3S7DA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
b'GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 150
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7dA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7dA01
4APOA 4HOUA 3FFLA 5T0KA 1ELWA 4XIFA 2QFCA 2FO7A 3CK9A 5CCLA 1MVXA 3RKVA 2XGOA 2FEZA 4KXKB 1NA3A 3LY8A 4U04A 1ELRA 3TGOA 3S7BA 5F59A 4Y6WA 3OXGA 4G24A 3S7FA 3RIBA 5T5GA 4BTAA 5F6LA 4WNEA 3Q4AB 4XI0A 5FJYA 4Y6CA 4JLGA 5A7DB 3RJWA 4J8EA 2O8JA 5FZQA 3M54A 3RO2A 3Q47B 4BT8A 4I9EA 2FF4A 4IN3B 4UI9C 2XPIA 4QEOA 4N2SA 5JIYA 3CBOA 5G05J 4GA2A 3S8PA 2KCLA 3TG5A 4XI9A 5TEGA 3QWWA 4I9CA 4G2VA 3M57A 1HZ4A 3FWVA 4JA9A 2WQHA 4GCOA 3PE3A 5ARGA 3K9IA 3AS8A 2KATA 3SZ7A 2AVPA 1NA0A 1YA0A 2VGXA 2FI7A 3CVNA 4I17A 4N3BA 5TTFA 1NZNA 3CVQA 4B94A 5KJLA 4GZ5A 2XCBA 3ZPJA 1A17A 3SF4A 5LCWC 4H7XA 5FT9A 4AY5A 3MEKA 4I2WA 2MHKA 4GCNA 4NRHB 5G04C 3LYAA 4J83A 3CK7A 2KCVA 3K5KA 4QEPA 4ABNA 2P58C 4I1AA 3OS5A 5DIZA 4CGVA 3Q15A 4UI9J 2PL2A 3AS4A 5CCMA 4RG9A 4GA1A 4N39A 3DB5A 3U4TA 2UY1B 3KD7A 4YPEA 4G25A 2DBAA 4U0SA 4U0UA 2F69A 4I51A 4J8FA 4GYOA 5KJNA 2VGXB 3MO2A 1IHGA 3CV0A 1ML9A 3OOIA 4LDGA 4HOQA 2C0MA 3CBPA 3ZFWA 2W5ZA 4AM9A 5JJ7A 3AS5A 4O30A 3LPZA 3S7DA 4EQFA 4WNDA 3ZGQA 2XGMA 4HOSA 3KS2A 2R3AA 4U07A 4H12A 5KJKA 5F6KC 5LCWJ 4GPKA 5F5EA 4CDRA 2WPVA 3MO0A 2C2LA 5G04J 3SW9A 4J0UA 3M5AA 4GYYA 3FPDA 2LSVA 4YVQC 4C1QA 3HYMB 3MV3B 5D0OD 3GZ1A 5AYWD 4N2QA 3GZ2A 3S7JA 3GW4A 1HH8A 4HOTA 2Y4UA 1P5QA 2HO1A 1ZKKA 1TJCA 3KMJA 1MVHA 2PQRA 2YQ8A 3BEEA 2PQNA 1WAO1 2I6HA 3HNAA 4MI0A 2IFUA 4UQYA 1H3IA 3UPVA 3CEQA 5D0QD 1XQHA 3ASFA 3E4BA 2VYIA 4BTBA 2IGQA 4FMUA 2UY1A 4IJDA 2RFIA 4A1SA 3LY9A 3GYZA 5FZSA 1QQEA 2HYZA 3ASDA 3PE4A 3TAXA 3KMTA 3CBMA 3VUZA 5BNWA 5A6CA 4J7FA 2J9QA 4KYOB 5KJMA 1KLXA 4YNPA 3QOUA 5CHEE 4NJ5A 4GYWA 3EP0A 2OOEA 4KBQA 1KT1A 5JINA 2NC9A 3Q49B 3RU0A 1PC2A 2JV0A 5DBKA 3RJVA 4N5CA 3OXLA 2VSYA 3ASHA 3FP3A 2LNIA 4BWRA 3DALA 3MV2B 2Q7FA 2QPWA 4UI9K 4YNDA 3M55A 4AIFA 3ASGA 2V5FA 5FZRA 2ONDA 3LKUA 4JL0A 5FTPA 5HQ8A 2R5SA 5JJTA 2XEVA 5EKQD 1IYGA 1XNFA 4O6FA 2LSUA 3F9XA 4YPUA 1ZBPA 4RZ0A 3CVLA 4BUPA 3CKCA 2E2EA 2VSNA 3MA5A 3RO3A 4YVOA 3Q5MA 3URZA 4RG6A 3OXFA 3OPEA 3QKYA 5M72A 4WUYA 5EX3A 5G05C 2BQZA 2HR2A 4J8DA 3EDTB 4NVQA 3WXXA 3JYSA 2VQ2A 1N6CA 5LSXA 1N6AA 4N3AA 1MT6A 4JDSA 4G26A 3LCAA 2XCCA 1W3BA 5LSZA 5HI7A 4YNMA 3M53A 1PEGA 1O9SA 5CPRB 1N3JA 3CK8A 4H7YA 3IHXA 3VV0A 1KT0A 3UQ3A 3ZHEB 4ME2A 1Y8MA 2GW1A 1E96B 1WM5A 3CKBA 2C0LA 1OUVA 5T0MA 3F9WA 3VTXA 4YPAA 3PDNA 4JHRA 4WNFA 4J7IA 2L6JA 4GZ6A 2Y4TA 4MI5A 3M58A 4QENA 2VGYA 3CVPA 4G23A 3IEGA 1HXIA 4NQ0A 5TH7A 5ARFA 2BUGA 5AYFA 3M59A 5EG2A 4JA7A 3MO5A 5EX0A 2FBNA 5JJ6A 3R9AB 4BT9A 3KMAA 3ZN3A 3N71A 4W9RA 2JLBA 5BT1A 3QWPA 1MUFA 5C1DA 3F9YA 1FCHA 3NF1A 1B89A 2W5YA 2UWJG 2YHCA 4AU7A 1QZ2A 4N3CA 2KCKA 3KAEA 3VTYA 3ESKA 4CGWA 3QWVA 1ZU2A 3RAYA 4U0ZA 3U3WA 3BO5A 4J8OA 3F9ZA 4UQZA 4G1TA 4WNGA 3UUXA 3ZHEA 4UQXA 3LY7A 4GZ3A 4AY6A 2PZIA 4HORA 2XGSA 5JHNA 4F3VA 4I2ZA 2IF4A 4GA0A 2KC7A 4E47A 3SWCA 3ULQA 4IJ8A 3RQ4A 3TG4A 3O48A 5BW8C 2G46A 3MKRA 3QDNA 5JJ0A 4LEUA 4Z4PA 3M56A
chains in the Genus database with same CATH superfamily
1OWNA 4APOA 3WG7E 4GTMA 4JVSA 3MZLB 3CHOA 5T0KA 4YDEA 2GRNB 5CBNA 5FWQA 2FEZA 3PZ2A 1SZAA 1SZ9A 3W9GA 2P9UG 1TN8A 4GU5A 5T5GA 5FJYA 5CMYA 4PH4B 4Y6CA 3TWUA 2NSZA 4EZLA 3QB2A 2A5UA 3RJWA 4M3OA 5FZQA 3L22A 3M54A 1SQMA 3FUNA 2XRZA 1FVFA 3T8KA 3CBOA 3EIQC 2I1JA 3HHMA 3LXUX 1IQRA 3TG5A 3ABLE 4JEHA 5TEGA 3FH8A 4LNGA 3QWWA 3B13A 4PDXA 4D10C 4ILIA 3M57A 1HZ4A 3SBTB 4TRQA 4JA9A 2WQHA 4GAAA 3MCXA 3FEXA 5AARA 4HI9A 3ABKE 1S63A 2EILE 1YA0A 3DSTA 3TWTA 3LVRE 3B7SA 3PZ3A 4I6GA 4B94A 5KJLA 4E6HA 4Z68A 1OY3D 2XCBA 3SGHA 1A17A 3SF4A 3UI2A 5FT9A 5LP0A 2VJ8A 4Q96A 4GCNA 1OCRE 5EILA 3PRZA 3CK7A 2DWZA 4CRWA 5BV0A 3IBEA 1D9SA 2EQXA 1YMPA 1VDYA 3PS6A 4J8YA 4A3TA 5ENRD 4GTTA 1OT8A 4UI9J 2PL2A 5CCMA 4GA1A 1FPPA 4C48B 3S2AA 4IYPA 2I2OA 3FDHA 5ENNA 4QFVA 2DBAA 4U0UA 3IHYA 4I51A 4DX1A 2WXQA 4HQDA 1HU3A 2VGXB 4LDGA 1S64A 1YCSB 3FU5A 2C0MA 3QJZA 3CBPA 5AJDA 3ZFWA 3AS5A 5CEDB 4WNDA 3ZGQA 1Y6IA 3KS2A 2R3AA 4O1PA 1TN7A 4LERA 5F5EA 4FHKA 4URKA 3ULEG 1H2UA 3M5AA 5LX8A 3FPDA 1EF1C 3FEYA 2H6IA 3ZRHA 3UMVA 3S7JA 1D8DA 3GW4A 2VTBB 1P5QA 2HO1A 4DJAA 2EIME 2GGFA 3ASOE 1HE8A 2PQRA 2PQNA 5A23A 2I6HA 4MI0A 1H3IA 1FT1A 2IQCA 1V54E 3I4RB 4UWGA 2ZIRA 3NZSA 3Q7AA 1L5JA 4N5QA 3LY9A 3GYZA 1QBQA 4OAVB 5FZSA 1QQEA 3TAXA 5AQAA 1JCRA 3VUZA 2BF0X 3QNKA 3FTYA 5JHAA 3FUEA 3E37A 2I1KA 5KJMA 1KLXA 3FU0A 5CHEE 4NJ5A 4GYWA 3ONKA 3EP0A 4M7CA 4IRUA 2IO3C 5JINA 1AWCB 4NURA 3CQCB 4EBAG 2MYOA 1DVPA 2JV0A 4JPSA 2R2LA 4N5CA 3FUIA 3ASHA 3FP3A 4BWRA 1NL4A 1HX8A 3Q9UC 3MV2B 3NB2A 1MX6A 2QPWA 3D9HA 3FTUA 3L9TA 5HS0A 1TNOA 2VTBA 3ASGA 3FH7A 4OAUC 2WQ7A 2FULA 2RD0A 4DX6D 3RRMB 3LKUA 3DEOA 1TR4A 3I4GA 3TWQA 4CT0A 1N4PA 5JJTA 4ATZD 5EKQD 3R7RA 4CT4A 1IYGA 1NP7A 5ENTD 3CKCA 4ANWA 3MA5A 3RO3A 2EINE 4YVOA 2P9NG 1TJFA 3RK6A 2HR2A 2X38A 5LSXA 1MX4A 3V2XA 2DYSE 4JDSA 4G26A 3SNXA 1PAQA 5LSZA 4L2YA 3UKRG 4DX2A 3FTWA 3JXJA 3CK8A 5LOZA 1LD8A 1UOHA 3ZHEB 1Y8MA 3GZSA 3CKBA 3J5QB 2C0LA 1OUVA 2ETCA 4BY6A 4EECA 3HXEA 4FU3A 2VGEA 3DSUA 3PDNA 3LEWA 2BEDA 5KBAA 3MKQB 1WY6A 2WM9A 3C5RA 4DPRA 3HIZA 3IEGA 3RRNB 2DZOA 3G2WA 3FUJA 3V30A 4NIKA 2JEKA 4RSYA 3ABME 3V79K 4FULA 1S70B 5EYLA 4F1PA 3DBSA 3FUDA 4LNUD 4L2LA 2E0IA 3N71A 2JLBA 2MRIA 2ZGGA 3D9JA 3NF1A 5G2NA 1E7UA 3ZYQA 4BX9A 2UWJG 5AENA 4AU7A 2KM4A 2XHEA 1E8YA 3ESKA 3VTYA 3SO8A 3HVEB 4CDNA 3SD5A 5BV1A 3ZW3A 3F9ZA 1UJJA 1N4QA 1Z3XA 2I9CA 1O1SA 3UUXA 3ZHEA 3CQGB 4AY6A 4L23A 4HXIA 3JXIA 3NOCD 1MYOA 2V8SE 4GA0A 2R03A 2KC7A 4E47A 5CEAA 3UIOC 3SWCA 3ULQA 3MKQA 2XENA 2GRLA 5BW8C 3MKRA 3J5PA 5HRYA 3M56A 4B8CB 2A4ZA 2QZAA 5AN8A 3NZUA 3Q75A 3EHMA 2R05A 4Q69A 2VSXE 3PREA 4HI8A 4XIFA 2FO7A 3CK9A 4XZ4A 3Q7FA 5EYPF 1OWLA 3EJNA 1NA3A 4J6IA 4U95D 5F59A 3S7FA 3RIBA 4KMOA 5B1BE 5CERB 4PS3A 3HVEA 3TJPA 3VLDA 4BSZB 4J8EA 4DUIA 5G55A 1YYHA 4HVBA 3Q47B 4BT8A 3SHFA 4JZYA 3ZYMA 2FF4A 2R17C 2AW6A 2WXJA 4U8YD 4QEOA 4RVBA 2AWIA 4N2SA 1N11A 1HS6A 1BD8A 5G05J 2GRRB 2KCLA 2V0PA 1QNFA 4I9CA 2A5EA 1H19A 2P9KG 4G2VA 3UIPC 4HBDA 3SFXA 5ARGA 4K03A 2IOSA 2KATA 4XKBA 4ANVA 1NZNA 3CVQA 4GZ5A 1U3CA 3PUJA 2IOLA 4H7XA 2Y69E 2WXKA 2MHKA 2WXIA 5EIBE 2F37A 5G04C 5BXOA 1ELKA 4J83A 4I1AA 3UM1A 3OS5A 4DRXE 1BI8B 3CGHA 2X6KA 3FUFA 4PS7A 1H2VC 3AS4A 2WXPA 2F8XK 2QY7A 2WXFA 3DB5A 3U4TA 4AJWA 2XS1A 2GRPB 1OXJA 4U0SA 2F69A 4ATGA 3EHQA 4J8FA 3TWRA 3FU6A 3UM3A 3L54A 4UWLA 3T8MA 4IULA 2YNQA 1ML9A 4GTSA 3AG4E 3FTXA 2W5ZA 5JJ7A 3LPZA 4JC8A 4KZCA 3SFYA 1KPSB 1H0AA 5LCWJ 1DC2A 1KZOA 4CDRA 1OCZE 3NBNB 3SW9A 4OVUA 4B0ZA 4GYYA 2WXGA 4C1QA 3MV3B 5CBOA 2Y0BG 5D0OD 3GZ1A 2WMNA 4KT6B 3BG1B 4NACA 3BG0B 3QARA 2Y4UA 4I1OB 1INZA 3CVWA 1ZKKA 3JQ1A 5J90A 2R02A 3L6AA 2YQ8A 3Q79A 3HNAA 2IFUA 4UQYA 4AV7A 3UPVA 3CEQA 4BERA 2LAIA 3ASFA 3E4BA 2NYJA 2AJAA 4BTBA 2P9LG 2IGQA 1H2TC 4FMUA 2RFIA 4FJZA 1HG2A 5CECB 3KMTA 3B7BA 4L9PA 3CBMA 4GTPA 2KXPC 3C3QA 1TEZA 3AU4A 5HKPA 5LFAA 5B1AE 2V4HC 4BSXA 2LXLA 1N0RA 1KT1A 2AXZA 1PC2A 3ENEA 3G2VA 4G8KA 3RJVA 2J8SD 4CYMD 3HRAA 2X6HA 3UT8A 3OXLA 2LNIA 2RFAA 3DALA 3DPYA 1O1TA 3FUKA 4B89A 3QC1A 2XEHA 4A63B 2V5FA 3CIAA 4WWOA 2ONDA 1UN9A 4TUUA 4JL0A 2XRYA 4EBAA 4MRUA 3B7RL 2LSUA 4YPUA 4U7EB 4RZ0A 4CZ2D 1OCOE 2VSNA 1DCQA 3URZA 3KSQA 4RG6A 5T8IA 3OXFA 4JEUA 3QKYA 5M72A 5CRUA 3QK0A 5JA4D 5G05C 2XQ0A 3HXDA 2BQZA 4J8DA 3JYSA 3UT4A 3ZXPA 3E30A 1N6CA 2X6IA 4N3AA 3EU5A 4AOFA 3LCAA 3PZ4A 2XCCA 3ZKJA 3M53A 2DVWA 1JWGA 4K5BA 4UUCA 4YDOA 1BPOA 2XEEA 5CPRB 1N3JA 1U3DA 4H7YA 5JMND 1IHBA 1KT0A 3IXEA 4U8HA 3CSFA 1A5EA 2GW1A 5C2YA 3UTMA 5ENSD 5ENPD 1Q2ZA 3F9WA 2BKKB 5B3SE 1N4RA 2VSOE 3Q73A 4JHRA 4WNFA 5AQ9A 2P9PG 3RRUA 4WWNA 3E32A 4YDWA 5ARFA 2H6HA 4O60A 2V5QC 3M59A 2J4DA 2FBNA 4BT9A 2F0YA 4B93B 3CLJA 3APDA 1TNYA 4W9RA 1QYMA 5EDSA 3F9YA 4FADA 3CSTA 2P9IG 1B89A 2XS8A 4DX7D 1QZ2A 1UG3A 4N3CA 2WMOA 3KAEA 5BXUA 1IXVA 2CG3A 2P2CP 1ZU2A 3RAYA 4UWHA 3U3WA 2WVIA 4J8OA 3OAWA 4UQZA 5FQ6A 3D9IA 3ZIMA 4UQXA 3LY7A 3PEVB 2PZIA 4HORA 3P1UA 5CMWA 4F3VA 3DEPA 2IF4A 4CEMA 1E8XA 4JB8P 4EPZA 3APFA 1RW2A 4G8LA 3RQ4A 2X6JA 1V55E 3T9KA 3C72A 4LUNU 4HOUA 3FFLA 3TWXA 5FINA 5AIJA 3CHMA 3AG1E 3RKVA 2XGOA 2CFZA 4FJYA 1BI7B 3LY8A 3EHNA 4Y6WA 3Q4AB 1EYHA 1MQSA 2KBXA 4UWFA 1N95A 3MJWA 2KZTB 3UXGA 3C3OA 3D3MA 3RO2A 4IN3B 1XGWA 4UI9C 5JIYA 3HG0D 4EZJA 3C98A 3DXKG 5ANRA 2PNNA 1UJKA 4E85A 2HE0A 3FULA 3D9NA 4L7TA 3K9IA 3L08A 3P2BA 4GMRA 3SZ7A 2AVPA 4AXHA 4I6EA 5KNGA 4WAFA 3CVNA 4GPMA 3ULYA 4I17A 4N3BA 3AG3E 4YDYA 5ANLA 1NI1A 4NRHB 2X6FA 3LYAA 2ETAA 2KCVA 4B8AA 4QEPA 4ABNA 4G11A 2P58C 4TXQA 1MZCA 5DIZA 3G2SA 1H6PA 1TNUA 3DXMG 4RLYA 3MX3A 4CGVA 3Q15A 5AJLA 3VLEA 4C0EA 1EPUA 5KNHD 3KD7A 4YPEA 5ENQD 3JCKC 4JHJA 4Q94A 5KCMA 3D9LA 3IHVA 2KZTA 4KZ0A 4XX5A 3R7QA 1UW4B 5E75A 5KJNA 3MO2A 3AAAC 3CV0A 3ASNE 5T3RA 4AM9A 2OEWA 2JABA 4L1BA 1K8KG 4H12A 5D2MC 5KJKA 1JWFA 3B95A 4GPKA 2WPVA 3E33A 3MO0A 3DSVA 4I43A 2CHXA 5IY5E 2L0IA 1E8WA 3HYMB 1H6KA 5AYWD 3GZ2A 2P9SG 4DLQA 3HDXA 3G2UA 4HLEA 1O5MA 3V31A 5H7PA 4R7LA 2J49A 1MVHA 3FU3A 1WAO1 4WWPA 4PUCA 1O1RA 2WXMA 2WXLA 5KWDA 5D0QD 3DSXA 4FP7A 3T5VA 2V4LA 3ZEFA 2VYIA 1FT2A 4A1SA 5J08A 3ASDA 5BNWA 5AQBA 2CHZA 3F6QA 3PVLA 4YNPA 4PS8A 2QYUA 1OWOA 2QYJA 2OOEA 4KBQA 2WB2A 2R59A 2NC9A 1Z5SC 2GROB 2DZNA 3DSWA 3Q49B 3DRAA 5DBKA 5D66A 3SY2A 3MGBA 3OTNA 5ITZF 4DLOA 1IQUA 2GRMA 2YHEA 3ZVVA 3U9WA 2ILRA 4YNDA 3M55A 4AIFA 3PZDA 3UX4A 3CVVA 2NXPA 4A3VA 1KZPA 5HQ8A 2R5SA 3LJ3A 3PNLB 2XEVA 1XNFA 3F9XA 4A55A 3UKUG 1ZBPA 4BUPA 1N52A 3O4ZA 3EIJA 1Z6TA 4UWKA 4FC8A 3OPEA 3LS8A 1GW6A 3X2QE 2WQ6A 4F53A 2OCCE 3EDTB 3WXXA 2VQ2A 2MOWA 4XKCA 3CR3A 2OVFA 2YINA 1MT6A 3L17A 2H6FA 2AXUA 5FIOA 1IKND 1EDUA 3LJNA 1W3BA 3UINC 4DX5D 1SVXA 2ETBA 5FQ4A 1HO8A 3PEUB 3IHXA 4GMLA 3SQVA 4V3IA 3C3RA 3BQOA 4LRZA 1E96B 1WM5A 2L0TB 3VTXA 3CVXA 2EIKE 3FUMA 2LO6A 2CFUA 3RAUA 4GTVA 4J7IA 2L6JA 3SI5A 1OWMA 3B7TA 4ANUA 1AP7A 3UM0A 4MI5A 2RFMA 2VGYA 4JXTA 1MJ0A 4GB9A 4APFA 2M63A 1JPLA 5AYFA 1E8ZA 3MO5A 3I5PA 5EX0A 3CHRA 4LNBA 3R9AB 2DIWA 3KMAA 2L9BA 5BT1A 3QWPA 1MUFA 4ZFHA 3HXCA 1FCHA 1E90A 2J07A 4BFRA 2X3MA 1SA5A 4HRMB 1TNBA 3AG2E 4XEIG 4CGWA 4F1SA 3KEAA 3ONLA 4BESA 3I3NA 4MKTA 4AVXA 3FY4A 4GZDA 4G1TA 3DPDA 4WNGA 4F7AA 3W9FA 4AEZC 1ZB1A 4C9BB 1E7VA 2XGSA 5JHNA 4OYSA 3NAWA 4FA6A 4FLHA 3ML9A 3TXMA 2LAHA 4GTQA 3O48A 3TG4A 3QDNA 2DCPA 2GRQB 5JJ0A 4Z4PA 2IO2C 3ISMC 4QQIA 1G3NB 2WXOA 2IY0C 1ELWA 2QFCA 1PY1A 5CCLA 3ZU7B 1MVXA 3UM2A 4HRLA 1TN6A 1MHQA 4KXKB 2AXVA 4U04A 4CCAA 1ELRA 3TGOA 3S7BA 3HXBA 3OXGA 4G24A 3U66A 3D9MA 4BTAA 5F6LA 4WNEA 4XI0A 4LSZE 4X8QA 4JLGA 2ZXWE 4O1OA 5CRVA 1JCQA 5A7DB 4KVOA 2ZGDA 2O8JA 3L13A 4HNAD 3CHQA 4HFGA 3QAQA 4I9EA 3UT7A 2XPIA 4TUMA 3U64A 2Y3AA 4TV3A 4DK5A 4GA2A 3S8PA 4FHJA 3EU9A 4XI9A 3G2TA 1UN8A 1LD7A 3FWVA 3FHEA 3L82A 4GCOA 3PE3A 3FTVA 3AS8A 3KSLA 4P29A 1NA0A 2VGXA 2FI7A 1BLXB 4JHKA 2Y1LE 1S0PA 5TTFA 1K1AA 3ESLA 4J8SA 1DCEA 5AQ7A 1NFIE 4DI3A 4K0RA 2XPYA 3ZPJA 2WXHA 3APCA 4ANXA 5LCWC 4AY5A 3MEKA 4I2WA 3JUIA 4BETA 1Z3YA 4DI4A 4K5CA 5FQ8A 4FLBA 3NQPA 2EIJE 5AAOA 3K5KA 3ZYKA 4RQIA 3RSEG 4AP2A 3ZUVB 3B7UX 3PNTB 4RG9A 3SFZA 4N39A 3NOGD 3T5XA 2WXNA 1LTXA 2UY1B 4G25A 3MYVA 4HB5A 1HFAA 4GYOA 3DWLG 3PH0C 5FQ7A 1N54A 1IHGA 3OOIA 4HOQA 2FO1E 4BX8A 3TXNA 4TXRA 4O30A 3S7DA 4EQFA 4HOSA 2XGMA 4U07A 5F6KC 2BTDA 3E34A 1K3ZD 2BKGA 1BU9A 2C2LA 5G04J 4ZHBA 2WXRA 4J0UA 2CG2A 3TWSA 3CHSA 4I6JA 2LSVA 4YVQC 4N2QA 4BEPA 1SW6A 1HH8A 3AJIA 4LCTA 4MBGA 4HOTA 3PZ1A 3AU5A 3FUHA 1TJCA 3KMJA 2XPZA 3BEEA 4CDMA 5BPPA 4EZKA 1XQHA 4HS2A 3ZNGA 4MS6A 2H6GA 1HF8A 4MLPA 3TL5A 3ML8A 4TXPA 2UY1A 4IJDA 3HXFA 4GTRA 3TWVA 3LVQE 2HYZA 3PE4A 5A6CA 5BUZA 4U96D 2PM7A 4J7FA 2XZDG 2J9QA 4KYOB 3QOUA 2J09A 3L16A 1N4SA 3D9KA 3RU0A 2LXMA 1OWPA 3CVUA 2VSYA 4A1GA 3LDZA 3JQ0A 4I1MA 2Q7FA 4UI9K 1RZ4A 2J08A 1SA4A 3IV0A 5FZRA 1X5BA 5ENOD 5FTPA 1WG0A 2DYRE 4XE0A 4OVVA 4O6FA 2CHWA 3CVLA 1HG5A 2E2EA 2IEJA 3Q5MA 3ZXSA 3CVYA 4ILHB 3IKOB 4WUYA 1U2VG 1JCSA 5EX3A 4NVQA 1TNZA 3VLFA 4HRNA 1N6AA 1FVHA 1OCCE 3BUAA 2IJGX 3EHRA 3JUEA 5HI7A 4YNMA 1N0QA 1PEGA 1O9SA 2J4BA 1N9AA 4K5AB 3VV0A 3R9MA 3UQ3A 4ME2A 3ZYLA 2LUHA 1JUQA 2PM6A 2B6CA 4GZCA 1K1BA 5T0MA 4YPAA 2B0OE 1TYQG 4GZ6A 3FTSA 2Y4TA 2RKKA 2QC9A 3M58A 4QENA 3CVPA 4G23A 4ACLA 3FTZA 1HXIA 4NQ0A 2L6BA 4ACKA 5TH7A 3Q78A 2OVBA 2BUGA 5EG2A 1D8EA 4JA7A 4C0MA 3KEZA 5EN5D 3D9PA 5JJ6A 2ZU6B 3PUKA 3ZN3A 5C1DA 3EUVA 1MX2A 2XZTG 3CHPA 2W5YA 3BU8A 1DNPA 2YHCA 1WDYA 3FH5A 2IU1A 2KCKA 4GTOA 4F6RD 4JW1A 3QWVA 3DSSA 4U0ZA 3D9OA 3BO5A 4KVMA 1X81A 1H6OA 5JHBA 3Q9NC 4U8VD 2HM8A 4GZ3A 2RG8A 1N94A 1LF8A 3V2OA 2IONA 2ZISA 4JD2G 2F8YA 4I2ZA 4LG6A 5EIDA 5T4YA 2OEVA 3TWWA 4HLLA 4IJ8A 5E76A 3SBSA 4GMJA 2G46A 4J7WA 4LEUA 4U63A 4EHMA 4ILGA 2OV8A
chains in the Genus database with same CATH topology
1OWNA 4APOA 3EHMA 4HOUA 3FFLA 4Q69A 2VSXE 2WXOA 3CHOA 3MZLB 4JVSA 5AIJA 5T0KA 3PREA 1ELWA 4XIFA 2QFCA 3CHMA 1PY1A 2FO7A 3CK9A 4XZ4A 5CCLA 1MVXA 3RKVA 2XGOA 2CFZA 1OWLA 4FJYA 1MHQA 2FEZA 3EJNA 4KXKB 5FWQA 1SZAA 1NA3A 1SZ9A 2AXVA 3LY8A 4J6IA 4U04A 4CCAA 1ELRA 3TGOA 3EHNA 3S7BA 5F59A 4Y6WA 3OXGA 4G24A 4GU5A 3RIBA 3S7FA 3U66A 5T5GA 3D9MA 4BTAA 5F6LA 4WNEA 3Q4AB 4XI0A 5FJYA 5CMYA 4KMOA 4PH4B 4Y6CA 1EYHA 1MQSA 4JLGA 5A7DB 2NSZA 4EZLA 4UWFA 3QB2A 4KVOA 2A5UA 4PS3A 3HVEA 3TJPA 3VLDA 3RJWA 3MJWA 2KZTB 4J8EA 3L13A 5G55A 4M3OA 5FZQA 2O8JA 3CHQA 4HFGA 3QAQA 3L22A 3M54A 3D3MA 4HVBA 3RO2A 3Q47B 1SQMA 3FUNA 4BT8A 3SHFA 4I9EA 4JZYA 2FF4A 2R17C 4IN3B 1XGWA 2AW6A 2XPIA 4UI9C 3UT7A 2WXJA 2XRZA 4QEOA 4RVBA 1FVFA 2AWIA 2Y3AA 3U64A 4N2SA 5JIYA 3CBOA 3EIQC 2I1JA 1HS6A 4TV3A 5G05J 3HHMA 4DK5A 4GA2A 3S8PA 4C1QA 2KCLA 3LXUX 4FHJA 2V0PA 1IQRA 3TG5A 4EZJA 3C98A 1QNFA 4XI9A 3G2TA 4JEHA 5TEGA 1UN8A 3FH8A 5ANRA 3QWWA 4I9CA 3B13A 4PDXA 4D10C 1UJKA 4ILIA 4E85A 1H19A 4G2VA 3M57A 1HZ4A 3FWVA 4TRQA 3SBTB 3FHEA 3FULA 3D9NA 4JA9A 4L7TA 2WQHA 4GAAA 3MCXA 4GCOA 3FEXA 3PE3A 5ARGA 3FTVA 3K9IA 3AS8A 4K03A 2IOSA 3L08A 2KATA 3P2BA 3SZ7A 4P29A 2AVPA 4XKBA 4I6EA 4AXHA 1NA0A 1YA0A 2VGXA 2FI7A 4JHKA 4WAFA 4ANVA 3CVNA 4I17A 3LVRE 1S0PA 3B7SA 4N3BA 5TTFA 1NZNA 4I6GA 3CVQA 4J8SA 3ESLA 4B94A 4GZ5A 5KJLA 4E6HA 4DI3A 4K0RA 2XCBA 2XPYA 3SGHA 3ZPJA 2WXHA 5ANLA 1A17A 3SF4A 1U3CA 3APCA 2IOLA 3PUJA 4H7XA 5FT9A 4AY5A 2WXKA 4ANXA 3MEKA 2VJ8A 4I2WA 3JUIA 4Q96A 5LP0A 2MHKA 2WXIA 4GCNA 1Z3YA 4NRHB 5G04C 2X6FA 3LYAA 3PRZA 4DI4A 1ELKA 4FLBA 5FQ8A 4J83A 3CK7A 3NQPA 2KCVA 4CRWA 4B8AA 5BV0A 3K5KA 4ABNA 3IBEA 4G11A 2P58C 4I1AA 4QEPA 3OS5A 3ZYKA 2EQXA 5DIZA 1VDYA 3CGHA 3G2SA 2X6KA 3PS6A 4AP2A 4A3TA 3FUFA 3MX3A 4CGVA 3Q15A 4UI9J 5AJLA 2PL2A 3B7UX 4PS7A 3VLEA 3PNTB 1H2VC 3AS4A 4C0EA 1EPUA 2WXPA 4GA1A 4RG9A 3SFZA 5CCMA 4N39A 2QY7A 3T5XA 2WXFA 3DB5A 3U4TA 4AJWA 2WXNA 2UY1B 3KD7A 3S2AA 4YPEA 4IYPA 4G25A 3JCKC 3MYVA 2I2OA 3FDHA 5ENNA 4JHJA 4Q94A 4QFVA 2DBAA 4U0SA 5KCMA 3D9LA 4U0UA 3IHVA 2F69A 2KZTA 4ATGA 3IHYA 4I51A 1HFAA 4KZ0A 4XX5A 2WXQA 3R7QA 4J8FA 1UW4B 1HU3A 4GYOA 5E75A 3PH0C 3ZYMA 3FU6A 3L54A 5KJNA 2VGXB 4UWLA 5FQ7A 3MO2A 3T8MA 4IULA 1N54A 1IHGA 2YNQA 3CV0A 1ML9A 3OOIA 4LDGA 4HOQA 3FU5A 2C0MA 3QJZA 5T3RA 3CBPA 3FTXA 5AJDA 3ZFWA 4BX8A 4AM9A 3TXNA 5LCWC 2W5ZA 5JJ7A 3AS5A 4O30A 3LPZA 4JC8A 4KZCA 4L1BA 3S7DA 4EQFA 4WNDA 3ZGQA 1Y6IA 2XGMA 4HOSA 3KS2A 2R3AA 4U07A 4H12A 5KJKA 5F6KC 1H0AA 2BTDA 5LCWJ 1JWFA 4GPKA 4LERA 5F5EA 4CDRA 4FHKA 2WPVA 3MO0A 4URKA 2C2LA 5G04J 3SW9A 2WXRA 4J0UA 1H2UA 2CG2A 3CHSA 4I43A 3M5AA 4OVUA 4I6JA 2CHXA 4GYYA 4B0ZA 5LX8A 3FPDA 2L0IA 2LSVA 2WXGA 1EF1C 1E8WA 3FEYA 3HYMB 3MV3B 4YVQC 1H6KA 5D0OD 3GZ1A 5AYWD 2WMNA 3UMVA 3ZRHA 4KT6B 3GZ2A 4N2QA 3BG1B 3GW4A 3S7JA 1HH8A 4NACA 2VTBB 4LCTA 3BG0B 3QARA 2Y4UA 4HOTA 4I1OB 1P5QA 4DLQA 3HDXA 2HO1A 4DJAA 3G2UA 1INZA 3CVWA 4HLEA 2GGFA 1ZKKA 3AU5A 3FUHA 3JQ1A 1TJCA 5J90A 4R7LA 3KMJA 2J49A 1MVHA 2XPZA 3FU3A 1HE8A 2PQRA 3L6AA 2YQ8A 3BEEA 2PQNA 4CDMA 1WAO1 5A23A 4WWPA 5BPPA 2I6HA 4PUCA 3HNAA 4MI0A 2IFUA 4UQYA 4AV7A 2WXMA 1H3IA 3UPVA 3CEQA 2WXLA 4EZKA 5D0QD 2LAIA 1XQHA 2IQCA 4HS2A 3I4RB 4UWGA 4FP7A 4MS6A 3ASFA 3E4BA 4MLPA 1HF8A 3TL5A 3T5VA 2V4LA 3ZEFA 2VYIA 3ML8A 3NZSA 4BTBA 2IGQA 1H2TC 4FMUA 2UY1A 4IJDA 1L5JA 2RFIA 4A1SA 5J08A 3LY9A 3GYZA 4FJZA 1HG2A 3LVQE 5FZSA 1QQEA 2HYZA 3ASDA 3PE4A 3TAXA 3KMTA 3CBMA 3VUZA 2BF0X 5BNWA 5A6CA 5BUZA 3QNKA 3FTYA 2CHZA 5JHAA 2PM7A 3FUEA 4J7FA 1TEZA 3AU4A 2I1KA 2J9QA 4KYOB 5KJMA 1KLXA 3PVLA 5LFAA 4PS8A 3FU0A 2J09A 3QOUA 5CHEE 1OWOA 4GYWA 4NJ5A 3ONKA 3EP0A 2OOEA 3L16A 4KBQA 4BSXA 2WB2A 4IRUA 3D9KA 1KT1A 2AXZA 2NC9A 2R59A 5JINA 3Q49B 3RU0A 1PC2A 3ENEA 4NURA 3CQCB 4EBAG 3G2VA 1DVPA 2JV0A 4JPSA 1OWPA 3CVUA 5DBKA 3RJVA 2X6HA 3MGBA 4N5CA 3OTNA 3OXLA 3UT8A 3FUIA 2VSYA 3ASHA 3FP3A 2LNIA 4A1GA 4DLOA 4BWRA 1IQUA 3LDZA 1HX8A 3DALA 2GRMA 3MV2B 2YHEA 3FUKA 3JQ0A 3ZVVA 4I1MA 2Q7FA 2QPWA 3U9WA 4UI9K 4B89A 3FTUA 2J08A 3QC1A 2ILRA 4YNDA 3M55A 4AIFA 3ASGA 3IV0A 2V5FA 3FH7A 5FZRA 2VTBA 1X5BA 3CIAA 3PZDA 4WWOA 2WQ7A 2ONDA 2FULA 3UX4A 1UN9A 2RD0A 3CVVA 3RRMB 3LKUA 4TUUA 4JL0A 2XRYA 2NXPA 4EBAA 4A3VA 3I4GA 4CT0A 5FTPA 5HQ8A 2R5SA 3LJ3A 4MRUA 5JJTA 4XE0A 3PNLB 3B7RL 2XEVA 4OVVA 5EKQD 3R7RA 4CT4A 1IYGA 1XNFA 4O6FA 2LSUA 3F9XA 2CHWA 4YPUA 4A55A 1ZBPA 1NP7A 4RZ0A 3CVLA 4BUPA 3CKCA 1N52A 1HG5A 2E2EA 2VSNA 4ANWA 3MA5A 3O4ZA 3RO3A 4YVOA 3EIJA 3Q5MA 1Z6TA 4UWKA 3ZXSA 3CVYA 4ILHB 3URZA 4RG6A 5T8IA 3OXFA 1TJFA 4JEUA 4FC8A 3OPEA 3LS8A 3QKYA 5M72A 1GW6A 3RK6A 3IKOB 4WUYA 3QK0A 5EX3A 2XQ0A 5G05C 2WQ6A 2BQZA 2HR2A 4J8DA 4F53A 3EDTB 4NVQA 3WXXA 3JYSA 3UT4A 2VQ2A 2MOWA 2X38A 1N6CA 5LSXA 4XKCA 3VLFA 3CR3A 2OVFA 1N6AA 2X6IA 2YINA 4N3AA 1MT6A 1FVHA 3L17A 4AOFA 2AXUA 4JDSA 1EDUA 4G26A 2IJGX 3LCAA 2XCCA 1PAQA 3SNXA 1W3BA 5LSZA 5HI7A 4YNMA 3M53A 4L2YA 3FTWA 1JWGA 1PEGA 1BPOA 5FQ4A 1O9SA 1HO8A 2J4BA 5CPRB 1N3JA 3CK8A 5LOZA 1U3DA 4H7YA 3PEUB 3IHXA 3VV0A 4GMLA 1KT0A 4V3IA 3UQ3A 3ZHEB 4ME2A 4U8HA 1Y8MA 3CSFA 3ZYLA 3GZSA 4LRZA 2GW1A 1E96B 1WM5A 1JUQA 5C2YA 3CKBA 2PM6A 2C0LA 1OUVA 2L0TB 4GZCA 5T0MA 4BY6A 4EECA 3F9WA 3VTXA 4FU3A 3CVXA 4YPAA 3FUMA 2LO6A 3LEWA 3PDNA 2CFUA 2VSOE 4JHRA 3MKQB 4WNFA 2L6JA 4J7IA 4GZ6A 1WY6A 3FTSA 2WM9A 3SI5A 1OWMA 3B7TA 4ANUA 2Y4TA 4DPRA 4MI5A 3RRUA 3HIZA 3M58A 4QENA 4WWNA 2VGYA 3CVPA 4G23A 3IEGA 4JXTA 3RRNB 4ACLA 3FTZA 1HXIA 3G2WA 4GB9A 4NQ0A 3FUJA 4YNPA 4ACKA 5TH7A 5ARFA 4APFA 2M63A 2OVBA 1JPLA 2BUGA 5AYFA 2JEKA 4RSYA 3M59A 5EG2A 4FULA 1E8ZA 4JA7A 3MO5A 3DBSA 2J4DA 3I5PA 5EX0A 2FBNA 3FUDA 3KEZA 4C0MA 3CHRA 3D9PA 5JJ6A 3R9AB 4BT9A 2DIWA 2ZU6B 3KMAA 3CLJA 3APDA 3PUKA 4L2LA 3ZN3A 2E0IA 2L9BA 3N71A 2JLBA 4W9RA 5BT1A 5EDSA 3QWPA 1MUFA 2MRIA 5C1DA 3F9YA 3D9JA 1FCHA 1E90A 3CSTA 4FADA 3NF1A 2J07A 5G2NA 1E7UA 1B89A 3CHPA 3ZYQA 2W5YA 4BX9A 1DNPA 2UWJG 2YHCA 4BFRA 5AENA 4AU7A 1QZ2A 2X3MA 1UG3A 3FH5A 2IU1A 2KM4A 2KCKA 2WMOA 3KAEA 4N3CA 2XHEA 2CG3A 1E8YA 3ESKA 3VTYA 4CGWA 4JW1A 3QWVA 4F1SA 1ZU2A 3RAYA 3ONLA 4U0ZA 3I3NA 4UWHA 4MKTA 3HVEB 3U3WA 4CDNA 3SD5A 4AVXA 3D9OA 3ZW3A 5BV1A 3BO5A 3FY4A 2WVIA 4J8OA 3OAWA 4GZDA 3F9ZA 1UJJA 4UQZA 4G1TA 4KVMA 1Z3XA 5FQ6A 3D9IA 3DPDA 2I9CA 3ZIMA 4WNGA 3UUXA 3ZHEA 5JHBA 3CQGB 4UQXA 2HM8A 3LY7A 2RG8A 4GZ3A 4F7AA 3PEVB 4AEZC 4AY6A 4L23A 4HXIA 1LF8A 2IONA 4C9BB 2PZIA 4HORA 3P1UA 1E7VA 2XGSA 5CMWA 4F3VA 5JHNA 2V8SE 4I2ZA 2IF4A 4OYSA 4GA0A 4CEMA 2KC7A 1E8XA 4E47A 5T4YA 3SWCA 3ULQA 3MKQA 4EPZA 4IJ8A 3APFA 5E76A 4FA6A 3SBSA 4FLHA 2GRLA 3ML9A 4GMJA 3TXMA 2LAHA 3TG4A 3O48A 5BW8C 2G46A 3MKRA 2DCPA 3QDNA 3RQ4A 2X6JA 5JJ0A 4LEUA 4Z4PA 4U63A 3M56A 4LUNU 4B8CB 4ILGA 2A4ZA 2OV8A 3NZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4APO A;  4HOU A;  3FFL A;  5T0K A;  1ELW A;  4XIF A;  2QFC A;  2FO7 A;  3CK9 A;  5CCL A;  1MVX A;  3RKV A;  2XGO A;  2FEZ A;  4KXK B;  1NA3 A;  3LY8 A;  4U04 A;  1ELR A;  3TGO A;  3S7B A;  5F59 A;  4Y6W A;  3OXG A;  4G24 A;  3S7F A;  3RIB A;  5T5G A;  4BTA A;  5F6L A;  4WNE A;  3Q4A B;  4XI0 A;  5FJY A;  4Y6C A;  4JLG A;  5A7D B;  3RJW A;  4J8E A;  2O8J A;  5FZQ A;  3M54 A;  3RO2 A;  3Q47 B;  4BT8 A;  4I9E A;  2FF4 A;  4IN3 B;  4UI9 C;  2XPI A;  4QEO A;  4N2S A;  5JIY A;  3CBO A;  5G05 J;  4GA2 A;  3S8P A;  2KCL A;  3TG5 A;  4XI9 A;  5TEG A;  3QWW A;  4I9C A;  4G2V A;  3M57 A;  1HZ4 A;  3FWV A;  4JA9 A;  2WQH A;  4GCO A;  3PE3 A;  5ARG A;  3K9I A;  3AS8 A;  2KAT A;  3SZ7 A;  2AVP A;  1NA0 A;  1YA0 A;  2VGX A;  2FI7 A;  3CVN A;  4I17 A;  4N3B A;  5TTF A;  1NZN A;  3CVQ A;  4B94 A;  5KJL A;  4GZ5 A;  2XCB A;  3ZPJ A;  1A17 A;  3SF4 A;  5LCW C;  4H7X A;  5FT9 A;  4AY5 A;  3MEK A;  4I2W A;  2MHK A;  4GCN A;  4NRH B;  5G04 C;  3LYA A;  4J83 A;  3CK7 A;  2KCV A;  3K5K A;  4QEP A;  4ABN A;  2P58 C;  4I1A A;  3OS5 A;  5DIZ A;  4CGV A;  3Q15 A;  4UI9 J;  2PL2 A;  3AS4 A;  5CCM A;  4RG9 A;  4GA1 A;  4N39 A;  3DB5 A;  3U4T A;  2UY1 B;  3KD7 A;  4YPE A;  4G25 A;  2DBA A;  4U0S A;  4U0U A;  2F69 A;  4I51 A;  4J8F A;  4GYO A;  5KJN A;  2VGX B;  3MO2 A;  1IHG A;  3CV0 A;  1ML9 A;  3OOI A;  4LDG A;  4HOQ A;  2C0M A;  3CBP A;  3ZFW A;  2W5Z A;  4AM9 A;  5JJ7 A;  3AS5 A;  4O30 A;  3LPZ A;  3S7D A;  4EQF A;  4WND A;  3ZGQ A;  2XGM A;  4HOS A;  3KS2 A;  2R3A A;  4U07 A;  4H12 A;  5KJK A;  5F6K C;  5LCW J;  4GPK A;  5F5E A;  4CDR A;  2WPV A;  3MO0 A;  2C2L A;  5G04 J;  3SW9 A;  4J0U A;  3M5A A;  4GYY A;  3FPD A;  2LSV A;  4YVQ C;  4C1Q A;  3HYM B;  3MV3 B;  5D0O D;  3GZ1 A;  5AYW D;  4N2Q A;  3GZ2 A;  3S7J A;  3GW4 A;  1HH8 A;  4HOT A;  2Y4U A;  1P5Q A;  2HO1 A;  1ZKK A;  1TJC A;  3KMJ A;  1MVH A;  2PQR A;  2YQ8 A;  3BEE A;  2PQN A;  1WAO 1;  2I6H A;  3HNA A;  4MI0 A;  2IFU A;  4UQY A;  1H3I A;  3UPV A;  3CEQ A;  5D0Q D;  1XQH A;  3ASF A;  3E4B A;  2VYI A;  4BTB A;  2IGQ A;  4FMU A;  2UY1 A;  4IJD A;  2RFI A;  4A1S A;  3LY9 A;  3GYZ A;  5FZS A;  1QQE A;  2HYZ A;  3ASD A;  3PE4 A;  3TAX A;  3KMT A;  3CBM A;  3VUZ A;  5BNW A;  5A6C A;  4J7F A;  2J9Q A;  4KYO B;  5KJM A;  1KLX A;  4YNP A;  3QOU A;  5CHE E;  4NJ5 A;  4GYW A;  3EP0 A;  2OOE A;  4KBQ A;  1KT1 A;  5JIN A;  2NC9 A;  3Q49 B;  3RU0 A;  1PC2 A;  2JV0 A;  5DBK A;  3RJV A;  4N5C A;  3OXL A;  2VSY A;  3ASH A;  3FP3 A;  2LNI A;  4BWR A;  3DAL A;  3MV2 B;  2Q7F A;  2QPW A;  4UI9 K;  4YND A;  3M55 A;  4AIF A;  3ASG A;  2V5F A;  5FZR A;  2OND A;  3LKU A;  4JL0 A;  5FTP A;  5HQ8 A;  2R5S A;  5JJT A;  2XEV A;  5EKQ D;  1IYG A;  1XNF A;  4O6F A;  2LSU A;  3F9X A;  4YPU A;  1ZBP A;  4RZ0 A;  3CVL A;  4BUP A;  3CKC A;  2E2E A;  2VSN A;  3MA5 A;  3RO3 A;  4YVO A;  3Q5M A;  3URZ A;  4RG6 A;  3OXF A;  3OPE A;  3QKY A;  5M72 A;  4WUY A;  5EX3 A;  5G05 C;  2BQZ A;  2HR2 A;  4J8D A;  3EDT B;  4NVQ A;  3WXX A;  3JYS A;  2VQ2 A;  1N6C A;  5LSX A;  1N6A A;  4N3A A;  1MT6 A;  4JDS A;  4G26 A;  3LCA A;  2XCC A;  1W3B A;  5LSZ A;  5HI7 A;  4YNM A;  3M53 A;  1PEG A;  1O9S A;  5CPR B;  1N3J A;  3CK8 A;  4H7Y A;  3IHX A;  3VV0 A;  1KT0 A;  3UQ3 A;  3ZHE B;  4ME2 A;  1Y8M A;  2GW1 A;  1E96 B;  1WM5 A;  3CKB A;  2C0L A;  1OUV A;  5T0M A;  3F9W A;  3VTX A;  4YPA A;  3PDN A;  4JHR A;  4WNF A;  4J7I A;  2L6J A;  4GZ6 A;  2Y4T A;  4MI5 A;  3M58 A;  4QEN A;  2VGY A;  3CVP A;  4G23 A;  3IEG A;  1HXI A;  4NQ0 A;  5TH7 A;  5ARF A;  2BUG A;  5AYF A;  3M59 A;  5EG2 A;  4JA7 A;  3MO5 A;  5EX0 A;  2FBN A;  5JJ6 A;  3R9A B;  4BT9 A;  3KMA A;  3ZN3 A;  3N71 A;  4W9R A;  2JLB A;  5BT1 A;  3QWP A;  1MUF A;  5C1D A;  3F9Y A;  1FCH A;  3NF1 A;  1B89 A;  2W5Y A;  2UWJ G;  2YHC A;  4AU7 A;  1QZ2 A;  4N3C A;  2KCK A;  3KAE A;  3VTY A;  3ESK A;  4CGW A;  3QWV A;  1ZU2 A;  3RAY A;  4U0Z A;  3U3W A;  3BO5 A;  4J8O A;  3F9Z A;  4UQZ A;  4G1T A;  4WNG A;  3UUX A;  3ZHE A;  4UQX A;  3LY7 A;  4GZ3 A;  4AY6 A;  2PZI A;  4HOR A;  2XGS A;  5JHN A;  4F3V A;  4I2Z A;  2IF4 A;  4GA0 A;  2KC7 A;  4E47 A;  3SWC A;  3ULQ A;  4IJ8 A;  3RQ4 A;  3TG4 A;  3O48 A;  5BW8 C;  2G46 A;  3MKR A;  3QDN A;  5JJ0 A;  4LEU A;  4Z4P A;  3M56 A; 
#chains in the Genus database with same CATH topology
 1OWN A;  4APO A;  3WG7 E;  4GTM A;  4JVS A;  3MZL B;  3CHO A;  5T0K A;  4YDE A;  2GRN B;  5CBN A;  5FWQ A;  2FEZ A;  3PZ2 A;  1SZA A;  1SZ9 A;  3W9G A;  2P9U G;  1TN8 A;  4GU5 A;  5T5G A;  5FJY A;  5CMY A;  4PH4 B;  4Y6C A;  3TWU A;  2NSZ A;  4EZL A;  3QB2 A;  2A5U A;  3RJW A;  4M3O A;  5FZQ A;  3L22 A;  3M54 A;  1SQM A;  3FUN A;  2XRZ A;  1FVF A;  3T8K A;  3CBO A;  3EIQ C;  2I1J A;  3HHM A;  3LXU X;  1IQR A;  3TG5 A;  3ABL E;  4JEH A;  5TEG A;  3FH8 A;  4LNG A;  3QWW A;  3B13 A;  4PDX A;  4D10 C;  4ILI A;  3M57 A;  1HZ4 A;  3SBT B;  4TRQ A;  4JA9 A;  2WQH A;  4GAA A;  3MCX A;  3FEX A;  5AAR A;  4HI9 A;  3ABK E;  1S63 A;  2EIL E;  1YA0 A;  3DST A;  3TWT A;  3LVR E;  3B7S A;  3PZ3 A;  4I6G A;  4B94 A;  5KJL A;  4E6H A;  4Z68 A;  1OY3 D;  2XCB A;  3SGH A;  1A17 A;  3SF4 A;  3UI2 A;  5FT9 A;  5LP0 A;  2VJ8 A;  4Q96 A;  4GCN A;  1OCR E;  5EIL A;  3PRZ A;  3CK7 A;  2DWZ A;  4CRW A;  5BV0 A;  3IBE A;  1D9S A;  2EQX A;  1YMP A;  1VDY A;  3PS6 A;  4J8Y A;  4A3T A;  5ENR D;  4GTT A;  1OT8 A;  4UI9 J;  2PL2 A;  5CCM A;  4GA1 A;  1FPP A;  4C48 B;  3S2A A;  4IYP A;  2I2O A;  3FDH A;  5ENN A;  4QFV A;  2DBA A;  4U0U A;  3IHY A;  4I51 A;  4DX1 A;  2WXQ A;  4HQD A;  1HU3 A;  2VGX B;  4LDG A;  1S64 A;  1YCS B;  3FU5 A;  2C0M A;  3QJZ A;  3CBP A;  5AJD A;  3ZFW A;  3AS5 A;  5CED B;  4WND A;  3ZGQ A;  1Y6I A;  3KS2 A;  2R3A A;  4O1P A;  1TN7 A;  4LER A;  5F5E A;  4FHK A;  4URK A;  3ULE G;  1H2U A;  3M5A A;  5LX8 A;  3FPD A;  1EF1 C;  3FEY A;  2H6I A;  3ZRH A;  3UMV A;  3S7J A;  1D8D A;  3GW4 A;  2VTB B;  1P5Q A;  2HO1 A;  4DJA A;  2EIM E;  2GGF A;  3ASO E;  1HE8 A;  2PQR A;  2PQN A;  5A23 A;  2I6H A;  4MI0 A;  1H3I A;  1FT1 A;  2IQC A;  1V54 E;  3I4R B;  4UWG A;  2ZIR A;  3NZS A;  3Q7A A;  1L5J A;  4N5Q A;  3LY9 A;  3GYZ A;  1QBQ A;  4OAV B;  5FZS A;  1QQE A;  3TAX A;  5AQA A;  1JCR A;  3VUZ A;  2BF0 X;  3QNK A;  3FTY A;  5JHA A;  3FUE A;  3E37 A;  2I1K A;  5KJM A;  1KLX A;  3FU0 A;  5CHE E;  4NJ5 A;  4GYW A;  3ONK A;  3EP0 A;  4M7C A;  4IRU A;  2IO3 C;  5JIN A;  1AWC B;  4NUR A;  3CQC B;  4EBA G;  2MYO A;  1DVP A;  2JV0 A;  4JPS A;  2R2L A;  4N5C A;  3FUI A;  3ASH A;  3FP3 A;  4BWR A;  1NL4 A;  1HX8 A;  3Q9U C;  3MV2 B;  3NB2 A;  1MX6 A;  2QPW A;  3D9H A;  3FTU A;  3L9T A;  5HS0 A;  1TNO A;  2VTB A;  3ASG A;  3FH7 A;  4OAU C;  2WQ7 A;  2FUL A;  2RD0 A;  4DX6 D;  3RRM B;  3LKU A;  3DEO A;  1TR4 A;  3I4G A;  3TWQ A;  4CT0 A;  1N4P A;  5JJT A;  4ATZ D;  5EKQ D;  3R7R A;  4CT4 A;  1IYG A;  1NP7 A;  5ENT D;  3CKC A;  4ANW A;  3MA5 A;  3RO3 A;  2EIN E;  4YVO A;  2P9N G;  1TJF A;  3RK6 A;  2HR2 A;  2X38 A;  5LSX A;  1MX4 A;  3V2X A;  2DYS E;  4JDS A;  4G26 A;  3SNX A;  1PAQ A;  5LSZ A;  4L2Y A;  3UKR G;  4DX2 A;  3FTW A;  3JXJ A;  3CK8 A;  5LOZ A;  1LD8 A;  1UOH A;  3ZHE B;  1Y8M A;  3GZS A;  3CKB A;  3J5Q B;  2C0L A;  1OUV A;  2ETC A;  4BY6 A;  4EEC A;  3HXE A;  4FU3 A;  2VGE A;  3DSU A;  3PDN A;  3LEW A;  2BED A;  5KBA A;  3MKQ B;  1WY6 A;  2WM9 A;  3C5R A;  4DPR A;  3HIZ A;  3IEG A;  3RRN B;  2DZO A;  3G2W A;  3FUJ A;  3V30 A;  4NIK A;  2JEK A;  4RSY A;  3ABM E;  3V79 K;  4FUL A;  1S70 B;  5EYL A;  4F1P A;  3DBS A;  3FUD A;  4LNU D;  4L2L A;  2E0I A;  3N71 A;  2JLB A;  2MRI A;  2ZGG A;  3D9J A;  3NF1 A;  5G2N A;  1E7U A;  3ZYQ A;  4BX9 A;  2UWJ G;  5AEN A;  4AU7 A;  2KM4 A;  2XHE A;  1E8Y A;  3ESK A;  3VTY A;  3SO8 A;  3HVE B;  4CDN A;  3SD5 A;  5BV1 A;  3ZW3 A;  3F9Z A;  1UJJ A;  1N4Q A;  1Z3X A;  2I9C A;  1O1S A;  3UUX A;  3ZHE A;  3CQG B;  4AY6 A;  4L23 A;  4HXI A;  3JXI A;  3NOC D;  1MYO A;  2V8S E;  4GA0 A;  2R03 A;  2KC7 A;  4E47 A;  5CEA A;  3UIO C;  3SWC A;  3ULQ A;  3MKQ A;  2XEN A;  2GRL A;  5BW8 C;  3MKR A;  3J5P A;  5HRY A;  3M56 A;  4B8C B;  2A4Z A;  2QZA A;  5AN8 A;  3NZU A;  3Q75 A;  3EHM A;  2R05 A;  4Q69 A;  2VSX E;  3PRE A;  4HI8 A;  4XIF A;  2FO7 A;  3CK9 A;  4XZ4 A;  3Q7F A;  5EYP F;  1OWL A;  3EJN A;  1NA3 A;  4J6I A;  4U95 D;  5F59 A;  3S7F A;  3RIB A;  4KMO A;  5B1B E;  5CER B;  4PS3 A;  3HVE A;  3TJP A;  3VLD A;  4BSZ B;  4J8E A;  4DUI A;  5G55 A;  1YYH A;  4HVB A;  3Q47 B;  4BT8 A;  3SHF A;  4JZY A;  3ZYM A;  2FF4 A;  2R17 C;  2AW6 A;  2WXJ A;  4U8Y D;  4QEO A;  4RVB A;  2AWI A;  4N2S A;  1N11 A;  1HS6 A;  1BD8 A;  5G05 J;  2GRR B;  2KCL A;  2V0P A;  1QNF A;  4I9C A;  2A5E A;  1H19 A;  2P9K G;  4G2V A;  3UIP C;  4HBD A;  3SFX A;  5ARG A;  4K03 A;  2IOS A;  2KAT A;  4XKB A;  4ANV A;  1NZN A;  3CVQ A;  4GZ5 A;  1U3C A;  3PUJ A;  2IOL A;  4H7X A;  2Y69 E;  2WXK A;  2MHK A;  2WXI A;  5EIB E;  2F37 A;  5G04 C;  5BXO A;  1ELK A;  4J83 A;  4I1A A;  3UM1 A;  3OS5 A;  4DRX E;  1BI8 B;  3CGH A;  2X6K A;  3FUF A;  4PS7 A;  1H2V C;  3AS4 A;  2WXP A;  2F8X K;  2QY7 A;  2WXF A;  3DB5 A;  3U4T A;  4AJW A;  2XS1 A;  2GRP B;  1OXJ A;  4U0S A;  2F69 A;  4ATG A;  3EHQ A;  4J8F A;  3TWR A;  3FU6 A;  3UM3 A;  3L54 A;  4UWL A;  3T8M A;  4IUL A;  2YNQ A;  1ML9 A;  4GTS A;  3AG4 E;  3FTX A;  2W5Z A;  5JJ7 A;  3LPZ A;  4JC8 A;  4KZC A;  3SFY A;  1KPS B;  1H0A A;  5LCW J;  1DC2 A;  1KZO A;  4CDR A;  1OCZ E;  3NBN B;  3SW9 A;  4OVU A;  4B0Z A;  4GYY A;  2WXG A;  4C1Q A;  3MV3 B;  5CBO A;  2Y0B G;  5D0O D;  3GZ1 A;  2WMN A;  4KT6 B;  3BG1 B;  4NAC A;  3BG0 B;  3QAR A;  2Y4U A;  4I1O B;  1INZ A;  3CVW A;  1ZKK A;  3JQ1 A;  5J90 A;  2R02 A;  3L6A A;  2YQ8 A;  3Q79 A;  3HNA A;  2IFU A;  4UQY A;  4AV7 A;  3UPV A;  3CEQ A;  4BER A;  2LAI A;  3ASF A;  3E4B A;  2NYJ A;  2AJA A;  4BTB A;  2P9L G;  2IGQ A;  1H2T C;  4FMU A;  2RFI A;  4FJZ A;  1HG2 A;  5CEC B;  3KMT A;  3B7B A;  4L9P A;  3CBM A;  4GTP A;  2KXP C;  3C3Q A;  1TEZ A;  3AU4 A;  5HKP A;  5LFA A;  5B1A E;  2V4H C;  4BSX A;  2LXL A;  1N0R A;  1KT1 A;  2AXZ A;  1PC2 A;  3ENE A;  3G2V A;  4G8K A;  3RJV A;  2J8S D;  4CYM D;  3HRA A;  2X6H A;  3UT8 A;  3OXL A;  2LNI A;  2RFA A;  3DAL A;  3DPY A;  1O1T A;  3FUK A;  4B89 A;  3QC1 A;  2XEH A;  4A63 B;  2V5F A;  3CIA A;  4WWO A;  2OND A;  1UN9 A;  4TUU A;  4JL0 A;  2XRY A;  4EBA A;  4MRU A;  3B7R L;  2LSU A;  4YPU A;  4U7E B;  4RZ0 A;  4CZ2 D;  1OCO E;  2VSN A;  1DCQ A;  3URZ A;  3KSQ A;  4RG6 A;  5T8I A;  3OXF A;  4JEU A;  3QKY A;  5M72 A;  5CRU A;  3QK0 A;  5JA4 D;  5G05 C;  2XQ0 A;  3HXD A;  2BQZ A;  4J8D A;  3JYS A;  3UT4 A;  3ZXP A;  3E30 A;  1N6C A;  2X6I A;  4N3A A;  3EU5 A;  4AOF A;  3LCA A;  3PZ4 A;  2XCC A;  3ZKJ A;  3M53 A;  2DVW A;  1JWG A;  4K5B A;  4UUC A;  4YDO A;  1BPO A;  2XEE A;  5CPR B;  1N3J A;  1U3D A;  4H7Y A;  5JMN D;  1IHB A;  1KT0 A;  3IXE A;  4U8H A;  3CSF A;  1A5E A;  2GW1 A;  5C2Y A;  3UTM A;  5ENS D;  5ENP D;  1Q2Z A;  3F9W A;  2BKK B;  5B3S E;  1N4R A;  2VSO E;  3Q73 A;  4JHR A;  4WNF A;  5AQ9 A;  2P9P G;  3RRU A;  4WWN A;  3E32 A;  4YDW A;  5ARF A;  2H6H A;  4O60 A;  2V5Q C;  3M59 A;  2J4D A;  2FBN A;  4BT9 A;  2F0Y A;  4B93 B;  3CLJ A;  3APD A;  1TNY A;  4W9R A;  1QYM A;  5EDS A;  3F9Y A;  4FAD A;  3CST A;  2P9I G;  1B89 A;  2XS8 A;  4DX7 D;  1QZ2 A;  1UG3 A;  4N3C A;  2WMO A;  3KAE A;  5BXU A;  1IXV A;  2CG3 A;  2P2C P;  1ZU2 A;  3RAY A;  4UWH A;  3U3W A;  2WVI A;  4J8O A;  3OAW A;  4UQZ A;  5FQ6 A;  3D9I A;  3ZIM A;  4UQX A;  3LY7 A;  3PEV B;  2PZI A;  4HOR A;  3P1U A;  5CMW A;  4F3V A;  3DEP A;  2IF4 A;  4CEM A;  1E8X A;  4JB8 P;  4EPZ A;  3APF A;  1RW2 A;  4G8L A;  3RQ4 A;  2X6J A;  1V55 E;  3T9K A;  3C72 A;  4LUN U;  4HOU A;  3FFL A;  3TWX A;  5FIN A;  5AIJ A;  3CHM A;  3AG1 E;  3RKV A;  2XGO A;  2CFZ A;  4FJY A;  1BI7 B;  3LY8 A;  3EHN A;  4Y6W A;  3Q4A B;  1EYH A;  1MQS A;  2KBX A;  4UWF A;  1N95 A;  3MJW A;  2KZT B;  3UXG A;  3C3O A;  3D3M A;  3RO2 A;  4IN3 B;  1XGW A;  4UI9 C;  5JIY A;  3HG0 D;  4EZJ A;  3C98 A;  3DXK G;  5ANR A;  2PNN A;  1UJK A;  4E85 A;  2HE0 A;  3FUL A;  3D9N A;  4L7T A;  3K9I A;  3L08 A;  3P2B A;  4GMR A;  3SZ7 A;  2AVP A;  4AXH A;  4I6E A;  5KNG A;  4WAF A;  3CVN A;  4GPM A;  3ULY A;  4I17 A;  4N3B A;  3AG3 E;  4YDY A;  5ANL A;  1NI1 A;  4NRH B;  2X6F A;  3LYA A;  2ETA A;  2KCV A;  4B8A A;  4QEP A;  4ABN A;  4G11 A;  2P58 C;  4TXQ A;  1MZC A;  5DIZ A;  3G2S A;  1H6P A;  1TNU A;  3DXM G;  4RLY A;  3MX3 A;  4CGV A;  3Q15 A;  5AJL A;  3VLE A;  4C0E A;  1EPU A;  5KNH D;  3KD7 A;  4YPE A;  5ENQ D;  3JCK C;  4JHJ A;  4Q94 A;  5KCM A;  3D9L A;  3IHV A;  2KZT A;  4KZ0 A;  4XX5 A;  3R7Q A;  1UW4 B;  5E75 A;  5KJN A;  3MO2 A;  3AAA C;  3CV0 A;  3ASN E;  5T3R A;  4AM9 A;  2OEW A;  2JAB A;  4L1B A;  1K8K G;  4H12 A;  5D2M C;  5KJK A;  1JWF A;  3B95 A;  4GPK A;  2WPV A;  3E33 A;  3MO0 A;  3DSV A;  4I43 A;  2CHX A;  5IY5 E;  2L0I A;  1E8W A;  3HYM B;  1H6K A;  5AYW D;  3GZ2 A;  2P9S G;  4DLQ A;  3HDX A;  3G2U A;  4HLE A;  1O5M A;  3V31 A;  5H7P A;  4R7L A;  2J49 A;  1MVH A;  3FU3 A;  1WAO 1;  4WWP A;  4PUC A;  1O1R A;  2WXM A;  2WXL A;  5KWD A;  5D0Q D;  3DSX A;  4FP7 A;  3T5V A;  2V4L A;  3ZEF A;  2VYI A;  1FT2 A;  4A1S A;  5J08 A;  3ASD A;  5BNW A;  5AQB A;  2CHZ A;  3F6Q A;  3PVL A;  4YNP A;  4PS8 A;  2QYU A;  1OWO A;  2QYJ A;  2OOE A;  4KBQ A;  2WB2 A;  2R59 A;  2NC9 A;  1Z5S C;  2GRO B;  2DZN A;  3DSW A;  3Q49 B;  3DRA A;  5DBK A;  5D66 A;  3SY2 A;  3MGB A;  3OTN A;  5ITZ F;  4DLO A;  1IQU A;  2GRM A;  2YHE A;  3ZVV A;  3U9W A;  2ILR A;  4YND A;  3M55 A;  4AIF A;  3PZD A;  3UX4 A;  3CVV A;  2NXP A;  4A3V A;  1KZP A;  5HQ8 A;  2R5S A;  3LJ3 A;  3PNL B;  2XEV A;  1XNF A;  3F9X A;  4A55 A;  3UKU G;  1ZBP A;  4BUP A;  1N52 A;  3O4Z A;  3EIJ A;  1Z6T A;  4UWK A;  4FC8 A;  3OPE A;  3LS8 A;  1GW6 A;  3X2Q E;  2WQ6 A;  4F53 A;  2OCC E;  3EDT B;  3WXX A;  2VQ2 A;  2MOW A;  4XKC A;  3CR3 A;  2OVF A;  2YIN A;  1MT6 A;  3L17 A;  2H6F A;  2AXU A;  5FIO A;  1IKN D;  1EDU A;  3LJN A;  1W3B A;  3UIN C;  4DX5 D;  1SVX A;  2ETB A;  5FQ4 A;  1HO8 A;  3PEU B;  3IHX A;  4GML A;  3SQV A;  4V3I A;  3C3R A;  3BQO A;  4LRZ A;  1E96 B;  1WM5 A;  2L0T B;  3VTX A;  3CVX A;  2EIK E;  3FUM A;  2LO6 A;  2CFU A;  3RAU A;  4GTV A;  4J7I A;  2L6J A;  3SI5 A;  1OWM A;  3B7T A;  4ANU A;  1AP7 A;  3UM0 A;  4MI5 A;  2RFM A;  2VGY A;  4JXT A;  1MJ0 A;  4GB9 A;  4APF A;  2M63 A;  1JPL A;  5AYF A;  1E8Z A;  3MO5 A;  3I5P A;  5EX0 A;  3CHR A;  4LNB A;  3R9A B;  2DIW A;  3KMA A;  2L9B A;  5BT1 A;  3QWP A;  1MUF A;  4ZFH A;  3HXC A;  1FCH A;  1E90 A;  2J07 A;  4BFR A;  2X3M A;  1SA5 A;  4HRM B;  1TNB A;  3AG2 E;  4XEI G;  4CGW A;  4F1S A;  3KEA A;  3ONL A;  4BES A;  3I3N A;  4MKT A;  4AVX A;  3FY4 A;  4GZD A;  4G1T A;  3DPD A;  4WNG A;  4F7A A;  3W9F A;  4AEZ C;  1ZB1 A;  4C9B B;  1E7V A;  2XGS A;  5JHN A;  4OYS A;  3NAW A;  4FA6 A;  4FLH A;  3ML9 A;  3TXM A;  2LAH A;  4GTQ A;  3O48 A;  3TG4 A;  3QDN A;  2DCP A;  2GRQ B;  5JJ0 A;  4Z4P A;  2IO2 C;  3ISM C;  4QQI A;  1G3N B;  2WXO A;  2IY0 C;  1ELW A;  2QFC A;  1PY1 A;  5CCL A;  3ZU7 B;  1MVX A;  3UM2 A;  4HRL A;  1TN6 A;  1MHQ A;  4KXK B;  2AXV A;  4U04 A;  4CCA A;  1ELR A;  3TGO A;  3S7B A;  3HXB A;  3OXG A;  4G24 A;  3U66 A;  3D9M A;  4BTA A;  5F6L A;  4WNE A;  4XI0 A;  4LSZ E;  4X8Q A;  4JLG A;  2ZXW E;  4O1O A;  5CRV A;  1JCQ A;  5A7D B;  4KVO A;  2ZGD A;  2O8J A;  3L13 A;  4HNA D;  3CHQ A;  4HFG A;  3QAQ A;  4I9E A;  3UT7 A;  2XPI A;  4TUM A;  3U64 A;  2Y3A A;  4TV3 A;  4DK5 A;  4GA2 A;  3S8P A;  4FHJ A;  3EU9 A;  4XI9 A;  3G2T A;  1UN8 A;  1LD7 A;  3FWV A;  3FHE A;  3L82 A;  4GCO A;  3PE3 A;  3FTV A;  3AS8 A;  3KSL A;  4P29 A;  1NA0 A;  2VGX A;  2FI7 A;  1BLX B;  4JHK A;  2Y1L E;  1S0P A;  5TTF A;  1K1A A;  3ESL A;  4J8S A;  1DCE A;  5AQ7 A;  1NFI E;  4DI3 A;  4K0R A;  2XPY A;  3ZPJ A;  2WXH A;  3APC A;  4ANX A;  5LCW C;  4AY5 A;  3MEK A;  4I2W A;  3JUI A;  4BET A;  1Z3Y A;  4DI4 A;  4K5C A;  5FQ8 A;  4FLB A;  3NQP A;  2EIJ E;  5AAO A;  3K5K A;  3ZYK A;  4RQI A;  3RSE G;  4AP2 A;  3ZUV B;  3B7U X;  3PNT B;  4RG9 A;  3SFZ A;  4N39 A;  3NOG D;  3T5X A;  2WXN A;  1LTX A;  2UY1 B;  4G25 A;  3MYV A;  4HB5 A;  1HFA A;  4GYO A;  3DWL G;  3PH0 C;  5FQ7 A;  1N54 A;  1IHG A;  3OOI A;  4HOQ A;  2FO1 E;  4BX8 A;  3TXN A;  4TXR A;  4O30 A;  3S7D A;  4EQF A;  4HOS A;  2XGM A;  4U07 A;  5F6K C;  2BTD A;  3E34 A;  1K3Z D;  2BKG A;  1BU9 A;  2C2L A;  5G04 J;  4ZHB A;  2WXR A;  4J0U A;  2CG2 A;  3TWS A;  3CHS A;  4I6J A;  2LSV A;  4YVQ C;  4N2Q A;  4BEP A;  1SW6 A;  1HH8 A;  3AJI A;  4LCT A;  4MBG A;  4HOT A;  3PZ1 A;  3AU5 A;  3FUH A;  1TJC A;  3KMJ A;  2XPZ A;  3BEE A;  4CDM A;  5BPP A;  4EZK A;  1XQH A;  4HS2 A;  3ZNG A;  4MS6 A;  2H6G A;  1HF8 A;  4MLP A;  3TL5 A;  3ML8 A;  4TXP A;  2UY1 A;  4IJD A;  3HXF A;  4GTR A;  3TWV A;  3LVQ E;  2HYZ A;  3PE4 A;  5A6C A;  5BUZ A;  4U96 D;  2PM7 A;  4J7F A;  2XZD G;  2J9Q A;  4KYO B;  3QOU A;  2J09 A;  3L16 A;  1N4S A;  3D9K A;  3RU0 A;  2LXM A;  1OWP A;  3CVU A;  2VSY A;  4A1G A;  3LDZ A;  3JQ0 A;  4I1M A;  2Q7F A;  4UI9 K;  1RZ4 A;  2J08 A;  1SA4 A;  3IV0 A;  5FZR A;  1X5B A;  5ENO D;  5FTP A;  1WG0 A;  2DYR E;  4XE0 A;  4OVV A;  4O6F A;  2CHW A;  3CVL A;  1HG5 A;  2E2E A;  2IEJ A;  3Q5M A;  3ZXS A;  3CVY A;  4ILH B;  3IKO B;  4WUY A;  1U2V G;  1JCS A;  5EX3 A;  4NVQ A;  1TNZ A;  3VLF A;  4HRN A;  1N6A A;  1FVH A;  1OCC E;  3BUA A;  2IJG X;  3EHR A;  3JUE A;  5HI7 A;  4YNM A;  1N0Q A;  1PEG A;  1O9S A;  2J4B A;  1N9A A;  4K5A B;  3VV0 A;  3R9M A;  3UQ3 A;  4ME2 A;  3ZYL A;  2LUH A;  1JUQ A;  2PM6 A;  2B6C A;  4GZC A;  1K1B A;  5T0M A;  4YPA A;  2B0O E;  1TYQ G;  4GZ6 A;  3FTS A;  2Y4T A;  2RKK A;  2QC9 A;  3M58 A;  4QEN A;  3CVP A;  4G23 A;  4ACL A;  3FTZ A;  1HXI A;  4NQ0 A;  2L6B A;  4ACK A;  5TH7 A;  3Q78 A;  2OVB A;  2BUG A;  5EG2 A;  1D8E A;  4JA7 A;  4C0M A;  3KEZ A;  5EN5 D;  3D9P A;  5JJ6 A;  2ZU6 B;  3PUK A;  3ZN3 A;  5C1D A;  3EUV A;  1MX2 A;  2XZT G;  3CHP A;  2W5Y A;  3BU8 A;  1DNP A;  2YHC A;  1WDY A;  3FH5 A;  2IU1 A;  2KCK A;  4GTO A;  4F6R D;  4JW1 A;  3QWV A;  3DSS A;  4U0Z A;  3D9O A;  3BO5 A;  4KVM A;  1X81 A;  1H6O A;  5JHB A;  3Q9N C;  4U8V D;  2HM8 A;  4GZ3 A;  2RG8 A;  1N94 A;  1LF8 A;  3V2O A;  2ION A;  2ZIS A;  4JD2 G;  2F8Y A;  4I2Z A;  4LG6 A;  5EID A;  5T4Y A;  2OEV A;  3TWW A;  4HLL A;  4IJ8 A;  5E76 A;  3SBS A;  4GMJ A;  2G46 A;  4J7W A;  4LEU A;  4U63 A;  4EHM A;  4ILG A;  2OV8 A; 
#chains in the Genus database with same CATH homology
 1OWN A;  4APO A;  3EHM A;  4HOU A;  3FFL A;  4Q69 A;  2VSX E;  2WXO A;  3CHO A;  3MZL B;  4JVS A;  5AIJ A;  5T0K A;  3PRE A;  1ELW A;  4XIF A;  2QFC A;  3CHM A;  1PY1 A;  2FO7 A;  3CK9 A;  4XZ4 A;  5CCL A;  1MVX A;  3RKV A;  2XGO A;  2CFZ A;  1OWL A;  4FJY A;  1MHQ A;  2FEZ A;  3EJN A;  4KXK B;  5FWQ A;  1SZA A;  1NA3 A;  1SZ9 A;  2AXV A;  3LY8 A;  4J6I A;  4U04 A;  4CCA A;  1ELR A;  3TGO A;  3EHN A;  3S7B A;  5F59 A;  4Y6W A;  3OXG A;  4G24 A;  4GU5 A;  3RIB A;  3S7F A;  3U66 A;  5T5G A;  3D9M A;  4BTA A;  5F6L A;  4WNE A;  3Q4A B;  4XI0 A;  5FJY A;  5CMY A;  4KMO A;  4PH4 B;  4Y6C A;  1EYH A;  1MQS A;  4JLG A;  5A7D B;  2NSZ A;  4EZL A;  4UWF A;  3QB2 A;  4KVO A;  2A5U A;  4PS3 A;  3HVE A;  3TJP A;  3VLD A;  3RJW A;  3MJW A;  2KZT B;  4J8E A;  3L13 A;  5G55 A;  4M3O A;  5FZQ A;  2O8J A;  3CHQ A;  4HFG A;  3QAQ A;  3L22 A;  3M54 A;  3D3M A;  4HVB A;  3RO2 A;  3Q47 B;  1SQM A;  3FUN A;  4BT8 A;  3SHF A;  4I9E A;  4JZY A;  2FF4 A;  2R17 C;  4IN3 B;  1XGW A;  2AW6 A;  2XPI A;  4UI9 C;  3UT7 A;  2WXJ A;  2XRZ A;  4QEO A;  4RVB A;  1FVF A;  2AWI A;  2Y3A A;  3U64 A;  4N2S A;  5JIY A;  3CBO A;  3EIQ C;  2I1J A;  1HS6 A;  4TV3 A;  5G05 J;  3HHM A;  4DK5 A;  4GA2 A;  3S8P A;  4C1Q A;  2KCL A;  3LXU X;  4FHJ A;  2V0P A;  1IQR A;  3TG5 A;  4EZJ A;  3C98 A;  1QNF A;  4XI9 A;  3G2T A;  4JEH A;  5TEG A;  1UN8 A;  3FH8 A;  5ANR A;  3QWW A;  4I9C A;  3B13 A;  4PDX A;  4D10 C;  1UJK A;  4ILI A;  4E85 A;  1H19 A;  4G2V A;  3M57 A;  1HZ4 A;  3FWV A;  4TRQ A;  3SBT B;  3FHE A;  3FUL A;  3D9N A;  4JA9 A;  4L7T A;  2WQH A;  4GAA A;  3MCX A;  4GCO A;  3FEX A;  3PE3 A;  5ARG A;  3FTV A;  3K9I A;  3AS8 A;  4K03 A;  2IOS A;  3L08 A;  2KAT A;  3P2B A;  3SZ7 A;  4P29 A;  2AVP A;  4XKB A;  4I6E A;  4AXH A;  1NA0 A;  1YA0 A;  2VGX A;  2FI7 A;  4JHK A;  4WAF A;  4ANV A;  3CVN A;  4I17 A;  3LVR E;  1S0P A;  3B7S A;  4N3B A;  5TTF A;  1NZN A;  4I6G A;  3CVQ A;  4J8S A;  3ESL A;  4B94 A;  4GZ5 A;  5KJL A;  4E6H A;  4DI3 A;  4K0R A;  2XCB A;  2XPY A;  3SGH A;  3ZPJ A;  2WXH A;  5ANL A;  1A17 A;  3SF4 A;  1U3C A;  3APC A;  2IOL A;  3PUJ A;  4H7X A;  5FT9 A;  4AY5 A;  2WXK A;  4ANX A;  3MEK A;  2VJ8 A;  4I2W A;  3JUI A;  4Q96 A;  5LP0 A;  2MHK A;  2WXI A;  4GCN A;  1Z3Y A;  4NRH B;  5G04 C;  2X6F A;  3LYA A;  3PRZ A;  4DI4 A;  1ELK A;  4FLB A;  5FQ8 A;  4J83 A;  3CK7 A;  3NQP A;  2KCV A;  4CRW A;  4B8A A;  5BV0 A;  3K5K A;  4ABN A;  3IBE A;  4G11 A;  2P58 C;  4I1A A;  4QEP A;  3OS5 A;  3ZYK A;  2EQX A;  5DIZ A;  1VDY A;  3CGH A;  3G2S A;  2X6K A;  3PS6 A;  4AP2 A;  4A3T A;  3FUF A;  3MX3 A;  4CGV A;  3Q15 A;  4UI9 J;  5AJL A;  2PL2 A;  3B7U X;  4PS7 A;  3VLE A;  3PNT B;  1H2V C;  3AS4 A;  4C0E A;  1EPU A;  2WXP A;  4GA1 A;  4RG9 A;  3SFZ A;  5CCM A;  4N39 A;  2QY7 A;  3T5X A;  2WXF A;  3DB5 A;  3U4T A;  4AJW A;  2WXN A;  2UY1 B;  3KD7 A;  3S2A A;  4YPE A;  4IYP A;  4G25 A;  3JCK C;  3MYV A;  2I2O A;  3FDH A;  5ENN A;  4JHJ A;  4Q94 A;  4QFV A;  2DBA A;  4U0S A;  5KCM A;  3D9L A;  4U0U A;  3IHV A;  2F69 A;  2KZT A;  4ATG A;  3IHY A;  4I51 A;  1HFA A;  4KZ0 A;  4XX5 A;  2WXQ A;  3R7Q A;  4J8F A;  1UW4 B;  1HU3 A;  4GYO A;  5E75 A;  3PH0 C;  3ZYM A;  3FU6 A;  3L54 A;  5KJN A;  2VGX B;  4UWL A;  5FQ7 A;  3MO2 A;  3T8M A;  4IUL A;  1N54 A;  1IHG A;  2YNQ A;  3CV0 A;  1ML9 A;  3OOI A;  4LDG A;  4HOQ A;  3FU5 A;  2C0M A;  3QJZ A;  5T3R A;  3CBP A;  3FTX A;  5AJD A;  3ZFW A;  4BX8 A;  4AM9 A;  3TXN A;  5LCW C;  2W5Z A;  5JJ7 A;  3AS5 A;  4O30 A;  3LPZ A;  4JC8 A;  4KZC A;  4L1B A;  3S7D A;  4EQF A;  4WND A;  3ZGQ A;  1Y6I A;  2XGM A;  4HOS A;  3KS2 A;  2R3A A;  4U07 A;  4H12 A;  5KJK A;  5F6K C;  1H0A A;  2BTD A;  5LCW J;  1JWF A;  4GPK A;  4LER A;  5F5E A;  4CDR A;  4FHK A;  2WPV A;  3MO0 A;  4URK A;  2C2L A;  5G04 J;  3SW9 A;  2WXR A;  4J0U A;  1H2U A;  2CG2 A;  3CHS A;  4I43 A;  3M5A A;  4OVU A;  4I6J A;  2CHX A;  4GYY A;  4B0Z A;  5LX8 A;  3FPD A;  2L0I A;  2LSV A;  2WXG A;  1EF1 C;  1E8W A;  3FEY A;  3HYM B;  3MV3 B;  4YVQ C;  1H6K A;  5D0O D;  3GZ1 A;  5AYW D;  2WMN A;  3UMV A;  3ZRH A;  4KT6 B;  3GZ2 A;  4N2Q A;  3BG1 B;  3GW4 A;  3S7J A;  1HH8 A;  4NAC A;  2VTB B;  4LCT A;  3BG0 B;  3QAR A;  2Y4U A;  4HOT A;  4I1O B;  1P5Q A;  4DLQ A;  3HDX A;  2HO1 A;  4DJA A;  3G2U A;  1INZ A;  3CVW A;  4HLE A;  2GGF A;  1ZKK A;  3AU5 A;  3FUH A;  3JQ1 A;  1TJC A;  5J90 A;  4R7L A;  3KMJ A;  2J49 A;  1MVH A;  2XPZ A;  3FU3 A;  1HE8 A;  2PQR A;  3L6A A;  2YQ8 A;  3BEE A;  2PQN A;  4CDM A;  1WAO 1;  5A23 A;  4WWP A;  5BPP A;  2I6H A;  4PUC A;  3HNA A;  4MI0 A;  2IFU A;  4UQY A;  4AV7 A;  2WXM A;  1H3I A;  3UPV A;  3CEQ A;  2WXL A;  4EZK A;  5D0Q D;  2LAI A;  1XQH A;  2IQC A;  4HS2 A;  3I4R B;  4UWG A;  4FP7 A;  4MS6 A;  3ASF A;  3E4B A;  4MLP A;  1HF8 A;  3TL5 A;  3T5V A;  2V4L A;  3ZEF A;  2VYI A;  3ML8 A;  3NZS A;  4BTB A;  2IGQ A;  1H2T C;  4FMU A;  2UY1 A;  4IJD A;  1L5J A;  2RFI A;  4A1S A;  5J08 A;  3LY9 A;  3GYZ A;  4FJZ A;  1HG2 A;  3LVQ E;  5FZS A;  1QQE A;  2HYZ A;  3ASD A;  3PE4 A;  3TAX A;  3KMT A;  3CBM A;  3VUZ A;  2BF0 X;  5BNW A;  5A6C A;  5BUZ A;  3QNK A;  3FTY A;  2CHZ A;  5JHA A;  2PM7 A;  3FUE A;  4J7F A;  1TEZ A;  3AU4 A;  2I1K A;  2J9Q A;  4KYO B;  5KJM A;  1KLX A;  3PVL A;  5LFA A;  4PS8 A;  3FU0 A;  2J09 A;  3QOU A;  5CHE E;  1OWO A;  4GYW A;  4NJ5 A;  3ONK A;  3EP0 A;  2OOE A;  3L16 A;  4KBQ A;  4BSX A;  2WB2 A;  4IRU A;  3D9K A;  1KT1 A;  2AXZ A;  2NC9 A;  2R59 A;  5JIN A;  3Q49 B;  3RU0 A;  1PC2 A;  3ENE A;  4NUR A;  3CQC B;  4EBA G;  3G2V A;  1DVP A;  2JV0 A;  4JPS A;  1OWP A;  3CVU A;  5DBK A;  3RJV A;  2X6H A;  3MGB A;  4N5C A;  3OTN A;  3OXL A;  3UT8 A;  3FUI A;  2VSY A;  3ASH A;  3FP3 A;  2LNI A;  4A1G A;  4DLO A;  4BWR A;  1IQU A;  3LDZ A;  1HX8 A;  3DAL A;  2GRM A;  3MV2 B;  2YHE A;  3FUK A;  3JQ0 A;  3ZVV A;  4I1M A;  2Q7F A;  2QPW A;  3U9W A;  4UI9 K;  4B89 A;  3FTU A;  2J08 A;  3QC1 A;  2ILR A;  4YND A;  3M55 A;  4AIF A;  3ASG A;  3IV0 A;  2V5F A;  3FH7 A;  5FZR A;  2VTB A;  1X5B A;  3CIA A;  3PZD A;  4WWO A;  2WQ7 A;  2OND A;  2FUL A;  3UX4 A;  1UN9 A;  2RD0 A;  3CVV A;  3RRM B;  3LKU A;  4TUU A;  4JL0 A;  2XRY A;  2NXP A;  4EBA A;  4A3V A;  3I4G A;  4CT0 A;  5FTP A;  5HQ8 A;  2R5S A;  3LJ3 A;  4MRU A;  5JJT A;  4XE0 A;  3PNL B;  3B7R L;  2XEV A;  4OVV A;  5EKQ D;  3R7R A;  4CT4 A;  1IYG A;  1XNF A;  4O6F A;  2LSU A;  3F9X A;  2CHW A;  4YPU A;  4A55 A;  1ZBP A;  1NP7 A;  4RZ0 A;  3CVL A;  4BUP A;  3CKC A;  1N52 A;  1HG5 A;  2E2E A;  2VSN A;  4ANW A;  3MA5 A;  3O4Z A;  3RO3 A;  4YVO A;  3EIJ A;  3Q5M A;  1Z6T A;  4UWK A;  3ZXS A;  3CVY A;  4ILH B;  3URZ A;  4RG6 A;  5T8I A;  3OXF A;  1TJF A;  4JEU A;  4FC8 A;  3OPE A;  3LS8 A;  3QKY A;  5M72 A;  1GW6 A;  3RK6 A;  3IKO B;  4WUY A;  3QK0 A;  5EX3 A;  2XQ0 A;  5G05 C;  2WQ6 A;  2BQZ A;  2HR2 A;  4J8D A;  4F53 A;  3EDT B;  4NVQ A;  3WXX A;  3JYS A;  3UT4 A;  2VQ2 A;  2MOW A;  2X38 A;  1N6C A;  5LSX A;  4XKC A;  3VLF A;  3CR3 A;  2OVF A;  1N6A A;  2X6I A;  2YIN A;  4N3A A;  1MT6 A;  1FVH A;  3L17 A;  4AOF A;  2AXU A;  4JDS A;  1EDU A;  4G26 A;  2IJG X;  3LCA A;  2XCC A;  1PAQ A;  3SNX A;  1W3B A;  5LSZ A;  5HI7 A;  4YNM A;  3M53 A;  4L2Y A;  3FTW A;  1JWG A;  1PEG A;  1BPO A;  5FQ4 A;  1O9S A;  1HO8 A;  2J4B A;  5CPR B;  1N3J A;  3CK8 A;  5LOZ A;  1U3D A;  4H7Y A;  3PEU B;  3IHX A;  3VV0 A;  4GML A;  1KT0 A;  4V3I A;  3UQ3 A;  3ZHE B;  4ME2 A;  4U8H A;  1Y8M A;  3CSF A;  3ZYL A;  3GZS A;  4LRZ A;  2GW1 A;  1E96 B;  1WM5 A;  1JUQ A;  5C2Y A;  3CKB A;  2PM6 A;  2C0L A;  1OUV A;  2L0T B;  4GZC A;  5T0M A;  4BY6 A;  4EEC A;  3F9W A;  3VTX A;  4FU3 A;  3CVX A;  4YPA A;  3FUM A;  2LO6 A;  3LEW A;  3PDN A;  2CFU A;  2VSO E;  4JHR A;  3MKQ B;  4WNF A;  2L6J A;  4J7I A;  4GZ6 A;  1WY6 A;  3FTS A;  2WM9 A;  3SI5 A;  1OWM A;  3B7T A;  4ANU A;  2Y4T A;  4DPR A;  4MI5 A;  3RRU A;  3HIZ A;  3M58 A;  4QEN A;  4WWN A;  2VGY A;  3CVP A;  4G23 A;  3IEG A;  4JXT A;  3RRN B;  4ACL A;  3FTZ A;  1HXI A;  3G2W A;  4GB9 A;  4NQ0 A;  3FUJ A;  4YNP A;  4ACK A;  5TH7 A;  5ARF A;  4APF A;  2M63 A;  2OVB A;  1JPL A;  2BUG A;  5AYF A;  2JEK A;  4RSY A;  3M59 A;  5EG2 A;  4FUL A;  1E8Z A;  4JA7 A;  3MO5 A;  3DBS A;  2J4D A;  3I5P A;  5EX0 A;  2FBN A;  3FUD A;  3KEZ A;  4C0M A;  3CHR A;  3D9P A;  5JJ6 A;  3R9A B;  4BT9 A;  2DIW A;  2ZU6 B;  3KMA A;  3CLJ A;  3APD A;  3PUK A;  4L2L A;  3ZN3 A;  2E0I A;  2L9B A;  3N71 A;  2JLB A;  4W9R A;  5BT1 A;  5EDS A;  3QWP A;  1MUF A;  2MRI A;  5C1D A;  3F9Y A;  3D9J A;  1FCH A;  1E90 A;  3CST A;  4FAD A;  3NF1 A;  2J07 A;  5G2N A;  1E7U A;  1B89 A;  3CHP A;  3ZYQ A;  2W5Y A;  4BX9 A;  1DNP A;  2UWJ G;  2YHC A;  4BFR A;  5AEN A;  4AU7 A;  1QZ2 A;  2X3M A;  1UG3 A;  3FH5 A;  2IU1 A;  2KM4 A;  2KCK A;  2WMO A;  3KAE A;  4N3C A;  2XHE A;  2CG3 A;  1E8Y A;  3ESK A;  3VTY A;  4CGW A;  4JW1 A;  3QWV A;  4F1S A;  1ZU2 A;  3RAY A;  3ONL A;  4U0Z A;  3I3N A;  4UWH A;  4MKT A;  3HVE B;  3U3W A;  4CDN A;  3SD5 A;  4AVX A;  3D9O A;  3ZW3 A;  5BV1 A;  3BO5 A;  3FY4 A;  2WVI A;  4J8O A;  3OAW A;  4GZD A;  3F9Z A;  1UJJ A;  4UQZ A;  4G1T A;  4KVM A;  1Z3X A;  5FQ6 A;  3D9I A;  3DPD A;  2I9C A;  3ZIM A;  4WNG A;  3UUX A;  3ZHE A;  5JHB A;  3CQG B;  4UQX A;  2HM8 A;  3LY7 A;  2RG8 A;  4GZ3 A;  4F7A A;  3PEV B;  4AEZ C;  4AY6 A;  4L23 A;  4HXI A;  1LF8 A;  2ION A;  4C9B B;  2PZI A;  4HOR A;  3P1U A;  1E7V A;  2XGS A;  5CMW A;  4F3V A;  5JHN A;  2V8S E;  4I2Z A;  2IF4 A;  4OYS A;  4GA0 A;  4CEM A;  2KC7 A;  1E8X A;  4E47 A;  5T4Y A;  3SWC A;  3ULQ A;  3MKQ A;  4EPZ A;  4IJ8 A;  3APF A;  5E76 A;  4FA6 A;  3SBS A;  4FLH A;  2GRL A;  3ML9 A;  4GMJ A;  3TXM A;  2LAH A;  3TG4 A;  3O48 A;  5BW8 C;  2G46 A;  3MKR A;  2DCP A;  3QDN A;  3RQ4 A;  2X6J A;  5JJ0 A;  4LEU A;  4Z4P A;  4U63 A;  3M56 A;  4LUN U;  4B8C B;  4ILG A;  2A4Z A;  2OV8 A;  3NZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...