3S7DA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 150
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7dA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7dA01
2W5YA 3K5KA 3PDNA 3RO2A 5CPRB 3CVLA 3UPVA 3CK8A 5LSXA 2VGXA 2Y4TA 4W9RA 3RO3A 3F9ZA 2IF4A 4UQZA 2LSVA 4YVOA 4Y6WA 1ELWA 2R3AA 4BUPA 2WQHA 3SF4A 1Y8MA 4BT9A 3ZN3A 3AS5A 3BEEA 3Q5MA 3RJVA 4N3BA 3OXGA 3KMTA 3M56A 5T0MA 3AS8A 2VSYA 3VTYA 2LSUA 4I51A 4U07A 3WXXA 4Y6CA 2J9QA 4XI0A 3QKYA 1HH8A 3OXLA 3FPDA 3RIBA 4YNPA 3CVPA 1XQHA 5D0OD 2HO1A 5F59A 2UWJG 4GCOA 4UI9C 4FMUA 1ZKKA 4JA9A 3CVNA 1YA0A 2XPIA 2KC7A 3Q47B 5LCWC 2XGMA 4J0UA 3LCAA 1OUVA 5FT9A 3Q4AB 4QENA 2KATA 4RZ0A 2IFUA 2AVPA 3EP0A 2NC9A 3M53A 3GW4A 5LSZA 4G26A 3F9WA 2WPVA 2VGXB 1MVHA 4N2QA 4UI9K 2XEVA 4I1AA 3LY8A 4O30A 4GA0A 2MHKA 2FBNA 3ASFA 4RG9A 3CVQA 1WAO1 4YPEA 5CCMA 3RKVA 2QFCA 4KYOB 2P58C 4N5CA 4IJDA 4XI9A 4U0SA 5KJMA 5AYWD 1NA0A 3O48A 2FI7A 4U04A 4N3CA 3N71A 5CCLA 3F9XA 3URZA 3MKRA 4YNDA 3GZ1A 4Z4PA 5F5EA 3SZ7A 1KT1A 4BTAA 3ESKA 2BUGA 4GZ3A 1ML9A 2HYZA 4WNDA 3MV3B 4CDRA 4JHRA 1MT6A 3FWVA 3QDNA 3S7DA 2FO7A 2FEZA 1KLXA 5TTFA 1NA3A 3QOUA 4YPUA 1QQEA 3TGOA 3OS5A 1FCHA 5T5GA 4C1QA 4APOA 3HNAA 1N6AA 4G1TA 3MV2B 2VQ2A 2PZIA 2IGQA 5TEGA 5G04C 4JL0A 2W5ZA 3F9YA 4JDSA 4GYWA 4J8FA 2G46A 2BQZA 4NJ5A 4ME2A 4KBQA 1ZBPA 3S7JA 2VSNA 3LY9A 5G05J 3S7BA 1HXIA 4AM9A 1E96B 3VTXA 1N6CA 4BWRA 4IJ8A 2XGOA 4U0UA 2QPWA 4NVQA 3RAYA 5HQ8A 4CGWA 3LY7A 4J7FA 1O9SA 5HI7A 2O8JA 4YNMA 3RQ4A 4GZ5A 5JHNA 3S8PA 5EKQD 4GYOA 2XCCA 5BNWA 3CK7A 2XGSA 4RG6A 3LKUA 4AY5A 3CKBA 1QZ2A 2Q7FA 1IYGA 4HORA 3KMAA 3ULQA 1HZ4A 2HR2A 2PQRA 1PEGA 3OPEA 3QWVA 5M72A 4UI9J 3VV0A 3UQ3A 4AU7A 3CBMA 2V5FA 4JLGA 3PE4A 1IHGA 5BW8C 4QEOA 2ONDA 1W3BA 5F6LA 3M5AA 2L6JA 3SWCA 3ZFWA 4UQYA 2KCKA 5KJLA 1NZNA 3M54A 3MEKA 5EX0A 4H7YA 4JA7A 3CBPA 2C2LA 1A17A 5EG2A 4HOUA 5JJ0A 5F6KC 4G25A 2FF4A 4LEUA 4I9EA 1KT0A 5FTPA 4HOTA 2VYIA 3MO5A 4HOQA 2YQ8A 5KJNA 3VUZA 2YHCA 3ASHA 4YVQC 1MVXA 5T0KA 4G2VA 2VGYA 2PL2A 3UUXA 4G23A 3CKCA 5FZRA 3FP3A 4AY6A 2E2EA 5D0QD 1N3JA 3IEGA 5JJ7A 3EDTB 5DBKA 3FFLA 3SW9A 5BT1A 4H7XA 4NQ0A 3KAEA 3ZHEB 4CGVA 4WNFA 5KJKA 5AYFA 5CHEE 4J7IA 2UY1A 3U3WA 4XIFA 4N2SA 3U4TA 4N3AA 5G05C 4H12A 1PC2A 2XCBA 3GYZA 4G24A 1ZU2A 4N39A 4WNGA 3LYAA 3QWPA 5ARGA 3RU0A 3M55A 4GZ6A 4GPKA 2GW1A 4U0ZA 4I17A 5FZSA 5JJ6A 2RFIA 3TAXA 4LDGA 1XNFA 3Q49B 1H3IA 3ASDA 2R5SA 5EX3A 2KCVA 3DB5A 3HYMB 3S7FA 3OOIA 1TJCA 5G04J 3IHXA 2JLBA 5JJTA 4A1SA 3MO2A 4WNEA 3TG5A 4ABNA 4QEPA 5A6CA 4HOSA 4GYYA 4UQXA 2KCLA 4AIFA 4NRHB 4KXKB 3NF1A 4J8DA 1P5QA 3ZHEA 3BO5A 4J83A 2C0LA 5JINA 3M59A 3CK9A 3JYSA 5DIZA 4I2ZA 4E47A 3KMJA 3MO0A 3ASGA 5LCWJ 2F69A 1ELRA 2UY1B 2C0MA 5JIYA 4IN3B 4BTBA 4WUYA 3DALA 2PQNA 5TH7A 3QWWA 3GZ2A 5ARFA 4GCNA 3MA5A 4EQFA 4MI0A 3CV0A 5A7DB 5FZQA 2OOEA 3TG4A 3KD7A 2LNIA 3R9AB 5C1DA 4I2WA 3AS4A 1MUFA 3M57A 4J8OA 4MI5A 3LPZA 3ZPJA 3CEQA 4GA1A 2DBAA 3ZGQA 3K9IA 3PE3A 3Q15A 1B89A 4J8EA 4BT8A 3OXFA 3CBOA 4GA2A 4O6FA 3E4BA 3RJWA 3KS2A 3M58A 5FJYA 4I9CA 1WM5A 2Y4UA 4F3VA 4YPAA 2JV0A 2I6HA 4B94A
chains in the Genus database with same CATH superfamily
4UWGA 4JEUA 3UM1A 4B0ZA 5AENA 1DNPA 1V55E 5D66A 3UPVA 1LF8A 5LSXA 4W9RA 4UQZA 2LSVA 2A5UA 1ELWA 3HRAA 1EF1C 2F37A 2X6KA 5CEAA 4BUPA 3DRAA 3SF4A 1Y8MA 1BI8B 3BEEA 3MKQB 3KMTA 3M56A 5T0MA 4WAFA 2CG2A 2LSUA 3IHYA 1HFAA 3L22A 4Y6CA 2J9QA 1OWMA 3QKYA 1HH8A 2X6HA 4PS7A 3NZSA 1MX6A 4YNPA 3CVPA 1MHQA 2KBXA 3SBSA 4EPZA 2WXRA 3UIOC 3OAWA 3CIAA 3CHQA 4JA9A 4Z68A 2JEKA 1HG5A 2GRLA 4YDEA 4F1PA 4J6IA 2LUHA 5FT9A 1U3DA 2J4DA 4PUCA 3SFZA 2WPVA 4F6RD 1MVHA 4N2QA 4UI9K 4U8HA 3MKQA 5ENOD 4B89A 2MHKA 2DYSE 3CVQA 4D10C 1WAO1 5CCMA 5CRVA 3QARA 4IJDA 4HRLA 3ABLE 4U0SA 5KJMA 2ILRA 2JABA 1UJJA 3ONLA 5BPPA 4YDOA 3N71A 1TNZA 3EJNA 4YNDA 3GZ1A 1KT1A 2J8SD 1D8EA 3FWVA 2ZU6B 3S7DA 3T8MA 3FUNA 3DSWA 4CDNA 4LG6A 3T8KA 4YPUA 4ZHBA 2XPYA 3TGOA 4TRQA 3APDA 1JWGA 4FADA 2VQ2A 2HM8A 4LNBA 4DI3A 4JDSA 2WXOA 4LERA 3RRNB 5ENNA 3HHMA 3V2XA 4DUIA 2QC9A 4NJ5A 3CVWA 1H6KA 2X3MA 4J7WA 4AM9A 1N4SA 4CZ2D 4ILIA 2I2OA 2CFZA 5LFAA 5HQ8A 2ZISA 2GRQB 4J7FA 2ZIRA 2PNNA 2YINA 2O8JA 4YNMA 3RQ4A 3S8PA 2VSOE 2XCCA 3D9NA 5BNWA 3CK7A 3UI2A 2WXIA 1S63A 3CKBA 1TR4A 4K5BA 2QZAA 2CG3A 4B8AA 3C72A 3VLEA 3PZ3A 1TNOA 1EYHA 5M72A 3IV0A 4AU7A 3W9GA 3FUFA 3PE4A 5AQ9A 4KVOA 4QEOA 4RSYA 4TXRA 2J4BA 2OVBA 3UM3A 1HX8A 3FTYA 3SNXA 3ZYKA 1A17A 3QC1A 5CECB 3FUIA 3LJNA 4LEUA 1JCRA 2DCPA 4HQDA 3BQOA 3AJIA 4HOQA 2YQ8A 4GB9A 3ASHA 3Q73A 1SW6A 3TWRA 1OWOA 2PL2A 3AAAC 5D0QD 3IEGA 4M3OA 3FFLA 3SW9A 3JQ0A 3NB2A 5J08A 3JUIA 3B7UX 3L13A 4A1GA 4CGVA 1TN8A 5ENPD 4EECA 1TN7A 5AIJA 3ML9A 3DSTA 5D2MC 1MQSA 3FUKA 3HXDA 1SQMA 3KSLA 3U64A 4XIFA 4RQIA 2XQ0A 4MBGA 3L08A 5ARGA 3VLDA 4LNUD 3KEAA 4GPKA 3C3OA 2RFIA 5JJ6A 3PREA 4FJYA 1EPUA 1RW2A 3PEVB 1SA5A 5AJLA 2NXPA 2R17C 3CQCB 2X38A 1H2UA 4BFRA 5AQ7A 3V79K 4GYYA 4AIFA 4NRHB 2WMNA 2MYOA 1P5QA 3BO5A 5JINA 4HXIA 1H6PA 1IQRA 3CK9A 2IY0C 4P29A 3TXNA 3FU3A 2C0MA 4IN3B 4L2YA 4BTBA 5TH7A 4C48B 3APCA 3E32A 4ILHB 4BERA 1HE8A 1Z5SC 3ZXPA 3TG4A 3KD7A 2LNIA 1UN9A 2F8YA 4JB8P 2WXNA 4I2WA 2WB2A 3IBEA 4J8OA 3ZW3A 4MI5A 3ZPJA 4JZYA 3UM0A 2P9LG 2MRIA 2J07A 3ZGQA 3CVXA 3UKRG 4J8EA 3PNLB 3NQPA 4F1SA 1X81A 4O6FA 2R05A 3ULEG 5FINA 2WXGA 3T5VA 3B7RL 4A3VA 3PZ4A 1WM5A 4KMOA 4F3VA 1H2VC 2I6HA 3AG1E 2IOLA 2WXPA 1N11A 2Y0BG 1TNYA 3SFYA 2AXVA 3CVLA 3TJPA 2F0YA 1JUQA 1OY3D 3ZKJA 2B6CA 3JXIA 3Q78A 1HG2A 3NAWA 3PS6A 4XKBA 1FVFA 1NP7A 4HI8A 4ATGA 5EYPF 3RJVA 1TN6A 3PZDA 4N3BA 3D3MA 1WDYA 5E75A 3AS8A 2VSYA 3VTYA 5LX8A 3D9PA 2XRZA 4XI0A 3CGHA 3DXKG 3C3RA 3FPDA 3PRZA 2ETAA 4Q96A 3D9LA 2HO1A 5F59A 3C3QA 3NOGD 4HRNA 1JCSA 1ZKKA 5KWDA 1H2TC 1YA0A 3B13A 1E8WA 2IO3C 2BTDA 5LCWC 2IOSA 1AP7A 2XGMA 1N95A 3LCAA 3EIJA 2YNQA 4PH4B 3SD5A 2KATA 3Q9UC 2DYRE 5JA4D 4BESA 4G11A 4URKA 4I1AA 3RRUA 2IO2C 4GA0A 1DVPA 1O5MA 4RG9A 5ENQD 3T9KA 3PZ2A 3CSFA 2QFCA 4KYOB 3PVLA 4N5CA 4AEZC 4XI9A 4DK5A 2RKKA 3B95A 1NA0A 4U04A 4I43A 3FUMA 3Q79A 3R7RA 4TXQA 3PH0C 3UT8A 4B93B 5EDSA 4FLBA 4TUMA 3SHFA 3URZA 5AARA 4K5CA 5FIOA 5F5EA 1E7UA 5HRYA 3ESKA 1ML9A 2CHWA 3DWLG 3HXBA 3BG0B 4CDRA 4JHRA 3EHMA 1MT6A 3Q7FA 3QDNA 4GMLA 2FO7A 2FEZA 4GTSA 1KLXA 3ZYLA 3MX3A 5TTFA 4MS6A 2RFAA 1NA3A 3FUDA 3QOUA 3TWTA 4KZ0A 4MLPA 4C1QA 1MJ0A 1TNUA 3V31A 1HF8A 5T8IA 4ANWA 4QQIA 1D9SA 2PZIA 2IGQA 1IXVA 5TEGA 3ABME 2W5ZA 4JPSA 4I6JA 3FHEA 5BV1A 3HXEA 2Y69E 5ENTD 2P2CP 4J8FA 2G46A 4HS2A 2BQZA 5BUZA 1ZBPA 2ZXWE 2QYJA 3S7BA 1E96B 3R9MA 4IJ8A 4M7CA 2QPWA 5CERB 4NVQA 3V30A 3RAYA 4CGWA 3LY7A 5EYLA 3AG2E 2FULA 2WXHA 4GZ5A 4QFVA 5JHNA 2AWIA 1DCQA 3SBTB 2F8XK 2AXUA 2WXLA 2XGSA 3JCKC 3E33A 4RG6A 3FTUA 5KNGA 1L5JA 1OCRE 1UJKA 1KZOA 5CBNA 2PQRA 4HRMB 1PEGA 5KBAA 3OPEA 3CLJA 3ISMC 4UI9J 3IXEA 5IY5E 2H6FA 5CMYA 1IHGA 5BW8C 1HO8A 2XS1A 2ONDA 4I6EA 2L6JA 3ZFWA 3LVRE 1NZNA 3MZLB 3MEKA 5EX0A 3G2VA 4H7YA 3CBPA 5EIBE 2L6BA 3W9FA 4AP2A 4G25A 2LXMA 4UWLA 3ZNGA 1IKND 4U8VD 4UWKA 4AOFA 3BG1B 5FTPA 3P1UA 5FQ8A 5AQAA 2YHCA 2KZTA 4U63A 1UG3A 2P9IG 4CRWA 3SFXA 2FO1E 4G23A 5ANLA 3ZUVB 5FZRA 3FTSA 2E2EA 3B7BA 1N0QA 4GAAA 3O4ZA 3L17A 4BEPA 3CHOA 2BEDA 2XS8A 4H7XA 3S2AA 1KPSB 5KCMA 4EZLA 3TWWA 2V4LA 2NYJA 4XX5A 1E7VA 4NACA 5CHEE 4DLQA 4J7IA 3HVEA 2UY1A 5CRUA 1MX4A 1O1SA 1PC2A 4ANVA 2Y3AA 2XCBA 3GYZA 5KNHD 4N39A 3LYAA 3B7TA 3RU0A 3M55A 4E85A 4U0ZA 4RLYA 1N4RA 4LDGA 1FT2A 3ZU7B 4HLEA 3OOIA 5G04J 2GRRB 3Q7AA 2GRNB 2PM7A 4BETA 1Z3YA 5JJTA 3ASOE 3L6AA 4JD2G 4WNEA 4U95D 4ABNA 4ATZD 4EZKA 1UW4B 2KCLA 3CHSA 3Q75A 4KXKB 4GTPA 3BUAA 3ZRHA 3UX4A 3UXGA 2VSXE 3ZYMA 2HE0A 2AW6A 3FU0A 5DIZA 4I2ZA 2AJAA 4ACLA 3LDZA 4ZFHA 3KSQA 3ASGA 5LCWJ 2F69A 4JW1A 4JHJA 5JIYA 4WUYA 4U96D 3GZ2A 4GCNA 2A5EA 2PM6A 4AJWA 2BF0X 4CCAA 3CV0A 3G2WA 2H6HA 4DPRA 5C1DA 1MYOA 2EIKE 3E34A 3AS4A 1MUFA 3M57A 2I1JA 3CVVA 1SZAA 2A4ZA 4GA1A 3FUEA 2LAHA 4O1OA 4PDXA 3Q15A 1B89A 4L2LA 3CBOA 4GA2A 3E4BA 3RJWA 3D9KA 3SI5A 2LXLA 3DEPA 2XPZA 3NOCD 3ML8A 3SWCA 5LP0A 2W5YA 4IULA 3PDNA 3HXCA 3EHRA 5AN8A 4GZCA 3UM2A 3UT7A 2VGXA 2X6FA 3F9ZA 2IF4A 4YVOA 3HIZA 3CQGB 1SA4A 3P2BA 2R3AA 4JEHA 1VDYA 3FULA 1TNBA 3AS5A 3Q5MA 5BXUA 2VTBA 4DRXE 3OXGA 2WM9A 2RD0A 4R7LA 2L0IA 4XEIG 4I51A 4U07A 3UMVA 5FWQA 2XEEA 4IRUA 3OXLA 3RIBA 1BU9A 4GZDA 5D0OD 1KZPA 1TJFA 2UWJG 1E90A 2DIWA 4GCOA 4UI9C 4FMUA 2I9CA 2CFUA 3LJ3A 2KC7A 3Q47B 4DX7D 4OVVA 2IQCA 1YMPA 3EU5A 4BX9A 4J0UA 3LEWA 5J90A 1OUVA 2P9NG 3Q4AB 4GTMA 5CMWA 1A5EA 2IFUA 2LO6A 5ANRA 4B8CB 4NIKA 4Q69A 3EP0A 3M53A 3RRMB 3GW4A 4L7TA 1ELKA 4ILGA 4G26A 4CEMA 4PS8A 1NL4A 2XEVA 4I6GA 2EQXA 3Q9NC 4MKTA 4YDWA 3LY8A 4JVSA 5C2YA 4O1PA 3D9HA 4FULA 3RKVA 2P58C 4EHMA 3UINC 4X8QA 1NFIE 5AYWD 3G2SA 2FI7A 4FHKA 3ZYQA 3FH8A 3SO8A 4UWHA 5B1AE 3AG3E 4Z4PA 3SZ7A 4PS3A 1QBQA 3D9IA 4GZ3A 3ENEA 2EIJE 2H6IA 4I1OB 4BY6A 3AU5A 2EIME 4LSZE 3FU6A 3RK6A 3TWUA 4K0RA 1OCCE 4BSXA 1FCHA 5T5GA 5LOZA 4J8SA 4APOA 2E0IA 3PUKA 3D9OA 3MV2B 5BXOA 4FC8A 5G04C 2DWZA 4JL0A 3PEUB 1OXJA 3F9YA 2P9KG 4F7AA 5JHAA 3TWSA 4FP7A 4GYWA 3FDHA 1ZB1A 3LVQE 2OEVA 3FTWA 3DSSA 3EHQA 4KBQA 2VSNA 3FUJA 3VTXA 3NBNB 3J5QB 4U0UA 5E76A 3C98A 1O9SA 1TYQG 3TWXA 1N4PA 5HI7A 3CR3A 1K1AA 4GYOA 5EKQD 2XHEA 1TEZA 1YCSB 3EHNA 3CVYA 5EILA 3ZEFA 4DI4A 4K03A 1IYGA 1K1BA 3FEXA 2HR2A 5T3RA 3QWVA 3VV0A 4EBAA 4FU3A 1PY1A 3UQ3A 4ANUA 2V5FA 2P9SG 3FH7A 1WY6A 1DCEA 2ETCA 1DC2A 4L9PA 1W3BA 2AXZA 3QNKA 2WMOA 4F53A 3M54A 1SVXA 3FTXA 5EG2A 4HOUA 1UOHA 3U66A 5F6KC 3QAQA 5JJ0A 2FF4A 5JMND 1H19A 3RSEG 5FQ7A 3SY2A 1KT0A 3MO5A 1Z3XA 3APFA 4DX5D 3VUZA 3I4RB 3EU9A 4YVQC 1MVXA 5B3SE 1N9AA 4G2VA 1JWFA 4CYMD 3UUXA 2NSZA 3IHVA 5FQ6A 3CKCA 3UIPC 1E8ZA 4AY6A 1S70B 3I3NA 5BT1A 3ZVVA 1OWLA 3ZHEB 5AAOA 5AJDA 4WNFA 5KJKA 2XZDG 1XGWA 5AYFA 1FPPA 3FH5A 2WXKA 2I1KA 2ZGDA 3UT4A 1NI1A 2J09A 3U4TA 5G05C 4L23A 3ULYA 4UUCA 4G24A 1ZU2A 3QWPA 4LNGA 3CSTA 2GW1A 3T5XA 5ENSD 5FZSA 3TAXA 1QNFA 3QK0A 1H3IA 2L0TB 5EX3A 2KCVA 3DB5A 3HYMB 1TJCA 4CDMA 2JLBA 2KZTB 1AWCB 3TG5A 4QEPA 1O1RA 4GTRA 3KEZA 4CT4A 4C9BB 3UTMA 5ENRD 2WXQA 3PUJA 1Y6IA 5G2NA 3NF1A 2J49A 4J8DA 3D9JA 3MJWA 3ZHEA 1N52A 2C0LA 5FQ4A 3M59A 3JYSA 4HVBA 3MO0A 2GRPB 3HVEB 1ELRA 4LRZA 4NURA 2UY1B 1INZA 4EZJA 2PQNA 1BPOA 3QWWA 5ARFA 4CT0A 3MA5A 4EQFA 4GTTA 4RVBA 3L54A 4MI0A 5A7DB 3FUHA 3I5PA 2OOEA 3G2TA 3R9AB 1O1TA 3ASNE 4DX2A 2OCCE 1YYHA 2J08A 5HKPA 1HS6A 4OAVB 2DBAA 3K9IA 3PE3A 2GGFA 3FTZA 3EUVA 4XZ4A 3B7SA 3KS2A 3M58A 4I9CA 4KT6B 3IKOB 2Y4UA 2RG8A 2JV0A 2KM4A 4MRUA 2WQ6A 2VJ8A 3K5KA 3DSVA 1OT8A 3RO2A 5CPRB 1H0AA 2WXFA 3CK8A 4XKCA 2WXMA 2Y4TA 3RO3A 4Y6WA 2R59A 3WG7E 2WQHA 4BT9A 3ZN3A 4TV3A 4JXTA 2EINE 3FEYA 4FHJA 5BV0A 4GMRA 3WXXA 1N94A 3TWVA 3VLFA 1EDUA 1S64A 5HS0A 2V8SE 2QY7A 1XQHA 2R03A 4TUUA 3AG4E 4A63B 3DPYA 3I4GA 2XEHA 2LAIA 4GPMA 2CHXA 2XRYA 3MGBA 1HU3A 4DX6D 3CVNA 2XPIA 4DJAA 2BKGA 3MYVA 1S0PA 2XENA 4WWOA 1E8XA 4KVMA 4QENA 4RZ0A 2AVPA 2NC9A 5LSZA 3HDXA 3F9WA 2Y1LE 3HXFA 2VGXB 1OWPA 3U9WA 2OV8A 2KXPC 4BSZB 4O30A 3DPDA 4ANXA 2FBNA 1LTXA 3ASFA 3X2QE 3F6QA 2VTBB 4YDYA 4YPEA 1WG0A 1OCZE 3CHPA 4GTOA 1QYMA 3QB2A 4K5AB 1MZCA 3O48A 4N3CA 4DLOA 3DSUA 1FVHA 5CCLA 5G55A 3F9XA 3DEOA 1K8KG 3MKRA 1MX2A 4OAUC 4UWFA 4BTAA 2BUGA 2HYZA 4WNDA 3MV3B 5EIDA 3JQ1A 2OEWA 2WQ7A 1LD8A 4L1BA 3DXMG 3FY4A 4I1MA 4GMJA 3E37A 2V5QC 1QQEA 2H6GA 3AU4A 3CVUA 3OS5A 3J5PA 4U8YD 3HNAA 1N6AA 4G1TA 4A55A 5T4YA 4APFA 3JXJA 2WVIA 3L9TA 4HLLA 2MOWA 3G2UA 5JHBA 3L82A 3ZXSA 1U2VG 1OWNA 2IU1A 4A3TA 4AV7A 4ME2A 3TXMA 4HB5A 3S7JA 2DZOA 3LY9A 4EBAG 5G05J 1JPLA 1HXIA 1N6CA 4BWRA 4JC8A 2XGOA 2R02A 3TWQA 3C5RA 4DX1A 4HFGA 4JHKA 3L16A 1X5BA 3NZUA 3D9MA 4TXPA 1UN8A 4FA6A 4C0MA 1D8DA 1G3NB 3LKUA 3SGHA 4AY5A 4HNAD 1N0RA 1QZ2A 2Q7FA 4OYSA 4HORA 3KMAA 3ULQA 1HZ4A 2IEJA 2M63A 4BX8A 3V2OA 3CBMA 2V0PA 4JLGA 5CEDB 1LD7A 1Z6TA 5F6LA 3M5AA 4U7EB 3GZSA 4UQYA 2KCKA 5KJLA 3QJZA 3CHRA 4O60A 4JA7A 5A23A 2C2LA 4GU5A 3RAUA 2ETBA 4I9EA 4HOTA 2VYIA 2GROB 5KJNA 5T0KA 1BLXB 2QYUA 2VGYA 5AQBA 1JCQA 3PNTB 2WXJA 2P9UG 3FP3A 3PZ1A 1GW6A 1N3JA 4LCTA 5JJ7A 3EDTB 5DBKA 4V3IA 3ABKE 3DSXA 4NQ0A 3KAEA 2RFMA 4ACKA 3HG0D 4HI9A 2BKKB 4Q94A 3U3WA 4KZCA 1H6OA 4LUNU 4N2SA 4N3AA 4H12A 2OVFA 3ZIMA 4WNGA 2X6JA 4GZ6A 2VGEA 4E6HA 1N4QA 4J8YA 4I17A 1XNFA 3Q49B 3ASDA 2R5SA 3S7FA 3ESLA 4AXHA 2GRMA 1PAQA 3R7QA 3IHXA 2R2LA 4WWNA 3FTVA 1V54E 1K3ZD 4A1SA 3MO2A 2IJGX 5A6CA 4HOSA 4IYPA 3ONKA 2EILE 4UQXA 2ZGGA 3FU5A 2CHZA 3LS8A 4WWPA 3E30A 1OCOE 3OTNA 2B0OE 2XZTG 4J83A 1RZ4A 1IQUA 2DVWA 1U3CA 4G8KA 1SZ9A 4E47A 3KMJA 1IHBA 4FJZA 3TL5A 2L9BA 3JUEA 4C0EA 3DALA 1N54A 5CBOA 5B1BE 3LXUX 3CHMA 5ITZF 5FZQA 4AVXA 1FT1A 4FLHA 4GTVA 3EIQC 2P9PG 5EN5D 1BI7B 2YHEA 3BU8A 3UKUG 4XE0A 3DBSA 5H7PA 4N5QA 4HBDA 4GTQA 4G8LA 2DZNA 3LPZA 2IONA 3CEQA 3SQVA 1Q2ZA 4BT8A 4OVUA 3OXFA 1E8YA 5FJYA 2V4HC 3MCXA 4YPAA 1BD8A 4B94A 2X6IA
chains in the Genus database with same CATH topology
2KM4A 2WXPA 4UWGA 5LP0A 2W5YA 4MRUA 4IULA 2WQ6A 2VJ8A 4JEUA 4B0ZA 3K5KA 5AENA 3PDNA 1DNPA 3RO2A 2AXVA 5CPRB 1H0AA 3CVLA 2WXFA 3TJPA 1JUQA 4GZCA 3UPVA 3CK8A 4XKCA 3UT7A 1LF8A 2WXMA 5LSXA 2VGXA 2X6FA 2Y4TA 4W9RA 3RO3A 3F9ZA 2IF4A 4UQZA 2LSVA 4YVOA 3HIZA 1HG2A 3CQGB 3PS6A 2R59A 2A5UA 1FVFA 4XKBA 4Y6WA 1NP7A 1ELWA 4ATGA 1EF1C 2X6KA 3P2BA 4JEHA 2R3AA 4BUPA 2WQHA 3SF4A 1VDYA 1Y8MA 3FULA 4BT9A 3ZN3A 3AS5A 3BEEA 3MKQB 3Q5MA 3RJVA 3PZDA 4N3BA 3D3MA 2VTBA 4TV3A 4JXTA 5E75A 3OXGA 3KMTA 3M56A 5T0MA 4WAFA 2WM9A 3AS8A 2RD0A 2VSYA 3FEYA 2CG2A 4FHJA 5BV0A 4R7LA 2L0IA 2LSUA 3VTYA 5LX8A 3IHYA 4I51A 1HFAA 3D9PA 3L22A 4U07A 3UMVA 3WXXA 5FWQA 2XRZA 4Y6CA 2J9QA 4XI0A 1OWMA 3QKYA 1HH8A 3CGHA 4IRUA 2X6HA 3VLFA 3OXLA 1EDUA 3NZSA 4PS7A 3FPDA 3RIBA 2V8SE 4YNPA 2QY7A 3CVPA 3PRZA 1XQHA 1MHQA 4TUUA 4GZDA 4Q96A 5D0OD 3D9LA 2HO1A 5F59A 3SBSA 4EPZA 3I4GA 2WXRA 1TJFA 2UWJG 2LAIA 1E90A 2DIWA 4GCOA 4UI9C 3OAWA 4FMUA 2I9CA 3CIAA 2CFUA 2CHXA 1ZKKA 2XRYA 3MGBA 3CHQA 1H2TC 1HU3A 4JA9A 3CVNA 1YA0A 2XPIA 3LJ3A 2KC7A 3B13A 3Q47B 4DJAA 1E8WA 2JEKA 2BTDA 5LCWC 2IOSA 4OVVA 1HG5A 2IQCA 2GRLA 3MYVA 1S0PA 2XGMA 4BX9A 4J0UA 4WWOA 3LEWA 5J90A 3LCAA 1E8XA 4J6IA 4KVMA 3EIJA 1OUVA 5FT9A 2YNQA 4PH4B 3SD5A 1U3DA 3Q4AB 4QENA 2KATA 5CMWA 4RZ0A 2IFUA 2LO6A 5ANRA 2AVPA 4B8CB 4Q69A 3EP0A 2NC9A 3RRMB 3M53A 3GW4A 4L7TA 1ELKA 2J4DA 4PUCA 5LSZA 4ILGA 3SFZA 3HDXA 4G26A 4CEMA 4PS8A 3F9WA 2WPVA 2VGXB 1OWPA 3U9WA 4N2QA 1MVHA 4G11A 4UI9K 4U8HA 2XEVA 4I6GA 4URKA 2EQXA 2OV8A 4MKTA 3MKQA 4I1AA 3RRUA 3LY8A 4O30A 4B89A 4JVSA 3DPDA 4GA0A 5C2YA 4ANXA 1DVPA 2FBNA 2MHKA 3ASFA 4RG9A 2VTBB 3CVQA 4D10C 3CSFA 4FULA 1WAO1 4YPEA 5CCMA 3RKVA 2QFCA 2P58C 3CHPA 4KYOB 3PVLA 4N5CA 4AEZC 3QARA 4IJDA 4XI9A 4DK5A 4U0SA 5KJMA 3QB2A 2ILRA 5AYWD 1NA0A 3G2SA 1UJJA 3O48A 2FI7A 3ONLA 4FHKA 3FUMA 4I43A 4N3CA 4U04A 3R7RA 3ZYQA 4DLOA 1FVHA 3PH0C 3UT8A 3N71A 5CCLA 5EDSA 4FLBA 5G55A 3SHFA 3F9XA 3FH8A 3URZA 4UWHA 3EJNA 3MKRA 4YNDA 3GZ1A 4UWFA 4Z4PA 5F5EA 3SZ7A 1KT1A 4PS3A 4BTAA 1E7UA 3ESKA 2BUGA 3D9IA 4GZ3A 1ML9A 2CHWA 2HYZA 3BG0B 3ENEA 4WNDA 3MV3B 4CDRA 4I1OB 4JHRA 3EHMA 3JQ1A 4BY6A 1MT6A 3FWVA 2WQ7A 2ZU6B 3QDNA 3AU5A 4GMLA 3S7DA 2FO7A 3T8MA 3FUNA 4L1BA 2FEZA 3FU6A 1KLXA 3FY4A 3ZYLA 3MX3A 4GMJA 4I1MA 5TTFA 4MS6A 3RK6A 4CDNA 1NA3A 3FUDA 3QOUA 4YPUA 4K0RA 2XPYA 4KZ0A 1QQEA 4MLPA 3TGOA 3AU4A 4TRQA 3CVUA 4BSXA 3APDA 3OS5A 1FCHA 5T5GA 4C1QA 5LOZA 4J8SA 4APOA 2E0IA 1JWGA 3HNAA 1HF8A 3PUKA 4FADA 5T8IA 1N6AA 3D9OA 4G1TA 4ANWA 3MV2B 4A55A 2VQ2A 2PZIA 4FC8A 2HM8A 5T4YA 2IGQA 5TEGA 4DI3A 4APFA 5G04C 2WVIA 4JL0A 2W5ZA 3PEUB 3F9YA 4JDSA 4F7AA 5JHAA 2WXOA 2MOWA 4JPSA 4FP7A 4I6JA 4LERA 3FHEA 3G2UA 4GYWA 5BV1A 3FDHA 5JHBA 3LVQE 3RRNB 5ENNA 3ZXSA 1OWNA 3FTWA 2IU1A 3HHMA 4J8FA 2G46A 4HS2A 4A3TA 2BQZA 4AV7A 4NJ5A 4ME2A 3TXMA 3CVWA 1H6KA 4KBQA 5BUZA 1ZBPA 3S7JA 2VSNA 3LY9A 2X3MA 4EBAG 5G05J 1JPLA 1HXIA 3S7BA 1E96B 3FUJA 4AM9A 3VTXA 1N6CA 4BWRA 4IJ8A 4ILIA 2XGOA 4JC8A 2I2OA 4U0UA 2CFZA 5BPPA 2QPWA 5E76A 5LFAA 4NVQA 3RAYA 4HFGA 4JHKA 4CGWA 5HQ8A 3L16A 3C98A 3LY7A 4J7FA 1O9SA 1X5BA 3NZUA 2YINA 5HI7A 2O8JA 2FULA 2WXHA 4YNMA 3RQ4A 3D9MA 4GZ5A 1UN8A 4QFVA 5JHNA 2AWIA 3CR3A 3SBTB 4FA6A 3S8PA 2VSOE 5EKQD 4GYOA 2XCCA 2XHEA 3D9NA 4C0MA 5BNWA 3CK7A 1TEZA 2AXUA 2WXLA 2XGSA 3EHNA 3JCKC 4RG6A 3CVYA 2WXIA 3FTUA 3LKUA 3SGHA 4AY5A 3ZEFA 3CKBA 4DI4A 4K03A 2CG3A 1L5JA 1QZ2A 1UJKA 4B8AA 2Q7FA 1IYGA 4OYSA 4HORA 3KMAA 3ULQA 3FEXA 3VLEA 1HZ4A 2HR2A 2PQRA 2M63A 5T3RA 1PEGA 1EYHA 4BX8A 3OPEA 3CLJA 3QWVA 5M72A 4UI9J 3VV0A 4EBAA 3IV0A 4FU3A 1PY1A 3UQ3A 4ANUA 4AU7A 3CBMA 2V5FA 2V0PA 3FH7A 3FUFA 1WY6A 4JLGA 3PE4A 5CMYA 1IHGA 1Z6TA 4KVOA 5BW8C 4QEOA 1HO8A 2ONDA 1W3BA 5F6LA 4RSYA 2AXZA 3QNKA 4I6EA 2WMOA 3M5AA 2L6JA 3SWCA 3GZSA 3ZFWA 3LVRE 4UQYA 2J4BA 2KCKA 5KJLA 4F53A 2OVBA 3QJZA 1HX8A 1NZNA 3CHRA 3M54A 3FTYA 3MEKA 3MZLB 3SNXA 5EX0A 3G2VA 4H7YA 4JA7A 3ZYKA 2C2LA 5A23A 3CBPA 1A17A 3FTXA 3QC1A 4GU5A 5EG2A 4HOUA 3FUIA 3U66A 4AP2A 3QAQA 5F6KC 4G25A 2FF4A 5JJ0A 1H19A 5FQ7A 4UWLA 4LEUA 4I9EA 1KT0A 4UWKA 4AOFA 3BG1B 2DCPA 5FTPA 1Z3XA 2VYIA 3P1UA 4HOTA 3MO5A 3APFA 4HOQA 2YQ8A 5FQ8A 5KJNA 3VUZA 4GB9A 2YHCA 2KZTA 3ASHA 3I4RB 4YVQC 1MVXA 5T0KA 4U63A 4G2VA 1JWFA 1UG3A 1OWOA 2VGYA 2NSZA 2PL2A 3IHVA 3PNTB 3UUXA 5FQ6A 4CRWA 4G23A 3CKCA 5ANLA 5FZRA 2WXJA 3FTSA 1E8ZA 3FP3A 4AY6A 2E2EA 5D0QD 1GW6A 1N3JA 4GAAA 4LCTA 3IEGA 3I3NA 3O4ZA 5JJ7A 3EDTB 5DBKA 3L17A 4M3OA 3FFLA 3SW9A 3JQ0A 3CHOA 4V3IA 3ZVVA 5BT1A 4H7XA 5J08A 3JUIA 3B7UX 4NQ0A 3L13A 3S2AA 1OWLA 4A1GA 3KAEA 3ZHEB 4CGVA 5AJDA 4ACKA 4WNFA 5KJKA 5KCMA 4EZLA 2V4LA 1XGWA 4EECA 4Q94A 5AYFA 5AIJA 4XX5A 3ML9A 1E7VA 4NACA 5CHEE 1MQSA 4DLQA 3FH5A 3HVEA 4J7IA 2WXKA 3FUKA 2I1KA 2UY1A 3U3WA 1SQMA 4KZCA 3U64A 4XIFA 3UT4A 4LUNU 4N2SA 2J09A 3U4TA 4N3AA 5G05C 4H12A 1PC2A 4L23A 4ANVA 2Y3AA 2XQ0A 2XCBA 2OVFA 3GYZA 3L08A 4G24A 1ZU2A 4N39A 3ZIMA 4WNGA 3LYAA 3QWPA 5ARGA 3B7TA 3VLDA 2X6JA 3RU0A 3M55A 4GZ6A 4E85A 3CSTA 4GPKA 4E6HA 2GW1A 4U0ZA 4I17A 5FZSA 5JJ6A 3T5XA 3TAXA 1QNFA 3QK0A 2RFIA 3PREA 1XNFA 4LDGA 3Q49B 4FJYA 1H3IA 3ASDA 2L0TB 1EPUA 2R5SA 5EX3A 3PEVB 4HLEA 2KCVA 3DB5A 3HYMB 3S7FA 3OOIA 1TJCA 3ESLA 5AJLA 5G04J 4AXHA 2GRMA 1PAQA 3R7QA 2NXPA 3IHXA 4WWNA 3FTVA 4CDMA 2R17C 3CQCB 2JLBA 2PM7A 2X38A 1H2UA 1Z3YA 5JJTA 4BFRA 2KZTB 3L6AA 4A1SA 4WNEA 3MO2A 2IJGX 3TG5A 4ABNA 4QEPA 5A6CA 3KEZA 3ML8A 4CT4A 4C9BB 4HOSA 4GYYA 4IYPA 2WXQA 1UW4B 3ONKA 3PUJA 4UQXA 1Y6IA 4EZKA 2KCLA 5G2NA 4AIFA 4NRHB 3CHSA 4KXKB 2WMNA 3FU5A 3NF1A 2CHZA 3LS8A 2J49A 4WWPA 4J8DA 1P5QA 3D9JA 3MJWA 3OTNA 3ZHEA 3BO5A 3ZRHA 1N52A 4J83A 2C0LA 5FQ4A 5JINA 1IQUA 3M59A 3UX4A 4HXIA 1U3CA 2VSXE 3ZYMA 1IQRA 3CK9A 3JYSA 2AW6A 3FU0A 5DIZA 4I2ZA 4HVBA 1SZ9A 4E47A 4ACLA 3LDZA 4P29A 3KMJA 3MO0A 3ASGA 5LCWJ 3TXNA 3HVEB 3FU3A 2F69A 1ELRA 4JW1A 4LRZA 4NURA 2UY1B 4FJZA 4JHJA 2C0MA 1INZA 5JIYA 4IN3B 3TL5A 2L9BA 4L2YA 4BTBA 4C0EA 4WUYA 4EZJA 3DALA 2PQNA 1BPOA 5TH7A 3QWWA 3GZ2A 5ARFA 1N54A 4CT0A 4GCNA 3MA5A 3LXUX 2PM6A 4EQFA 3APCA 4AJWA 2BF0X 3CHMA 4RVBA 3L54A 4CCAA 4ILHB 4MI0A 3CV0A 5A7DB 5FZQA 3FUHA 1HE8A 3G2WA 2OOEA 3I5PA 4AVXA 4FLHA 3EIQC 3TG4A 3G2TA 3KD7A 2YHEA 2LNIA 1UN9A 3R9AB 4DPRA 5C1DA 2WXNA 4XE0A 4I2WA 2WB2A 3DBSA 2J08A 3AS4A 1MUFA 3M57A 2I1JA 3CVVA 3IBEA 4J8OA 1HS6A 3ZW3A 1SZAA 3LPZA 3ZPJA 2A4ZA 4JZYA 2IONA 3CEQA 4GA1A 3FUEA 2LAHA 2DBAA 2J07A 2MRIA 3K9IA 3ZGQA 3CVXA 4PDXA 2JV0A 3PE3A 3Q15A 1B89A 4L2LA 4J8EA 3PNLB 4BT8A 2GGFA 4OVUA 3OXFA 3FTZA 3CBOA 3NQPA 4MI5A 4F1SA 4XZ4A 4GA2A 4O6FA 3E4BA 1E8YA 3RJWA 3D9KA 3B7SA 3KS2A 3M58A 5FJYA 3SI5A 2WXGA 3MCXA 4I9CA 3T5VA 3B7RL 4A3VA 4KT6B 3IKOB 2XPZA 1WM5A 2Y4UA 4KMOA 4F3VA 4YPAA 1H2VC 2RG8A 2I6HA 4B94A 2X6IA 2IOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W5Y A;  3K5K A;  3PDN A;  3RO2 A;  5CPR B;  3CVL A;  3UPV A;  3CK8 A;  5LSX A;  2VGX A;  2Y4T A;  4W9R A;  3RO3 A;  3F9Z A;  2IF4 A;  4UQZ A;  2LSV A;  4YVO A;  4Y6W A;  1ELW A;  2R3A A;  4BUP A;  2WQH A;  3SF4 A;  1Y8M A;  4BT9 A;  3ZN3 A;  3AS5 A;  3BEE A;  3Q5M A;  3RJV A;  4N3B A;  3OXG A;  3KMT A;  3M56 A;  5T0M A;  3AS8 A;  2VSY A;  3VTY A;  2LSU A;  4I51 A;  4U07 A;  3WXX A;  4Y6C A;  2J9Q A;  4XI0 A;  3QKY A;  1HH8 A;  3OXL A;  3FPD A;  3RIB A;  4YNP A;  3CVP A;  1XQH A;  5D0O D;  2HO1 A;  5F59 A;  2UWJ G;  4GCO A;  4UI9 C;  4FMU A;  1ZKK A;  4JA9 A;  3CVN A;  1YA0 A;  2XPI A;  2KC7 A;  3Q47 B;  5LCW C;  2XGM A;  4J0U A;  3LCA A;  1OUV A;  5FT9 A;  3Q4A B;  4QEN A;  2KAT A;  4RZ0 A;  2IFU A;  2AVP A;  3EP0 A;  2NC9 A;  3M53 A;  3GW4 A;  5LSZ A;  4G26 A;  3F9W A;  2WPV A;  2VGX B;  1MVH A;  4N2Q A;  4UI9 K;  2XEV A;  4I1A A;  3LY8 A;  4O30 A;  4GA0 A;  2MHK A;  2FBN A;  3ASF A;  4RG9 A;  3CVQ A;  1WAO 1;  4YPE A;  5CCM A;  3RKV A;  2QFC A;  4KYO B;  2P58 C;  4N5C A;  4IJD A;  4XI9 A;  4U0S A;  5KJM A;  5AYW D;  1NA0 A;  3O48 A;  2FI7 A;  4U04 A;  4N3C A;  3N71 A;  5CCL A;  3F9X A;  3URZ A;  3MKR A;  4YND A;  3GZ1 A;  4Z4P A;  5F5E A;  3SZ7 A;  1KT1 A;  4BTA A;  3ESK A;  2BUG A;  4GZ3 A;  1ML9 A;  2HYZ A;  4WND A;  3MV3 B;  4CDR A;  4JHR A;  1MT6 A;  3FWV A;  3QDN A;  3S7D A;  2FO7 A;  2FEZ A;  1KLX A;  5TTF A;  1NA3 A;  3QOU A;  4YPU A;  1QQE A;  3TGO A;  3OS5 A;  1FCH A;  5T5G A;  4C1Q A;  4APO A;  3HNA A;  1N6A A;  4G1T A;  3MV2 B;  2VQ2 A;  2PZI A;  2IGQ A;  5TEG A;  5G04 C;  4JL0 A;  2W5Z A;  3F9Y A;  4JDS A;  4GYW A;  4J8F A;  2G46 A;  2BQZ A;  4NJ5 A;  4ME2 A;  4KBQ A;  1ZBP A;  3S7J A;  2VSN A;  3LY9 A;  5G05 J;  3S7B A;  1HXI A;  4AM9 A;  1E96 B;  3VTX A;  1N6C A;  4BWR A;  4IJ8 A;  2XGO A;  4U0U A;  2QPW A;  4NVQ A;  3RAY A;  5HQ8 A;  4CGW A;  3LY7 A;  4J7F A;  1O9S A;  5HI7 A;  2O8J A;  4YNM A;  3RQ4 A;  4GZ5 A;  5JHN A;  3S8P A;  5EKQ D;  4GYO A;  2XCC A;  5BNW A;  3CK7 A;  2XGS A;  4RG6 A;  3LKU A;  4AY5 A;  3CKB A;  1QZ2 A;  2Q7F A;  1IYG A;  4HOR A;  3KMA A;  3ULQ A;  1HZ4 A;  2HR2 A;  2PQR A;  1PEG A;  3OPE A;  3QWV A;  5M72 A;  4UI9 J;  3VV0 A;  3UQ3 A;  4AU7 A;  3CBM A;  2V5F A;  4JLG A;  3PE4 A;  1IHG A;  5BW8 C;  4QEO A;  2OND A;  1W3B A;  5F6L A;  3M5A A;  2L6J A;  3SWC A;  3ZFW A;  4UQY A;  2KCK A;  5KJL A;  1NZN A;  3M54 A;  3MEK A;  5EX0 A;  4H7Y A;  4JA7 A;  3CBP A;  2C2L A;  1A17 A;  5EG2 A;  4HOU A;  5JJ0 A;  5F6K C;  4G25 A;  2FF4 A;  4LEU A;  4I9E A;  1KT0 A;  5FTP A;  4HOT A;  2VYI A;  3MO5 A;  4HOQ A;  2YQ8 A;  5KJN A;  3VUZ A;  2YHC A;  3ASH A;  4YVQ C;  1MVX A;  5T0K A;  4G2V A;  2VGY A;  2PL2 A;  3UUX A;  4G23 A;  3CKC A;  5FZR A;  3FP3 A;  4AY6 A;  2E2E A;  5D0Q D;  1N3J A;  3IEG A;  5JJ7 A;  3EDT B;  5DBK A;  3FFL A;  3SW9 A;  5BT1 A;  4H7X A;  4NQ0 A;  3KAE A;  3ZHE B;  4CGV A;  4WNF A;  5KJK A;  5AYF A;  5CHE E;  4J7I A;  2UY1 A;  3U3W A;  4XIF A;  4N2S A;  3U4T A;  4N3A A;  5G05 C;  4H12 A;  1PC2 A;  2XCB A;  3GYZ A;  4G24 A;  1ZU2 A;  4N39 A;  4WNG A;  3LYA A;  3QWP A;  5ARG A;  3RU0 A;  3M55 A;  4GZ6 A;  4GPK A;  2GW1 A;  4U0Z A;  4I17 A;  5FZS A;  5JJ6 A;  2RFI A;  3TAX A;  4LDG A;  1XNF A;  3Q49 B;  1H3I A;  3ASD A;  2R5S A;  5EX3 A;  2KCV A;  3DB5 A;  3HYM B;  3S7F A;  3OOI A;  1TJC A;  5G04 J;  3IHX A;  2JLB A;  5JJT A;  4A1S A;  3MO2 A;  4WNE A;  3TG5 A;  4ABN A;  4QEP A;  5A6C A;  4HOS A;  4GYY A;  4UQX A;  2KCL A;  4AIF A;  4NRH B;  4KXK B;  3NF1 A;  4J8D A;  1P5Q A;  3ZHE A;  3BO5 A;  4J83 A;  2C0L A;  5JIN A;  3M59 A;  3CK9 A;  3JYS A;  5DIZ A;  4I2Z A;  4E47 A;  3KMJ A;  3MO0 A;  3ASG A;  5LCW J;  2F69 A;  1ELR A;  2UY1 B;  2C0M A;  5JIY A;  4IN3 B;  4BTB A;  4WUY A;  3DAL A;  2PQN A;  5TH7 A;  3QWW A;  3GZ2 A;  5ARF A;  4GCN A;  3MA5 A;  4EQF A;  4MI0 A;  3CV0 A;  5A7D B;  5FZQ A;  2OOE A;  3TG4 A;  3KD7 A;  2LNI A;  3R9A B;  5C1D A;  4I2W A;  3AS4 A;  1MUF A;  3M57 A;  4J8O A;  4MI5 A;  3LPZ A;  3ZPJ A;  3CEQ A;  4GA1 A;  2DBA A;  3ZGQ A;  3K9I A;  3PE3 A;  3Q15 A;  1B89 A;  4J8E A;  4BT8 A;  3OXF A;  3CBO A;  4GA2 A;  4O6F A;  3E4B A;  3RJW A;  3KS2 A;  3M58 A;  5FJY A;  4I9C A;  1WM5 A;  2Y4U A;  4F3V A;  4YPA A;  2JV0 A;  2I6H A;  4B94 A; 
#chains in the Genus database with same CATH topology
 4UWG A;  4JEU A;  3UM1 A;  4B0Z A;  5AEN A;  1DNP A;  1V55 E;  5D66 A;  3UPV A;  1LF8 A;  5LSX A;  4W9R A;  4UQZ A;  2LSV A;  2A5U A;  1ELW A;  3HRA A;  1EF1 C;  2F37 A;  2X6K A;  5CEA A;  4BUP A;  3DRA A;  3SF4 A;  1Y8M A;  1BI8 B;  3BEE A;  3MKQ B;  3KMT A;  3M56 A;  5T0M A;  4WAF A;  2CG2 A;  2LSU A;  3IHY A;  1HFA A;  3L22 A;  4Y6C A;  2J9Q A;  1OWM A;  3QKY A;  1HH8 A;  2X6H A;  4PS7 A;  3NZS A;  1MX6 A;  4YNP A;  3CVP A;  1MHQ A;  2KBX A;  3SBS A;  4EPZ A;  2WXR A;  3UIO C;  3OAW A;  3CIA A;  3CHQ A;  4JA9 A;  4Z68 A;  2JEK A;  1HG5 A;  2GRL A;  4YDE A;  4F1P A;  4J6I A;  2LUH A;  5FT9 A;  1U3D A;  2J4D A;  4PUC A;  3SFZ A;  2WPV A;  4F6R D;  1MVH A;  4N2Q A;  4UI9 K;  4U8H A;  3MKQ A;  5ENO D;  4B89 A;  2MHK A;  2DYS E;  3CVQ A;  4D10 C;  1WAO 1;  5CCM A;  5CRV A;  3QAR A;  4IJD A;  4HRL A;  3ABL E;  4U0S A;  5KJM A;  2ILR A;  2JAB A;  1UJJ A;  3ONL A;  5BPP A;  4YDO A;  3N71 A;  1TNZ A;  3EJN A;  4YND A;  3GZ1 A;  1KT1 A;  2J8S D;  1D8E A;  3FWV A;  2ZU6 B;  3S7D A;  3T8M A;  3FUN A;  3DSW A;  4CDN A;  4LG6 A;  3T8K A;  4YPU A;  4ZHB A;  2XPY A;  3TGO A;  4TRQ A;  3APD A;  1JWG A;  4FAD A;  2VQ2 A;  2HM8 A;  4LNB A;  4DI3 A;  4JDS A;  2WXO A;  4LER A;  3RRN B;  5ENN A;  3HHM A;  3V2X A;  4DUI A;  2QC9 A;  4NJ5 A;  3CVW A;  1H6K A;  2X3M A;  4J7W A;  4AM9 A;  1N4S A;  4CZ2 D;  4ILI A;  2I2O A;  2CFZ A;  5LFA A;  5HQ8 A;  2ZIS A;  2GRQ B;  4J7F A;  2ZIR A;  2PNN A;  2YIN A;  2O8J A;  4YNM A;  3RQ4 A;  3S8P A;  2VSO E;  2XCC A;  3D9N A;  5BNW A;  3CK7 A;  3UI2 A;  2WXI A;  1S63 A;  3CKB A;  1TR4 A;  4K5B A;  2QZA A;  2CG3 A;  4B8A A;  3C72 A;  3VLE A;  3PZ3 A;  1TNO A;  1EYH A;  5M72 A;  3IV0 A;  4AU7 A;  3W9G A;  3FUF A;  3PE4 A;  5AQ9 A;  4KVO A;  4QEO A;  4RSY A;  4TXR A;  2J4B A;  2OVB A;  3UM3 A;  1HX8 A;  3FTY A;  3SNX A;  3ZYK A;  1A17 A;  3QC1 A;  5CEC B;  3FUI A;  3LJN A;  4LEU A;  1JCR A;  2DCP A;  4HQD A;  3BQO A;  3AJI A;  4HOQ A;  2YQ8 A;  4GB9 A;  3ASH A;  3Q73 A;  1SW6 A;  3TWR A;  1OWO A;  2PL2 A;  3AAA C;  5D0Q D;  3IEG A;  4M3O A;  3FFL A;  3SW9 A;  3JQ0 A;  3NB2 A;  5J08 A;  3JUI A;  3B7U X;  3L13 A;  4A1G A;  4CGV A;  1TN8 A;  5ENP D;  4EEC A;  1TN7 A;  5AIJ A;  3ML9 A;  3DST A;  5D2M C;  1MQS A;  3FUK A;  3HXD A;  1SQM A;  3KSL A;  3U64 A;  4XIF A;  4RQI A;  2XQ0 A;  4MBG A;  3L08 A;  5ARG A;  3VLD A;  4LNU D;  3KEA A;  4GPK A;  3C3O A;  2RFI A;  5JJ6 A;  3PRE A;  4FJY A;  1EPU A;  1RW2 A;  3PEV B;  1SA5 A;  5AJL A;  2NXP A;  2R17 C;  3CQC B;  2X38 A;  1H2U A;  4BFR A;  5AQ7 A;  3V79 K;  4GYY A;  4AIF A;  4NRH B;  2WMN A;  2MYO A;  1P5Q A;  3BO5 A;  5JIN A;  4HXI A;  1H6P A;  1IQR A;  3CK9 A;  2IY0 C;  4P29 A;  3TXN A;  3FU3 A;  2C0M A;  4IN3 B;  4L2Y A;  4BTB A;  5TH7 A;  4C48 B;  3APC A;  3E32 A;  4ILH B;  4BER A;  1HE8 A;  1Z5S C;  3ZXP A;  3TG4 A;  3KD7 A;  2LNI A;  1UN9 A;  2F8Y A;  4JB8 P;  2WXN A;  4I2W A;  2WB2 A;  3IBE A;  4J8O A;  3ZW3 A;  4MI5 A;  3ZPJ A;  4JZY A;  3UM0 A;  2P9L G;  2MRI A;  2J07 A;  3ZGQ A;  3CVX A;  3UKR G;  4J8E A;  3PNL B;  3NQP A;  4F1S A;  1X81 A;  4O6F A;  2R05 A;  3ULE G;  5FIN A;  2WXG A;  3T5V A;  3B7R L;  4A3V A;  3PZ4 A;  1WM5 A;  4KMO A;  4F3V A;  1H2V C;  2I6H A;  3AG1 E;  2IOL A;  2WXP A;  1N11 A;  2Y0B G;  1TNY A;  3SFY A;  2AXV A;  3CVL A;  3TJP A;  2F0Y A;  1JUQ A;  1OY3 D;  3ZKJ A;  2B6C A;  3JXI A;  3Q78 A;  1HG2 A;  3NAW A;  3PS6 A;  4XKB A;  1FVF A;  1NP7 A;  4HI8 A;  4ATG A;  5EYP F;  3RJV A;  1TN6 A;  3PZD A;  4N3B A;  3D3M A;  1WDY A;  5E75 A;  3AS8 A;  2VSY A;  3VTY A;  5LX8 A;  3D9P A;  2XRZ A;  4XI0 A;  3CGH A;  3DXK G;  3C3R A;  3FPD A;  3PRZ A;  2ETA A;  4Q96 A;  3D9L A;  2HO1 A;  5F59 A;  3C3Q A;  3NOG D;  4HRN A;  1JCS A;  1ZKK A;  5KWD A;  1H2T C;  1YA0 A;  3B13 A;  1E8W A;  2IO3 C;  2BTD A;  5LCW C;  2IOS A;  1AP7 A;  2XGM A;  1N95 A;  3LCA A;  3EIJ A;  2YNQ A;  4PH4 B;  3SD5 A;  2KAT A;  3Q9U C;  2DYR E;  5JA4 D;  4BES A;  4G11 A;  4URK A;  4I1A A;  3RRU A;  2IO2 C;  4GA0 A;  1DVP A;  1O5M A;  4RG9 A;  5ENQ D;  3T9K A;  3PZ2 A;  3CSF A;  2QFC A;  4KYO B;  3PVL A;  4N5C A;  4AEZ C;  4XI9 A;  4DK5 A;  2RKK A;  3B95 A;  1NA0 A;  4U04 A;  4I43 A;  3FUM A;  3Q79 A;  3R7R A;  4TXQ A;  3PH0 C;  3UT8 A;  4B93 B;  5EDS A;  4FLB A;  4TUM A;  3SHF A;  3URZ A;  5AAR A;  4K5C A;  5FIO A;  5F5E A;  1E7U A;  5HRY A;  3ESK A;  1ML9 A;  2CHW A;  3DWL G;  3HXB A;  3BG0 B;  4CDR A;  4JHR A;  3EHM A;  1MT6 A;  3Q7F A;  3QDN A;  4GML A;  2FO7 A;  2FEZ A;  4GTS A;  1KLX A;  3ZYL A;  3MX3 A;  5TTF A;  4MS6 A;  2RFA A;  1NA3 A;  3FUD A;  3QOU A;  3TWT A;  4KZ0 A;  4MLP A;  4C1Q A;  1MJ0 A;  1TNU A;  3V31 A;  1HF8 A;  5T8I A;  4ANW A;  4QQI A;  1D9S A;  2PZI A;  2IGQ A;  1IXV A;  5TEG A;  3ABM E;  2W5Z A;  4JPS A;  4I6J A;  3FHE A;  5BV1 A;  3HXE A;  2Y69 E;  5ENT D;  2P2C P;  4J8F A;  2G46 A;  4HS2 A;  2BQZ A;  5BUZ A;  1ZBP A;  2ZXW E;  2QYJ A;  3S7B A;  1E96 B;  3R9M A;  4IJ8 A;  4M7C A;  2QPW A;  5CER B;  4NVQ A;  3V30 A;  3RAY A;  4CGW A;  3LY7 A;  5EYL A;  3AG2 E;  2FUL A;  2WXH A;  4GZ5 A;  4QFV A;  5JHN A;  2AWI A;  1DCQ A;  3SBT B;  2F8X K;  2AXU A;  2WXL A;  2XGS A;  3JCK C;  3E33 A;  4RG6 A;  3FTU A;  5KNG A;  1L5J A;  1OCR E;  1UJK A;  1KZO A;  5CBN A;  2PQR A;  4HRM B;  1PEG A;  5KBA A;  3OPE A;  3CLJ A;  3ISM C;  4UI9 J;  3IXE A;  5IY5 E;  2H6F A;  5CMY A;  1IHG A;  5BW8 C;  1HO8 A;  2XS1 A;  2OND A;  4I6E A;  2L6J A;  3ZFW A;  3LVR E;  1NZN A;  3MZL B;  3MEK A;  5EX0 A;  3G2V A;  4H7Y A;  3CBP A;  5EIB E;  2L6B A;  3W9F A;  4AP2 A;  4G25 A;  2LXM A;  4UWL A;  3ZNG A;  1IKN D;  4U8V D;  4UWK A;  4AOF A;  3BG1 B;  5FTP A;  3P1U A;  5FQ8 A;  5AQA A;  2YHC A;  2KZT A;  4U63 A;  1UG3 A;  2P9I G;  4CRW A;  3SFX A;  2FO1 E;  4G23 A;  5ANL A;  3ZUV B;  5FZR A;  3FTS A;  2E2E A;  3B7B A;  1N0Q A;  4GAA A;  3O4Z A;  3L17 A;  4BEP A;  3CHO A;  2BED A;  2XS8 A;  4H7X A;  3S2A A;  1KPS B;  5KCM A;  4EZL A;  3TWW A;  2V4L A;  2NYJ A;  4XX5 A;  1E7V A;  4NAC A;  5CHE E;  4DLQ A;  4J7I A;  3HVE A;  2UY1 A;  5CRU A;  1MX4 A;  1O1S A;  1PC2 A;  4ANV A;  2Y3A A;  2XCB A;  3GYZ A;  5KNH D;  4N39 A;  3LYA A;  3B7T A;  3RU0 A;  3M55 A;  4E85 A;  4U0Z A;  4RLY A;  1N4R A;  4LDG A;  1FT2 A;  3ZU7 B;  4HLE A;  3OOI A;  5G04 J;  2GRR B;  3Q7A A;  2GRN B;  2PM7 A;  4BET A;  1Z3Y A;  5JJT A;  3ASO E;  3L6A A;  4JD2 G;  4WNE A;  4U95 D;  4ABN A;  4ATZ D;  4EZK A;  1UW4 B;  2KCL A;  3CHS A;  3Q75 A;  4KXK B;  4GTP A;  3BUA A;  3ZRH A;  3UX4 A;  3UXG A;  2VSX E;  3ZYM A;  2HE0 A;  2AW6 A;  3FU0 A;  5DIZ A;  4I2Z A;  2AJA A;  4ACL A;  3LDZ A;  4ZFH A;  3KSQ A;  3ASG A;  5LCW J;  2F69 A;  4JW1 A;  4JHJ A;  5JIY A;  4WUY A;  4U96 D;  3GZ2 A;  4GCN A;  2A5E A;  2PM6 A;  4AJW A;  2BF0 X;  4CCA A;  3CV0 A;  3G2W A;  2H6H A;  4DPR A;  5C1D A;  1MYO A;  2EIK E;  3E34 A;  3AS4 A;  1MUF A;  3M57 A;  2I1J A;  3CVV A;  1SZA A;  2A4Z A;  4GA1 A;  3FUE A;  2LAH A;  4O1O A;  4PDX A;  3Q15 A;  1B89 A;  4L2L A;  3CBO A;  4GA2 A;  3E4B A;  3RJW A;  3D9K A;  3SI5 A;  2LXL A;  3DEP A;  2XPZ A;  3NOC D;  3ML8 A;  3SWC A;  5LP0 A;  2W5Y A;  4IUL A;  3PDN A;  3HXC A;  3EHR A;  5AN8 A;  4GZC A;  3UM2 A;  3UT7 A;  2VGX A;  2X6F A;  3F9Z A;  2IF4 A;  4YVO A;  3HIZ A;  3CQG B;  1SA4 A;  3P2B A;  2R3A A;  4JEH A;  1VDY A;  3FUL A;  1TNB A;  3AS5 A;  3Q5M A;  5BXU A;  2VTB A;  4DRX E;  3OXG A;  2WM9 A;  2RD0 A;  4R7L A;  2L0I A;  4XEI G;  4I51 A;  4U07 A;  3UMV A;  5FWQ A;  2XEE A;  4IRU A;  3OXL A;  3RIB A;  1BU9 A;  4GZD A;  5D0O D;  1KZP A;  1TJF A;  2UWJ G;  1E90 A;  2DIW A;  4GCO A;  4UI9 C;  4FMU A;  2I9C A;  2CFU A;  3LJ3 A;  2KC7 A;  3Q47 B;  4DX7 D;  4OVV A;  2IQC A;  1YMP A;  3EU5 A;  4BX9 A;  4J0U A;  3LEW A;  5J90 A;  1OUV A;  2P9N G;  3Q4A B;  4GTM A;  5CMW A;  1A5E A;  2IFU A;  2LO6 A;  5ANR A;  4B8C B;  4NIK A;  4Q69 A;  3EP0 A;  3M53 A;  3RRM B;  3GW4 A;  4L7T A;  1ELK A;  4ILG A;  4G26 A;  4CEM A;  4PS8 A;  1NL4 A;  2XEV A;  4I6G A;  2EQX A;  3Q9N C;  4MKT A;  4YDW A;  3LY8 A;  4JVS A;  5C2Y A;  4O1P A;  3D9H A;  4FUL A;  3RKV A;  2P58 C;  4EHM A;  3UIN C;  4X8Q A;  1NFI E;  5AYW D;  3G2S A;  2FI7 A;  4FHK A;  3ZYQ A;  3FH8 A;  3SO8 A;  4UWH A;  5B1A E;  3AG3 E;  4Z4P A;  3SZ7 A;  4PS3 A;  1QBQ A;  3D9I A;  4GZ3 A;  3ENE A;  2EIJ E;  2H6I A;  4I1O B;  4BY6 A;  3AU5 A;  2EIM E;  4LSZ E;  3FU6 A;  3RK6 A;  3TWU A;  4K0R A;  1OCC E;  4BSX A;  1FCH A;  5T5G A;  5LOZ A;  4J8S A;  4APO A;  2E0I A;  3PUK A;  3D9O A;  3MV2 B;  5BXO A;  4FC8 A;  5G04 C;  2DWZ A;  4JL0 A;  3PEU B;  1OXJ A;  3F9Y A;  2P9K G;  4F7A A;  5JHA A;  3TWS A;  4FP7 A;  4GYW A;  3FDH A;  1ZB1 A;  3LVQ E;  2OEV A;  3FTW A;  3DSS A;  3EHQ A;  4KBQ A;  2VSN A;  3FUJ A;  3VTX A;  3NBN B;  3J5Q B;  4U0U A;  5E76 A;  3C98 A;  1O9S A;  1TYQ G;  3TWX A;  1N4P A;  5HI7 A;  3CR3 A;  1K1A A;  4GYO A;  5EKQ D;  2XHE A;  1TEZ A;  1YCS B;  3EHN A;  3CVY A;  5EIL A;  3ZEF A;  4DI4 A;  4K03 A;  1IYG A;  1K1B A;  3FEX A;  2HR2 A;  5T3R A;  3QWV A;  3VV0 A;  4EBA A;  4FU3 A;  1PY1 A;  3UQ3 A;  4ANU A;  2V5F A;  2P9S G;  3FH7 A;  1WY6 A;  1DCE A;  2ETC A;  1DC2 A;  4L9P A;  1W3B A;  2AXZ A;  3QNK A;  2WMO A;  4F53 A;  3M54 A;  1SVX A;  3FTX A;  5EG2 A;  4HOU A;  1UOH A;  3U66 A;  5F6K C;  3QAQ A;  5JJ0 A;  2FF4 A;  5JMN D;  1H19 A;  3RSE G;  5FQ7 A;  3SY2 A;  1KT0 A;  3MO5 A;  1Z3X A;  3APF A;  4DX5 D;  3VUZ A;  3I4R B;  3EU9 A;  4YVQ C;  1MVX A;  5B3S E;  1N9A A;  4G2V A;  1JWF A;  4CYM D;  3UUX A;  2NSZ A;  3IHV A;  5FQ6 A;  3CKC A;  3UIP C;  1E8Z A;  4AY6 A;  1S70 B;  3I3N A;  5BT1 A;  3ZVV A;  1OWL A;  3ZHE B;  5AAO A;  5AJD A;  4WNF A;  5KJK A;  2XZD G;  1XGW A;  5AYF A;  1FPP A;  3FH5 A;  2WXK A;  2I1K A;  2ZGD A;  3UT4 A;  1NI1 A;  2J09 A;  3U4T A;  5G05 C;  4L23 A;  3ULY A;  4UUC A;  4G24 A;  1ZU2 A;  3QWP A;  4LNG A;  3CST A;  2GW1 A;  3T5X A;  5ENS D;  5FZS A;  3TAX A;  1QNF A;  3QK0 A;  1H3I A;  2L0T B;  5EX3 A;  2KCV A;  3DB5 A;  3HYM B;  1TJC A;  4CDM A;  2JLB A;  2KZT B;  1AWC B;  3TG5 A;  4QEP A;  1O1R A;  4GTR A;  3KEZ A;  4CT4 A;  4C9B B;  3UTM A;  5ENR D;  2WXQ A;  3PUJ A;  1Y6I A;  5G2N A;  3NF1 A;  2J49 A;  4J8D A;  3D9J A;  3MJW A;  3ZHE A;  1N52 A;  2C0L A;  5FQ4 A;  3M59 A;  3JYS A;  4HVB A;  3MO0 A;  2GRP B;  3HVE B;  1ELR A;  4LRZ A;  4NUR A;  2UY1 B;  1INZ A;  4EZJ A;  2PQN A;  1BPO A;  3QWW A;  5ARF A;  4CT0 A;  3MA5 A;  4EQF A;  4GTT A;  4RVB A;  3L54 A;  4MI0 A;  5A7D B;  3FUH A;  3I5P A;  2OOE A;  3G2T A;  3R9A B;  1O1T A;  3ASN E;  4DX2 A;  2OCC E;  1YYH A;  2J08 A;  5HKP A;  1HS6 A;  4OAV B;  2DBA A;  3K9I A;  3PE3 A;  2GGF A;  3FTZ A;  3EUV A;  4XZ4 A;  3B7S A;  3KS2 A;  3M58 A;  4I9C A;  4KT6 B;  3IKO B;  2Y4U A;  2RG8 A;  2JV0 A;  2KM4 A;  4MRU A;  2WQ6 A;  2VJ8 A;  3K5K A;  3DSV A;  1OT8 A;  3RO2 A;  5CPR B;  1H0A A;  2WXF A;  3CK8 A;  4XKC A;  2WXM A;  2Y4T A;  3RO3 A;  4Y6W A;  2R59 A;  3WG7 E;  2WQH A;  4BT9 A;  3ZN3 A;  4TV3 A;  4JXT A;  2EIN E;  3FEY A;  4FHJ A;  5BV0 A;  4GMR A;  3WXX A;  1N94 A;  3TWV A;  3VLF A;  1EDU A;  1S64 A;  5HS0 A;  2V8S E;  2QY7 A;  1XQH A;  2R03 A;  4TUU A;  3AG4 E;  4A63 B;  3DPY A;  3I4G A;  2XEH A;  2LAI A;  4GPM A;  2CHX A;  2XRY A;  3MGB A;  1HU3 A;  4DX6 D;  3CVN A;  2XPI A;  4DJA A;  2BKG A;  3MYV A;  1S0P A;  2XEN A;  4WWO A;  1E8X A;  4KVM A;  4QEN A;  4RZ0 A;  2AVP A;  2NC9 A;  5LSZ A;  3HDX A;  3F9W A;  2Y1L E;  3HXF A;  2VGX B;  1OWP A;  3U9W A;  2OV8 A;  2KXP C;  4BSZ B;  4O30 A;  3DPD A;  4ANX A;  2FBN A;  1LTX A;  3ASF A;  3X2Q E;  3F6Q A;  2VTB B;  4YDY A;  4YPE A;  1WG0 A;  1OCZ E;  3CHP A;  4GTO A;  1QYM A;  3QB2 A;  4K5A B;  1MZC A;  3O48 A;  4N3C A;  4DLO A;  3DSU A;  1FVH A;  5CCL A;  5G55 A;  3F9X A;  3DEO A;  1K8K G;  3MKR A;  1MX2 A;  4OAU C;  4UWF A;  4BTA A;  2BUG A;  2HYZ A;  4WND A;  3MV3 B;  5EID A;  3JQ1 A;  2OEW A;  2WQ7 A;  1LD8 A;  4L1B A;  3DXM G;  3FY4 A;  4I1M A;  4GMJ A;  3E37 A;  2V5Q C;  1QQE A;  2H6G A;  3AU4 A;  3CVU A;  3OS5 A;  3J5P A;  4U8Y D;  3HNA A;  1N6A A;  4G1T A;  4A55 A;  5T4Y A;  4APF A;  3JXJ A;  2WVI A;  3L9T A;  4HLL A;  2MOW A;  3G2U A;  5JHB A;  3L82 A;  3ZXS A;  1U2V G;  1OWN A;  2IU1 A;  4A3T A;  4AV7 A;  4ME2 A;  3TXM A;  4HB5 A;  3S7J A;  2DZO A;  3LY9 A;  4EBA G;  5G05 J;  1JPL A;  1HXI A;  1N6C A;  4BWR A;  4JC8 A;  2XGO A;  2R02 A;  3TWQ A;  3C5R A;  4DX1 A;  4HFG A;  4JHK A;  3L16 A;  1X5B A;  3NZU A;  3D9M A;  4TXP A;  1UN8 A;  4FA6 A;  4C0M A;  1D8D A;  1G3N B;  3LKU A;  3SGH A;  4AY5 A;  4HNA D;  1N0R A;  1QZ2 A;  2Q7F A;  4OYS A;  4HOR A;  3KMA A;  3ULQ A;  1HZ4 A;  2IEJ A;  2M63 A;  4BX8 A;  3V2O A;  3CBM A;  2V0P A;  4JLG A;  5CED B;  1LD7 A;  1Z6T A;  5F6L A;  3M5A A;  4U7E B;  3GZS A;  4UQY A;  2KCK A;  5KJL A;  3QJZ A;  3CHR A;  4O60 A;  4JA7 A;  5A23 A;  2C2L A;  4GU5 A;  3RAU A;  2ETB A;  4I9E A;  4HOT A;  2VYI A;  2GRO B;  5KJN A;  5T0K A;  1BLX B;  2QYU A;  2VGY A;  5AQB A;  1JCQ A;  3PNT B;  2WXJ A;  2P9U G;  3FP3 A;  3PZ1 A;  1GW6 A;  1N3J A;  4LCT A;  5JJ7 A;  3EDT B;  5DBK A;  4V3I A;  3ABK E;  3DSX A;  4NQ0 A;  3KAE A;  2RFM A;  4ACK A;  3HG0 D;  4HI9 A;  2BKK B;  4Q94 A;  3U3W A;  4KZC A;  1H6O A;  4LUN U;  4N2S A;  4N3A A;  4H12 A;  2OVF A;  3ZIM A;  4WNG A;  2X6J A;  4GZ6 A;  2VGE A;  4E6H A;  1N4Q A;  4J8Y A;  4I17 A;  1XNF A;  3Q49 B;  3ASD A;  2R5S A;  3S7F A;  3ESL A;  4AXH A;  2GRM A;  1PAQ A;  3R7Q A;  3IHX A;  2R2L A;  4WWN A;  3FTV A;  1V54 E;  1K3Z D;  4A1S A;  3MO2 A;  2IJG X;  5A6C A;  4HOS A;  4IYP A;  3ONK A;  2EIL E;  4UQX A;  2ZGG A;  3FU5 A;  2CHZ A;  3LS8 A;  4WWP A;  3E30 A;  1OCO E;  3OTN A;  2B0O E;  2XZT G;  4J83 A;  1RZ4 A;  1IQU A;  2DVW A;  1U3C A;  4G8K A;  1SZ9 A;  4E47 A;  3KMJ A;  1IHB A;  4FJZ A;  3TL5 A;  2L9B A;  3JUE A;  4C0E A;  3DAL A;  1N54 A;  5CBO A;  5B1B E;  3LXU X;  3CHM A;  5ITZ F;  5FZQ A;  4AVX A;  1FT1 A;  4FLH A;  4GTV A;  3EIQ C;  2P9P G;  5EN5 D;  1BI7 B;  2YHE A;  3BU8 A;  3UKU G;  4XE0 A;  3DBS A;  5H7P A;  4N5Q A;  4HBD A;  4GTQ A;  4G8L A;  2DZN A;  3LPZ A;  2ION A;  3CEQ A;  3SQV A;  1Q2Z A;  4BT8 A;  4OVU A;  3OXF A;  1E8Y A;  5FJY A;  2V4H C;  3MCX A;  4YPA A;  1BD8 A;  4B94 A;  2X6I A; 
#chains in the Genus database with same CATH homology
 2KM4 A;  2WXP A;  4UWG A;  5LP0 A;  2W5Y A;  4MRU A;  4IUL A;  2WQ6 A;  2VJ8 A;  4JEU A;  4B0Z A;  3K5K A;  5AEN A;  3PDN A;  1DNP A;  3RO2 A;  2AXV A;  5CPR B;  1H0A A;  3CVL A;  2WXF A;  3TJP A;  1JUQ A;  4GZC A;  3UPV A;  3CK8 A;  4XKC A;  3UT7 A;  1LF8 A;  2WXM A;  5LSX A;  2VGX A;  2X6F A;  2Y4T A;  4W9R A;  3RO3 A;  3F9Z A;  2IF4 A;  4UQZ A;  2LSV A;  4YVO A;  3HIZ A;  1HG2 A;  3CQG B;  3PS6 A;  2R59 A;  2A5U A;  1FVF A;  4XKB A;  4Y6W A;  1NP7 A;  1ELW A;  4ATG A;  1EF1 C;  2X6K A;  3P2B A;  4JEH A;  2R3A A;  4BUP A;  2WQH A;  3SF4 A;  1VDY A;  1Y8M A;  3FUL A;  4BT9 A;  3ZN3 A;  3AS5 A;  3BEE A;  3MKQ B;  3Q5M A;  3RJV A;  3PZD A;  4N3B A;  3D3M A;  2VTB A;  4TV3 A;  4JXT A;  5E75 A;  3OXG A;  3KMT A;  3M56 A;  5T0M A;  4WAF A;  2WM9 A;  3AS8 A;  2RD0 A;  2VSY A;  3FEY A;  2CG2 A;  4FHJ A;  5BV0 A;  4R7L A;  2L0I A;  2LSU A;  3VTY A;  5LX8 A;  3IHY A;  4I51 A;  1HFA A;  3D9P A;  3L22 A;  4U07 A;  3UMV A;  3WXX A;  5FWQ A;  2XRZ A;  4Y6C A;  2J9Q A;  4XI0 A;  1OWM A;  3QKY A;  1HH8 A;  3CGH A;  4IRU A;  2X6H A;  3VLF A;  3OXL A;  1EDU A;  3NZS A;  4PS7 A;  3FPD A;  3RIB A;  2V8S E;  4YNP A;  2QY7 A;  3CVP A;  3PRZ A;  1XQH A;  1MHQ A;  4TUU A;  4GZD A;  4Q96 A;  5D0O D;  3D9L A;  2HO1 A;  5F59 A;  3SBS A;  4EPZ A;  3I4G A;  2WXR A;  1TJF A;  2UWJ G;  2LAI A;  1E90 A;  2DIW A;  4GCO A;  4UI9 C;  3OAW A;  4FMU A;  2I9C A;  3CIA A;  2CFU A;  2CHX A;  1ZKK A;  2XRY A;  3MGB A;  3CHQ A;  1H2T C;  1HU3 A;  4JA9 A;  3CVN A;  1YA0 A;  2XPI A;  3LJ3 A;  2KC7 A;  3B13 A;  3Q47 B;  4DJA A;  1E8W A;  2JEK A;  2BTD A;  5LCW C;  2IOS A;  4OVV A;  1HG5 A;  2IQC A;  2GRL A;  3MYV A;  1S0P A;  2XGM A;  4BX9 A;  4J0U A;  4WWO A;  3LEW A;  5J90 A;  3LCA A;  1E8X A;  4J6I A;  4KVM A;  3EIJ A;  1OUV A;  5FT9 A;  2YNQ A;  4PH4 B;  3SD5 A;  1U3D A;  3Q4A B;  4QEN A;  2KAT A;  5CMW A;  4RZ0 A;  2IFU A;  2LO6 A;  5ANR A;  2AVP A;  4B8C B;  4Q69 A;  3EP0 A;  2NC9 A;  3RRM B;  3M53 A;  3GW4 A;  4L7T A;  1ELK A;  2J4D A;  4PUC A;  5LSZ A;  4ILG A;  3SFZ A;  3HDX A;  4G26 A;  4CEM A;  4PS8 A;  3F9W A;  2WPV A;  2VGX B;  1OWP A;  3U9W A;  4N2Q A;  1MVH A;  4G11 A;  4UI9 K;  4U8H A;  2XEV A;  4I6G A;  4URK A;  2EQX A;  2OV8 A;  4MKT A;  3MKQ A;  4I1A A;  3RRU A;  3LY8 A;  4O30 A;  4B89 A;  4JVS A;  3DPD A;  4GA0 A;  5C2Y A;  4ANX A;  1DVP A;  2FBN A;  2MHK A;  3ASF A;  4RG9 A;  2VTB B;  3CVQ A;  4D10 C;  3CSF A;  4FUL A;  1WAO 1;  4YPE A;  5CCM A;  3RKV A;  2QFC A;  2P58 C;  3CHP A;  4KYO B;  3PVL A;  4N5C A;  4AEZ C;  3QAR A;  4IJD A;  4XI9 A;  4DK5 A;  4U0S A;  5KJM A;  3QB2 A;  2ILR A;  5AYW D;  1NA0 A;  3G2S A;  1UJJ A;  3O48 A;  2FI7 A;  3ONL A;  4FHK A;  3FUM A;  4I43 A;  4N3C A;  4U04 A;  3R7R A;  3ZYQ A;  4DLO A;  1FVH A;  3PH0 C;  3UT8 A;  3N71 A;  5CCL A;  5EDS A;  4FLB A;  5G55 A;  3SHF A;  3F9X A;  3FH8 A;  3URZ A;  4UWH A;  3EJN A;  3MKR A;  4YND A;  3GZ1 A;  4UWF A;  4Z4P A;  5F5E A;  3SZ7 A;  1KT1 A;  4PS3 A;  4BTA A;  1E7U A;  3ESK A;  2BUG A;  3D9I A;  4GZ3 A;  1ML9 A;  2CHW A;  2HYZ A;  3BG0 B;  3ENE A;  4WND A;  3MV3 B;  4CDR A;  4I1O B;  4JHR A;  3EHM A;  3JQ1 A;  4BY6 A;  1MT6 A;  3FWV A;  2WQ7 A;  2ZU6 B;  3QDN A;  3AU5 A;  4GML A;  3S7D A;  2FO7 A;  3T8M A;  3FUN A;  4L1B A;  2FEZ A;  3FU6 A;  1KLX A;  3FY4 A;  3ZYL A;  3MX3 A;  4GMJ A;  4I1M A;  5TTF A;  4MS6 A;  3RK6 A;  4CDN A;  1NA3 A;  3FUD A;  3QOU A;  4YPU A;  4K0R A;  2XPY A;  4KZ0 A;  1QQE A;  4MLP A;  3TGO A;  3AU4 A;  4TRQ A;  3CVU A;  4BSX A;  3APD A;  3OS5 A;  1FCH A;  5T5G A;  4C1Q A;  5LOZ A;  4J8S A;  4APO A;  2E0I A;  1JWG A;  3HNA A;  1HF8 A;  3PUK A;  4FAD A;  5T8I A;  1N6A A;  3D9O A;  4G1T A;  4ANW A;  3MV2 B;  4A55 A;  2VQ2 A;  2PZI A;  4FC8 A;  2HM8 A;  5T4Y A;  2IGQ A;  5TEG A;  4DI3 A;  4APF A;  5G04 C;  2WVI A;  4JL0 A;  2W5Z A;  3PEU B;  3F9Y A;  4JDS A;  4F7A A;  5JHA A;  2WXO A;  2MOW A;  4JPS A;  4FP7 A;  4I6J A;  4LER A;  3FHE A;  3G2U A;  4GYW A;  5BV1 A;  3FDH A;  5JHB A;  3LVQ E;  3RRN B;  5ENN A;  3ZXS A;  1OWN A;  3FTW A;  2IU1 A;  3HHM A;  4J8F A;  2G46 A;  4HS2 A;  4A3T A;  2BQZ A;  4AV7 A;  4NJ5 A;  4ME2 A;  3TXM A;  3CVW A;  1H6K A;  4KBQ A;  5BUZ A;  1ZBP A;  3S7J A;  2VSN A;  3LY9 A;  2X3M A;  4EBA G;  5G05 J;  1JPL A;  1HXI A;  3S7B A;  1E96 B;  3FUJ A;  4AM9 A;  3VTX A;  1N6C A;  4BWR A;  4IJ8 A;  4ILI A;  2XGO A;  4JC8 A;  2I2O A;  4U0U A;  2CFZ A;  5BPP A;  2QPW A;  5E76 A;  5LFA A;  4NVQ A;  3RAY A;  4HFG A;  4JHK A;  4CGW A;  5HQ8 A;  3L16 A;  3C98 A;  3LY7 A;  4J7F A;  1O9S A;  1X5B A;  3NZU A;  2YIN A;  5HI7 A;  2O8J A;  2FUL A;  2WXH A;  4YNM A;  3RQ4 A;  3D9M A;  4GZ5 A;  1UN8 A;  4QFV A;  5JHN A;  2AWI A;  3CR3 A;  3SBT B;  4FA6 A;  3S8P A;  2VSO E;  5EKQ D;  4GYO A;  2XCC A;  2XHE A;  3D9N A;  4C0M A;  5BNW A;  3CK7 A;  1TEZ A;  2AXU A;  2WXL A;  2XGS A;  3EHN A;  3JCK C;  4RG6 A;  3CVY A;  2WXI A;  3FTU A;  3LKU A;  3SGH A;  4AY5 A;  3ZEF A;  3CKB A;  4DI4 A;  4K03 A;  2CG3 A;  1L5J A;  1QZ2 A;  1UJK A;  4B8A A;  2Q7F A;  1IYG A;  4OYS A;  4HOR A;  3KMA A;  3ULQ A;  3FEX A;  3VLE A;  1HZ4 A;  2HR2 A;  2PQR A;  2M63 A;  5T3R A;  1PEG A;  1EYH A;  4BX8 A;  3OPE A;  3CLJ A;  3QWV A;  5M72 A;  4UI9 J;  3VV0 A;  4EBA A;  3IV0 A;  4FU3 A;  1PY1 A;  3UQ3 A;  4ANU A;  4AU7 A;  3CBM A;  2V5F A;  2V0P A;  3FH7 A;  3FUF A;  1WY6 A;  4JLG A;  3PE4 A;  5CMY A;  1IHG A;  1Z6T A;  4KVO A;  5BW8 C;  4QEO A;  1HO8 A;  2OND A;  1W3B A;  5F6L A;  4RSY A;  2AXZ A;  3QNK A;  4I6E A;  2WMO A;  3M5A A;  2L6J A;  3SWC A;  3GZS A;  3ZFW A;  3LVR E;  4UQY A;  2J4B A;  2KCK A;  5KJL A;  4F53 A;  2OVB A;  3QJZ A;  1HX8 A;  1NZN A;  3CHR A;  3M54 A;  3FTY A;  3MEK A;  3MZL B;  3SNX A;  5EX0 A;  3G2V A;  4H7Y A;  4JA7 A;  3ZYK A;  2C2L A;  5A23 A;  3CBP A;  1A17 A;  3FTX A;  3QC1 A;  4GU5 A;  5EG2 A;  4HOU A;  3FUI A;  3U66 A;  4AP2 A;  3QAQ A;  5F6K C;  4G25 A;  2FF4 A;  5JJ0 A;  1H19 A;  5FQ7 A;  4UWL A;  4LEU A;  4I9E A;  1KT0 A;  4UWK A;  4AOF A;  3BG1 B;  2DCP A;  5FTP A;  1Z3X A;  2VYI A;  3P1U A;  4HOT A;  3MO5 A;  3APF A;  4HOQ A;  2YQ8 A;  5FQ8 A;  5KJN A;  3VUZ A;  4GB9 A;  2YHC A;  2KZT A;  3ASH A;  3I4R B;  4YVQ C;  1MVX A;  5T0K A;  4U63 A;  4G2V A;  1JWF A;  1UG3 A;  1OWO A;  2VGY A;  2NSZ A;  2PL2 A;  3IHV A;  3PNT B;  3UUX A;  5FQ6 A;  4CRW A;  4G23 A;  3CKC A;  5ANL A;  5FZR A;  2WXJ A;  3FTS A;  1E8Z A;  3FP3 A;  4AY6 A;  2E2E A;  5D0Q D;  1GW6 A;  1N3J A;  4GAA A;  4LCT A;  3IEG A;  3I3N A;  3O4Z A;  5JJ7 A;  3EDT B;  5DBK A;  3L17 A;  4M3O A;  3FFL A;  3SW9 A;  3JQ0 A;  3CHO A;  4V3I A;  3ZVV A;  5BT1 A;  4H7X A;  5J08 A;  3JUI A;  3B7U X;  4NQ0 A;  3L13 A;  3S2A A;  1OWL A;  4A1G A;  3KAE A;  3ZHE B;  4CGV A;  5AJD A;  4ACK A;  4WNF A;  5KJK A;  5KCM A;  4EZL A;  2V4L A;  1XGW A;  4EEC A;  4Q94 A;  5AYF A;  5AIJ A;  4XX5 A;  3ML9 A;  1E7V A;  4NAC A;  5CHE E;  1MQS A;  4DLQ A;  3FH5 A;  3HVE A;  4J7I A;  2WXK A;  3FUK A;  2I1K A;  2UY1 A;  3U3W A;  1SQM A;  4KZC A;  3U64 A;  4XIF A;  3UT4 A;  4LUN U;  4N2S A;  2J09 A;  3U4T A;  4N3A A;  5G05 C;  4H12 A;  1PC2 A;  4L23 A;  4ANV A;  2Y3A A;  2XQ0 A;  2XCB A;  2OVF A;  3GYZ A;  3L08 A;  4G24 A;  1ZU2 A;  4N39 A;  3ZIM A;  4WNG A;  3LYA A;  3QWP A;  5ARG A;  3B7T A;  3VLD A;  2X6J A;  3RU0 A;  3M55 A;  4GZ6 A;  4E85 A;  3CST A;  4GPK A;  4E6H A;  2GW1 A;  4U0Z A;  4I17 A;  5FZS A;  5JJ6 A;  3T5X A;  3TAX A;  1QNF A;  3QK0 A;  2RFI A;  3PRE A;  1XNF A;  4LDG A;  3Q49 B;  4FJY A;  1H3I A;  3ASD A;  2L0T B;  1EPU A;  2R5S A;  5EX3 A;  3PEV B;  4HLE A;  2KCV A;  3DB5 A;  3HYM B;  3S7F A;  3OOI A;  1TJC A;  3ESL A;  5AJL A;  5G04 J;  4AXH A;  2GRM A;  1PAQ A;  3R7Q A;  2NXP A;  3IHX A;  4WWN A;  3FTV A;  4CDM A;  2R17 C;  3CQC B;  2JLB A;  2PM7 A;  2X38 A;  1H2U A;  1Z3Y A;  5JJT A;  4BFR A;  2KZT B;  3L6A A;  4A1S A;  4WNE A;  3MO2 A;  2IJG X;  3TG5 A;  4ABN A;  4QEP A;  5A6C A;  3KEZ A;  3ML8 A;  4CT4 A;  4C9B B;  4HOS A;  4GYY A;  4IYP A;  2WXQ A;  1UW4 B;  3ONK A;  3PUJ A;  4UQX A;  1Y6I A;  4EZK A;  2KCL A;  5G2N A;  4AIF A;  4NRH B;  3CHS A;  4KXK B;  2WMN A;  3FU5 A;  3NF1 A;  2CHZ A;  3LS8 A;  2J49 A;  4WWP A;  4J8D A;  1P5Q A;  3D9J A;  3MJW A;  3OTN A;  3ZHE A;  3BO5 A;  3ZRH A;  1N52 A;  4J83 A;  2C0L A;  5FQ4 A;  5JIN A;  1IQU A;  3M59 A;  3UX4 A;  4HXI A;  1U3C A;  2VSX E;  3ZYM A;  1IQR A;  3CK9 A;  3JYS A;  2AW6 A;  3FU0 A;  5DIZ A;  4I2Z A;  4HVB A;  1SZ9 A;  4E47 A;  4ACL A;  3LDZ A;  4P29 A;  3KMJ A;  3MO0 A;  3ASG A;  5LCW J;  3TXN A;  3HVE B;  3FU3 A;  2F69 A;  1ELR A;  4JW1 A;  4LRZ A;  4NUR A;  2UY1 B;  4FJZ A;  4JHJ A;  2C0M A;  1INZ A;  5JIY A;  4IN3 B;  3TL5 A;  2L9B A;  4L2Y A;  4BTB A;  4C0E A;  4WUY A;  4EZJ A;  3DAL A;  2PQN A;  1BPO A;  5TH7 A;  3QWW A;  3GZ2 A;  5ARF A;  1N54 A;  4CT0 A;  4GCN A;  3MA5 A;  3LXU X;  2PM6 A;  4EQF A;  3APC A;  4AJW A;  2BF0 X;  3CHM A;  4RVB A;  3L54 A;  4CCA A;  4ILH B;  4MI0 A;  3CV0 A;  5A7D B;  5FZQ A;  3FUH A;  1HE8 A;  3G2W A;  2OOE A;  3I5P A;  4AVX A;  4FLH A;  3EIQ C;  3TG4 A;  3G2T A;  3KD7 A;  2YHE A;  2LNI A;  1UN9 A;  3R9A B;  4DPR A;  5C1D A;  2WXN A;  4XE0 A;  4I2W A;  2WB2 A;  3DBS A;  2J08 A;  3AS4 A;  1MUF A;  3M57 A;  2I1J A;  3CVV A;  3IBE A;  4J8O A;  1HS6 A;  3ZW3 A;  1SZA A;  3LPZ A;  3ZPJ A;  2A4Z A;  4JZY A;  2ION A;  3CEQ A;  4GA1 A;  3FUE A;  2LAH A;  2DBA A;  2J07 A;  2MRI A;  3K9I A;  3ZGQ A;  3CVX A;  4PDX A;  2JV0 A;  3PE3 A;  3Q15 A;  1B89 A;  4L2L A;  4J8E A;  3PNL B;  4BT8 A;  2GGF A;  4OVU A;  3OXF A;  3FTZ A;  3CBO A;  3NQP A;  4MI5 A;  4F1S A;  4XZ4 A;  4GA2 A;  4O6F A;  3E4B A;  1E8Y A;  3RJW A;  3D9K A;  3B7S A;  3KS2 A;  3M58 A;  5FJY A;  3SI5 A;  2WXG A;  3MCX A;  4I9C A;  3T5V A;  3B7R L;  4A3V A;  4KT6 B;  3IKO B;  2XPZ A;  1WM5 A;  2Y4U A;  4KMO A;  4F3V A;  4YPA A;  1H2V C;  2RG8 A;  2I6H A;  4B94 A;  2X6I A;  2IOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...