3OOIA

Crystal structure of human histone-lysine n-methyltransferase nsd1 set domain in complex with s-adenosyl-l-methionine
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
232
structure length
232
Chain Sequence
b'SKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysi
molecule tags Transferase
source organism Homo sapiens
publication title The structure of NSD1 reveals an autoregulatory mechanism underlying histone H3K36 methylation
pubmed doi rcsb
total genus 64
structure length 232
sequence length 232
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ooiA00
3S7JA 2W5ZA 5KJMA 5KJKA 2JV0A 3M56A 3OPEA 4RZ0A 2W5YA 3SWCA 3OXGA 3M54A 5TH7A 3MO2A 1MT6A 5F5EA 5T0MA 4QEOA 3HNAA 4YNMA 3K5KA 5EG2A 3RU0A 3QWPA 5F59A 5JINA 3OXFA 4J7FA 4O6FA 1MUFA 3EP0A 3S7DA 3RIBA 5F6LA 3S7BA 4C1QA 5HI7A 4QEPA 3OOIA 4JDSA 3F9YA 5T0KA 3N71A 3M59A 4E47A 3F9XA 4WUYA 3TG4A 3MEKA 4YPAA 3S7FA 2RFIA 3QWVA 3VV0A 3SW9A 3BO5A 5ARGA 5TTFA 5JJ0A 2O8JA 1ML9A 3FPDA 3KMJA 4H12A 2QPWA 4MI0A 4NJ5A 3OS5A 4Z4PA 2IGQA 5EX3A 4YNDA 3CBPA 3DB5A 4YPEA 3KMTA 3M57A 4J83A 4IJ8A 5JIYA 5LSXA 5CCMA 5KJNA 1PEGA 3F9WA 5EX0A 5CPRB 3M53A 3M5AA 4YPUA 4IJDA 2R3AA 4AU7A 5HQ8A 1XQHA 3M58A 3RAYA 4BUPA 4FMUA 4I51A 4O30A 3VUZA 5ARFA 4QENA 3OXLA 1N6AA 2G46A 1N6CA 4YNPA 3TG5A 3PDNA 3KMAA 3IHXA 5AYFA 4J8OA 4JLGA 5JHNA 1MVXA 1H3IA 3M55A 3DALA 1MVHA 3RQ4A 5LSZA 3CBOA 2BQZA 3F9ZA 3QWWA 4LDGA 2F69A 5TEGA 1ZKKA 4J7IA 5F6KC 3MO0A 4MI5A 3S8PA 3MO5A 3CBMA 5KJLA 1O9SA 5CCLA 1N3JA 3RJWA 5T5GA 4NVQA
chains in the Genus database with same CATH superfamily
3S7JA 2W5ZA 5KJMA 5KJKA 2JV0A 3M56A 3OPEA 4RZ0A 2W5YA 3SWCA 3OXGA 3M54A 5TH7A 3MO2A 1MT6A 5F5EA 5T0MA 4QEOA 3HNAA 4YNMA 3K5KA 5EG2A 3RU0A 3QWPA 5F59A 5JINA 3OXFA 4J7FA 4O6FA 1MUFA 3EP0A 3S7DA 3RIBA 5F6LA 3S7BA 4C1QA 5HI7A 4QEPA 3OOIA 4JDSA 3F9YA 5T0KA 3N71A 3M59A 4E47A 3F9XA 4WUYA 3TG4A 3MEKA 4YPAA 3S7FA 2RFIA 3QWVA 3VV0A 3SW9A 3BO5A 5ARGA 5TTFA 5JJ0A 2O8JA 1ML9A 3FPDA 3KMJA 4H12A 2QPWA 4MI0A 4NJ5A 3OS5A 4Z4PA 2IGQA 5EX3A 4YNDA 3CBPA 3DB5A 4YPEA 3KMTA 3M57A 4J83A 4IJ8A 5JIYA 5LSXA 5CCMA 5KJNA 1PEGA 3F9WA 5EX0A 5CPRB 3M53A 3M5AA 4YPUA 4IJDA 2R3AA 4AU7A 5HQ8A 1XQHA 3M58A 3RAYA 4BUPA 4FMUA 4I51A 4O30A 3VUZA 5ARFA 4QENA 3OXLA 1N6AA 2G46A 1N6CA 4YNPA 3TG5A 3PDNA 3KMAA 3IHXA 5AYFA 4J8OA 4JLGA 5JHNA 1MVXA 1H3IA 3M55A 3DALA 1MVHA 3RQ4A 5LSZA 3CBOA 2BQZA 3F9ZA 3QWWA 4LDGA 2F69A 5TEGA 1ZKKA 4J7IA 5F6KC 3MO0A 4MI5A 3S8PA 3MO5A 3CBMA 5KJLA 1O9SA 5CCLA 1N3JA 3RJWA 5T5GA 4NVQA
chains in the Genus database with same CATH topology
3S7JA 2W5ZA 5KJMA 5KJKA 2JV0A 3M56A 3OPEA 4RZ0A 2W5YA 3SWCA 3OXGA 3M54A 5TH7A 3MO2A 1MT6A 5F5EA 5T0MA 4QEOA 3HNAA 4YNMA 3K5KA 5EG2A 3RU0A 3QWPA 5F59A 5JINA 3OXFA 4J7FA 4O6FA 1MUFA 3EP0A 3S7DA 3RIBA 5F6LA 3S7BA 4C1QA 5HI7A 4QEPA 3OOIA 4JDSA 3F9YA 5T0KA 3N71A 3M59A 4E47A 3F9XA 4WUYA 3TG4A 3MEKA 4YPAA 3S7FA 2RFIA 3QWVA 3VV0A 3SW9A 3BO5A 5ARGA 5TTFA 5JJ0A 2O8JA 1ML9A 3FPDA 3KMJA 4H12A 2QPWA 4MI0A 4NJ5A 3OS5A 4Z4PA 2IGQA 5EX3A 4YNDA 3CBPA 3DB5A 4YPEA 3KMTA 3M57A 4J83A 4IJ8A 5JIYA 5LSXA 5CCMA 5KJNA 1PEGA 3F9WA 5EX0A 5CPRB 3M53A 3M5AA 4YPUA 4IJDA 2R3AA 4AU7A 5HQ8A 1XQHA 3M58A 3RAYA 4BUPA 4FMUA 4I51A 4O30A 3VUZA 5ARFA 4QENA 3OXLA 1N6AA 2G46A 1N6CA 4YNPA 3TG5A 3PDNA 3KMAA 3IHXA 5AYFA 4J8OA 4JLGA 5JHNA 1MVXA 1H3IA 3M55A 3DALA 1MVHA 3RQ4A 5LSZA 3CBOA 2BQZA 3F9ZA 3QWWA 4LDGA 2F69A 5TEGA 1ZKKA 4J7IA 5F6KC 3MO0A 4MI5A 3S8PA 3MO5A 3CBMA 5KJLA 1O9SA 5CCLA 1N3JA 3RJWA 5T5GA 4NVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7J A;  2W5Z A;  5KJM A;  5KJK A;  2JV0 A;  3M56 A;  3OPE A;  4RZ0 A;  2W5Y A;  3SWC A;  3OXG A;  3M54 A;  5TH7 A;  3MO2 A;  1MT6 A;  5F5E A;  5T0M A;  4QEO A;  3HNA A;  4YNM A;  3K5K A;  5EG2 A;  3RU0 A;  3QWP A;  5F59 A;  5JIN A;  3OXF A;  4J7F A;  4O6F A;  1MUF A;  3EP0 A;  3S7D A;  3RIB A;  5F6L A;  3S7B A;  4C1Q A;  5HI7 A;  4QEP A;  3OOI A;  4JDS A;  3F9Y A;  5T0K A;  3N71 A;  3M59 A;  4E47 A;  3F9X A;  4WUY A;  3TG4 A;  3MEK A;  4YPA A;  3S7F A;  2RFI A;  3QWV A;  3VV0 A;  3SW9 A;  3BO5 A;  5ARG A;  5TTF A;  5JJ0 A;  2O8J A;  1ML9 A;  3FPD A;  3KMJ A;  4H12 A;  2QPW A;  4MI0 A;  4NJ5 A;  3OS5 A;  4Z4P A;  2IGQ A;  5EX3 A;  4YND A;  3CBP A;  3DB5 A;  4YPE A;  3KMT A;  3M57 A;  4J83 A;  4IJ8 A;  5JIY A;  5LSX A;  5CCM A;  5KJN A;  1PEG A;  3F9W A;  5EX0 A;  5CPR B;  3M53 A;  3M5A A;  4YPU A;  4IJD A;  2R3A A;  4AU7 A;  5HQ8 A;  1XQH A;  3M58 A;  3RAY A;  4BUP A;  4FMU A;  4I51 A;  4O30 A;  3VUZ A;  5ARF A;  4QEN A;  3OXL A;  1N6A A;  2G46 A;  1N6C A;  4YNP A;  3TG5 A;  3PDN A;  3KMA A;  3IHX A;  5AYF A;  4J8O A;  4JLG A;  5JHN A;  1MVX A;  1H3I A;  3M55 A;  3DAL A;  1MVH A;  3RQ4 A;  5LSZ A;  3CBO A;  2BQZ A;  3F9Z A;  3QWW A;  4LDG A;  2F69 A;  5TEG A;  1ZKK A;  4J7I A;  5F6K C;  3MO0 A;  4MI5 A;  3S8P A;  3MO5 A;  3CBM A;  5KJL A;  1O9S A;  5CCL A;  1N3J A;  3RJW A;  5T5G A;  4NVQ A; 
#chains in the Genus database with same CATH topology
 3S7J A;  2W5Z A;  5KJM A;  5KJK A;  2JV0 A;  3M56 A;  3OPE A;  4RZ0 A;  2W5Y A;  3SWC A;  3OXG A;  3M54 A;  5TH7 A;  3MO2 A;  1MT6 A;  5F5E A;  5T0M A;  4QEO A;  3HNA A;  4YNM A;  3K5K A;  5EG2 A;  3RU0 A;  3QWP A;  5F59 A;  5JIN A;  3OXF A;  4J7F A;  4O6F A;  1MUF A;  3EP0 A;  3S7D A;  3RIB A;  5F6L A;  3S7B A;  4C1Q A;  5HI7 A;  4QEP A;  3OOI A;  4JDS A;  3F9Y A;  5T0K A;  3N71 A;  3M59 A;  4E47 A;  3F9X A;  4WUY A;  3TG4 A;  3MEK A;  4YPA A;  3S7F A;  2RFI A;  3QWV A;  3VV0 A;  3SW9 A;  3BO5 A;  5ARG A;  5TTF A;  5JJ0 A;  2O8J A;  1ML9 A;  3FPD A;  3KMJ A;  4H12 A;  2QPW A;  4MI0 A;  4NJ5 A;  3OS5 A;  4Z4P A;  2IGQ A;  5EX3 A;  4YND A;  3CBP A;  3DB5 A;  4YPE A;  3KMT A;  3M57 A;  4J83 A;  4IJ8 A;  5JIY A;  5LSX A;  5CCM A;  5KJN A;  1PEG A;  3F9W A;  5EX0 A;  5CPR B;  3M53 A;  3M5A A;  4YPU A;  4IJD A;  2R3A A;  4AU7 A;  5HQ8 A;  1XQH A;  3M58 A;  3RAY A;  4BUP A;  4FMU A;  4I51 A;  4O30 A;  3VUZ A;  5ARF A;  4QEN A;  3OXL A;  1N6A A;  2G46 A;  1N6C A;  4YNP A;  3TG5 A;  3PDN A;  3KMA A;  3IHX A;  5AYF A;  4J8O A;  4JLG A;  5JHN A;  1MVX A;  1H3I A;  3M55 A;  3DAL A;  1MVH A;  3RQ4 A;  5LSZ A;  3CBO A;  2BQZ A;  3F9Z A;  3QWW A;  4LDG A;  2F69 A;  5TEG A;  1ZKK A;  4J7I A;  5F6K C;  3MO0 A;  4MI5 A;  3S8P A;  3MO5 A;  3CBM A;  5KJL A;  1O9S A;  5CCL A;  1N3J A;  3RJW A;  5T5G A;  4NVQ A; 
#chains in the Genus database with same CATH homology
 3S7J A;  2W5Z A;  5KJM A;  5KJK A;  2JV0 A;  3M56 A;  3OPE A;  4RZ0 A;  2W5Y A;  3SWC A;  3OXG A;  3M54 A;  5TH7 A;  3MO2 A;  1MT6 A;  5F5E A;  5T0M A;  4QEO A;  3HNA A;  4YNM A;  3K5K A;  5EG2 A;  3RU0 A;  3QWP A;  5F59 A;  5JIN A;  3OXF A;  4J7F A;  4O6F A;  1MUF A;  3EP0 A;  3S7D A;  3RIB A;  5F6L A;  3S7B A;  4C1Q A;  5HI7 A;  4QEP A;  3OOI A;  4JDS A;  3F9Y A;  5T0K A;  3N71 A;  3M59 A;  4E47 A;  3F9X A;  4WUY A;  3TG4 A;  3MEK A;  4YPA A;  3S7F A;  2RFI A;  3QWV A;  3VV0 A;  3SW9 A;  3BO5 A;  5ARG A;  5TTF A;  5JJ0 A;  2O8J A;  1ML9 A;  3FPD A;  3KMJ A;  4H12 A;  2QPW A;  4MI0 A;  4NJ5 A;  3OS5 A;  4Z4P A;  2IGQ A;  5EX3 A;  4YND A;  3CBP A;  3DB5 A;  4YPE A;  3KMT A;  3M57 A;  4J83 A;  4IJ8 A;  5JIY A;  5LSX A;  5CCM A;  5KJN A;  1PEG A;  3F9W A;  5EX0 A;  5CPR B;  3M53 A;  3M5A A;  4YPU A;  4IJD A;  2R3A A;  4AU7 A;  5HQ8 A;  1XQH A;  3M58 A;  3RAY A;  4BUP A;  4FMU A;  4I51 A;  4O30 A;  3VUZ A;  5ARF A;  4QEN A;  3OXL A;  1N6A A;  2G46 A;  1N6C A;  4YNP A;  3TG5 A;  3PDN A;  3KMA A;  3IHX A;  5AYF A;  4J8O A;  4JLG A;  5JHN A;  1MVX A;  1H3I A;  3M55 A;  3DAL A;  1MVH A;  3RQ4 A;  5LSZ A;  3CBO A;  2BQZ A;  3F9Z A;  3QWW A;  4LDG A;  2F69 A;  5TEG A;  1ZKK A;  4J7I A;  5F6K C;  3MO0 A;  4MI5 A;  3S8P A;  3MO5 A;  3CBM A;  5KJL A;  1O9S A;  5CCL A;  1N3J A;  3RJW A;  5T5G A;  4NVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...