5Q A;  2XRZ A;  5ENO D;  3UXG A;  3EUV A;  2VTB A;  3WXX A;  1TJC A;  1NA3 A;  3B7S A;  3L13 A;  3CHP A;  3HXD A;  3L54 A;  1WM5 A;  2KZT B;  5AQ7 A;  4JLG A;  4UI9 K;  2DBA A;  5D66 A;  3TG5 A;  4KVM A;  4BET A;  1JCR A;  5EKQ D;  2IEJ A;  1KLX A;  4GCO A;  5ARF A;  3JXI A;  2LSU A;  2VJ8 A;  2WMN A;  5FQ6 A;  1SVX A;  2VGX A;  2P2C P;  4DK5 A;  1N95 A;  3FTW A;  3TWS A;  1E8X A;  4QQI A;  1YMP A;  5F5E A;  1TN7 A;  3E4B A;  1JCQ A;  2X38 A;  2OEV A;  2KBX A;  2NYJ A;  2CFU A;  2WQ6 A;  3SGH A;  3C3R A;  5CPR B;  3CEQ A;  3RO2 A;  3KMJ A;  2WXR A;  2YQ8 A;  5CER B;  2PZI A;  3RSE G;  4JEH A;  3FUD A;  4GTQ A;  4CZ2 D;  4HVB A;  3UX4 A;  4FA6 A;  1O9S A;  4IUL A;  1UG3 A;  1HH8 A;  5G05 J;  4F1S A;  4WWO A;  2WXK A;  2DYR E;  4U0U A;  3RRN B;  3I5P A;  2CHX A;  2BF0 X;  5CRV A;  3MA5 A;  4YDY A;  2ION A;  2V5F A;  3RO3 A;  3PEV B;  3V2X A;  2Y0B G;  4A1S A;  2UWJ G;  4U95 D;  4I9E A;  1K3Z D;  2XCC A;  1WG0 A;  3CV0 A;  3VV0 A;  5E75 A;  4L2Y A;  2XQ0 A;  4HLE A;  4ILH B;  2XGO A;  3U4T A;  5JHA A;  5G04 C;  3LCA A;  4CGV A;  4HRL A;  3SFY A;  4HQD A;  3ZYM A;  2AXV A;  4FP7 A;  4XZ4 A;  3QNK A;  3T8M A;  3JQ0 A;  2XEV A;  4NUR A;  5FTP A;  3OPE A;  5JIN A;  3MCX A;  5HRY A;  2I6H A;  4GA0 A;  4BSX A;  1Z3X A;  3PZ4 A;  3ZFW A;  4GB9 A;  4XI9 A;  4B8A A;  1BLX B;  1H19 A;  4OVV A;  1ELW A;  4U07 A;  4UWG A;  2XS1 A;  3FUI A;  2L6B A;  4CDM A;  5G05 C;  4GU5 A;  4GYO A;  3UKR G;  5AYF A;  2QY7 A;  5KCM A;  3DSS A;  5ENP D;  4U8Y D;  3L82 A;  3APD A;  1E7V A;  4EZK A;  3CQC B;  4MS6 A;  4KVO A;  4HXI A;  5CCM A;  3ML9 A;  4I6G A;  3CVY A;  3I4R B;  2V4L A;  2DWZ A;  5KWD A;  3BEE A;  5BV1 A;  4FUL A;  3PUJ A;  1NA0 A;  5B1B E;  4MLP A;  3OS5 A;  4N5C A;  5CEA A;  4FAD A;  1JWF A;  5JJT A;  4BT9 A;  3SI5 A;  2FO7 A;  4BUP A;  2F8X K;  1OCZ E;  4H12 A;  3NQP A;  4RQI A;  3NBN B;  1OCO E;  1MX6 A;  3MJW A;  2KXP C;  2R2L A;  4LRZ A;  4YDO A;  3S7B A;  3HYM B;  4YVO A;  4AM9 A;  1N4Q A;  2WXQ A;  4GZ6 A;  4IN3 B;  1IYG A;  1AWC B;  4IRU A;  1IXV A;  1IKN D;  4K5A B;  4JDS A;  4PS8 A;  1NZN A;  4A1G A;  1MVH A;  1E8Z A;  4EBA A;  4I1O B;  4WAF A;  1SW6 A;  4ANW A;  1KT1 A;  2H6F A;  2LNI A;  5D0O D;  1SA5 A;  3RQ4 A;  2CG2 A;  3V79 K;  1WDY A;  2NSZ A;  5JHN A;  4KXK B;  2LAH A;  3LY8 A;  4GTT A;  4HNA D;  2LAI A;  4MRU A;  3KEZ A;  5ARG A;  3TWV A;  1N6A A;  4APF A;  1RZ4 A;  1OWN A;  2IOL A;  2YNQ A;  3RAU A;  5BPP A;  1TNY A;  2UY1 A;  2QZA A;  3TWW A;  3ZHE B;  4WNF A;  3LY7 A;  2I2O A;  3BQO A;  5FZR A;  3NAW A;  4LNU D;  1E8W A;  3D9H A;  3G2W A;  4H7Y A;  4C0M A;  3HDX A;  3ZXS A;  1JWG A;  2AVP A;  4G26 A;  2EIM E;  1TNB A;  1ZU2 A;  4PDX A;  3G2T A;  1NP7 A;  2BUG A;  3NB2 A;  4K5C A;  1S70 B;  3UPV A;  2WQH A;  2R05 A;  3JUE A;  4L7T A;  5EIB E;  3Q75 A;  4DI4 A;  4Q69 A;  3BG0 B;  4GZ5 A;  3SBT B;  1UN8 A;  4JPS A;  2ZGD A;  3I3N A;  2X6H A;  1MX2 A;  2GGF A;  1EF1 C;  4LUN U;  4TRQ A;  1FVH A;  1SA4 A;  3BG1 B;  5CBN A;  5BXU A;  3UIP C;  2YHC A;  2B0O E;  4JVS A;  4J8F A;  3SD5 A;  4YPE A;  3PVL A;  3PZ1 A;  3PZ2 A;  5B1A E;  1MT6 A;  3CKB A;  1BD8 A;  1N6C A;  4AIF A;  2V0P A;  3GW4 A;  1PC2 A;  4BWR A;  2OOE A;  1LD7 A;  2MOW A;  4WWP A;  3Q9N C;  3R7Q A;  3SFZ A;  3TXN A;  4E6H A;  2MYO A;  4FLB A;  2KCL A;  3SZ7 A;  4HOR A;  3QJZ A;  3N71 A;  3TWT A;  3L17 A;  4UQY A;  3OXF A;  4GYW A;  3HXF A;  4L2L A;  1V54 E;  3ZRH A;  4WUY A;  1HU3 A;  3GZ1 A;  3CHS A;  4HRM B;  4Y6C A;  3ONL A;  4B94 A;  2W5Y A;  5A6C A;  4B93 B;  4MI0 A;  3B95 A;  4J7W A;  5CBO A;  4OVU A;  1MJ0 A;  1PAQ A;  2LUH A;  4NJ5 A;  3UM1 A;  4HFG A;  1NL4 A;  3TWQ A;  4GA2 A;  3K9I A;  2HE0 A;  3QC1 A;  3CGH A;  2DZN A;  1KZP A;  2EIN E;  5KNH D;  5KJK A;  3L08 A;  3PRE A;  3QAQ A;  2IOS A;  3HG0 D;  2PQN A;  3B7R L;  2H6I A;  3SHF A;  1GW6 A;  3Q7A A;  4YDE A;  1LD8 A;  4ACL A;  2ILR A;  2IY0 C;  2Y4T A;  3MEK A;  1EDU A;  2PM7 A;  2M63 A;  4HOT A;  3Q73 A;  1PY1 A;  3E34 A;  4BSZ B;  3L6A A;  2J8S D;  3FTZ A;  3CVU A;  2J07 A;  1XGW A;  1Y6I A;  4XIF A;  2DZO A;  3S2A A;  1QNF A;  2QC9 A;  3MO5 A;  3CQG B;  2YIN A;  4HB5 A;  3E33 A;  4O1O A;  4RZ0 A;  1L5J A;  2WXG A;  4LDG A;  4G25 A;  3CBP A;  3FH8 A;  3AG2 E;  4Q94 A;  4XKC A;  5B3S E;  3MO0 A;  3MZL B;  2EIJ E;  5E76 A;  2IQC A;  3ZXP A;  3DSV A;  2NXP A;  3FUM A;  2XGS A;  5FIN A;  2H6G A;  4QEP A;  2KCK A;  4RVB A;  1FPP A;  5CMY A;  4UI9 J;  4UWK A;  2C0M A;  1OCR E;  3LJN A;  4TUM A;  3NZS A;  3Q78 A;  3UT8 A;  3CVX A;  4AY6 A;  4I2Z A;  3HXC A;  4RG6 A;  3FH7 A;  4EZL A;  3GZS A;  4ANU A;  3L9T A;  3QK0 A;  1H0A A;  2ZIS A;  1D8E A;  4K03 A;  4QFV A;  4JHK A;  1N3J A;  1ZB1 A;  1INZ A;  4BES A;  4KYO B;  5A23 A;  1U3D A;  3VLD A;  1OUV A;  3AS8 A;  5ENS D;  2XPZ A;  4QEN A;  3D9I A;  4JW1 A;  2XZT G;  1OCC E;  1S0P A;  3FTV A;  4I6E A;  1TN6 A;  3TG4 A;  2GRM A;  1N54 A;  3PS6 A;  4AXH A;  4FC8 A;  5BUZ A;  2LXM A;  2V8S E;  2WXP A;  4JA9 A;  5G04 J;  4CEM A;  4G11 A;  4N2Q A;  4AY5 A;  4HOU A;  1BPO A;  3MV2 B;  4GYY A;  3TXM A;  3C72 A;  3KAE A;  5KBA A;  5M72 A;  3DRA A;  2P58 C;  1A5E A;  3MYV A;  5CHE E;  4XX5 A;  2F37 A;  3ASG A;  5EN5 D;  3TWX A;  4UI9 C;  2Y4U A;  4URK A;  2XPI A;  4APO A;  4N3C A;  5H7P A;  3CVW A;  4FU3 A;  3JCK C;  3BO5 A;  3IHX A;  5FWQ A;  3E32 A;  3J5P A;  2JEK A;  3AG1 E;  2R17 C;  3U3W A;  3ZKJ A;  4GZD A;  2C2L A;  4MI5 A;  4TV3 A;  2BTD A;  3S7J A;  3FUL A;  4CT0 A;  5KNG A;  4EQF A;  3CVQ A;  3ZU7 B;  3RKV A;  5D0Q D;  1OXJ A;  1UW4 B;  3M56 A;  2J09 A;  3PUK A;  3HXB A;  1SZA A;  5J90 A;  3CVN A;  4JHR A;  4GCN A;  5FT9 A;  4F6R D;  3U64 A;  2G46 A;  1Q2Z A;  1BI7 B;  5TH7 A;  3ML8 A;  3ABL E;  3LJ3 A;  3MKR A;  2P9U G;  3UT4 A;  1H3I A;  1H6K A;  2EIL E;  5BNW A;  5AJL A;  2KAT A;  3R9M A;  2R03 A;  3ZW3 A;  4L9P A;  4ANV A;  2I1K A;  3RRU A;  2WXJ A;  4ABN A;  4A55 A;  3ULE G;  5JMN D;  2BQZ A;  3EJN A;  4UWL A;  5AIJ A;  3ZHE A;  4U8H A;  4A63 B;  3ZIM A;  5LP0 A;  4G8L A;  3CLJ A;  4I51 A;  1DCQ A;  2ZXW E;  4F3V A;  1WY6 A;  1N4P A;  2KM4 A;  4O60 A;  3MGB A;  4HOS A;  3HRA A;  4I2W A;  5HI7 A;  3RK6 A;  3CVL A;  3KMA A;  3AJI A;  1D9S A;  3OOI A;  3HVE A;  3FDH A;  1ZKK A;  4BFR A;  2XGM A;  4TXQ A;  2R02 A;  1O1S A;  2IU1 A;  4J83 A;  1N0Q A;  2WVI A;  3Q49 B;  4JL0 A;  4OYS A;  3CHM A;  4KZC A;  3LYA A;  3DSX A;  4O30 A;  3QWW A;  3ZGQ A;  3VUZ A;  1E90 A;  4XI0 A;  4EBA G;  5EYL A;  4J8O A;  2MHK A;  3DXK G;  3UIO C;  5CEC B;  3ZYK A;  3IV0 A;  3TWR A;  3V2O A;  2IJG X;  3PDN A;  1Z3Y A;  4PS7 A;  4YVQ C;  3CBM A;  5C2Y A;  3ONK A;  2IO2 C;  4CCA A;  4FJZ A;  1P5Q A;  4LG6 A;  3JYS A;  3PZD A;  2OND A;  2RFM A;  5AN8 A;  3C3O A;  1N4S A;  4AV7 A;  3LVR E;  2WB2 A;  2FUL A;  5ITZ F;  4B8C B;  2VSX E;  4U8V D;  1HE8 A;  4P29 A;  3UKU G;  3MKQ A;  2XEH A;  4ATG A;  2GRO B;  3ESL A;  4CYM D;  4GTP A;  3FFL A;  3QAR A;  4ATZ D;  4FHK A;  5EX3 A;  2GRR B;  1N0R A;  2KCV A;  3WG7 E;  3KMT A;  4DJA A;  2AXU A;  5JJ6 A;  1O5M A;  2VQ2 A;  3NZU A;  3PE3 A;  3AAA C;  3B13 A;  2DYS E;  2WXO A;  3EHQ A;  4IJ8 A;  1TNZ A;  5FZS A;  4GAA A;  4F1P A;  5AJD A;  3ZYQ A;  1X81 A;  2FEZ A;  4EEC A;  4JEU A;  3GZ2 A;  4KT6 B;  3UUX A;  3F9Z A;  2E0I A;  3T8K A;  2GRP B;  5DIZ A;  5ENT D;  4EHM A;  4IJD A;  4J0U A;  5BT1 A;  4HLL A;  2XCB A;  4J8D A; 
#chains in the Genus database with same CATH homology
 1IHG A;  3B7T A;  2PM7 A;  2M63 A;  4HOT A;  3FTW A;  5LCW C;  1PY1 A;  4AOF A;  3FPD A;  3L6A A;  5ANL A;  3FTZ A;  4E47 A;  3CVU A;  1E8X A;  2J07 A;  2J49 A;  3FHE A;  1XGW A;  2VGX B;  3MX3 A;  3KS2 A;  1Y6I A;  2OVF A;  1HZ4 A;  1ZBP A;  4XIF A;  3M5A A;  2PQR A;  4NQ0 A;  5F5E A;  3S2A A;  3E4B A;  5TTF A;  3CIA A;  2X38 A;  1QNF A;  2KC7 A;  4U0S A;  2CFU A;  2WQ6 A;  5CCL A;  1QZ2 A;  4E85 A;  3SGH A;  3OAW A;  3LEW A;  3MO5 A;  5CPR B;  5EG2 A;  3CQG B;  3DB5 A;  1MVX A;  3CEQ A;  1HG2 A;  2LO6 A;  3RO2 A;  3KMJ A;  2WXR A;  2YIN A;  2YQ8 A;  3FUN A;  2PZI A;  5FJY A;  4RZ0 A;  4UWH A;  4GML A;  3LY9 A;  4JEH A;  4J7I A;  1L5J A;  3FUD A;  4I6J A;  2AXZ A;  2WXG A;  4LDG A;  4NAC A;  4HVB A;  3ASH A;  3Q47 B;  4KZ0 A;  4I43 A;  4G25 A;  3UX4 A;  3CBP A;  4FA6 A;  3FH8 A;  4FLH A;  2LSV A;  1O9S A;  4Q94 A;  4IUL A;  4XKC A;  1UG3 A;  3MO0 A;  2EQX A;  2J4B A;  2IF4 A;  1HH8 A;  3MZL B;  1X5B A;  5G05 J;  4DI3 A;  5E76 A;  4F1S A;  4WWO A;  3DBS A;  2IQC A;  5KJM A;  4AJW A;  5FQ8 A;  3P1U A;  4HOQ A;  4ME2 A;  2NXP A;  2WXK A;  3FUM A;  2XGS A;  4DPR A;  2VSN A;  1YA0 A;  4QEP A;  4U0U A;  3ULQ A;  2KCK A;  4GZ3 A;  1E8Y A;  4RVB A;  5FZQ A;  3RRN B;  4GA1 A;  3I5P A;  2CHX A;  3ESK A;  2BF0 X;  4JA7 A;  2I1J A;  3ZYL A;  5T0M A;  1H2T C;  3MA5 A;  3ZPJ A;  2L0I A;  5JHB A;  2RFI A;  2FF4 A;  2ION A;  2V5F A;  3RO3 A;  3PEV B;  5CMY A;  4UI9 J;  4UWK A;  4A1S A;  2UWJ G;  4I9E A;  2C0M A;  3FEY A;  5FQ4 A;  2XPY A;  2XCC A;  3EDT B;  3NZS A;  5T0K A;  4BX9 A;  3ZN3 A;  2X6F A;  3UT8 A;  3CVX A;  5T8I A;  4AY6 A;  3CV0 A;  3VV0 A;  4I2Z A;  5E75 A;  4RG6 A;  4L2Y A;  3AS4 A;  2XQ0 A;  3D3M A;  3FH7 A;  3JQ1 A;  4EZL A;  4HLE A;  4U0Z A;  3GZS A;  4ILH B;  4ANU A;  3F9X A;  2XGO A;  2CHZ A;  2DIW A;  3M59 A;  3QK0 A;  4KMO A;  1H0A A;  4DLQ A;  3U4T A;  3MEK A;  3OTN A;  5G04 C;  5JHA A;  3LCA A;  4CGV A;  3T5X A;  3D9J A;  1HF8 A;  3FU0 A;  2Q7F A;  3CHQ A;  1HO8 A;  5AEN A;  1HXI A;  3FUJ A;  4K03 A;  4BTA A;  3ZYM A;  2WXF A;  2KZT A;  4QFV A;  4JHK A;  5EX0 A;  1H2U A;  2AXV A;  3AU4 A;  4FP7 A;  4R7L A;  3QNK A;  4XZ4 A;  4EPZ A;  3T8M A;  3JQ0 A;  1INZ A;  1N3J A;  2XEV A;  4KYO B;  5A23 A;  4NUR A;  1U3D A;  3PEU B;  4UWF A;  3TL5 A;  3VLD A;  5FTP A;  1OUV A;  3OPE A;  4ILI A;  3AS8 A;  5JIN A;  4UQZ A;  2XPZ A;  3MCX A;  3LVQ E;  4QEN A;  3D9I A;  4JW1 A;  2FBN A;  3RAY A;  2I6H A;  4GA0 A;  3F9Y A;  4LCT A;  1S0P A;  3FTV A;  2J08 A;  3D9M A;  5ENN A;  4I6E A;  1Z3X A;  4BSX A;  3APC A;  2OVB A;  4GZC A;  3SBS A;  3TG4 A;  3T5V A;  5TEG A;  3ZFW A;  4C1Q A;  2GRM A;  1Z6T A;  4GB9 A;  1N54 A;  4XI9 A;  1OWL A;  3PS6 A;  4UQX A;  3VLF A;  2WMO A;  5A7D B;  4AXH A;  4Z4P A;  4B8A A;  4FC8 A;  3TGO A;  3SWC A;  5BUZ A;  1Y8M A;  1MUF A;  2V8S E;  1H19 A;  4OVV A;  1UN9 A;  4Q96 A;  2WXP A;  2JLB A;  1ELW A;  4LEU A;  4U07 A;  4JA9 A;  4UWG A;  5G04 J;  3FUI A;  4CEM A;  4F7A A;  4G11 A;  5HQ8 A;  4G23 A;  2QFC A;  4N2Q A;  3CBO A;  4AY5 A;  4B0Z A;  4HOU A;  4LER A;  3UQ3 A;  4CDM A;  1BPO A;  1WAO 1;  3MV2 B;  4GYY A;  4FJY A;  5G05 C;  3TXM A;  2WXI A;  4GU5 A;  4GYO A;  2L0T B;  5LOZ A;  5JIY A;  1B89 A;  3KAE A;  3SNX A;  5M72 A;  3Q4A B;  4N3A A;  2QY7 A;  3RRM B;  5AYF A;  5KCM A;  5EDS A;  2GRL A;  3IBE A;  4JHJ A;  3APD A;  2P58 C;  1E7V A;  4EZK A;  3QB2 A;  3MYV A;  2WPV A;  3FP3 A;  3CSF A;  2WXL A;  4F53 A;  3CQC B;  5LX8 A;  4MS6 A;  3K5K A;  4KVO A;  4HXI A;  3HVE B;  5CCM A;  5CHE E;  3ML9 A;  4XX5 A;  1OWM A;  5F6L A;  4I6G A;  3ASG A;  4YNP A;  3CVY A;  2VSY A;  3FWV A;  3I4R B;  2V4L A;  1EYH A;  4UI9 C;  3NF1 A;  2Y4U A;  5JJ0 A;  4URK A;  3BEE A;  2VSO E;  3JUI A;  3CK9 A;  1KT0 A;  2DCP A;  3D9P A;  3S8P A;  2XPI A;  2HYZ A;  5BV1 A;  4FUL A;  4APO A;  3CKC A;  3PUJ A;  1LF8 A;  3FU6 A;  4N3C A;  4ACK A;  1NA0 A;  2E2E A;  3JCK C;  4FU3 A;  3R7R A;  3CVW A;  3BO5 A;  3OS5 A;  4MLP A;  3MO2 A;  3F9W A;  4N5C A;  3IHX A;  5FWQ A;  3KD7 A;  4I1M A;  4PUC A;  2IGQ A;  2JEK A;  4FAD A;  2R17 C;  4G1T A;  3U3W A;  3M55 A;  1W3B A;  1XNF A;  4GZD A;  1JWF A;  5JJT A;  3Q15 A;  4BT9 A;  3FTS A;  3P2B A;  4JC8 A;  2C2L A;  2Y3A A;  1N52 A;  3SI5 A;  4FMU A;  4MI5 A;  4TV3 A;  4XKB A;  2BTD A;  2FO7 A;  3OXG A;  4YPU A;  3S7J A;  3IEG A;  3FUL A;  1E96 B;  4BUP A;  3PNT B;  4AVX A;  2A5U A;  4I17 A;  4H12 A;  4CT0 A;  3RU0 A;  4CDR A;  3NQP A;  2OV8 A;  3G2V A;  4EQF A;  3CVQ A;  3S7F A;  2PL2 A;  3MJW A;  5J08 A;  3FUE A;  3RKV A;  2XRY A;  5D0Q D;  3CVP A;  4LRZ A;  1UW4 B;  5JJ7 A;  3S7B A;  3M56 A;  3HYM B;  2J09 A;  3EHN A;  4YVO A;  4CT4 A;  4AM9 A;  3PUK A;  3ZVV A;  5BV0 A;  2WXQ A;  1SZA A;  4GZ6 A;  3LDZ A;  4IN3 B;  1IYG A;  5J90 A;  3CVN A;  4AEZ C;  4JHR A;  4IRU A;  4GCN A;  4J8S A;  4JXT A;  5FT9 A;  4JDS A;  4PS8 A;  3U64 A;  5FQ7 A;  2G46 A;  3UT7 A;  1NZN A;  4A1G A;  1MVH A;  4GPK A;  1E8Z A;  5TH7 A;  3ML8 A;  4EBA A;  4I1O B;  4WAF A;  3LJ3 A;  4ANW A;  3FH5 A;  1KT1 A;  3FU3 A;  3MKR A;  2HR2 A;  2WXM A;  2HM8 A;  4M3O A;  3UT4 A;  1H3I A;  2O8J A;  5LSZ A;  1H6K A;  3RIB A;  4PS3 A;  5F6K C;  4JZY A;  1IQR A;  3RJW A;  2LNI A;  3O48 A;  4XE0 A;  5LFA A;  5BNW A;  4A3T A;  3HNA A;  5D0O D;  2R3A A;  3CK7 A;  3RQ4 A;  4QEO A;  1HX8 A;  3PRZ A;  2CG2 A;  4N2S A;  5AJL A;  3IKO B;  2KAT A;  2NC9 A;  3MKQ B;  4WWN A;  3ZW3 A;  3ASF A;  2NSZ A;  4ANV A;  2I1K A;  2WM9 A;  2WQ7 A;  5JHN A;  4KXK B;  3C98 A;  4PH4 B;  3RRU A;  2WXJ A;  4ABN A;  4A55 A;  3FTX A;  2LAH A;  2J4D A;  3CHR A;  2CHW A;  3LY8 A;  3U66 A;  4RG9 A;  2BQZ A;  2JV0 A;  5T4Y A;  2IFU A;  3EJN A;  3HHM A;  4UWL A;  5AIJ A;  5KJN A;  4U04 A;  2LAI A;  3ZHE A;  4MRU A;  4U8H A;  3KEZ A;  5ARG A;  1N6A A;  4APF A;  4A3V A;  2L9B A;  1E7U A;  1OWN A;  4I1A A;  2IOL A;  3UMV A;  3LKU A;  3ZIM A;  2YNQ A;  5BPP A;  5LP0 A;  2UY1 A;  3AU5 A;  3CLJ A;  4NVQ A;  4I51 A;  1VDY A;  3ZHE B;  3DAL A;  3D9N A;  4F3V A;  1EPU A;  1WY6 A;  3LXU X;  4WNF A;  2KM4 A;  5KJL A;  3LY7 A;  2I2O A;  3MGB A;  3VUZ A;  4HOS A;  5FZR A;  3CK8 A;  3FU5 A;  4I2W A;  3TJP A;  1E8W A;  2UY1 B;  3CST A;  3MV3 B;  3APF A;  5HI7 A;  3RK6 A;  3ZEF A;  2X6J A;  4H7X A;  3CVL A;  2R5S A;  2VGY A;  3G2W A;  3HDX A;  4H7Y A;  3ZXS A;  1OWO A;  3HIZ A;  4C0M A;  3KMA A;  1JWG A;  4B89 A;  1MHQ A;  2AVP A;  4HS2 A;  4G26 A;  3OOI A;  4J6I A;  3HVE A;  3FDH A;  4C9B B;  1ZU2 A;  4AP2 A;  3Q5M A;  1ZKK A;  4BFR A;  2XGM A;  1UJK A;  4J8E A;  4ANX A;  4PDX A;  5F59 A;  4BTB A;  4BX8 A;  3QDN A;  3G2T A;  3EIJ A;  3FTU A;  1FCH A;  1NP7 A;  2BUG A;  3IHY A;  3FUH A;  3QWP A;  1DNP A;  2IU1 A;  2MRI A;  3UPV A;  2WQH A;  2X6I A;  3CR3 A;  3PH0 C;  4L7T A;  4J83 A;  4I9C A;  1ELR A;  1ML9 A;  4DI4 A;  1HS6 A;  4Q69 A;  3BG0 B;  4KBQ A;  2CFZ A;  4FHJ A;  2WXN A;  4GZ5 A;  2WVI A;  4U63 A;  3CHO A;  3Q49 B;  2I9C A;  3QOU A;  4JL0 A;  4OYS A;  5T3R A;  1XQH A;  3CHM A;  4KZC A;  3SBT B;  3SW9 A;  1UN8 A;  3LYA A;  2C0L A;  4JPS A;  4TUU A;  3I3N A;  2CG3 A;  2GGF A;  2X6H A;  3FY4 A;  4O30 A;  3QWW A;  1EF1 C;  4D10 C;  4LUN U;  3ZGQ A;  3AS5 A;  2YHE A;  5DBK A;  3B7U X;  3FTY A;  3FEX A;  1E90 A;  4L23 A;  1FVH A;  3D9L A;  4TRQ A;  4XI0 A;  4YND A;  2MHK A;  4EBA G;  4J8O A;  3SF4 A;  3BG1 B;  4AU7 A;  3I4G A;  3ZYK A;  3O4Z A;  3IV0 A;  3M53 A;  2F69 A;  3M54 A;  1DVP A;  3D9K A;  5BW8 C;  2YHC A;  3S7D A;  3M57 A;  3EP0 A;  3FUF A;  2IJG X;  2GW1 A;  3PDN A;  4JVS A;  4J8F A;  3SD5 A;  4YPE A;  3R9A B;  1Z3Y A;  3PVL A;  4N39 A;  3G2U A;  4YPA A;  3FUK A;  3URZ A;  1MT6 A;  3CKB A;  4Y6W A;  4O6F A;  2WXH A;  5T5G A;  4PS7 A;  1N6C A;  4YVQ C;  3CBM A;  5C2Y A;  3M58 A;  5LSX A;  1TJF A;  3ONK A;  4AIF A;  2VYI A;  4CCA A;  5LCW J;  4FJZ A;  2FI7 A;  1P5Q A;  1H2V C;  2V0P A;  3JYS A;  3GW4 A;  1FVF A;  3PZD A;  3CVV A;  2OND A;  1PC2 A;  4BWR A;  2OOE A;  2MOW A;  3QKY A;  4WWP A;  3VLE A;  3RJV A;  3R7Q A;  3SFZ A;  3TXN A;  2A4Z A;  4E6H A;  4J7F A;  4MKT A;  2AW6 A;  1TEZ A;  1PEG A;  4CDN A;  1SZ9 A;  4AV7 A;  4WND A;  4EZJ A;  3LVR E;  4FLB A;  2WB2 A;  2FUL A;  2KCL A;  3GYZ A;  1IQU A;  3SZ7 A;  4HOR A;  3QJZ A;  4B8C B;  2VSX E;  3EHM A;  3L22 A;  1HE8 A;  3N71 A;  4P29 A;  3L17 A;  1HFA A;  5CMW A;  4W9R A;  4UQY A;  3ENE A;  3MKQ A;  1QQE A;  2ZU6 B;  3PE4 A;  4WNE A;  4IYP A;  3OXF A;  4ATG A;  4G2V A;  4GYW A;  1SQM A;  2AWI A;  4L2L A;  4C0E A;  3ZRH A;  1OWP A;  3ESL A;  4GMJ A;  4DLO A;  1A17 A;  4WUY A;  1HU3 A;  3GZ1 A;  3FFL A;  3CHS A;  4Y6C A;  4RSY A;  3ONL A;  3QAR A;  4B94 A;  5G2N A;  2W5Y A;  4CRW A;  4NRH B;  3L16 A;  1HG5 A;  1ELK A;  1JPL A;  2PM6 A;  3G2S A;  4FHK A;  4K0R A;  5G55 A;  5A6C A;  4MI0 A;  4WNG A;  4BT8 A;  2X6K A;  2L6J A;  2HO1 A;  5EX3 A;  1MQS A;  2RG8 A;  5ANR A;  2RD0 A;  2KCV A;  4OVU A;  3TAX A;  3ASD A;  3IHV A;  4N3B A;  4CGW A;  3KMT A;  4DJA A;  1U3C A;  2AXU A;  1JUQ A;  5JJ6 A;  2XRZ A;  1PAQ A;  4NJ5 A;  2VQ2 A;  3NZU A;  3PE3 A;  3VTY A;  2W5Z A;  3B13 A;  4HFG A;  4V3I A;  2VTB A;  3WXX A;  2QPW A;  2WXO A;  1TJC A;  3U9W A;  4IJ8 A;  1NA3 A;  2J9Q A;  5FZS A;  3B7S A;  5AYW D;  4GA2 A;  3K9I A;  3L13 A;  3QWV A;  3CHP A;  4GAA A;  4L1B A;  3L54 A;  3QC1 A;  1WM5 A;  2KZT B;  3CGH A;  2VTB B;  4G24 A;  4JLG A;  2XHE A;  4UI9 K;  2X3M A;  5AJD A;  2DBA A;  3ZYQ A;  3OXL A;  3TG5 A;  4KVM A;  2FEZ A;  4ILG A;  3L08 A;  5KJK A;  4YNM A;  3PRE A;  3QAQ A;  4EEC A;  2IOS A;  4JEU A;  3GZ2 A;  5EKQ D;  4KT6 B;  2PQN A;  3UUX A;  3D9O A;  1KLX A;  3F9Z A;  5C1D A;  3B7R L;  2E0I A;  3EIQ C;  4GCO A;  3SHF A;  1GW6 A;  3LPZ A;  3DPD A;  3LS8 A;  1UJJ A;  5DIZ A;  2R59 A;  5ARF A;  4ACL A;  4IJD A;  2LSU A;  2ILR A;  4J0U A;  2VJ8 A;  3VTX A;  5BT1 A;  2Y4T A;  2WMN A;  2XCB A;  5FQ6 A;  4BY6 A;  2VGX A;  4J8D A;  4DK5 A;  1EDU A;  3PNL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...