3S7DA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 150
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7dA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7dA01
4BTBA 3ASDA 1FCHA 4GA2A 5G05C 3IEGA 4MI0A 5C1DA 1B89A 4NRHB 4O30A 3M59A 2NC9A 3PDNA 5FZSA 2G46A 3CKCA 2C0MA 3RQ4A 3F9ZA 1MVXA 4H7YA 1PEGA 4YPUA 2O8JA 4BTAA 3LCAA 3RJWA 4JDSA 2R3AA 4HOTA 1MUFA 2PQNA 3NF1A 2FO7A 3MV3B 4N3AA 4U04A 4QENA 4G25A 4AU7A 4JA9A 2AVPA 1NA0A 2V5FA 4I2ZA 4CGVA 5JHNA 4BT9A 1ZKKA 2R5SA 3RO2A 3MO2A 4J0UA 4U0ZA 3ASFA 5EX3A 2WPVA 3VTYA 2KCLA 2ONDA 5G04C 3MV2B 5LCWC 3UPVA 2PZIA 2XGOA 4G23A 3BEEA 2HO1A 1WM5A 4WUYA 3MA5A 3QWVA 4ABNA 2VGXA 5KJMA 5CCMA 3FP3A 2RFIA 3KD7A 4LDGA 4GA0A 3Q4AB 1XQHA 2IFUA 3LYAA 3OXGA 3SW9A 5EKQD 1ZBPA 1KLXA 4G2VA 4W9RA 5LSXA 3RKVA 5HI7A 3HNAA 2XGSA 4FMUA 4RG6A 3S7FA 3CKBA 2XGMA 3CVLA 2YQ8A 4LEUA 4NJ5A 3DALA 5BT1A 3OXLA 5DBKA 5LSZA 3AS4A 3CK7A 1H3IA 4JA7A 5JJ7A 3SZ7A 4H7XA 4N3BA 4YVOA 4XIFA 5T5GA 5HQ8A 3ASGA 3Q5MA 4XI9A 4AM9A 3ZN3A 3OOIA 3KAEA 3MKRA 2Q7FA 4GPKA 2VGYA 4I2WA 3Q47B 4YPAA 4YPEA 3F9XA 2KC7A 2F69A 3R9AB 3UQ3A 3U3WA 2XEVA 5D0QD 4N2QA 3VV0A 2XPIA 4I1AA 4J7IA 3F9YA 3GW4A 4GYOA 4CDRA 5M72A 1ELWA 4H12A 3S7DA 3FFLA 2HR2A 3VTXA 2MHKA 4NVQA 3CVNA 2C0LA 3QWPA 2GW1A 3ZFWA 1YA0A 3CK9A 1QQEA 1ELRA 4N5CA 2KATA 4UI9J 4UQZA 2PQRA 4GA1A 4WNGA 4U0SA 1IYGA 4QEPA 2KCKA 3URZA 4HOSA 2W5ZA 5CHEE 1A17A 4GCOA 3CBOA 4AY5A 3M56A 4BWRA 2QPWA 1HXIA 3KMTA 3TG4A 3IHXA 5TH7A 3KMJA 3CBMA 5EX0A 2Y4TA 1ML9A 5TTFA 5CCLA 3RO3A 5F6KC 4YNMA 4WNFA 4J83A 5ARGA 4AIFA 4EQFA 2VSNA 3FPDA 1HH8A 4A1SA 4MI5A 1N6AA 1MVHA 3GYZA 3BO5A 3S7JA 5AYWD 4GCNA 4AY6A 4BT8A 4J8FA 2BUGA 5TEGA 1Y8MA 4I17A 4HOQA 3O48A 3MO0A 1KT1A 5ARFA 5A7DB 2Y4UA 5FTPA 2LSVA 4BUPA 3RJVA 2C2LA 3MEKA 5A6CA 4NQ0A 2W5YA 2VYIA 3RIBA 3LKUA 2HYZA 4Y6WA 2DBAA 3MO5A 2VSYA 2IGQA 3M58A 2IF4A 1HZ4A 1NA3A 4J7FA 3SWCA 4HORA 5EG2A 5KJKA 5F59A 5BNWA 3QWWA 3M54A 2WQHA 4J8DA 5JIYA 1OUVA 1MT6A 2LSUA 4IN3B 3LY7A 4UI9C 3RAYA 3FWVA 4Z4PA 3EDTB 3VUZA 3OXFA 2JLBA 4C1QA 3F9WA 3LY9A 4KBQA 4IJDA 5FT9A 3OS5A 3KMAA 4YNPA 3N71A 3ZHEA 3SF4A 3OPEA 3RU0A 3TAXA 3DB5A 1KT0A 3EP0A 2OOEA 3ULQA 1IHGA 3Q49B 3AS8A 4N2SA 1W3BA 4GYWA 4GZ5A 4RZ0A 2FBNA 2L6JA 5FZQA 4WNEA 1N6CA 5JINA 5T0KA 4CGWA 1TJCA 3LPZA 3CBPA 3QOUA 4GZ3A 2QFCA 4J8OA 4IJ8A 4Y6CA 2KCVA 3M55A 4GYYA 3M57A 5FZRA 5KJLA 4UQXA 3ZHEB 5F5EA 4G26A 5CPRB 2FI7A 3S8PA 4UQYA 3TG5A 1NZNA 3E4BA 3PE3A 4ME2A 4F3VA 2FF4A 4JLGA 3GZ1A 5F6LA 5G05J 4HOUA 3ASHA 3JYSA 3CVPA 3UUXA 2P58C 3QDNA 5JJ6A 4YNDA 5JJ0A 2LNIA 4I9EA 4APOA 4U07A 5BW8C 3QKYA 3M5AA 1N3JA 4G24A 3CK8A 4RG9A 5DIZA 4J8EA 2UY1A 4O6FA 4JHRA 2J9QA 3CV0A 5T0MA 1WAO1 4JL0A 3CVQA 3ZGQA 4XI0A 3K9IA 3KS2A 1P5QA 2UWJG 3Q15A 4G1TA 2YHCA 2I6HA 2JV0A 2XCBA 3ZPJA 5G04J 2FEZA 4WNDA 4E47A 5LCWJ 5JJTA 2BQZA 4B94A 3GZ2A 3WXXA 3CEQA 4GZ6A 3ESKA 5AYFA 4N39A 3M53A 4I51A 4KYOB 5KJNA 3S7BA 4I9CA 2UY1B 4QEOA 2VGXB 4UI9K 4YVQC 1E96B 2PL2A 2XCCA 2VQ2A 3LY8A 1O9SA 3HYMB 3K5KA 3AS5A 3PE4A 1XNFA 5D0OD 2E2EA 1PC2A 4KXKB 1ZU2A 3TGOA 1QZ2A 5FJYA 4N3CA 3U4TA 4U0UA
chains in the Genus database with same CATH superfamily
3HXEA 5ENTD 4GMRA 3CVWA 3V30A 3I4RB 4PS7A 1HG5A 4GA2A 3FH8A 3MKQA 3DEPA 5CERB 3FUFA 4ATZD 5C1DA 4PUCA 5LP0A 3V31A 2NC9A 3CKCA 3DXKG 2C0MA 3JUIA 4IULA 1AWCB 4DK5A 3QK0A 4U8HA 2BTDA 4OAVB 1MVXA 4H7YA 4F6RD 4YPUA 3ABME 2O8JA 3LCAA 4JDSA 5J90A 3QJZA 4HVBA 1E8ZA 4K5AB 2JEKA 3RK6A 4APFA 4YDOA 4QENA 3UM1A 3NAWA 2V5FA 1A5EA 4CGVA 3MO2A 5EX3A 3VTYA 2KCLA 1UN9A 2XZDG 2VTBA 5LFAA 2PZIA 4AJWA 3DSXA 2RFMA 4ATGA 4WUYA 3T8MA 2LO6A 3QWVA 5J08A 2H6GA 2P9NG 1E8YA 4GA0A 3Q4AB 3EU5A 4OYSA 5EKQD 4NURA 1S63A 3GZSA 2XGSA 4FMUA 1K1AA 1K8KG 3CKBA 2RG8A 3JUEA 4WAFA 4HLEA 3DALA 1U3DA 2QY7A 5BT1A 3Q7FA 4RSYA 1H3IA 4JA7A 3FUJA 2BKKB 5JJ7A 4N3BA 3D9OA 4DPRA 2EIKE 3ASGA 3SD5A 3Q5MA 4ZHBA 3CVUA 4R7LA 4F53A 4I1MA 4FJZA 4GB9A 2LAHA 3NB2A 1HFAA 3KSLA 4KZ0A 1N4QA 3OOIA 3SQVA 4YPEA 1UJJA 2GRQB 1N52A 5D0QD 3VV0A 2XPIA 4I1AA 3GW4A 5EILA 4H12A 2J4BA 5IY5E 3X2QE 3FFLA 4KT6B 4LNGA 2HR2A 2VGEA 4NVQA 5CRVA 2YHEA 2C0LA 2FO1E 3UKUG 1N54A 1YA0A 4ANXA 4MKTA 1YMPA 2WXNA 4UQZA 2BEDA 3D9IA 1H19A 4U0SA 2KCKA 2V4HC 3ULYA 2AXVA 3M56A 1QBQA 4BWRA 3Q79A 3AG2E 2QPWA 3FUIA 4HLLA 5ANLA 3IHXA 3ASOE 3KMJA 5EX0A 2Y4TA 4HRMB 4I6EA 4XE0A 5CCLA 3DRAA 2VSXE 2H6FA 4WNFA 2Y3AA 4EQFA 4A1SA 4ANUA 5D2MC 1UW4B 3E30A 4GCNA 2WXPA 4J8FA 4GTVA 3FTZA 1BI8B 4A63B 2PNNA 3ZRHA 4O1OA 5FWQA 2I2OA 4I6GA 2LSVA 3FH7A 3LXUX 3IKOB 2B6CA 2VYIA 4F1SA 1PY1A 2JABA 4J6IA 1OT8A 2IF4A 4CT4A 4CCAA 3C3RA 4IRUA 5CEDB 1O1TA 2CG2A 1JCRA 5JIYA 3FDHA 4CDMA 1D9SA 1MT6A 5KNHD 4HNAD 3LY7A 3RAYA 3FWVA 3APFA 4FLBA 1UOHA 2WXIA 2JLBA 4C1QA 4KBQA 1OCCE 4YNPA 1JWGA 3ZHEA 3OPEA 3ZYMA 3VLDA 1N0RA 3EP0A 4GTSA 2Y0BG 1N94A 3KSQA 3Q49B 3MYVA 2NSZA 5BV0A 2FBNA 3IHVA 5JINA 4K0RA 4CGWA 2EIME 3EUVA 1MX2A 4FJYA 3QOUA 2QFCA 4ILHB 2J07A 2KCVA 3NZUA 3FTYA 2WXQA 4GYYA 3ZKJA 5KJLA 3EHRA 3TG5A 5BXUA 4ME2A 4F3VA 1XGWA 4JLGA 3GZ1A 4P29A 4CDNA 2LUHA 4HOUA 3JYSA 3L6AA 3UUXA 1OWNA 3DPDA 3B7BA 3CVYA 5JJ6A 1Q2ZA 3CHSA 4LUNU 2LNIA 2ZGGA 2OV8A 4JEUA 4K5CA 3M5AA 2P9KG 2EIJE 2WXOA 2IO3C 3UTMA 4RG9A 1E8XA 5DIZA 3C3OA 4O6FA 4JHRA 2J9QA 4J8YA 3NBNB 2IQCA 3I3NA 4JC8A 4GTRA 4U96D 4G1TA 4EBAG 1TN7A 4I43A 2XCBA 2QZAA 3LVRE 2KXPC 3CEQA 5T8IA 4FHKA 1IXVA 3ASNE 3SBTB 3W9GA 4HRNA 3TXMA 3FY4A 2Y69E 2IJGX 3ISMC 4PS3A 3VLEA 3CVVA 5AARA 1UJKA 2IOLA 4I9CA 2VGXB 4YVQC 1TNUA 2F0YA 2KZTA 1E96B 2GRNB 4CRWA 1UN8A 2EILE 2P9SG 5LOZA 3PNLB 4RLYA 1OWMA 2WMNA 4EZJA 3W9FA 4U0UA 1D8EA 4HI9A 5ENOD 5B3SE 3IEGA 3AU4A 4NRHB 3D9KA 2P9LG 5FZSA 4RVBA 3F6QA 3F9ZA 5AENA 4CZ2D 1PEGA 4Q69A 3B95A 4BTAA 1WG0A 3CLJA 2X3MA 2R3AA 1OY3D 2PQNA 2FO7A 4Q96A 4G25A 5AAOA 3DSVA 1IQUA 5BPPA 3NOGD 4DI4A 2AVPA 2NXPA 5JHNA 1ZKKA 2R5SA 3T8KA 3PUKA 4DLQA 3B13A 4L2YA 2WXFA 2ILRA 2ONDA 3EHQA 5G04C 3CHQA 3SFZA 5LCWC 3UPVA 3BEEA 3D9LA 1H0AA 2V4LA 2GRPB 1IQRA 2J8SD 3QAQA 4ABNA 2VGXA 5KJMA 5CCMA 3FP3A 2NYJA 1XQHA 2IFUA 3R7QA 2WXGA 3Q73A 1ZBPA 3RKVA 5HI7A 2H6IA 3G2TA 4JPSA 2WQ7A 2XS1A 4NJ5A 4N5QA 1MJ0A 1ELKA 4C0MA 3WG7E 4JB8P 3AU5A 5HQ8A 4JHKA 3DEOA 2XRZA 3HXBA 2M63A 4PS8A 1IHBA 4XI9A 3FU0A 3ZN3A 3UMVA 2VGYA 3Q47B 2KC7A 2F69A 2XEVA 1H2VC 3OAWA 4GZCA 3F9YA 4CDRA 1TR4A 1TN8A 4DI3A 2IU1A 2L9BA 3S7DA 2PM6A 5A23A 4EZKA 3VTXA 3L54A 4YDEA 3P1UA 4PDXA 3QWPA 4QFVA 3CK9A 5H7PA 1ELRA 1HO8A 1N4RA 2QYUA 4GA1A 4WNGA 3EIJA 5B1BE 3URZA 2W5ZA 5BUZA 5CHEE 4OVVA 2X6IA 4UWLA 2ZIRA 3AJIA 4JXTA 4AVXA 1HXIA 1HX8A 3QNKA 1KZOA 4KZCA 3RO3A 5F6KC 4YNMA 4HBDA 5ITZF 1G3NB 3LEWA 5LX8A 5FIOA 5ARGA 1MYOA 4AIFA 5AJLA 4G11A 3ZUVB 4MI5A 4NIKA 1DCQA 3BO5A 3S7JA 5ENQD 3PEVB 4AY6A 4BT8A 1FT1A 4F7AA 2BUGA 1QYMA 1IKND 4I17A 1KT1A 5ARFA 5A7DB 4LSZE 4BUPA 2DYSE 4HFGA 1TNYA 1SZ9A 5A6CA 4NQ0A 4Y6WA 4TXPA 5G55A 3D9PA 2F8YA 1NA3A 4J7FA 3AG3E 3UM0A 3SWCA 5F59A 4DJAA 5CEAA 3ZVVA 5EN5D 3Q9NC 3TWTA 4A3VA 4TV3A 3M54A 1N95A 3LJNA 2WQHA 1KPSB 4J8DA 1S70B 1OUVA 4C48B 4KVMA 2LSUA 2OEWA 3HXDA 4GTOA 3UT7A 4Z4PA 4DRXE 4TXRA 3C5RA 1K3ZD 4B89A 4IJDA 2YNQA 3KMAA 2DWZA 4PH4B 3SF4A 3RU0A 3U9WA 3DB5A 3ULQA 2XRYA 3AS8A 3IV0A 4GU5A 2P2CP 1TNZA 4GZ5A 1EDUA 5JHBA 2J09A 3T9KA 3LPZA 3CBPA 4GZ3A 2AW6A 4L9PA 3JQ1A 4YDYA 1MHQA 3ZHEB 1N4SA 4UQYA 5CBOA 3PZDA 4U8YD 3TWWA 3SHFA 4DX1A 3HG0D 3G2SA 1SA5A 1E7UA 2MYOA 3IHYA 1LF8A 1OWOA 3QDNA 4J7WA 2J49A 3HIZA 4DX7D 5JJ0A 1X81A 3UM3A 4APOA 3ONLA 4O1PA 1N3JA 1NI1A 3TWXA 2BKGA 3S2AA 3ESLA 4URKA 2YINA 5HS0A 2IONA 3R9MA 3MGBA 4XI0A 3KS2A 3Q15A 2YHCA 1H6KA 1H6PA 5G04J 4WNDA 4E47A 5LCWJ 2X38A 2BQZA 2F37A 3GZ2A 2R59A 2DZNA 4NACA 1SW6A 5AYFA 4I51A 3BG1B 4EBAA 3D9JA 4G8LA 2ETBA 3J5PA 1O5MA 2CFUA 3S7BA 3FTUA 3Q75A 4HQDA 4ANVA 2J08A 4CYMD 4V3IA 3J5QB 2DZOA 3RSEG 1XNFA 4X8QA 1NP7A 5D0OD 4KXKB 1ZU2A 3TGOA 1QZ2A 1BD8A 5FJYA 3ZYQA 1HG2A 3FTVA 4KVOA 1VDYA 3ASDA 3G2VA 1FCHA 3UINC 5AQAA 3KEAA 4JHJA 4MI0A 4EPZA 2G46A 3TWQA 2KZTB 4LERA 3RQ4A 4G8KA 4GTQA 4LNBA 2WM9A 4D10C 1LD8A 3PZ1A 4UWFA 3RJWA 4ACKA 4GMLA 4E6HA 4HOTA 1MUFA 1KZPA 4TUUA 3MV3B 1JCSA 4N3AA 2AXZA 3FU5A 4U04A 3UIPC 1FVFA 3JXJA 4U8VD 1NA0A 2GROB 2DIWA 3E34A 4GZDA 2FULA 3ASFA 4GTPA 2WXMA 3V2XA 1WY6A 2WPVA 3TWRA 3UKRG 3C98A 3HVEB 3FULA 1N4PA 2XGOA 3UXGA 2XEHA 4G23A 1DNPA 2HO1A 1WM5A 2P9UG 1PAQA 2HE0A 2L6BA 3AAAC 2RFIA 3KD7A 4LDGA 4LG6A 3L08A 5ANRA 3SW9A 4XKCA 3UT8A 2R02A 1KLXA 5LSXA 3UI2A 2XPYA 1BI7B 3S7FA 3I5PA 2R17C 4F1PA 3CVLA 4LEUA 5CMYA 3OXLA 5DBKA 3SGHA 4FLHA 2IOSA 3C72A 4BERA 4C9BB 3FUMA 4YVOA 4XIFA 3PZ3A 1JPLA 3FH5A 4UUCA 1E90A 1RW2A 5FQ8A 2V5QC 3U64A 4UWHA 3PEUB 2L0TB 2OVFA 3EHMA 3C3QA 2IEJA 4AM9A 3E33A 4BY6A 3PREA 3HDXA 3LVQE 3PNTB 2PM7A 3KAEA 1OCZE 4AOFA 3MKRA 4ILIA 3TWSA 3EJNA 4L23A 4ZFHA 4I2WA 4GPKA 4YPAA 5BXOA 3F9XA 2E0IA 3L13A 3R9AB 5ENSD 4N2QA 3NQPA 4C0EA 4GYOA 5M72A 1FPPA 3CR3A 3MJWA 3FUNA 2MHKA 3SO8A 3HVEA 3ML8A 3CHOA 3UT4A 3ZXPA 5B1AE 4A55A 2GRRB 1YCSB 1TJFA 2KBXA 2WB2A 4IYPA 1IYGA 4QEPA 4AV7A 4HRLA 1FVHA 4HOSA 4GCOA 3ZNGA 3CBOA 4M7CA 3SBSA 3ENEA 3APCA 4GPMA 3FUEA 1V55E 3ABLE 2AWIA 3KMTA 1N11A 3CHRA 2QYJA 4XKBA 5TH7A 3CBMA 2CHZA 4I6JA 4UWGA 3MZLB 3E32A 4TXQA 4FC8A 2R05A 1HH8A 1N6AA 1MVHA 2CFZA 3GYZA 3FUHA 3DWLG 5AYWD 3ML9A 2BF0X 1Y8MA 4DUIA 2LAIA 2R2LA 4HOQA 1MQSA 1TNBA 5T4YA 5AN8A 5FTPA 4GMJA 2CG3A 4L7TA 4XEIG 2HYZA 3RRUA 2MRIA 3UIOC 1HZ4A 5HKPA 4J8SA 2AXUA 5EG2A 5KJKA 1MZCA 2L0IA 3CSFA 3QWWA 4LRZA 2XEEA 4A1GA 2V8SE 4M3OA 3Q78A 4HS2A 4UI9C 3AG1E 4QQIA 1Z5SC 1EPUA 2VSOE 3EDTB 3EU9A 1K1BA 3OXFA 5E76A 3TXNA 2AJAA 3F9WA 3LY9A 3L16A 4MBGA 3OS5A 3BUAA 1N9AA 3TAXA 1KT0A 4GTTA 4B8AA 1BPOA 1IHGA 2P9PG 2V0PA 4HB5A 4N2SA 4GYWA 5JA4D 5FZQA 1DC2A 3DBSA 5CECB 4EHMA 1N6CA 4DX2A 5T0KA 4GAAA 4JVSA 1LD7A 5AIJA 3L82A 3R7RA 1TEZA 4WWOA 4TUMA 5FZRA 1HU3A 2CHXA 5F5EA 5CPRB 3B7RL 1NZNA 3NZSA 3PE3A 1NL4A 1HF8A 1TN6A 4K03A 2LXMA 1U2VG 3ABKE 3ASHA 3CVPA 4RQIA 2GRMA 1OCRE 3SY2A 4HXIA 4MLPA 4YNDA 3SNXA 3JCKC 3CK8A 3LS8A 4TRQA 1OCOE 3B7TA 3L9TA 2UY1A 3UX4A 5AQ9A 3CV0A 5T0MA 1WAO1 2IY0C 3CVQA 3CVXA 3QC1A 5CRUA 1P5QA 1H6OA 1U3CA 3HXCA 3HHMA 2I6HA 3ZPJA 1MX6A 4JZYA 2EINE 3WXXA 3ESKA 2XS8A 3M53A 4KYOB 4AP2A 1O1RA 1NFIE 3L17A 5AJDA 4FU3A 4FADA 3UM2A 4UI9K 2XQ0A 3VLFA 2PL2A 3CGHA 2XZTG 2XCCA 4DX6D 2MOWA 3LY8A 4BSXA 3AS5A 5HRYA 2E2EA 2XPZA 1DCEA 3PRZA 2WQ6A 4N3CA 4BTBA 3RAUA 1ZB1A 4EZLA 4Z68A 5G05C 1B89A 4O30A 4OAUC 3M59A 1H2TC 1YYHA 3FEXA 3PDNA 3TWUA 1SA4A 2LXLA 4A3TA 3JXIA 4FP7A 2B0OE 5G2NA 4B93B 5KNGA 4CEMA 4FHJA 1HE8A 2XHEA 3NF1A 1Z6TA 4AU7A 4MS6A 5EDSA 3PS6A 5JMND 3SFYA 4JA9A 3B7UX 3HXFA 2P9IG 4I2ZA 2QC9A 5CMWA 4BT9A 3RO2A 4J0UA 4U0ZA 2ETCA 3D9MA 3O4ZA 3RRMB 3MV2B 3QARA 5EYLA 3AG4E 5ENNA 1EF1C 5FQ4A 3MA5A 2GGFA 3FU6A 2DCPA 2WXLA 3FHEA 1E7VA 3LYAA 2WXJA 4CT0A 3OXGA 1JWFA 2WXKA 5KCMA 4UWKA 1TYQG 4G2VA 4W9RA 3HNAA 4RG6A 2XGMA 2F8XK 2YQ8A 2ZU6B 2ZGDA 2I1JA 3AS4A 3CK7A 3SZ7A 4H7XA 2ETAA 3Q7AA 1H2UA 5T5GA 3LDZA 4L1BA 3PZ4A 5C2YA 5ENRD 3KEZA 1E8WA 1BLXB 1Z3XA 1O1SA 2DVWA 1OWPA 2Q7FA 2X6KA 5KWDA 3UQ3A 3CSTA 3U3WA 3DXMG 4J7IA 4B8CB 2DYRE 1ELWA 3FUKA 1HS6A 4AEZC 1Y6IA 3PH0C 3CQCB 5AQBA 5FINA 3CVNA 1SQMA 1DVPA 1S0PA 4BETA 2GW1A 3ZFWA 4JD2G 1QQEA 4HI8A 4EECA 3BU8A 4N5CA 2KATA 4UI9J 5T3RA 5EYPF 4OVUA 2PQRA 3DSUA 3CHMA 3NOCD 2H6HA 4DLOA 1A17A 4AY5A 3G2UA 2RFAA 1GW6A 4BX8A 3FTWA 4BFRA 3ULEG 3PZ2A 2X6HA 4B0ZA 3ZYLA 3FUDA 2GRLA 2KM4A 2HM8A 3TG4A 3HRAA 2XENA 1ML9A 5TTFA 5AQ7A 5KBAA 3OTNA 3DSWA 3ZU7B 4J83A 2VJ8A 2VSNA 3IBEA 3FPDA 2OCCE 2WVIA 3L22A 3DPYA 2RKKA 4LCTA 3SFXA 3D9NA 4MRUA 4U63A 5TEGA 2OEVA 5E75A 3O48A 3MO0A 4GTMA 2Y4UA 3IXEA 3TJPA 2Y1LE 3RJVA 2C2LA 3FTSA 3MEKA 5FQ6A 1S64A 2W5YA 3RIBA 3FEYA 3LKUA 3T5VA 5D66A 2DBAA 3MO5A 2VSYA 3ONKA 2IGQA 2CHWA 3DSSA 4L2LA 3V2OA 3M58A 4HORA 5BNWA 3EIQC 1Z3YA 2A4ZA 3D9HA 1OXJA 4ANWA 1EYHA 4K5BA 4IN3B 1BU9A 1RZ4A 3MCXA 3Q9UC 3VUZA 2ZISA 4JEHA 4XX5A 1SVXA 5FT9A 3U66A 3N71A 4BX9A 1SZAA 2I9CA 2A5UA 3BG0B 4AXHA 2OOEA 3T5XA 4YDWA 5BV1A 1OWLA 1MX4A 1W3BA 1QNFA 4RZ0A 2L6JA 4Q94A 1UG3A 1V54E 3ZIMA 4WNEA 4DX5D 3CIAA 3ZYKA 2OVBA 1TJCA 5FQ7A 4E85A 1N0QA 3PUJA 3SI5A 4J8OA 4IJ8A 4Y6CA 4I1OB 4ACLA 1TNOA 3M55A 4FULA 4LNUD 3M57A 1AP7A 3APDA 4UQXA 1WDYA 4G26A 3S8PA 2FI7A 3CHPA 3I4GA 3QB2A 3E4BA 1L5JA 4BESA 2FF4A 3MX3A 1INZA 3D3MA 5F6LA 1FT2A 5G05J 2IO2C 4XZ4A 4WWNA 2X6JA 3MKQB 1D8DA 2WXRA 5JHAA 1JUQA 2P58C 4KMOA 3ZW3A 3EHNA 2WMOA 2J4DA 4I9EA 4U07A 5BW8C 3ZEFA 3QKYA 4G24A 4U95D 3DSTA 2I1KA 3BQOA 3ZXSA 4WWPA 4J8EA 2A5EA 4BSZB 4U7EB 1X5BA 3TWVA 3FTXA 2R03A 4JL0A 4JW1A 5CBNA 3ZGQA 3K9IA 2UWJG 2JV0A 3B7SA 2FEZA 3JQ0A 5JJTA 3TL5A 4B94A 3CQGB 2VTBB 4GZ6A 4BEPA 2ZXWE 4N39A 3RRNB 4FA6A 5KJNA 3V79K 3LJ3A 3G2WA 5EIBE 2UY1B 2RD0A 4QEOA 2EQXA 4ILGA 3FU3A 5EIDA 3P2BA 1JCQA 2X6FA 2VQ2A 3E37A 1O9SA 3HYMB 3K5KA 1LTXA 3PE4A 5ENPD 3PVLA 1PC2A 4O60A 2WXHA 5LSZA 3U4TA
chains in the Genus database with same CATH topology
1VDYA 4BTBA 3ASDA 3CVWA 3G2VA 4EZLA 3I4RB 4PS7A 1FCHA 1HG5A 4GA2A 3FH8A 5G05C 3MKQA 3IEGA 4JHJA 3AU4A 3FUFA 4MI0A 5C1DA 1B89A 4PUCA 5LP0A 4NRHB 4O30A 3D9KA 4EPZA 1H2TC 3M59A 2NC9A 3FEXA 3PDNA 5FZSA 2G46A 3CKCA 2KZTB 4LERA 2C0MA 4RVBA 3RQ4A 3JUIA 4IULA 3F9ZA 5AENA 4DK5A 2WM9A 3QK0A 2BTDA 4FP7A 4U8HA 4A3TA 4D10C 4H7YA 1MVXA 1PEGA 4YPUA 4Q69A 2O8JA 4BTAA 4UWFA 5G2NA 3LCAA 3CLJA 3RJWA 2X3MA 2R3AA 4JDSA 4CEMA 4ACKA 4GMLA 4E6HA 3QJZA 1HE8A 2PQNA 2XHEA 1E8ZA 2FO7A 3NF1A 4FHJA 1Z6TA 4TUUA 4HVBA 2JEKA 3MV3B 3RK6A 4APFA 4N3AA 2AXZA 3FU5A 4U04A 4Q96A 4QENA 4G25A 4AU7A 4MS6A 1FVFA 5EDSA 1IQUA 5BPPA 3PS6A 4JA9A 4DI4A 3B7UX 2AVPA 1NA0A 2NXPA 2V5FA 4I2ZA 5CMWA 4CGVA 5JHNA 4BT9A 2DIWA 1ZKKA 2R5SA 3RO2A 4GZDA 3MO2A 4J0UA 3PUKA 2FULA 4U0ZA 3B13A 3ASFA 3D9MA 4DLQA 2WXMA 4L2YA 1WY6A 2WXFA 5EX3A 2WPVA 3VTYA 2ILRA 2KCLA 3O4ZA 3RRMB 2ONDA 1UN9A 3C98A 5G04C 3HVEB 3FULA 3CHQA 3MV2B 3SFZA 5LCWC 2VTBA 5LFAA 3UPVA 2PZIA 4AJWA 2XGOA 3QARA 4G23A 3BEEA 1DNPA 4ATGA 2HO1A 1WM5A 3D9LA 4WUYA 5ENNA 1EF1C 1H0AA 2V4LA 5FQ4A 3T8MA 3MA5A 1PAQA 2GGFA 3FU6A 2DCPA 2WXLA 1IQRA 2LO6A 3FHEA 3QWVA 5J08A 3QAQA 4ABNA 1E7VA 2VGXA 5KJMA 5CCMA 3FP3A 2RFIA 3KD7A 1E8YA 4GA0A 4LDGA 3Q4AB 1XQHA 2IFUA 2WXJA 3LYAA 1MUFA 4OYSA 3L08A 2WXGA 3R7QA 4CT0A 3OXGA 1JWFA 2WXKA 4XKCA 5ANRA 5EKQD 3UT8A 3SW9A 1ZBPA 5KCMA 1KLXA 4NURA 4UWKA 4G2VA 4W9RA 3GZSA 5LSXA 3RKVA 5HI7A 3HNAA 2XGSA 2XPYA 4FMUA 4RG6A 3S7FA 3I5PA 2R17C 3CKBA 2RG8A 4WAFA 3G2TA 4JPSA 4HLEA 2WQ7A 2XGMA 3CVLA 2YQ8A 4LEUA 4NJ5A 3DALA 5CMYA 1U3DA 2QY7A 5BT1A 2ZU6B 3OXLA 2I1JA 5DBKA 5LSZA 3SGHA 4FLHA 4RSYA 3AS4A 2IOSA 3CK7A 1H3IA 4JA7A 3FUJA 5JJ7A 1ELKA 4C0MA 3SZ7A 4C9BB 4H7XA 3FUMA 4N3BA 4YVOA 4XIFA 1H2UA 3D9OA 1JPLA 5T5GA 3LDZA 4L1BA 4DPRA 3AU5A 3FH5A 5HQ8A 3ASGA 4JHKA 5C2YA 1E90A 2XRZA 5FQ8A 3SD5A 3Q5MA 2M63A 4UWHA 3U64A 4PS8A 3PEUB 2L0TB 3CVUA 4R7LA 4F53A 2OVFA 3EHMA 3KEZA 4FJZA 4I1MA 4GB9A 1E8WA 2LAHA 4XI9A 3FU0A 4AM9A 1HFAA 1Z3XA 4BY6A 3PREA 3HDXA 3ZN3A 1OWPA 3LVQE 3PNTB 2PM7A 3KAEA 4KZ0A 3OOIA 3UMVA 4AOFA 3MKRA 4ILIA 2Q7FA 3EJNA 2VGYA 4I2WA 3Q47B 4L23A 4GPKA 4YPAA 4YPEA 2X6KA 3F9XA 1UJJA 2KC7A 2F69A 2E0IA 3L13A 3R9AB 1N52A 3CSTA 3UQ3A 2XEVA 1H2VC 5D0QD 3U3WA 4N2QA 3VV0A 2XPIA 4I1AA 3OAWA 3NQPA 4GZCA 4B8CB 3F9YA 4J7IA 3GW4A 4C0EA 4GYOA 4CDRA 5M72A 1ELWA 3FUKA 4H12A 1HS6A 2J4BA 3CR3A 3MJWA 4AEZC 4DI3A 1Y6IA 3PH0C 2IU1A 3CQCB 2L9BA 3S7DA 2PM6A 3FUNA 5A23A 3FFLA 4KT6B 2HR2A 4EZKA 3VTXA 2MHKA 4NVQA 2YHEA 3CVNA 3L54A 1SQMA 2C0LA 3HVEA 1DVPA 3ML8A 3CHOA 3P1UA 4PDXA 3UT4A 1N54A 1S0PA 3QWPA 2GW1A 3ZFWA 4QFVA 1YA0A 3CK9A 1QQEA 4ANXA 4MKTA 4EECA 4A55A 1ELRA 1HO8A 4N5CA 2WXNA 2KATA 4UI9J 1TJFA 5T3RA 4OVUA 4UQZA 2PQRA 2WB2A 3D9IA 1H19A 4GA1A 4WNGA 3CHMA 4IYPA 4U0SA 1IYGA 4QEPA 4AV7A 3EIJA 2KCKA 3URZA 1FVHA 4HOSA 4DLOA 2W5ZA 5BUZA 5CHEE 1A17A 4GCOA 3CBOA 2AXVA 4AY5A 3SBSA 4OVVA 3ENEA 3G2UA 3M56A 2X6IA 4UWLA 1GW6A 3APCA 4BWRA 3FTWA 4BX8A 3FUEA 4BFRA 2QPWA 2X6HA 2AWIA 4B0ZA 3ZYLA 3FUDA 2GRLA 1HXIA 1HX8A 4JXTA 4AVXA 3KMTA 2KM4A 3CHRA 2HM8A 3FUIA 3TG4A 3QNKA 4XKBA 5ANLA 3IHXA 4KZCA 3KMJA 5TH7A 3CBMA 5EX0A 2Y4TA 4I6EA 4XE0A 1ML9A 5TTFA 2CHZA 4I6JA 5CCLA 3RO3A 3OTNA 4YNMA 2VSXE 5F6KC 4WNFA 2Y3AA 3LEWA 5LX8A 4J83A 5ARGA 4UWGA 4AIFA 3MZLB 4EQFA 2VJ8A 2VSNA 3IBEA 3FPDA 5AJLA 2WVIA 4FC8A 3L22A 4G11A 1HH8A 4A1SA 4MI5A 1N6AA 1MVHA 4ANUA 4LCTA 2CFZA 3GYZA 3BO5A 3S7JA 3FUHA 3PEVB 3D9NA 1UW4B 5AYWD 4GCNA 2WXPA 4AY6A 4BT8A 3ML9A 4J8FA 2BUGA 2BF0X 3FTZA 4MRUA 4F7AA 4U63A 5TEGA 1Y8MA 2LAIA 3ZRHA 4I17A 5FWQA 5E75A 4HOQA 1MQSA 3O48A 2I2OA 3MO0A 1KT1A 5T4YA 5ARFA 5A7DB 2Y4UA 3TJPA 5FTPA 4I6GA 2LSVA 3FH7A 4BUPA 3RJVA 2C2LA 3FTSA 3MEKA 5FQ6A 3LXUX 4HFGA 4GMJA 3IKOB 1SZ9A 2CG3A 4L7TA 4NQ0A 5A6CA 2W5YA 2VYIA 3RIBA 3FEYA 3LKUA 2HYZA 4F1SA 4Y6WA 3T5VA 5G55A 3RRUA 1PY1A 2DBAA 3MO5A 2VSYA 3ONKA 4J6IA 3D9PA 2IGQA 2CHWA 2MRIA 4L2LA 3M58A 2IF4A 1HZ4A 4CT4A 1NA3A 4J7FA 4CCAA 3SWCA 4IRUA 4J8SA 2AXUA 4HORA 5KJKA 5EG2A 5F59A 4N3CA 2L0IA 3CSFA 4DJAA 5BNWA 3ZVVA 3EIQC 3QWWA 4A3VA 1Z3YA 4TV3A 4LRZA 2A4ZA 3M54A 4A1GA 2WQHA 4ANWA 2CG2A 2V8SE 4J8DA 1EYHA 5JIYA 1OUVA 4M3OA 3FDHA 4CDMA 4KVMA 1MT6A 2LSUA 4IN3B 3UT7A 4HS2A 3LY7A 4UI9C 5J90A 3RAYA 3FWVA 1EPUA 2VSOE 3APFA 3MCXA 4Z4PA 3EDTB 4FLBA 3VUZA 2WXIA 3OXFA 5E76A 2JLBA 4B89A 4C1QA 3TXNA 3F9WA 3LY9A 4KBQA 3L16A 4JEHA 4XX5A 4IJDA 5FT9A 3U66A 2YNQA 3OS5A 3KMAA 4YNPA 1JWGA 3N71A 4BX9A 4PH4B 1SZAA 3SF4A 3ZHEA 3OPEA 3ZYMA 2I9CA 3RU0A 3TAXA 2A5UA 3BG0B 3U9WA 3VLDA 4AXHA 1KT0A 3DB5A 4B8AA 3EP0A 1BPOA 2OOEA 3ULQA 1IHGA 2XRYA 3T5XA 3Q49B 2V0PA 3AS8A 3IV0A 5BV1A 3MYVA 4GU5A 4N2SA 1OWLA 2NSZA 5BV0A 1W3BA 4GYWA 1QNFA 4GZ5A 4RZ0A 2FBNA 2L6JA 4Q94A 1UG3A 1EDUA 3IHVA 5FZQA 3ZIMA 3DBSA 4WNEA 1N6CA 5JINA 3CIAA 3ZYKA 4GAAA 4K0RA 4JVSA 2OVBA 5T0KA 4CGWA 1TJCA 5JHBA 2J09A 5FQ7A 4E85A 3LPZA 3PUJA 4FJYA 5AIJA 3CBPA 3QOUA 4GZ3A 2AW6A 2QFCA 3SI5A 4IJ8A 4J8OA 4Y6CA 4ILHB 2J07A 3JQ1A 2KCVA 4I1OB 3R7RA 3NZUA 4ACLA 3FTYA 2WXQA 1TEZA 3M55A 4FULA 4GYYA 4WWOA 1MHQA 3M57A 5FZRA 5KJLA 1HU3A 2CHXA 3APDA 4UQXA 3ZHEB 5F5EA 4G26A 5CPRB 2FI7A 3CHPA 3S8PA 3B7RL 3I4GA 4UQYA 3TG5A 3QB2A 3PZDA 1NZNA 3E4BA 1L5JA 3NZSA 3PE3A 4ME2A 1HF8A 4F3VA 2FF4A 3SHFA 3MX3A 1XGWA 4JLGA 1INZA 3D3MA 3GZ1A 5F6LA 3G2SA 4P29A 4CDNA 5G05J 4K03A 4XZ4A 4HOUA 3ASHA 4WWNA 3JYSA 1E7UA 2X6JA 3CVPA 3MKQB 3L6AA 3UUXA 2GRMA 3IHYA 1LF8A 1OWOA 2WXRA 1OWNA 3DPDA 5JHAA 1JUQA 2P58C 4KMOA 3ZW3A 3QDNA 3CVYA 5JJ6A 3CHSA 2J49A 2WMOA 3EHNA 3HIZA 4HXIA 4LUNU 4MLPA 4YNDA 2LNIA 3SNXA 2J4DA 5JJ0A 4I9EA 2OV8A 4APOA 4U07A 3ONLA 5BW8C 4JEUA 3ZEFA 3QKYA 3M5AA 1N3JA 4G24A 3JCKC 2I1KA 3CK8A 3LS8A 2WXOA 4RG9A 1E8XA 4TRQA 3ZXSA 3B7TA 3S2AA 4WWPA 5DIZA 4J8EA 2UY1A 3ESLA 4O6FA 4URKA 4JHRA 2YINA 3UX4A 2J9QA 1X5BA 2IQCA 3CV0A 3FTXA 5T0MA 1WAO1 3I3NA 2IONA 4JL0A 4JW1A 4JC8A 3CVQA 3MGBA 3ZGQA 4XI0A 3K9IA 3CVXA 3KS2A 3QC1A 1P5QA 2UWJG 3Q15A 4G1TA 4EBAG 1U3CA 3HHMA 2YHCA 1H6KA 2I6HA 2JV0A 3B7SA 4I43A 2XCBA 3ZPJA 5G04J 2FEZA 4WNDA 4E47A 5LCWJ 4JZYA 3JQ0A 2X38A 5JJTA 2BQZA 3LVRE 3TL5A 4B94A 3GZ2A 3CQGB 3WXXA 2VTBB 3CEQA 4GZ6A 2R59A 4FHKA 4NACA 5T8IA 3ESKA 5AYFA 3SBTB 4N39A 3RRNB 3TXMA 3M53A 4I51A 3BG1B 3FY4A 4KYOB 4AP2A 4EBAA 3D9JA 2IJGX 4PS3A 3VLEA 4FA6A 5KJNA 3CVVA 1UJKA 3LJ3A 2CFUA 3G2WA 2IOLA 4I9CA 3S7BA 3L17A 2UY1B 4HOTA 2RD0A 3FTUA 4QEOA 2EQXA 4ANVA 2VGXB 4ILGA 3FU3A 4FU3A 5AJDA 4FADA 2J08A 2XQ0A 4UI9K 4YVQC 2KZTA 3P2BA 1E96B 4V3IA 3VLFA 4CRWA 2PL2A 1UN8A 2X6FA 2XCCA 3CGHA 2VQ2A 2MOWA 3LY8A 1O9SA 3HYMB 3K5KA 4BSXA 3AS5A 3PE4A 5LOZA 1XNFA 3PNLB 1NP7A 5D0OD 2E2EA 1OWMA 3PVLA 1PC2A 2XPZA 4KXKB 1ZU2A 2WMNA 3TGOA 3PRZA 1QZ2A 5FJYA 3ZYQA 4EZJA 1HG2A 2WXHA 3FTVA 2WQ6A 4KVOA 3U4TA 4U0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BTB A;  3ASD A;  1FCH A;  4GA2 A;  5G05 C;  3IEG A;  4MI0 A;  5C1D A;  1B89 A;  4NRH B;  4O30 A;  3M59 A;  2NC9 A;  3PDN A;  5FZS A;  2G46 A;  3CKC A;  2C0M A;  3RQ4 A;  3F9Z A;  1MVX A;  4H7Y A;  1PEG A;  4YPU A;  2O8J A;  4BTA A;  3LCA A;  3RJW A;  4JDS A;  2R3A A;  4HOT A;  1MUF A;  2PQN A;  3NF1 A;  2FO7 A;  3MV3 B;  4N3A A;  4U04 A;  4QEN A;  4G25 A;  4AU7 A;  4JA9 A;  2AVP A;  1NA0 A;  2V5F A;  4I2Z A;  4CGV A;  5JHN A;  4BT9 A;  1ZKK A;  2R5S A;  3RO2 A;  3MO2 A;  4J0U A;  4U0Z A;  3ASF A;  5EX3 A;  2WPV A;  3VTY A;  2KCL A;  2OND A;  5G04 C;  3MV2 B;  5LCW C;  3UPV A;  2PZI A;  2XGO A;  4G23 A;  3BEE A;  2HO1 A;  1WM5 A;  4WUY A;  3MA5 A;  3QWV A;  4ABN A;  2VGX A;  5KJM A;  5CCM A;  3FP3 A;  2RFI A;  3KD7 A;  4LDG A;  4GA0 A;  3Q4A B;  1XQH A;  2IFU A;  3LYA A;  3OXG A;  3SW9 A;  5EKQ D;  1ZBP A;  1KLX A;  4G2V A;  4W9R A;  5LSX A;  3RKV A;  5HI7 A;  3HNA A;  2XGS A;  4FMU A;  4RG6 A;  3S7F A;  3CKB A;  2XGM A;  3CVL A;  2YQ8 A;  4LEU A;  4NJ5 A;  3DAL A;  5BT1 A;  3OXL A;  5DBK A;  5LSZ A;  3AS4 A;  3CK7 A;  1H3I A;  4JA7 A;  5JJ7 A;  3SZ7 A;  4H7X A;  4N3B A;  4YVO A;  4XIF A;  5T5G A;  5HQ8 A;  3ASG A;  3Q5M A;  4XI9 A;  4AM9 A;  3ZN3 A;  3OOI A;  3KAE A;  3MKR A;  2Q7F A;  4GPK A;  2VGY A;  4I2W A;  3Q47 B;  4YPA A;  4YPE A;  3F9X A;  2KC7 A;  2F69 A;  3R9A B;  3UQ3 A;  3U3W A;  2XEV A;  5D0Q D;  4N2Q A;  3VV0 A;  2XPI A;  4I1A A;  4J7I A;  3F9Y A;  3GW4 A;  4GYO A;  4CDR A;  5M72 A;  1ELW A;  4H12 A;  3S7D A;  3FFL A;  2HR2 A;  3VTX A;  2MHK A;  4NVQ A;  3CVN A;  2C0L A;  3QWP A;  2GW1 A;  3ZFW A;  1YA0 A;  3CK9 A;  1QQE A;  1ELR A;  4N5C A;  2KAT A;  4UI9 J;  4UQZ A;  2PQR A;  4GA1 A;  4WNG A;  4U0S A;  1IYG A;  4QEP A;  2KCK A;  3URZ A;  4HOS A;  2W5Z A;  5CHE E;  1A17 A;  4GCO A;  3CBO A;  4AY5 A;  3M56 A;  4BWR A;  2QPW A;  1HXI A;  3KMT A;  3TG4 A;  3IHX A;  5TH7 A;  3KMJ A;  3CBM A;  5EX0 A;  2Y4T A;  1ML9 A;  5TTF A;  5CCL A;  3RO3 A;  5F6K C;  4YNM A;  4WNF A;  4J83 A;  5ARG A;  4AIF A;  4EQF A;  2VSN A;  3FPD A;  1HH8 A;  4A1S A;  4MI5 A;  1N6A A;  1MVH A;  3GYZ A;  3BO5 A;  3S7J A;  5AYW D;  4GCN A;  4AY6 A;  4BT8 A;  4J8F A;  2BUG A;  5TEG A;  1Y8M A;  4I17 A;  4HOQ A;  3O48 A;  3MO0 A;  1KT1 A;  5ARF A;  5A7D B;  2Y4U A;  5FTP A;  2LSV A;  4BUP A;  3RJV A;  2C2L A;  3MEK A;  5A6C A;  4NQ0 A;  2W5Y A;  2VYI A;  3RIB A;  3LKU A;  2HYZ A;  4Y6W A;  2DBA A;  3MO5 A;  2VSY A;  2IGQ A;  3M58 A;  2IF4 A;  1HZ4 A;  1NA3 A;  4J7F A;  3SWC A;  4HOR A;  5EG2 A;  5KJK A;  5F59 A;  5BNW A;  3QWW A;  3M54 A;  2WQH A;  4J8D A;  5JIY A;  1OUV A;  1MT6 A;  2LSU A;  4IN3 B;  3LY7 A;  4UI9 C;  3RAY A;  3FWV A;  4Z4P A;  3EDT B;  3VUZ A;  3OXF A;  2JLB A;  4C1Q A;  3F9W A;  3LY9 A;  4KBQ A;  4IJD A;  5FT9 A;  3OS5 A;  3KMA A;  4YNP A;  3N71 A;  3ZHE A;  3SF4 A;  3OPE A;  3RU0 A;  3TAX A;  3DB5 A;  1KT0 A;  3EP0 A;  2OOE A;  3ULQ A;  1IHG A;  3Q49 B;  3AS8 A;  4N2S A;  1W3B A;  4GYW A;  4GZ5 A;  4RZ0 A;  2FBN A;  2L6J A;  5FZQ A;  4WNE A;  1N6C A;  5JIN A;  5T0K A;  4CGW A;  1TJC A;  3LPZ A;  3CBP A;  3QOU A;  4GZ3 A;  2QFC A;  4J8O A;  4IJ8 A;  4Y6C A;  2KCV A;  3M55 A;  4GYY A;  3M57 A;  5FZR A;  5KJL A;  4UQX A;  3ZHE B;  5F5E A;  4G26 A;  5CPR B;  2FI7 A;  3S8P A;  4UQY A;  3TG5 A;  1NZN A;  3E4B A;  3PE3 A;  4ME2 A;  4F3V A;  2FF4 A;  4JLG A;  3GZ1 A;  5F6L A;  5G05 J;  4HOU A;  3ASH A;  3JYS A;  3CVP A;  3UUX A;  2P58 C;  3QDN A;  5JJ6 A;  4YND A;  5JJ0 A;  2LNI A;  4I9E A;  4APO A;  4U07 A;  5BW8 C;  3QKY A;  3M5A A;  1N3J A;  4G24 A;  3CK8 A;  4RG9 A;  5DIZ A;  4J8E A;  2UY1 A;  4O6F A;  4JHR A;  2J9Q A;  3CV0 A;  5T0M A;  1WAO 1;  4JL0 A;  3CVQ A;  3ZGQ A;  4XI0 A;  3K9I A;  3KS2 A;  1P5Q A;  2UWJ G;  3Q15 A;  4G1T A;  2YHC A;  2I6H A;  2JV0 A;  2XCB A;  3ZPJ A;  5G04 J;  2FEZ A;  4WND A;  4E47 A;  5LCW J;  5JJT A;  2BQZ A;  4B94 A;  3GZ2 A;  3WXX A;  3CEQ A;  4GZ6 A;  3ESK A;  5AYF A;  4N39 A;  3M53 A;  4I51 A;  4KYO B;  5KJN A;  3S7B A;  4I9C A;  2UY1 B;  4QEO A;  2VGX B;  4UI9 K;  4YVQ C;  1E96 B;  2PL2 A;  2XCC A;  2VQ2 A;  3LY8 A;  1O9S A;  3HYM B;  3K5K A;  3AS5 A;  3PE4 A;  1XNF A;  5D0O D;  2E2E A;  1PC2 A;  4KXK B;  1ZU2 A;  3TGO A;  1QZ2 A;  5FJY A;  4N3C A;  3U4T A;  4U0U A; 
#chains in the Genus database with same CATH topology
 3HXE A;  5ENT D;  4GMR A;  3CVW A;  3V30 A;  3I4R B;  4PS7 A;  1HG5 A;  4GA2 A;  3FH8 A;  3MKQ A;  3DEP A;  5CER B;  3FUF A;  4ATZ D;  5C1D A;  4PUC A;  5LP0 A;  3V31 A;  2NC9 A;  3CKC A;  3DXK G;  2C0M A;  3JUI A;  4IUL A;  1AWC B;  4DK5 A;  3QK0 A;  4U8H A;  2BTD A;  4OAV B;  1MVX A;  4H7Y A;  4F6R D;  4YPU A;  3ABM E;  2O8J A;  3LCA A;  4JDS A;  5J90 A;  3QJZ A;  4HVB A;  1E8Z A;  4K5A B;  2JEK A;  3RK6 A;  4APF A;  4YDO A;  4QEN A;  3UM1 A;  3NAW A;  2V5F A;  1A5E A;  4CGV A;  3MO2 A;  5EX3 A;  3VTY A;  2KCL A;  1UN9 A;  2XZD G;  2VTB A;  5LFA A;  2PZI A;  4AJW A;  3DSX A;  2RFM A;  4ATG A;  4WUY A;  3T8M A;  2LO6 A;  3QWV A;  5J08 A;  2H6G A;  2P9N G;  1E8Y A;  4GA0 A;  3Q4A B;  3EU5 A;  4OYS A;  5EKQ D;  4NUR A;  1S63 A;  3GZS A;  2XGS A;  4FMU A;  1K1A A;  1K8K G;  3CKB A;  2RG8 A;  3JUE A;  4WAF A;  4HLE A;  3DAL A;  1U3D A;  2QY7 A;  5BT1 A;  3Q7F A;  4RSY A;  1H3I A;  4JA7 A;  3FUJ A;  2BKK B;  5JJ7 A;  4N3B A;  3D9O A;  4DPR A;  2EIK E;  3ASG A;  3SD5 A;  3Q5M A;  4ZHB A;  3CVU A;  4R7L A;  4F53 A;  4I1M A;  4FJZ A;  4GB9 A;  2LAH A;  3NB2 A;  1HFA A;  3KSL A;  4KZ0 A;  1N4Q A;  3OOI A;  3SQV A;  4YPE A;  1UJJ A;  2GRQ B;  1N52 A;  5D0Q D;  3VV0 A;  2XPI A;  4I1A A;  3GW4 A;  5EIL A;  4H12 A;  2J4B A;  5IY5 E;  3X2Q E;  3FFL A;  4KT6 B;  4LNG A;  2HR2 A;  2VGE A;  4NVQ A;  5CRV A;  2YHE A;  2C0L A;  2FO1 E;  3UKU G;  1N54 A;  1YA0 A;  4ANX A;  4MKT A;  1YMP A;  2WXN A;  4UQZ A;  2BED A;  3D9I A;  1H19 A;  4U0S A;  2KCK A;  2V4H C;  3ULY A;  2AXV A;  3M56 A;  1QBQ A;  4BWR A;  3Q79 A;  3AG2 E;  2QPW A;  3FUI A;  4HLL A;  5ANL A;  3IHX A;  3ASO E;  3KMJ A;  5EX0 A;  2Y4T A;  4HRM B;  4I6E A;  4XE0 A;  5CCL A;  3DRA A;  2VSX E;  2H6F A;  4WNF A;  2Y3A A;  4EQF A;  4A1S A;  4ANU A;  5D2M C;  1UW4 B;  3E30 A;  4GCN A;  2WXP A;  4J8F A;  4GTV A;  3FTZ A;  1BI8 B;  4A63 B;  2PNN A;  3ZRH A;  4O1O A;  5FWQ A;  2I2O A;  4I6G A;  2LSV A;  3FH7 A;  3LXU X;  3IKO B;  2B6C A;  2VYI A;  4F1S A;  1PY1 A;  2JAB A;  4J6I A;  1OT8 A;  2IF4 A;  4CT4 A;  4CCA A;  3C3R A;  4IRU A;  5CED B;  1O1T A;  2CG2 A;  1JCR A;  5JIY A;  3FDH A;  4CDM A;  1D9S A;  1MT6 A;  5KNH D;  4HNA D;  3LY7 A;  3RAY A;  3FWV A;  3APF A;  4FLB A;  1UOH A;  2WXI A;  2JLB A;  4C1Q A;  4KBQ A;  1OCC E;  4YNP A;  1JWG A;  3ZHE A;  3OPE A;  3ZYM A;  3VLD A;  1N0R A;  3EP0 A;  4GTS A;  2Y0B G;  1N94 A;  3KSQ A;  3Q49 B;  3MYV A;  2NSZ A;  5BV0 A;  2FBN A;  3IHV A;  5JIN A;  4K0R A;  4CGW A;  2EIM E;  3EUV A;  1MX2 A;  4FJY A;  3QOU A;  2QFC A;  4ILH B;  2J07 A;  2KCV A;  3NZU A;  3FTY A;  2WXQ A;  4GYY A;  3ZKJ A;  5KJL A;  3EHR A;  3TG5 A;  5BXU A;  4ME2 A;  4F3V A;  1XGW A;  4JLG A;  3GZ1 A;  4P29 A;  4CDN A;  2LUH A;  4HOU A;  3JYS A;  3L6A A;  3UUX A;  1OWN A;  3DPD A;  3B7B A;  3CVY A;  5JJ6 A;  1Q2Z A;  3CHS A;  4LUN U;  2LNI A;  2ZGG A;  2OV8 A;  4JEU A;  4K5C A;  3M5A A;  2P9K G;  2EIJ E;  2WXO A;  2IO3 C;  3UTM A;  4RG9 A;  1E8X A;  5DIZ A;  3C3O A;  4O6F A;  4JHR A;  2J9Q A;  4J8Y A;  3NBN B;  2IQC A;  3I3N A;  4JC8 A;  4GTR A;  4U96 D;  4G1T A;  4EBA G;  1TN7 A;  4I43 A;  2XCB A;  2QZA A;  3LVR E;  2KXP C;  3CEQ A;  5T8I A;  4FHK A;  1IXV A;  3ASN E;  3SBT B;  3W9G A;  4HRN A;  3TXM A;  3FY4 A;  2Y69 E;  2IJG X;  3ISM C;  4PS3 A;  3VLE A;  3CVV A;  5AAR A;  1UJK A;  2IOL A;  4I9C A;  2VGX B;  4YVQ C;  1TNU A;  2F0Y A;  2KZT A;  1E96 B;  2GRN B;  4CRW A;  1UN8 A;  2EIL E;  2P9S G;  5LOZ A;  3PNL B;  4RLY A;  1OWM A;  2WMN A;  4EZJ A;  3W9F A;  4U0U A;  1D8E A;  4HI9 A;  5ENO D;  5B3S E;  3IEG A;  3AU4 A;  4NRH B;  3D9K A;  2P9L G;  5FZS A;  4RVB A;  3F6Q A;  3F9Z A;  5AEN A;  4CZ2 D;  1PEG A;  4Q69 A;  3B95 A;  4BTA A;  1WG0 A;  3CLJ A;  2X3M A;  2R3A A;  1OY3 D;  2PQN A;  2FO7 A;  4Q96 A;  4G25 A;  5AAO A;  3DSV A;  1IQU A;  5BPP A;  3NOG D;  4DI4 A;  2AVP A;  2NXP A;  5JHN A;  1ZKK A;  2R5S A;  3T8K A;  3PUK A;  4DLQ A;  3B13 A;  4L2Y A;  2WXF A;  2ILR A;  2OND A;  3EHQ A;  5G04 C;  3CHQ A;  3SFZ A;  5LCW C;  3UPV A;  3BEE A;  3D9L A;  1H0A A;  2V4L A;  2GRP B;  1IQR A;  2J8S D;  3QAQ A;  4ABN A;  2VGX A;  5KJM A;  5CCM A;  3FP3 A;  2NYJ A;  1XQH A;  2IFU A;  3R7Q A;  2WXG A;  3Q73 A;  1ZBP A;  3RKV A;  5HI7 A;  2H6I A;  3G2T A;  4JPS A;  2WQ7 A;  2XS1 A;  4NJ5 A;  4N5Q A;  1MJ0 A;  1ELK A;  4C0M A;  3WG7 E;  4JB8 P;  3AU5 A;  5HQ8 A;  4JHK A;  3DEO A;  2XRZ A;  3HXB A;  2M63 A;  4PS8 A;  1IHB A;  4XI9 A;  3FU0 A;  3ZN3 A;  3UMV A;  2VGY A;  3Q47 B;  2KC7 A;  2F69 A;  2XEV A;  1H2V C;  3OAW A;  4GZC A;  3F9Y A;  4CDR A;  1TR4 A;  1TN8 A;  4DI3 A;  2IU1 A;  2L9B A;  3S7D A;  2PM6 A;  5A23 A;  4EZK A;  3VTX A;  3L54 A;  4YDE A;  3P1U A;  4PDX A;  3QWP A;  4QFV A;  3CK9 A;  5H7P A;  1ELR A;  1HO8 A;  1N4R A;  2QYU A;  4GA1 A;  4WNG A;  3EIJ A;  5B1B E;  3URZ A;  2W5Z A;  5BUZ A;  5CHE E;  4OVV A;  2X6I A;  4UWL A;  2ZIR A;  3AJI A;  4JXT A;  4AVX A;  1HXI A;  1HX8 A;  3QNK A;  1KZO A;  4KZC A;  3RO3 A;  5F6K C;  4YNM A;  4HBD A;  5ITZ F;  1G3N B;  3LEW A;  5LX8 A;  5FIO A;  5ARG A;  1MYO A;  4AIF A;  5AJL A;  4G11 A;  3ZUV B;  4MI5 A;  4NIK A;  1DCQ A;  3BO5 A;  3S7J A;  5ENQ D;  3PEV B;  4AY6 A;  4BT8 A;  1FT1 A;  4F7A A;  2BUG A;  1QYM A;  1IKN D;  4I17 A;  1KT1 A;  5ARF A;  5A7D B;  4LSZ E;  4BUP A;  2DYS E;  4HFG A;  1TNY A;  1SZ9 A;  5A6C A;  4NQ0 A;  4Y6W A;  4TXP A;  5G55 A;  3D9P A;  2F8Y A;  1NA3 A;  4J7F A;  3AG3 E;  3UM0 A;  3SWC A;  5F59 A;  4DJA A;  5CEA A;  3ZVV A;  5EN5 D;  3Q9N C;  3TWT A;  4A3V A;  4TV3 A;  3M54 A;  1N95 A;  3LJN A;  2WQH A;  1KPS B;  4J8D A;  1S70 B;  1OUV A;  4C48 B;  4KVM A;  2LSU A;  2OEW A;  3HXD A;  4GTO A;  3UT7 A;  4Z4P A;  4DRX E;  4TXR A;  3C5R A;  1K3Z D;  4B89 A;  4IJD A;  2YNQ A;  3KMA A;  2DWZ A;  4PH4 B;  3SF4 A;  3RU0 A;  3U9W A;  3DB5 A;  3ULQ A;  2XRY A;  3AS8 A;  3IV0 A;  4GU5 A;  2P2C P;  1TNZ A;  4GZ5 A;  1EDU A;  5JHB A;  2J09 A;  3T9K A;  3LPZ A;  3CBP A;  4GZ3 A;  2AW6 A;  4L9P A;  3JQ1 A;  4YDY A;  1MHQ A;  3ZHE B;  1N4S A;  4UQY A;  5CBO A;  3PZD A;  4U8Y D;  3TWW A;  3SHF A;  4DX1 A;  3HG0 D;  3G2S A;  1SA5 A;  1E7U A;  2MYO A;  3IHY A;  1LF8 A;  1OWO A;  3QDN A;  4J7W A;  2J49 A;  3HIZ A;  4DX7 D;  5JJ0 A;  1X81 A;  3UM3 A;  4APO A;  3ONL A;  4O1P A;  1N3J A;  1NI1 A;  3TWX A;  2BKG A;  3S2A A;  3ESL A;  4URK A;  2YIN A;  5HS0 A;  2ION A;  3R9M A;  3MGB A;  4XI0 A;  3KS2 A;  3Q15 A;  2YHC A;  1H6K A;  1H6P A;  5G04 J;  4WND A;  4E47 A;  5LCW J;  2X38 A;  2BQZ A;  2F37 A;  3GZ2 A;  2R59 A;  2DZN A;  4NAC A;  1SW6 A;  5AYF A;  4I51 A;  3BG1 B;  4EBA A;  3D9J A;  4G8L A;  2ETB A;  3J5P A;  1O5M A;  2CFU A;  3S7B A;  3FTU A;  3Q75 A;  4HQD A;  4ANV A;  2J08 A;  4CYM D;  4V3I A;  3J5Q B;  2DZO A;  3RSE G;  1XNF A;  4X8Q A;  1NP7 A;  5D0O D;  4KXK B;  1ZU2 A;  3TGO A;  1QZ2 A;  1BD8 A;  5FJY A;  3ZYQ A;  1HG2 A;  3FTV A;  4KVO A;  1VDY A;  3ASD A;  3G2V A;  1FCH A;  3UIN C;  5AQA A;  3KEA A;  4JHJ A;  4MI0 A;  4EPZ A;  2G46 A;  3TWQ A;  2KZT B;  4LER A;  3RQ4 A;  4G8K A;  4GTQ A;  4LNB A;  2WM9 A;  4D10 C;  1LD8 A;  3PZ1 A;  4UWF A;  3RJW A;  4ACK A;  4GML A;  4E6H A;  4HOT A;  1MUF A;  1KZP A;  4TUU A;  3MV3 B;  1JCS A;  4N3A A;  2AXZ A;  3FU5 A;  4U04 A;  3UIP C;  1FVF A;  3JXJ A;  4U8V D;  1NA0 A;  2GRO B;  2DIW A;  3E34 A;  4GZD A;  2FUL A;  3ASF A;  4GTP A;  2WXM A;  3V2X A;  1WY6 A;  2WPV A;  3TWR A;  3UKR G;  3C98 A;  3HVE B;  3FUL A;  1N4P A;  2XGO A;  3UXG A;  2XEH A;  4G23 A;  1DNP A;  2HO1 A;  1WM5 A;  2P9U G;  1PAQ A;  2HE0 A;  2L6B A;  3AAA C;  2RFI A;  3KD7 A;  4LDG A;  4LG6 A;  3L08 A;  5ANR A;  3SW9 A;  4XKC A;  3UT8 A;  2R02 A;  1KLX A;  5LSX A;  3UI2 A;  2XPY A;  1BI7 B;  3S7F A;  3I5P A;  2R17 C;  4F1P A;  3CVL A;  4LEU A;  5CMY A;  3OXL A;  5DBK A;  3SGH A;  4FLH A;  2IOS A;  3C72 A;  4BER A;  4C9B B;  3FUM A;  4YVO A;  4XIF A;  3PZ3 A;  1JPL A;  3FH5 A;  4UUC A;  1E90 A;  1RW2 A;  5FQ8 A;  2V5Q C;  3U64 A;  4UWH A;  3PEU B;  2L0T B;  2OVF A;  3EHM A;  3C3Q A;  2IEJ A;  4AM9 A;  3E33 A;  4BY6 A;  3PRE A;  3HDX A;  3LVQ E;  3PNT B;  2PM7 A;  3KAE A;  1OCZ E;  4AOF A;  3MKR A;  4ILI A;  3TWS A;  3EJN A;  4L23 A;  4ZFH A;  4I2W A;  4GPK A;  4YPA A;  5BXO A;  3F9X A;  2E0I A;  3L13 A;  3R9A B;  5ENS D;  4N2Q A;  3NQP A;  4C0E A;  4GYO A;  5M72 A;  1FPP A;  3CR3 A;  3MJW A;  3FUN A;  2MHK A;  3SO8 A;  3HVE A;  3ML8 A;  3CHO A;  3UT4 A;  3ZXP A;  5B1A E;  4A55 A;  2GRR B;  1YCS B;  1TJF A;  2KBX A;  2WB2 A;  4IYP A;  1IYG A;  4QEP A;  4AV7 A;  4HRL A;  1FVH A;  4HOS A;  4GCO A;  3ZNG A;  3CBO A;  4M7C A;  3SBS A;  3ENE A;  3APC A;  4GPM A;  3FUE A;  1V55 E;  3ABL E;  2AWI A;  3KMT A;  1N11 A;  3CHR A;  2QYJ A;  4XKB A;  5TH7 A;  3CBM A;  2CHZ A;  4I6J A;  4UWG A;  3MZL B;  3E32 A;  4TXQ A;  4FC8 A;  2R05 A;  1HH8 A;  1N6A A;  1MVH A;  2CFZ A;  3GYZ A;  3FUH A;  3DWL G;  5AYW D;  3ML9 A;  2BF0 X;  1Y8M A;  4DUI A;  2LAI A;  2R2L A;  4HOQ A;  1MQS A;  1TNB A;  5T4Y A;  5AN8 A;  5FTP A;  4GMJ A;  2CG3 A;  4L7T A;  4XEI G;  2HYZ A;  3RRU A;  2MRI A;  3UIO C;  1HZ4 A;  5HKP A;  4J8S A;  2AXU A;  5EG2 A;  5KJK A;  1MZC A;  2L0I A;  3CSF A;  3QWW A;  4LRZ A;  2XEE A;  4A1G A;  2V8S E;  4M3O A;  3Q78 A;  4HS2 A;  4UI9 C;  3AG1 E;  4QQI A;  1Z5S C;  1EPU A;  2VSO E;  3EDT B;  3EU9 A;  1K1B A;  3OXF A;  5E76 A;  3TXN A;  2AJA A;  3F9W A;  3LY9 A;  3L16 A;  4MBG A;  3OS5 A;  3BUA A;  1N9A A;  3TAX A;  1KT0 A;  4GTT A;  4B8A A;  1BPO A;  1IHG A;  2P9P G;  2V0P A;  4HB5 A;  4N2S A;  4GYW A;  5JA4 D;  5FZQ A;  1DC2 A;  3DBS A;  5CEC B;  4EHM A;  1N6C A;  4DX2 A;  5T0K A;  4GAA A;  4JVS A;  1LD7 A;  5AIJ A;  3L82 A;  3R7R A;  1TEZ A;  4WWO A;  4TUM A;  5FZR A;  1HU3 A;  2CHX A;  5F5E A;  5CPR B;  3B7R L;  1NZN A;  3NZS A;  3PE3 A;  1NL4 A;  1HF8 A;  1TN6 A;  4K03 A;  2LXM A;  1U2V G;  3ABK E;  3ASH A;  3CVP A;  4RQI A;  2GRM A;  1OCR E;  3SY2 A;  4HXI A;  4MLP A;  4YND A;  3SNX A;  3JCK C;  3CK8 A;  3LS8 A;  4TRQ A;  1OCO E;  3B7T A;  3L9T A;  2UY1 A;  3UX4 A;  5AQ9 A;  3CV0 A;  5T0M A;  1WAO 1;  2IY0 C;  3CVQ A;  3CVX A;  3QC1 A;  5CRU A;  1P5Q A;  1H6O A;  1U3C A;  3HXC A;  3HHM A;  2I6H A;  3ZPJ A;  1MX6 A;  4JZY A;  2EIN E;  3WXX A;  3ESK A;  2XS8 A;  3M53 A;  4KYO B;  4AP2 A;  1O1R A;  1NFI E;  3L17 A;  5AJD A;  4FU3 A;  4FAD A;  3UM2 A;  4UI9 K;  2XQ0 A;  3VLF A;  2PL2 A;  3CGH A;  2XZT G;  2XCC A;  4DX6 D;  2MOW A;  3LY8 A;  4BSX A;  3AS5 A;  5HRY A;  2E2E A;  2XPZ A;  1DCE A;  3PRZ A;  2WQ6 A;  4N3C A;  4BTB A;  3RAU A;  1ZB1 A;  4EZL A;  4Z68 A;  5G05 C;  1B89 A;  4O30 A;  4OAU C;  3M59 A;  1H2T C;  1YYH A;  3FEX A;  3PDN A;  3TWU A;  1SA4 A;  2LXL A;  4A3T A;  3JXI A;  4FP7 A;  2B0O E;  5G2N A;  4B93 B;  5KNG A;  4CEM A;  4FHJ A;  1HE8 A;  2XHE A;  3NF1 A;  1Z6T A;  4AU7 A;  4MS6 A;  5EDS A;  3PS6 A;  5JMN D;  3SFY A;  4JA9 A;  3B7U X;  3HXF A;  2P9I G;  4I2Z A;  2QC9 A;  5CMW A;  4BT9 A;  3RO2 A;  4J0U A;  4U0Z A;  2ETC A;  3D9M A;  3O4Z A;  3RRM B;  3MV2 B;  3QAR A;  5EYL A;  3AG4 E;  5ENN A;  1EF1 C;  5FQ4 A;  3MA5 A;  2GGF A;  3FU6 A;  2DCP A;  2WXL A;  3FHE A;  1E7V A;  3LYA A;  2WXJ A;  4CT0 A;  3OXG A;  1JWF A;  2WXK A;  5KCM A;  4UWK A;  1TYQ G;  4G2V A;  4W9R A;  3HNA A;  4RG6 A;  2XGM A;  2F8X K;  2YQ8 A;  2ZU6 B;  2ZGD A;  2I1J A;  3AS4 A;  3CK7 A;  3SZ7 A;  4H7X A;  2ETA A;  3Q7A A;  1H2U A;  5T5G A;  3LDZ A;  4L1B A;  3PZ4 A;  5C2Y A;  5ENR D;  3KEZ A;  1E8W A;  1BLX B;  1Z3X A;  1O1S A;  2DVW A;  1OWP A;  2Q7F A;  2X6K A;  5KWD A;  3UQ3 A;  3CST A;  3U3W A;  3DXM G;  4J7I A;  4B8C B;  2DYR E;  1ELW A;  3FUK A;  1HS6 A;  4AEZ C;  1Y6I A;  3PH0 C;  3CQC B;  5AQB A;  5FIN A;  3CVN A;  1SQM A;  1DVP A;  1S0P A;  4BET A;  2GW1 A;  3ZFW A;  4JD2 G;  1QQE A;  4HI8 A;  4EEC A;  3BU8 A;  4N5C A;  2KAT A;  4UI9 J;  5T3R A;  5EYP F;  4OVU A;  2PQR A;  3DSU A;  3CHM A;  3NOC D;  2H6H A;  4DLO A;  1A17 A;  4AY5 A;  3G2U A;  2RFA A;  1GW6 A;  4BX8 A;  3FTW A;  4BFR A;  3ULE G;  3PZ2 A;  2X6H A;  4B0Z A;  3ZYL A;  3FUD A;  2GRL A;  2KM4 A;  2HM8 A;  3TG4 A;  3HRA A;  2XEN A;  1ML9 A;  5TTF A;  5AQ7 A;  5KBA A;  3OTN A;  3DSW A;  3ZU7 B;  4J83 A;  2VJ8 A;  2VSN A;  3IBE A;  3FPD A;  2OCC E;  2WVI A;  3L22 A;  3DPY A;  2RKK A;  4LCT A;  3SFX A;  3D9N A;  4MRU A;  4U63 A;  5TEG A;  2OEV A;  5E75 A;  3O48 A;  3MO0 A;  4GTM A;  2Y4U A;  3IXE A;  3TJP A;  2Y1L E;  3RJV A;  2C2L A;  3FTS A;  3MEK A;  5FQ6 A;  1S64 A;  2W5Y A;  3RIB A;  3FEY A;  3LKU A;  3T5V A;  5D66 A;  2DBA A;  3MO5 A;  2VSY A;  3ONK A;  2IGQ A;  2CHW A;  3DSS A;  4L2L A;  3V2O A;  3M58 A;  4HOR A;  5BNW A;  3EIQ C;  1Z3Y A;  2A4Z A;  3D9H A;  1OXJ A;  4ANW A;  1EYH A;  4K5B A;  4IN3 B;  1BU9 A;  1RZ4 A;  3MCX A;  3Q9U C;  3VUZ A;  2ZIS A;  4JEH A;  4XX5 A;  1SVX A;  5FT9 A;  3U66 A;  3N71 A;  4BX9 A;  1SZA A;  2I9C A;  2A5U A;  3BG0 B;  4AXH A;  2OOE A;  3T5X A;  4YDW A;  5BV1 A;  1OWL A;  1MX4 A;  1W3B A;  1QNF A;  4RZ0 A;  2L6J A;  4Q94 A;  1UG3 A;  1V54 E;  3ZIM A;  4WNE A;  4DX5 D;  3CIA A;  3ZYK A;  2OVB A;  1TJC A;  5FQ7 A;  4E85 A;  1N0Q A;  3PUJ A;  3SI5 A;  4J8O A;  4IJ8 A;  4Y6C A;  4I1O B;  4ACL A;  1TNO A;  3M55 A;  4FUL A;  4LNU D;  3M57 A;  1AP7 A;  3APD A;  4UQX A;  1WDY A;  4G26 A;  3S8P A;  2FI7 A;  3CHP A;  3I4G A;  3QB2 A;  3E4B A;  1L5J A;  4BES A;  2FF4 A;  3MX3 A;  1INZ A;  3D3M A;  5F6L A;  1FT2 A;  5G05 J;  2IO2 C;  4XZ4 A;  4WWN A;  2X6J A;  3MKQ B;  1D8D A;  2WXR A;  5JHA A;  1JUQ A;  2P58 C;  4KMO A;  3ZW3 A;  3EHN A;  2WMO A;  2J4D A;  4I9E A;  4U07 A;  5BW8 C;  3ZEF A;  3QKY A;  4G24 A;  4U95 D;  3DST A;  2I1K A;  3BQO A;  3ZXS A;  4WWP A;  4J8E A;  2A5E A;  4BSZ B;  4U7E B;  1X5B A;  3TWV A;  3FTX A;  2R03 A;  4JL0 A;  4JW1 A;  5CBN A;  3ZGQ A;  3K9I A;  2UWJ G;  2JV0 A;  3B7S A;  2FEZ A;  3JQ0 A;  5JJT A;  3TL5 A;  4B94 A;  3CQG B;  2VTB B;  4GZ6 A;  4BEP A;  2ZXW E;  4N39 A;  3RRN B;  4FA6 A;  5KJN A;  3V79 K;  3LJ3 A;  3G2W A;  5EIB E;  2UY1 B;  2RD0 A;  4QEO A;  2EQX A;  4ILG A;  3FU3 A;  5EID A;  3P2B A;  1JCQ A;  2X6F A;  2VQ2 A;  3E37 A;  1O9S A;  3HYM B;  3K5K A;  1LTX A;  3PE4 A;  5ENP D;  3PVL A;  1PC2 A;  4O60 A;  2WXH A;  5LSZ A;  3U4T A; 
#chains in the Genus database with same CATH homology
 1VDY A;  4BTB A;  3ASD A;  3CVW A;  3G2V A;  4EZL A;  3I4R B;  4PS7 A;  1FCH A;  1HG5 A;  4GA2 A;  3FH8 A;  5G05 C;  3MKQ A;  3IEG A;  4JHJ A;  3AU4 A;  3FUF A;  4MI0 A;  5C1D A;  1B89 A;  4PUC A;  5LP0 A;  4NRH B;  4O30 A;  3D9K A;  4EPZ A;  1H2T C;  3M59 A;  2NC9 A;  3FEX A;  3PDN A;  5FZS A;  2G46 A;  3CKC A;  2KZT B;  4LER A;  2C0M A;  4RVB A;  3RQ4 A;  3JUI A;  4IUL A;  3F9Z A;  5AEN A;  4DK5 A;  2WM9 A;  3QK0 A;  2BTD A;  4FP7 A;  4U8H A;  4A3T A;  4D10 C;  4H7Y A;  1MVX A;  1PEG A;  4YPU A;  4Q69 A;  2O8J A;  4BTA A;  4UWF A;  5G2N A;  3LCA A;  3CLJ A;  3RJW A;  2X3M A;  2R3A A;  4JDS A;  4CEM A;  4ACK A;  4GML A;  4E6H A;  3QJZ A;  1HE8 A;  2PQN A;  2XHE A;  1E8Z A;  2FO7 A;  3NF1 A;  4FHJ A;  1Z6T A;  4TUU A;  4HVB A;  2JEK A;  3MV3 B;  3RK6 A;  4APF A;  4N3A A;  2AXZ A;  3FU5 A;  4U04 A;  4Q96 A;  4QEN A;  4G25 A;  4AU7 A;  4MS6 A;  1FVF A;  5EDS A;  1IQU A;  5BPP A;  3PS6 A;  4JA9 A;  4DI4 A;  3B7U X;  2AVP A;  1NA0 A;  2NXP A;  2V5F A;  4I2Z A;  5CMW A;  4CGV A;  5JHN A;  4BT9 A;  2DIW A;  1ZKK A;  2R5S A;  3RO2 A;  4GZD A;  3MO2 A;  4J0U A;  3PUK A;  2FUL A;  4U0Z A;  3B13 A;  3ASF A;  3D9M A;  4DLQ A;  2WXM A;  4L2Y A;  1WY6 A;  2WXF A;  5EX3 A;  2WPV A;  3VTY A;  2ILR A;  2KCL A;  3O4Z A;  3RRM B;  2OND A;  1UN9 A;  3C98 A;  5G04 C;  3HVE B;  3FUL A;  3CHQ A;  3MV2 B;  3SFZ A;  5LCW C;  2VTB A;  5LFA A;  3UPV A;  2PZI A;  4AJW A;  2XGO A;  3QAR A;  4G23 A;  3BEE A;  1DNP A;  4ATG A;  2HO1 A;  1WM5 A;  3D9L A;  4WUY A;  5ENN A;  1EF1 C;  1H0A A;  2V4L A;  5FQ4 A;  3T8M A;  3MA5 A;  1PAQ A;  2GGF A;  3FU6 A;  2DCP A;  2WXL A;  1IQR A;  2LO6 A;  3FHE A;  3QWV A;  5J08 A;  3QAQ A;  4ABN A;  1E7V A;  2VGX A;  5KJM A;  5CCM A;  3FP3 A;  2RFI A;  3KD7 A;  1E8Y A;  4GA0 A;  4LDG A;  3Q4A B;  1XQH A;  2IFU A;  2WXJ A;  3LYA A;  1MUF A;  4OYS A;  3L08 A;  2WXG A;  3R7Q A;  4CT0 A;  3OXG A;  1JWF A;  2WXK A;  4XKC A;  5ANR A;  5EKQ D;  3UT8 A;  3SW9 A;  1ZBP A;  5KCM A;  1KLX A;  4NUR A;  4UWK A;  4G2V A;  4W9R A;  3GZS A;  5LSX A;  3RKV A;  5HI7 A;  3HNA A;  2XGS A;  2XPY A;  4FMU A;  4RG6 A;  3S7F A;  3I5P A;  2R17 C;  3CKB A;  2RG8 A;  4WAF A;  3G2T A;  4JPS A;  4HLE A;  2WQ7 A;  2XGM A;  3CVL A;  2YQ8 A;  4LEU A;  4NJ5 A;  3DAL A;  5CMY A;  1U3D A;  2QY7 A;  5BT1 A;  2ZU6 B;  3OXL A;  2I1J A;  5DBK A;  5LSZ A;  3SGH A;  4FLH A;  4RSY A;  3AS4 A;  2IOS A;  3CK7 A;  1H3I A;  4JA7 A;  3FUJ A;  5JJ7 A;  1ELK A;  4C0M A;  3SZ7 A;  4C9B B;  4H7X A;  3FUM A;  4N3B A;  4YVO A;  4XIF A;  1H2U A;  3D9O A;  1JPL A;  5T5G A;  3LDZ A;  4L1B A;  4DPR A;  3AU5 A;  3FH5 A;  5HQ8 A;  3ASG A;  4JHK A;  5C2Y A;  1E90 A;  2XRZ A;  5FQ8 A;  3SD5 A;  3Q5M A;  2M63 A;  4UWH A;  3U64 A;  4PS8 A;  3PEU B;  2L0T B;  3CVU A;  4R7L A;  4F53 A;  2OVF A;  3EHM A;  3KEZ A;  4FJZ A;  4I1M A;  4GB9 A;  1E8W A;  2LAH A;  4XI9 A;  3FU0 A;  4AM9 A;  1HFA A;  1Z3X A;  4BY6 A;  3PRE A;  3HDX A;  3ZN3 A;  1OWP A;  3LVQ E;  3PNT B;  2PM7 A;  3KAE A;  4KZ0 A;  3OOI A;  3UMV A;  4AOF A;  3MKR A;  4ILI A;  2Q7F A;  3EJN A;  2VGY A;  4I2W A;  3Q47 B;  4L23 A;  4GPK A;  4YPA A;  4YPE A;  2X6K A;  3F9X A;  1UJJ A;  2KC7 A;  2F69 A;  2E0I A;  3L13 A;  3R9A B;  1N52 A;  3CST A;  3UQ3 A;  2XEV A;  1H2V C;  5D0Q D;  3U3W A;  4N2Q A;  3VV0 A;  2XPI A;  4I1A A;  3OAW A;  3NQP A;  4GZC A;  4B8C B;  3F9Y A;  4J7I A;  3GW4 A;  4C0E A;  4GYO A;  4CDR A;  5M72 A;  1ELW A;  3FUK A;  4H12 A;  1HS6 A;  2J4B A;  3CR3 A;  3MJW A;  4AEZ C;  4DI3 A;  1Y6I A;  3PH0 C;  2IU1 A;  3CQC B;  2L9B A;  3S7D A;  2PM6 A;  3FUN A;  5A23 A;  3FFL A;  4KT6 B;  2HR2 A;  4EZK A;  3VTX A;  2MHK A;  4NVQ A;  2YHE A;  3CVN A;  3L54 A;  1SQM A;  2C0L A;  3HVE A;  1DVP A;  3ML8 A;  3CHO A;  3P1U A;  4PDX A;  3UT4 A;  1N54 A;  1S0P A;  3QWP A;  2GW1 A;  3ZFW A;  4QFV A;  1YA0 A;  3CK9 A;  1QQE A;  4ANX A;  4MKT A;  4EEC A;  4A55 A;  1ELR A;  1HO8 A;  4N5C A;  2WXN A;  2KAT A;  4UI9 J;  1TJF A;  5T3R A;  4OVU A;  4UQZ A;  2PQR A;  2WB2 A;  3D9I A;  1H19 A;  4GA1 A;  4WNG A;  3CHM A;  4IYP A;  4U0S A;  1IYG A;  4QEP A;  4AV7 A;  3EIJ A;  2KCK A;  3URZ A;  1FVH A;  4HOS A;  4DLO A;  2W5Z A;  5BUZ A;  5CHE E;  1A17 A;  4GCO A;  3CBO A;  2AXV A;  4AY5 A;  3SBS A;  4OVV A;  3ENE A;  3G2U A;  3M56 A;  2X6I A;  4UWL A;  1GW6 A;  3APC A;  4BWR A;  3FTW A;  4BX8 A;  3FUE A;  4BFR A;  2QPW A;  2X6H A;  2AWI A;  4B0Z A;  3ZYL A;  3FUD A;  2GRL A;  1HXI A;  1HX8 A;  4JXT A;  4AVX A;  3KMT A;  2KM4 A;  3CHR A;  2HM8 A;  3FUI A;  3TG4 A;  3QNK A;  4XKB A;  5ANL A;  3IHX A;  4KZC A;  3KMJ A;  5TH7 A;  3CBM A;  5EX0 A;  2Y4T A;  4I6E A;  4XE0 A;  1ML9 A;  5TTF A;  2CHZ A;  4I6J A;  5CCL A;  3RO3 A;  3OTN A;  4YNM A;  2VSX E;  5F6K C;  4WNF A;  2Y3A A;  3LEW A;  5LX8 A;  4J83 A;  5ARG A;  4UWG A;  4AIF A;  3MZL B;  4EQF A;  2VJ8 A;  2VSN A;  3IBE A;  3FPD A;  5AJL A;  2WVI A;  4FC8 A;  3L22 A;  4G11 A;  1HH8 A;  4A1S A;  4MI5 A;  1N6A A;  1MVH A;  4ANU A;  4LCT A;  2CFZ A;  3GYZ A;  3BO5 A;  3S7J A;  3FUH A;  3PEV B;  3D9N A;  1UW4 B;  5AYW D;  4GCN A;  2WXP A;  4AY6 A;  4BT8 A;  3ML9 A;  4J8F A;  2BUG A;  2BF0 X;  3FTZ A;  4MRU A;  4F7A A;  4U63 A;  5TEG A;  1Y8M A;  2LAI A;  3ZRH A;  4I17 A;  5FWQ A;  5E75 A;  4HOQ A;  1MQS A;  3O48 A;  2I2O A;  3MO0 A;  1KT1 A;  5T4Y A;  5ARF A;  5A7D B;  2Y4U A;  3TJP A;  5FTP A;  4I6G A;  2LSV A;  3FH7 A;  4BUP A;  3RJV A;  2C2L A;  3FTS A;  3MEK A;  5FQ6 A;  3LXU X;  4HFG A;  4GMJ A;  3IKO B;  1SZ9 A;  2CG3 A;  4L7T A;  4NQ0 A;  5A6C A;  2W5Y A;  2VYI A;  3RIB A;  3FEY A;  3LKU A;  2HYZ A;  4F1S A;  4Y6W A;  3T5V A;  5G55 A;  3RRU A;  1PY1 A;  2DBA A;  3MO5 A;  2VSY A;  3ONK A;  4J6I A;  3D9P A;  2IGQ A;  2CHW A;  2MRI A;  4L2L A;  3M58 A;  2IF4 A;  1HZ4 A;  4CT4 A;  1NA3 A;  4J7F A;  4CCA A;  3SWC A;  4IRU A;  4J8S A;  2AXU A;  4HOR A;  5KJK A;  5EG2 A;  5F59 A;  4N3C A;  2L0I A;  3CSF A;  4DJA A;  5BNW A;  3ZVV A;  3EIQ C;  3QWW A;  4A3V A;  1Z3Y A;  4TV3 A;  4LRZ A;  2A4Z A;  3M54 A;  4A1G A;  2WQH A;  4ANW A;  2CG2 A;  2V8S E;  4J8D A;  1EYH A;  5JIY A;  1OUV A;  4M3O A;  3FDH A;  4CDM A;  4KVM A;  1MT6 A;  2LSU A;  4IN3 B;  3UT7 A;  4HS2 A;  3LY7 A;  4UI9 C;  5J90 A;  3RAY A;  3FWV A;  1EPU A;  2VSO E;  3APF A;  3MCX A;  4Z4P A;  3EDT B;  4FLB A;  3VUZ A;  2WXI A;  3OXF A;  5E76 A;  2JLB A;  4B89 A;  4C1Q A;  3TXN A;  3F9W A;  3LY9 A;  4KBQ A;  3L16 A;  4JEH A;  4XX5 A;  4IJD A;  5FT9 A;  3U66 A;  2YNQ A;  3OS5 A;  3KMA A;  4YNP A;  1JWG A;  3N71 A;  4BX9 A;  4PH4 B;  1SZA A;  3SF4 A;  3ZHE A;  3OPE A;  3ZYM A;  2I9C A;  3RU0 A;  3TAX A;  2A5U A;  3BG0 B;  3U9W A;  3VLD A;  4AXH A;  1KT0 A;  3DB5 A;  4B8A A;  3EP0 A;  1BPO A;  2OOE A;  3ULQ A;  1IHG A;  2XRY A;  3T5X A;  3Q49 B;  2V0P A;  3AS8 A;  3IV0 A;  5BV1 A;  3MYV A;  4GU5 A;  4N2S A;  1OWL A;  2NSZ A;  5BV0 A;  1W3B A;  4GYW A;  1QNF A;  4GZ5 A;  4RZ0 A;  2FBN A;  2L6J A;  4Q94 A;  1UG3 A;  1EDU A;  3IHV A;  5FZQ A;  3ZIM A;  3DBS A;  4WNE A;  1N6C A;  5JIN A;  3CIA A;  3ZYK A;  4GAA A;  4K0R A;  4JVS A;  2OVB A;  5T0K A;  4CGW A;  1TJC A;  5JHB A;  2J09 A;  5FQ7 A;  4E85 A;  3LPZ A;  3PUJ A;  4FJY A;  5AIJ A;  3CBP A;  3QOU A;  4GZ3 A;  2AW6 A;  2QFC A;  3SI5 A;  4IJ8 A;  4J8O A;  4Y6C A;  4ILH B;  2J07 A;  3JQ1 A;  2KCV A;  4I1O B;  3R7R A;  3NZU A;  4ACL A;  3FTY A;  2WXQ A;  1TEZ A;  3M55 A;  4FUL A;  4GYY A;  4WWO A;  1MHQ A;  3M57 A;  5FZR A;  5KJL A;  1HU3 A;  2CHX A;  3APD A;  4UQX A;  3ZHE B;  5F5E A;  4G26 A;  5CPR B;  2FI7 A;  3CHP A;  3S8P A;  3B7R L;  3I4G A;  4UQY A;  3TG5 A;  3QB2 A;  3PZD A;  1NZN A;  3E4B A;  1L5J A;  3NZS A;  3PE3 A;  4ME2 A;  1HF8 A;  4F3V A;  2FF4 A;  3SHF A;  3MX3 A;  1XGW A;  4JLG A;  1INZ A;  3D3M A;  3GZ1 A;  5F6L A;  3G2S A;  4P29 A;  4CDN A;  5G05 J;  4K03 A;  4XZ4 A;  4HOU A;  3ASH A;  4WWN A;  3JYS A;  1E7U A;  2X6J A;  3CVP A;  3MKQ B;  3L6A A;  3UUX A;  2GRM A;  3IHY A;  1LF8 A;  1OWO A;  2WXR A;  1OWN A;  3DPD A;  5JHA A;  1JUQ A;  2P58 C;  4KMO A;  3ZW3 A;  3QDN A;  3CVY A;  5JJ6 A;  3CHS A;  2J49 A;  2WMO A;  3EHN A;  3HIZ A;  4HXI A;  4LUN U;  4MLP A;  4YND A;  2LNI A;  3SNX A;  2J4D A;  5JJ0 A;  4I9E A;  2OV8 A;  4APO A;  4U07 A;  3ONL A;  5BW8 C;  4JEU A;  3ZEF A;  3QKY A;  3M5A A;  1N3J A;  4G24 A;  3JCK C;  2I1K A;  3CK8 A;  3LS8 A;  2WXO A;  4RG9 A;  1E8X A;  4TRQ A;  3ZXS A;  3B7T A;  3S2A A;  4WWP A;  5DIZ A;  4J8E A;  2UY1 A;  3ESL A;  4O6F A;  4URK A;  4JHR A;  2YIN A;  3UX4 A;  2J9Q A;  1X5B A;  2IQC A;  3CV0 A;  3FTX A;  5T0M A;  1WAO 1;  3I3N A;  2ION A;  4JL0 A;  4JW1 A;  4JC8 A;  3CVQ A;  3MGB A;  3ZGQ A;  4XI0 A;  3K9I A;  3CVX A;  3KS2 A;  3QC1 A;  1P5Q A;  2UWJ G;  3Q15 A;  4G1T A;  4EBA G;  1U3C A;  3HHM A;  2YHC A;  1H6K A;  2I6H A;  2JV0 A;  3B7S A;  4I43 A;  2XCB A;  3ZPJ A;  5G04 J;  2FEZ A;  4WND A;  4E47 A;  5LCW J;  4JZY A;  3JQ0 A;  2X38 A;  5JJT A;  2BQZ A;  3LVR E;  3TL5 A;  4B94 A;  3GZ2 A;  3CQG B;  3WXX A;  2VTB B;  3CEQ A;  4GZ6 A;  2R59 A;  4FHK A;  4NAC A;  5T8I A;  3ESK A;  5AYF A;  3SBT B;  4N39 A;  3RRN B;  3TXM A;  3M53 A;  4I51 A;  3BG1 B;  3FY4 A;  4KYO B;  4AP2 A;  4EBA A;  3D9J A;  2IJG X;  4PS3 A;  3VLE A;  4FA6 A;  5KJN A;  3CVV A;  1UJK A;  3LJ3 A;  2CFU A;  3G2W A;  2IOL A;  4I9C A;  3S7B A;  3L17 A;  2UY1 B;  4HOT A;  2RD0 A;  3FTU A;  4QEO A;  2EQX A;  4ANV A;  2VGX B;  4ILG A;  3FU3 A;  4FU3 A;  5AJD A;  4FAD A;  2J08 A;  2XQ0 A;  4UI9 K;  4YVQ C;  2KZT A;  3P2B A;  1E96 B;  4V3I A;  3VLF A;  4CRW A;  2PL2 A;  1UN8 A;  2X6F A;  2XCC A;  3CGH A;  2VQ2 A;  2MOW A;  3LY8 A;  1O9S A;  3HYM B;  3K5K A;  4BSX A;  3AS5 A;  3PE4 A;  5LOZ A;  1XNF A;  3PNL B;  1NP7 A;  5D0O D;  2E2E A;  1OWM A;  3PVL A;  1PC2 A;  2XPZ A;  4KXK B;  1ZU2 A;  2WMN A;  3TGO A;  3PRZ A;  1QZ2 A;  5FJY A;  3ZYQ A;  4EZJ A;  1HG2 A;  2WXH A;  3FTV A;  2WQ6 A;  4KVO A;  3U4T A;  4U0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...