3OOIA

Crystal structure of human histone-lysine n-methyltransferase nsd1 set domain in complex with s-adenosyl-l-methionine
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
232
structure length
232
Chain Sequence
SKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of NSD1 reveals an autoregulatory mechanism underlying histone H3K36 methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysi
total genus 64
structure length 232
sequence length 232
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ooiA00
4FMUA 4LDGA 3MO2A 4MI0A 3CBMA 3OS5A 4YNMA 1ZKKA 4MI5A 4YPEA 5KJNA 4IJDA 5LSXA 3DB5A 5T0KA 3OXFA 5EX0A 5KJKA 1MVXA 3PDNA 3HNAA 3DALA 3QWVA 3RJWA 3S7FA 4QEPA 3S8PA 3TG5A 2W5ZA 4E47A 3M58A 4J7IA 5F5EA 1PEGA 2RFIA 3F9YA 3F9ZA 4IJ8A 1O9SA 4J8OA 1MT6A 5HQ8A 2JV0A 5ARGA 4WUYA 3F9XA 3OXGA 5TEGA 5JINA 3KMJA 3KMAA 3MO0A 4JDSA 2O8JA 5AYFA 4O30A 4QENA 3RQ4A 4RZ0A 4NJ5A 3KMTA 1H3IA 5JHNA 3CBOA 5ARFA 3N71A 1ML9A 4QEOA 5HI7A 4Z4PA 3RAYA 3S7JA 2F69A 1XQHA 3M54A 5CCMA 3FPDA 3SW9A 1N3JA 3EP0A 2R3AA 4NVQA 3IHXA 5JJ0A 5EX3A 4YNDA 1N6CA 3M5AA 5JIYA 3OXLA 3K5KA 4YPAA 3VV0A 1MVHA 5F6KC 4AU7A 2BQZA 4YNPA 1MUFA 3M59A 2IGQA 5CCLA 3MEKA 3TG4A 5TTFA 2QPWA 4BUPA 3QWWA 5F6LA 4J83A 3F9WA 2G46A 3M56A 5TH7A 5KJLA 3VUZA 4I51A 4JLGA 3S7BA 4C1QA 5LSZA 5T5GA 5EG2A 4H12A 3RIBA 3M57A 3OPEA 1N6AA 3MO5A 5F59A 3OOIA 5CPRB 3M55A 5KJMA 3RU0A 3QWPA 4O6FA 3SWCA 3S7DA 4YPUA 3CBPA 5T0MA 3M53A 3BO5A 4J7FA 2W5YA
chains in the Genus database with same CATH superfamily
4FMUA 4LDGA 3MO2A 4MI0A 3CBMA 3OS5A 4YNMA 1ZKKA 4MI5A 4YPEA 5KJNA 4IJDA 5LSXA 3DB5A 5T0KA 3OXFA 5EX0A 5KJKA 1MVXA 3PDNA 3HNAA 3DALA 3QWVA 3RJWA 3S7FA 4QEPA 3S8PA 3TG5A 2W5ZA 4E47A 3M58A 4J7IA 5F5EA 1PEGA 2RFIA 3F9YA 3F9ZA 4IJ8A 1O9SA 4J8OA 1MT6A 5HQ8A 2JV0A 5ARGA 4WUYA 3F9XA 3OXGA 5TEGA 5JINA 3KMJA 3KMAA 3MO0A 4JDSA 2O8JA 5AYFA 4O30A 4QENA 3RQ4A 4RZ0A 4NJ5A 3KMTA 1H3IA 5JHNA 3CBOA 5ARFA 3N71A 1ML9A 4QEOA 5HI7A 4Z4PA 3RAYA 3S7JA 2F69A 1XQHA 3M54A 5CCMA 3FPDA 3SW9A 1N3JA 3EP0A 2R3AA 4NVQA 3IHXA 5JJ0A 5EX3A 4YNDA 1N6CA 3M5AA 5JIYA 3OXLA 3K5KA 4YPAA 3VV0A 1MVHA 5F6KC 4AU7A 2BQZA 4YNPA 1MUFA 3M59A 2IGQA 5CCLA 3MEKA 3TG4A 5TTFA 2QPWA 4BUPA 3QWWA 5F6LA 4J83A 3F9WA 2G46A 3M56A 5TH7A 5KJLA 3VUZA 4I51A 4JLGA 3S7BA 4C1QA 5LSZA 5T5GA 5EG2A 4H12A 3RIBA 3M57A 3OPEA 1N6AA 3MO5A 5F59A 3OOIA 5CPRB 3M55A 5KJMA 3RU0A 3QWPA 4O6FA 3SWCA 3S7DA 4YPUA 3CBPA 5T0MA 3M53A 3BO5A 4J7FA 2W5YA
chains in the Genus database with same CATH topology
4FMUA 4LDGA 3MO2A 4MI0A 3CBMA 3OS5A 4YNMA 1ZKKA 4MI5A 4YPEA 5KJNA 4IJDA 5LSXA 3DB5A 5T0KA 3OXFA 5EX0A 5KJKA 1MVXA 3PDNA 3HNAA 3DALA 3QWVA 3RJWA 3S7FA 4QEPA 3S8PA 3TG5A 2W5ZA 4E47A 3M58A 4J7IA 5F5EA 1PEGA 2RFIA 3F9YA 3F9ZA 4IJ8A 1O9SA 4J8OA 1MT6A 5HQ8A 2JV0A 5ARGA 4WUYA 3F9XA 3OXGA 5TEGA 5JINA 3KMJA 3KMAA 3MO0A 4JDSA 2O8JA 5AYFA 4O30A 4QENA 3RQ4A 4RZ0A 4NJ5A 3KMTA 1H3IA 5JHNA 3CBOA 5ARFA 3N71A 1ML9A 4QEOA 5HI7A 4Z4PA 3RAYA 3S7JA 2F69A 1XQHA 3M54A 5CCMA 3FPDA 3SW9A 1N3JA 3EP0A 2R3AA 4NVQA 3IHXA 5JJ0A 5EX3A 4YNDA 1N6CA 3M5AA 5JIYA 3OXLA 3K5KA 4YPAA 3VV0A 1MVHA 5F6KC 4AU7A 2BQZA 4YNPA 1MUFA 3M59A 2IGQA 5CCLA 3MEKA 3TG4A 5TTFA 2QPWA 4BUPA 3QWWA 5F6LA 4J83A 3F9WA 2G46A 3M56A 5TH7A 5KJLA 3VUZA 4I51A 4JLGA 3S7BA 4C1QA 5LSZA 5T5GA 5EG2A 4H12A 3RIBA 3M57A 3OPEA 1N6AA 3MO5A 5F59A 3OOIA 5CPRB 3M55A 5KJMA 3RU0A 3QWPA 4O6FA 3SWCA 3S7DA 4YPUA 3CBPA 5T0MA 3M53A 3BO5A 4J7FA 2W5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMU A;  4LDG A;  3MO2 A;  4MI0 A;  3CBM A;  3OS5 A;  4YNM A;  1ZKK A;  4MI5 A;  4YPE A;  5KJN A;  4IJD A;  5LSX A;  3DB5 A;  5T0K A;  3OXF A;  5EX0 A;  5KJK A;  1MVX A;  3PDN A;  3HNA A;  3DAL A;  3QWV A;  3RJW A;  3S7F A;  4QEP A;  3S8P A;  3TG5 A;  2W5Z A;  4E47 A;  3M58 A;  4J7I A;  5F5E A;  1PEG A;  2RFI A;  3F9Y A;  3F9Z A;  4IJ8 A;  1O9S A;  4J8O A;  1MT6 A;  5HQ8 A;  2JV0 A;  5ARG A;  4WUY A;  3F9X A;  3OXG A;  5TEG A;  5JIN A;  3KMJ A;  3KMA A;  3MO0 A;  4JDS A;  2O8J A;  5AYF A;  4O30 A;  4QEN A;  3RQ4 A;  4RZ0 A;  4NJ5 A;  3KMT A;  1H3I A;  5JHN A;  3CBO A;  5ARF A;  3N71 A;  1ML9 A;  4QEO A;  5HI7 A;  4Z4P A;  3RAY A;  3S7J A;  2F69 A;  1XQH A;  3M54 A;  5CCM A;  3FPD A;  3SW9 A;  1N3J A;  3EP0 A;  2R3A A;  4NVQ A;  3IHX A;  5JJ0 A;  5EX3 A;  4YND A;  1N6C A;  3M5A A;  5JIY A;  3OXL A;  3K5K A;  4YPA A;  3VV0 A;  1MVH A;  5F6K C;  4AU7 A;  2BQZ A;  4YNP A;  1MUF A;  3M59 A;  2IGQ A;  5CCL A;  3MEK A;  3TG4 A;  5TTF A;  2QPW A;  4BUP A;  3QWW A;  5F6L A;  4J83 A;  3F9W A;  2G46 A;  3M56 A;  5TH7 A;  5KJL A;  3VUZ A;  4I51 A;  4JLG A;  3S7B A;  4C1Q A;  5LSZ A;  5T5G A;  5EG2 A;  4H12 A;  3RIB A;  3M57 A;  3OPE A;  1N6A A;  3MO5 A;  5F59 A;  3OOI A;  5CPR B;  3M55 A;  5KJM A;  3RU0 A;  3QWP A;  4O6F A;  3SWC A;  3S7D A;  4YPU A;  3CBP A;  5T0M A;  3M53 A;  3BO5 A;  4J7F A;  2W5Y A; 
#chains in the Genus database with same CATH topology
 4FMU A;  4LDG A;  3MO2 A;  4MI0 A;  3CBM A;  3OS5 A;  4YNM A;  1ZKK A;  4MI5 A;  4YPE A;  5KJN A;  4IJD A;  5LSX A;  3DB5 A;  5T0K A;  3OXF A;  5EX0 A;  5KJK A;  1MVX A;  3PDN A;  3HNA A;  3DAL A;  3QWV A;  3RJW A;  3S7F A;  4QEP A;  3S8P A;  3TG5 A;  2W5Z A;  4E47 A;  3M58 A;  4J7I A;  5F5E A;  1PEG A;  2RFI A;  3F9Y A;  3F9Z A;  4IJ8 A;  1O9S A;  4J8O A;  1MT6 A;  5HQ8 A;  2JV0 A;  5ARG A;  4WUY A;  3F9X A;  3OXG A;  5TEG A;  5JIN A;  3KMJ A;  3KMA A;  3MO0 A;  4JDS A;  2O8J A;  5AYF A;  4O30 A;  4QEN A;  3RQ4 A;  4RZ0 A;  4NJ5 A;  3KMT A;  1H3I A;  5JHN A;  3CBO A;  5ARF A;  3N71 A;  1ML9 A;  4QEO A;  5HI7 A;  4Z4P A;  3RAY A;  3S7J A;  2F69 A;  1XQH A;  3M54 A;  5CCM A;  3FPD A;  3SW9 A;  1N3J A;  3EP0 A;  2R3A A;  4NVQ A;  3IHX A;  5JJ0 A;  5EX3 A;  4YND A;  1N6C A;  3M5A A;  5JIY A;  3OXL A;  3K5K A;  4YPA A;  3VV0 A;  1MVH A;  5F6K C;  4AU7 A;  2BQZ A;  4YNP A;  1MUF A;  3M59 A;  2IGQ A;  5CCL A;  3MEK A;  3TG4 A;  5TTF A;  2QPW A;  4BUP A;  3QWW A;  5F6L A;  4J83 A;  3F9W A;  2G46 A;  3M56 A;  5TH7 A;  5KJL A;  3VUZ A;  4I51 A;  4JLG A;  3S7B A;  4C1Q A;  5LSZ A;  5T5G A;  5EG2 A;  4H12 A;  3RIB A;  3M57 A;  3OPE A;  1N6A A;  3MO5 A;  5F59 A;  3OOI A;  5CPR B;  3M55 A;  5KJM A;  3RU0 A;  3QWP A;  4O6F A;  3SWC A;  3S7D A;  4YPU A;  3CBP A;  5T0M A;  3M53 A;  3BO5 A;  4J7F A;  2W5Y A; 
#chains in the Genus database with same CATH homology
 4FMU A;  4LDG A;  3MO2 A;  4MI0 A;  3CBM A;  3OS5 A;  4YNM A;  1ZKK A;  4MI5 A;  4YPE A;  5KJN A;  4IJD A;  5LSX A;  3DB5 A;  5T0K A;  3OXF A;  5EX0 A;  5KJK A;  1MVX A;  3PDN A;  3HNA A;  3DAL A;  3QWV A;  3RJW A;  3S7F A;  4QEP A;  3S8P A;  3TG5 A;  2W5Z A;  4E47 A;  3M58 A;  4J7I A;  5F5E A;  1PEG A;  2RFI A;  3F9Y A;  3F9Z A;  4IJ8 A;  1O9S A;  4J8O A;  1MT6 A;  5HQ8 A;  2JV0 A;  5ARG A;  4WUY A;  3F9X A;  3OXG A;  5TEG A;  5JIN A;  3KMJ A;  3KMA A;  3MO0 A;  4JDS A;  2O8J A;  5AYF A;  4O30 A;  4QEN A;  3RQ4 A;  4RZ0 A;  4NJ5 A;  3KMT A;  1H3I A;  5JHN A;  3CBO A;  5ARF A;  3N71 A;  1ML9 A;  4QEO A;  5HI7 A;  4Z4P A;  3RAY A;  3S7J A;  2F69 A;  1XQH A;  3M54 A;  5CCM A;  3FPD A;  3SW9 A;  1N3J A;  3EP0 A;  2R3A A;  4NVQ A;  3IHX A;  5JJ0 A;  5EX3 A;  4YND A;  1N6C A;  3M5A A;  5JIY A;  3OXL A;  3K5K A;  4YPA A;  3VV0 A;  1MVH A;  5F6K C;  4AU7 A;  2BQZ A;  4YNP A;  1MUF A;  3M59 A;  2IGQ A;  5CCL A;  3MEK A;  3TG4 A;  5TTF A;  2QPW A;  4BUP A;  3QWW A;  5F6L A;  4J83 A;  3F9W A;  2G46 A;  3M56 A;  5TH7 A;  5KJL A;  3VUZ A;  4I51 A;  4JLG A;  3S7B A;  4C1Q A;  5LSZ A;  5T5G A;  5EG2 A;  4H12 A;  3RIB A;  3M57 A;  3OPE A;  1N6A A;  3MO5 A;  5F59 A;  3OOI A;  5CPR B;  3M55 A;  5KJM A;  3RU0 A;  3QWP A;  4O6F A;  3SWC A;  3S7D A;  4YPU A;  3CBP A;  5T0M A;  3M53 A;  3BO5 A;  4J7F A;  2W5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...