3OOIA

Crystal structure of human histone-lysine n-methyltransferase nsd1 set domain in complex with s-adenosyl-l-methionine
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
232
structure length
232
Chain Sequence
SKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysi
publication title The structure of NSD1 reveals an autoregulatory mechanism underlying histone H3K36 methylation
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 232
sequence length 232
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ooiA00
4YNDA 1N6CA 3RIBA 1H3IA 4J7IA 3MEKA 3RU0A 1N3JA 2R3AA 4QENA 2O8JA 3SW9A 3IHXA 3K5KA 3F9YA 3RJWA 4WUYA 4LDGA 3TG5A 5CCLA 4YPAA 2BQZA 3OXFA 3S8PA 2JV0A 5KJLA 3S7FA 3CBMA 2W5ZA 4BUPA 5AYFA 3RAYA 4IJ8A 4NVQA 5KJKA 5T0KA 1O9SA 4MI0A 3M57A 2G46A 5CCMA 5EX0A 3RQ4A 3VV0A 3BO5A 4E47A 3MO2A 5JHNA 5JIYA 4JDSA 5F6KC 5TTFA 1PEGA 4J8OA 3S7JA 3OXLA 3M56A 4JLGA 5JINA 2F69A 5LSZA 3CBOA 2W5YA 3M5AA 1ZKKA 5F6LA 3PDNA 5JJ0A 4YPUA 4O6FA 3QWWA 4YNMA 5TEGA 1N6AA 3QWVA 2QPWA 3TG4A 5EX3A 4J7FA 3F9ZA 4J83A 3OXGA 3CBPA 2IGQA 4FMUA 1MVXA 4MI5A 3M55A 5HQ8A 3QWPA 5T5GA 5KJNA 3OS5A 3S7BA 4RZ0A 4NJ5A 5TH7A 4QEOA 5ARFA 3KMAA 3N71A 3M53A 3OPEA 4QEPA 3S7DA 4AU7A 5HI7A 5CPRB 3KMJA 3M54A 1MUFA 1ML9A 5F59A 3OOIA 5EG2A 3KMTA 4Z4PA 4YNPA 3M58A 3M59A 3VUZA 3FPDA 1XQHA 3DB5A 4YPEA 4I51A 3F9WA 3SWCA 4O30A 5LSXA 4IJDA 5T0MA 4H12A 4C1QA 5KJMA 1MVHA 1MT6A 2RFIA 3F9XA 3MO0A 3DALA 3HNAA 5F5EA 5ARGA 3MO5A 3EP0A
chains in the Genus database with same CATH superfamily
4YNDA 1N6CA 3RIBA 1H3IA 4J7IA 3MEKA 3RU0A 1N3JA 2R3AA 4QENA 2O8JA 3SW9A 3IHXA 3K5KA 3F9YA 3RJWA 4WUYA 4LDGA 3TG5A 5CCLA 4YPAA 2BQZA 3OXFA 3S8PA 2JV0A 5KJLA 3S7FA 3CBMA 2W5ZA 4BUPA 5AYFA 3RAYA 4IJ8A 4NVQA 5KJKA 5T0KA 1O9SA 4MI0A 3M57A 2G46A 5CCMA 5EX0A 3RQ4A 3VV0A 3BO5A 4E47A 3MO2A 5JHNA 5JIYA 4JDSA 5F6KC 5TTFA 1PEGA 4J8OA 3S7JA 3OXLA 3M56A 4JLGA 5JINA 2F69A 5LSZA 3CBOA 2W5YA 3M5AA 1ZKKA 5F6LA 3PDNA 5JJ0A 4YPUA 4O6FA 3QWWA 4YNMA 5TEGA 1N6AA 3QWVA 2QPWA 3TG4A 5EX3A 4J7FA 3F9ZA 4J83A 3OXGA 3CBPA 2IGQA 4FMUA 1MVXA 4MI5A 3M55A 5HQ8A 3QWPA 5T5GA 5KJNA 3OS5A 3S7BA 4RZ0A 4NJ5A 5TH7A 4QEOA 5ARFA 3KMAA 3N71A 3M53A 3OPEA 4QEPA 3S7DA 4AU7A 5HI7A 5CPRB 3KMJA 3M54A 1MUFA 1ML9A 5F59A 3OOIA 5EG2A 3KMTA 4Z4PA 4YNPA 3M58A 3M59A 3VUZA 3FPDA 1XQHA 3DB5A 4YPEA 4I51A 3F9WA 3SWCA 4O30A 5LSXA 4IJDA 5T0MA 4H12A 4C1QA 5KJMA 1MVHA 1MT6A 2RFIA 3F9XA 3MO0A 3DALA 3HNAA 5F5EA 5ARGA 3MO5A 3EP0A
chains in the Genus database with same CATH topology
4YNDA 1N6CA 3RIBA 1H3IA 4J7IA 3MEKA 3RU0A 1N3JA 2R3AA 4QENA 2O8JA 3SW9A 3IHXA 3K5KA 3F9YA 3RJWA 4WUYA 4LDGA 3TG5A 5CCLA 4YPAA 2BQZA 3OXFA 3S8PA 2JV0A 5KJLA 3S7FA 3CBMA 2W5ZA 4BUPA 5AYFA 3RAYA 4IJ8A 4NVQA 5KJKA 5T0KA 1O9SA 4MI0A 3M57A 2G46A 5CCMA 5EX0A 3RQ4A 3VV0A 3BO5A 4E47A 3MO2A 5JHNA 5JIYA 4JDSA 5F6KC 5TTFA 1PEGA 4J8OA 3S7JA 3OXLA 3M56A 4JLGA 5JINA 2F69A 5LSZA 3CBOA 2W5YA 3M5AA 1ZKKA 5F6LA 3PDNA 5JJ0A 4YPUA 4O6FA 3QWWA 4YNMA 5TEGA 1N6AA 3QWVA 2QPWA 3TG4A 5EX3A 4J7FA 3F9ZA 4J83A 3OXGA 3CBPA 2IGQA 4FMUA 1MVXA 4MI5A 3M55A 5HQ8A 3QWPA 5T5GA 5KJNA 3OS5A 3S7BA 4RZ0A 4NJ5A 5TH7A 4QEOA 5ARFA 3KMAA 3N71A 3M53A 3OPEA 4QEPA 3S7DA 4AU7A 5HI7A 5CPRB 3KMJA 3M54A 1MUFA 1ML9A 5F59A 3OOIA 5EG2A 3KMTA 4Z4PA 4YNPA 3M58A 3M59A 3VUZA 3FPDA 1XQHA 3DB5A 4YPEA 4I51A 3F9WA 3SWCA 4O30A 5LSXA 4IJDA 5T0MA 4H12A 4C1QA 5KJMA 1MVHA 1MT6A 2RFIA 3F9XA 3MO0A 3DALA 3HNAA 5F5EA 5ARGA 3MO5A 3EP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YND A;  1N6C A;  3RIB A;  1H3I A;  4J7I A;  3MEK A;  3RU0 A;  1N3J A;  2R3A A;  4QEN A;  2O8J A;  3SW9 A;  3IHX A;  3K5K A;  3F9Y A;  3RJW A;  4WUY A;  4LDG A;  3TG5 A;  5CCL A;  4YPA A;  2BQZ A;  3OXF A;  3S8P A;  2JV0 A;  5KJL A;  3S7F A;  3CBM A;  2W5Z A;  4BUP A;  5AYF A;  3RAY A;  4IJ8 A;  4NVQ A;  5KJK A;  5T0K A;  1O9S A;  4MI0 A;  3M57 A;  2G46 A;  5CCM A;  5EX0 A;  3RQ4 A;  3VV0 A;  3BO5 A;  4E47 A;  3MO2 A;  5JHN A;  5JIY A;  4JDS A;  5F6K C;  5TTF A;  1PEG A;  4J8O A;  3S7J A;  3OXL A;  3M56 A;  4JLG A;  5JIN A;  2F69 A;  5LSZ A;  3CBO A;  2W5Y A;  3M5A A;  1ZKK A;  5F6L A;  3PDN A;  5JJ0 A;  4YPU A;  4O6F A;  3QWW A;  4YNM A;  5TEG A;  1N6A A;  3QWV A;  2QPW A;  3TG4 A;  5EX3 A;  4J7F A;  3F9Z A;  4J83 A;  3OXG A;  3CBP A;  2IGQ A;  4FMU A;  1MVX A;  4MI5 A;  3M55 A;  5HQ8 A;  3QWP A;  5T5G A;  5KJN A;  3OS5 A;  3S7B A;  4RZ0 A;  4NJ5 A;  5TH7 A;  4QEO A;  5ARF A;  3KMA A;  3N71 A;  3M53 A;  3OPE A;  4QEP A;  3S7D A;  4AU7 A;  5HI7 A;  5CPR B;  3KMJ A;  3M54 A;  1MUF A;  1ML9 A;  5F59 A;  3OOI A;  5EG2 A;  3KMT A;  4Z4P A;  4YNP A;  3M58 A;  3M59 A;  3VUZ A;  3FPD A;  1XQH A;  3DB5 A;  4YPE A;  4I51 A;  3F9W A;  3SWC A;  4O30 A;  5LSX A;  4IJD A;  5T0M A;  4H12 A;  4C1Q A;  5KJM A;  1MVH A;  1MT6 A;  2RFI A;  3F9X A;  3MO0 A;  3DAL A;  3HNA A;  5F5E A;  5ARG A;  3MO5 A;  3EP0 A; 
#chains in the Genus database with same CATH topology
 4YND A;  1N6C A;  3RIB A;  1H3I A;  4J7I A;  3MEK A;  3RU0 A;  1N3J A;  2R3A A;  4QEN A;  2O8J A;  3SW9 A;  3IHX A;  3K5K A;  3F9Y A;  3RJW A;  4WUY A;  4LDG A;  3TG5 A;  5CCL A;  4YPA A;  2BQZ A;  3OXF A;  3S8P A;  2JV0 A;  5KJL A;  3S7F A;  3CBM A;  2W5Z A;  4BUP A;  5AYF A;  3RAY A;  4IJ8 A;  4NVQ A;  5KJK A;  5T0K A;  1O9S A;  4MI0 A;  3M57 A;  2G46 A;  5CCM A;  5EX0 A;  3RQ4 A;  3VV0 A;  3BO5 A;  4E47 A;  3MO2 A;  5JHN A;  5JIY A;  4JDS A;  5F6K C;  5TTF A;  1PEG A;  4J8O A;  3S7J A;  3OXL A;  3M56 A;  4JLG A;  5JIN A;  2F69 A;  5LSZ A;  3CBO A;  2W5Y A;  3M5A A;  1ZKK A;  5F6L A;  3PDN A;  5JJ0 A;  4YPU A;  4O6F A;  3QWW A;  4YNM A;  5TEG A;  1N6A A;  3QWV A;  2QPW A;  3TG4 A;  5EX3 A;  4J7F A;  3F9Z A;  4J83 A;  3OXG A;  3CBP A;  2IGQ A;  4FMU A;  1MVX A;  4MI5 A;  3M55 A;  5HQ8 A;  3QWP A;  5T5G A;  5KJN A;  3OS5 A;  3S7B A;  4RZ0 A;  4NJ5 A;  5TH7 A;  4QEO A;  5ARF A;  3KMA A;  3N71 A;  3M53 A;  3OPE A;  4QEP A;  3S7D A;  4AU7 A;  5HI7 A;  5CPR B;  3KMJ A;  3M54 A;  1MUF A;  1ML9 A;  5F59 A;  3OOI A;  5EG2 A;  3KMT A;  4Z4P A;  4YNP A;  3M58 A;  3M59 A;  3VUZ A;  3FPD A;  1XQH A;  3DB5 A;  4YPE A;  4I51 A;  3F9W A;  3SWC A;  4O30 A;  5LSX A;  4IJD A;  5T0M A;  4H12 A;  4C1Q A;  5KJM A;  1MVH A;  1MT6 A;  2RFI A;  3F9X A;  3MO0 A;  3DAL A;  3HNA A;  5F5E A;  5ARG A;  3MO5 A;  3EP0 A; 
#chains in the Genus database with same CATH homology
 4YND A;  1N6C A;  3RIB A;  1H3I A;  4J7I A;  3MEK A;  3RU0 A;  1N3J A;  2R3A A;  4QEN A;  2O8J A;  3SW9 A;  3IHX A;  3K5K A;  3F9Y A;  3RJW A;  4WUY A;  4LDG A;  3TG5 A;  5CCL A;  4YPA A;  2BQZ A;  3OXF A;  3S8P A;  2JV0 A;  5KJL A;  3S7F A;  3CBM A;  2W5Z A;  4BUP A;  5AYF A;  3RAY A;  4IJ8 A;  4NVQ A;  5KJK A;  5T0K A;  1O9S A;  4MI0 A;  3M57 A;  2G46 A;  5CCM A;  5EX0 A;  3RQ4 A;  3VV0 A;  3BO5 A;  4E47 A;  3MO2 A;  5JHN A;  5JIY A;  4JDS A;  5F6K C;  5TTF A;  1PEG A;  4J8O A;  3S7J A;  3OXL A;  3M56 A;  4JLG A;  5JIN A;  2F69 A;  5LSZ A;  3CBO A;  2W5Y A;  3M5A A;  1ZKK A;  5F6L A;  3PDN A;  5JJ0 A;  4YPU A;  4O6F A;  3QWW A;  4YNM A;  5TEG A;  1N6A A;  3QWV A;  2QPW A;  3TG4 A;  5EX3 A;  4J7F A;  3F9Z A;  4J83 A;  3OXG A;  3CBP A;  2IGQ A;  4FMU A;  1MVX A;  4MI5 A;  3M55 A;  5HQ8 A;  3QWP A;  5T5G A;  5KJN A;  3OS5 A;  3S7B A;  4RZ0 A;  4NJ5 A;  5TH7 A;  4QEO A;  5ARF A;  3KMA A;  3N71 A;  3M53 A;  3OPE A;  4QEP A;  3S7D A;  4AU7 A;  5HI7 A;  5CPR B;  3KMJ A;  3M54 A;  1MUF A;  1ML9 A;  5F59 A;  3OOI A;  5EG2 A;  3KMT A;  4Z4P A;  4YNP A;  3M58 A;  3M59 A;  3VUZ A;  3FPD A;  1XQH A;  3DB5 A;  4YPE A;  4I51 A;  3F9W A;  3SWC A;  4O30 A;  5LSX A;  4IJD A;  5T0M A;  4H12 A;  4C1Q A;  5KJM A;  1MVH A;  1MT6 A;  2RFI A;  3F9X A;  3MO0 A;  3DAL A;  3HNA A;  5F5E A;  5ARG A;  3MO5 A;  3EP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...