3OOIA

Crystal structure of human histone-lysine n-methyltransferase nsd1 set domain in complex with s-adenosyl-l-methionine
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
232
structure length
232
Chain Sequence
SKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysi
publication title The structure of NSD1 reveals an autoregulatory mechanism underlying histone H3K36 methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 64
structure length 232
sequence length 232
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ooiA00
2G46A 1N3JA 4J7IA 4IJ8A 4QEPA 1H3IA 3OXGA 3S8PA 2BQZA 4FMUA 3TG5A 2W5ZA 3F9YA 5F5EA 5TTFA 5HQ8A 5ARGA 4NVQA 3KMAA 1O9SA 5F59A 5KJNA 4O30A 1MVHA 3OOIA 4NJ5A 5JINA 5T0KA 3MO0A 3RQ4A 3S7DA 4YNDA 3S7FA 5TEGA 1ML9A 3OS5A 3S7BA 5JIYA 3CBMA 3M54A 3PDNA 3DALA 4QENA 3KMJA 4MI0A 3OXLA 5JJ0A 5JHNA 4Z4PA 3MO2A 1N6AA 5KJLA 3M59A 3CBPA 2RFIA 3M5AA 1ZKKA 4IJDA 4O6FA 4H12A 3VV0A 5F6LA 3SWCA 5EG2A 2W5YA 3M58A 3RAYA 3VUZA 5EX0A 3MO5A 4J8OA 5HI7A 3OXFA 4I51A 4WUYA 4E47A 3S7JA 5ARFA 4AU7A 4YNMA 5KJMA 3M53A 4J83A 5T0MA 4C1QA 3MEKA 3FPDA 3N71A 5F6KC 1MT6A 3OPEA 3QWVA 2F69A 3KMTA 5AYFA 4YNPA 3RIBA 3RJWA 4RZ0A 3M56A 3CBOA 3F9XA 4YPAA 1MUFA 3IHXA 3K5KA 3BO5A 5CPRB 4JDSA 3QWWA 3HNAA 2O8JA 5TH7A 5CCMA 4MI5A 5T5GA 3RU0A 3M55A 5LSZA 4YPEA 2JV0A 1MVXA 4J7FA 3M57A 4YPUA 1XQHA 1N6CA 2IGQA 3SW9A 4JLGA 3F9WA 4BUPA 5KJKA 4QEOA 3QWPA 2R3AA 5CCLA 4LDGA 3F9ZA 5LSXA 1PEGA 3DB5A 5EX3A 3EP0A 3TG4A 2QPWA
chains in the Genus database with same CATH superfamily
2G46A 1N3JA 4J7IA 4IJ8A 4QEPA 1H3IA 3OXGA 3S8PA 2BQZA 4FMUA 3TG5A 2W5ZA 3F9YA 5F5EA 5TTFA 5HQ8A 5ARGA 4NVQA 3KMAA 1O9SA 5F59A 5KJNA 4O30A 1MVHA 3OOIA 4NJ5A 5JINA 5T0KA 3MO0A 3RQ4A 3S7DA 4YNDA 3S7FA 5TEGA 1ML9A 3OS5A 3S7BA 5JIYA 3CBMA 3M54A 3PDNA 3DALA 4QENA 3KMJA 4MI0A 3OXLA 5JJ0A 5JHNA 4Z4PA 3MO2A 1N6AA 5KJLA 3M59A 3CBPA 2RFIA 3M5AA 1ZKKA 4IJDA 4O6FA 4H12A 3VV0A 5F6LA 3SWCA 5EG2A 2W5YA 3M58A 3RAYA 3VUZA 5EX0A 3MO5A 4J8OA 5HI7A 3OXFA 4I51A 4WUYA 4E47A 3S7JA 5ARFA 4AU7A 4YNMA 5KJMA 3M53A 4J83A 5T0MA 4C1QA 3MEKA 3FPDA 3N71A 5F6KC 1MT6A 3OPEA 3QWVA 2F69A 3KMTA 5AYFA 4YNPA 3RIBA 3RJWA 4RZ0A 3M56A 3CBOA 3F9XA 4YPAA 1MUFA 3IHXA 3K5KA 3BO5A 5CPRB 4JDSA 3QWWA 3HNAA 2O8JA 5TH7A 5CCMA 4MI5A 5T5GA 3RU0A 3M55A 5LSZA 4YPEA 2JV0A 1MVXA 4J7FA 3M57A 4YPUA 1XQHA 1N6CA 2IGQA 3SW9A 4JLGA 3F9WA 4BUPA 5KJKA 4QEOA 3QWPA 2R3AA 5CCLA 4LDGA 3F9ZA 5LSXA 1PEGA 3DB5A 5EX3A 3EP0A 3TG4A 2QPWA
chains in the Genus database with same CATH topology
2G46A 1N3JA 4J7IA 4IJ8A 4QEPA 1H3IA 3OXGA 3S8PA 2BQZA 4FMUA 3TG5A 2W5ZA 3F9YA 5F5EA 5TTFA 5HQ8A 5ARGA 4NVQA 3KMAA 1O9SA 5F59A 5KJNA 4O30A 1MVHA 3OOIA 4NJ5A 5JINA 5T0KA 3MO0A 3RQ4A 3S7DA 4YNDA 3S7FA 5TEGA 1ML9A 3OS5A 3S7BA 5JIYA 3CBMA 3M54A 3PDNA 3DALA 4QENA 3KMJA 4MI0A 3OXLA 5JJ0A 5JHNA 4Z4PA 3MO2A 1N6AA 5KJLA 3M59A 3CBPA 2RFIA 3M5AA 1ZKKA 4IJDA 4O6FA 4H12A 3VV0A 5F6LA 3SWCA 5EG2A 2W5YA 3M58A 3RAYA 3VUZA 5EX0A 3MO5A 4J8OA 5HI7A 3OXFA 4I51A 4WUYA 4E47A 3S7JA 5ARFA 4AU7A 4YNMA 5KJMA 3M53A 4J83A 5T0MA 4C1QA 3MEKA 3FPDA 3N71A 5F6KC 1MT6A 3OPEA 3QWVA 2F69A 3KMTA 5AYFA 4YNPA 3RIBA 3RJWA 4RZ0A 3M56A 3CBOA 3F9XA 4YPAA 1MUFA 3IHXA 3K5KA 3BO5A 5CPRB 4JDSA 3QWWA 3HNAA 2O8JA 5TH7A 5CCMA 4MI5A 5T5GA 3RU0A 3M55A 5LSZA 4YPEA 2JV0A 1MVXA 4J7FA 3M57A 4YPUA 1XQHA 1N6CA 2IGQA 3SW9A 4JLGA 3F9WA 4BUPA 5KJKA 4QEOA 3QWPA 2R3AA 5CCLA 4LDGA 3F9ZA 5LSXA 1PEGA 3DB5A 5EX3A 3EP0A 3TG4A 2QPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G46 A;  1N3J A;  4J7I A;  4IJ8 A;  4QEP A;  1H3I A;  3OXG A;  3S8P A;  2BQZ A;  4FMU A;  3TG5 A;  2W5Z A;  3F9Y A;  5F5E A;  5TTF A;  5HQ8 A;  5ARG A;  4NVQ A;  3KMA A;  1O9S A;  5F59 A;  5KJN A;  4O30 A;  1MVH A;  3OOI A;  4NJ5 A;  5JIN A;  5T0K A;  3MO0 A;  3RQ4 A;  3S7D A;  4YND A;  3S7F A;  5TEG A;  1ML9 A;  3OS5 A;  3S7B A;  5JIY A;  3CBM A;  3M54 A;  3PDN A;  3DAL A;  4QEN A;  3KMJ A;  4MI0 A;  3OXL A;  5JJ0 A;  5JHN A;  4Z4P A;  3MO2 A;  1N6A A;  5KJL A;  3M59 A;  3CBP A;  2RFI A;  3M5A A;  1ZKK A;  4IJD A;  4O6F A;  4H12 A;  3VV0 A;  5F6L A;  3SWC A;  5EG2 A;  2W5Y A;  3M58 A;  3RAY A;  3VUZ A;  5EX0 A;  3MO5 A;  4J8O A;  5HI7 A;  3OXF A;  4I51 A;  4WUY A;  4E47 A;  3S7J A;  5ARF A;  4AU7 A;  4YNM A;  5KJM A;  3M53 A;  4J83 A;  5T0M A;  4C1Q A;  3MEK A;  3FPD A;  3N71 A;  5F6K C;  1MT6 A;  3OPE A;  3QWV A;  2F69 A;  3KMT A;  5AYF A;  4YNP A;  3RIB A;  3RJW A;  4RZ0 A;  3M56 A;  3CBO A;  3F9X A;  4YPA A;  1MUF A;  3IHX A;  3K5K A;  3BO5 A;  5CPR B;  4JDS A;  3QWW A;  3HNA A;  2O8J A;  5TH7 A;  5CCM A;  4MI5 A;  5T5G A;  3RU0 A;  3M55 A;  5LSZ A;  4YPE A;  2JV0 A;  1MVX A;  4J7F A;  3M57 A;  4YPU A;  1XQH A;  1N6C A;  2IGQ A;  3SW9 A;  4JLG A;  3F9W A;  4BUP A;  5KJK A;  4QEO A;  3QWP A;  2R3A A;  5CCL A;  4LDG A;  3F9Z A;  5LSX A;  1PEG A;  3DB5 A;  5EX3 A;  3EP0 A;  3TG4 A;  2QPW A; 
#chains in the Genus database with same CATH topology
 2G46 A;  1N3J A;  4J7I A;  4IJ8 A;  4QEP A;  1H3I A;  3OXG A;  3S8P A;  2BQZ A;  4FMU A;  3TG5 A;  2W5Z A;  3F9Y A;  5F5E A;  5TTF A;  5HQ8 A;  5ARG A;  4NVQ A;  3KMA A;  1O9S A;  5F59 A;  5KJN A;  4O30 A;  1MVH A;  3OOI A;  4NJ5 A;  5JIN A;  5T0K A;  3MO0 A;  3RQ4 A;  3S7D A;  4YND A;  3S7F A;  5TEG A;  1ML9 A;  3OS5 A;  3S7B A;  5JIY A;  3CBM A;  3M54 A;  3PDN A;  3DAL A;  4QEN A;  3KMJ A;  4MI0 A;  3OXL A;  5JJ0 A;  5JHN A;  4Z4P A;  3MO2 A;  1N6A A;  5KJL A;  3M59 A;  3CBP A;  2RFI A;  3M5A A;  1ZKK A;  4IJD A;  4O6F A;  4H12 A;  3VV0 A;  5F6L A;  3SWC A;  5EG2 A;  2W5Y A;  3M58 A;  3RAY A;  3VUZ A;  5EX0 A;  3MO5 A;  4J8O A;  5HI7 A;  3OXF A;  4I51 A;  4WUY A;  4E47 A;  3S7J A;  5ARF A;  4AU7 A;  4YNM A;  5KJM A;  3M53 A;  4J83 A;  5T0M A;  4C1Q A;  3MEK A;  3FPD A;  3N71 A;  5F6K C;  1MT6 A;  3OPE A;  3QWV A;  2F69 A;  3KMT A;  5AYF A;  4YNP A;  3RIB A;  3RJW A;  4RZ0 A;  3M56 A;  3CBO A;  3F9X A;  4YPA A;  1MUF A;  3IHX A;  3K5K A;  3BO5 A;  5CPR B;  4JDS A;  3QWW A;  3HNA A;  2O8J A;  5TH7 A;  5CCM A;  4MI5 A;  5T5G A;  3RU0 A;  3M55 A;  5LSZ A;  4YPE A;  2JV0 A;  1MVX A;  4J7F A;  3M57 A;  4YPU A;  1XQH A;  1N6C A;  2IGQ A;  3SW9 A;  4JLG A;  3F9W A;  4BUP A;  5KJK A;  4QEO A;  3QWP A;  2R3A A;  5CCL A;  4LDG A;  3F9Z A;  5LSX A;  1PEG A;  3DB5 A;  5EX3 A;  3EP0 A;  3TG4 A;  2QPW A; 
#chains in the Genus database with same CATH homology
 2G46 A;  1N3J A;  4J7I A;  4IJ8 A;  4QEP A;  1H3I A;  3OXG A;  3S8P A;  2BQZ A;  4FMU A;  3TG5 A;  2W5Z A;  3F9Y A;  5F5E A;  5TTF A;  5HQ8 A;  5ARG A;  4NVQ A;  3KMA A;  1O9S A;  5F59 A;  5KJN A;  4O30 A;  1MVH A;  3OOI A;  4NJ5 A;  5JIN A;  5T0K A;  3MO0 A;  3RQ4 A;  3S7D A;  4YND A;  3S7F A;  5TEG A;  1ML9 A;  3OS5 A;  3S7B A;  5JIY A;  3CBM A;  3M54 A;  3PDN A;  3DAL A;  4QEN A;  3KMJ A;  4MI0 A;  3OXL A;  5JJ0 A;  5JHN A;  4Z4P A;  3MO2 A;  1N6A A;  5KJL A;  3M59 A;  3CBP A;  2RFI A;  3M5A A;  1ZKK A;  4IJD A;  4O6F A;  4H12 A;  3VV0 A;  5F6L A;  3SWC A;  5EG2 A;  2W5Y A;  3M58 A;  3RAY A;  3VUZ A;  5EX0 A;  3MO5 A;  4J8O A;  5HI7 A;  3OXF A;  4I51 A;  4WUY A;  4E47 A;  3S7J A;  5ARF A;  4AU7 A;  4YNM A;  5KJM A;  3M53 A;  4J83 A;  5T0M A;  4C1Q A;  3MEK A;  3FPD A;  3N71 A;  5F6K C;  1MT6 A;  3OPE A;  3QWV A;  2F69 A;  3KMT A;  5AYF A;  4YNP A;  3RIB A;  3RJW A;  4RZ0 A;  3M56 A;  3CBO A;  3F9X A;  4YPA A;  1MUF A;  3IHX A;  3K5K A;  3BO5 A;  5CPR B;  4JDS A;  3QWW A;  3HNA A;  2O8J A;  5TH7 A;  5CCM A;  4MI5 A;  5T5G A;  3RU0 A;  3M55 A;  5LSZ A;  4YPE A;  2JV0 A;  1MVX A;  4J7F A;  3M57 A;  4YPU A;  1XQH A;  1N6C A;  2IGQ A;  3SW9 A;  4JLG A;  3F9W A;  4BUP A;  5KJK A;  4QEO A;  3QWP A;  2R3A A;  5CCL A;  4LDG A;  3F9Z A;  5LSX A;  1PEG A;  3DB5 A;  5EX3 A;  3EP0 A;  3TG4 A;  2QPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...