4FMUA

Crystal structure of methyltransferase domain of human set domain-containing protein 2 compound: pr-snf
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
248
structure length
235
Chain Sequence
b'LVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Sinefungin Derivatives as Inhibitors and Structure Probes of Protein Lysine Methyltransferase SETD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 56
structure length 235
sequence length 248
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4fmuA00
3EP0A 5CCMA 3S7BA 5LSXA 4E47A 3OPEA 3M53A 3SW9A 5EX0A 2IGQA 3M54A 5KJMA 3VUZA 3TG4A 3M56A 3VV0A 1MVHA 4J7IA 5ARFA 5LSZA 1N6CA 3QWVA 3M57A 3HNAA 4JDSA 3MEKA 5F6KC 4AU7A 3M55A 1MT6A 5EX3A 2JV0A 5EG2A 3S8PA 4Z4PA 5TH7A 5F5EA 2R3AA 1ZKKA 3SWCA 2BQZA 3BO5A 3M58A 3M5AA 1H3IA 3F9XA 5JHNA 3CBPA 4J8OA 3M59A 5HI7A 1MUFA 2F69A 2W5ZA 4JLGA 4J83A 4WUYA 3OXGA 4RZ0A 2W5YA 3QWWA 3RIBA 3MO0A 3DB5A 5JJ0A 3KMJA 4QEOA 4H12A 4IJDA 5ARGA 4FMUA 4J7FA 5TTFA 5CPRB 2O8JA 3MO2A 4QEPA 5KJLA 3MO5A 3TG5A 1MVXA 5HQ8A 3CBMA 4YNPA 3F9WA 5CCLA 1PEGA 1N3JA 3OXFA 1N6AA 3RQ4A 3OS5A 3RAYA 5T0KA 4NVQA 3FPDA 3RJWA 4BUPA 5KJKA 3N71A 5T0MA 1O9SA 4O6FA 4YPAA 3K5KA 5F59A 3DALA 4C1QA 3QWPA 3S7DA 4I51A 4NJ5A 3KMTA 4YPEA 2RFIA 3RU0A 5TEGA 5JINA 3IHXA 4IJ8A 3F9YA 3OXLA 1ML9A 5T5GA 4YNDA 3F9ZA 3S7JA 4O30A 2G46A 5JIYA 5KJNA 4MI5A 3PDNA 4LDGA 4YPUA 5AYFA 3CBOA 5F6LA 4YNMA 3OOIA 2QPWA 3S7FA 1XQHA 4MI0A 3KMAA 4QENA
chains in the Genus database with same CATH superfamily
3EP0A 5CCMA 3S7BA 5LSXA 4E47A 3OPEA 3M53A 3SW9A 5EX0A 2IGQA 3M54A 5KJMA 3VUZA 3TG4A 3M56A 3VV0A 1MVHA 4J7IA 5ARFA 5LSZA 1N6CA 3QWVA 3M57A 3HNAA 4JDSA 3MEKA 5F6KC 4AU7A 3M55A 1MT6A 5EX3A 2JV0A 5EG2A 3S8PA 4Z4PA 5TH7A 5F5EA 2R3AA 1ZKKA 3SWCA 2BQZA 3BO5A 3M58A 3M5AA 1H3IA 3F9XA 5JHNA 3CBPA 4J8OA 3M59A 5HI7A 1MUFA 2F69A 2W5ZA 4JLGA 4J83A 4WUYA 3OXGA 4RZ0A 2W5YA 3QWWA 3RIBA 3MO0A 3DB5A 5JJ0A 3KMJA 4QEOA 4H12A 4IJDA 5ARGA 4FMUA 4J7FA 5TTFA 5CPRB 2O8JA 3MO2A 4QEPA 5KJLA 3MO5A 3TG5A 1MVXA 5HQ8A 3CBMA 4YNPA 3F9WA 5CCLA 1PEGA 1N3JA 3OXFA 1N6AA 3RQ4A 3OS5A 3RAYA 5T0KA 4NVQA 3FPDA 3RJWA 4BUPA 5KJKA 3N71A 5T0MA 1O9SA 4O6FA 4YPAA 3K5KA 5F59A 3DALA 4C1QA 3QWPA 3S7DA 4I51A 4NJ5A 3KMTA 4YPEA 2RFIA 3RU0A 5TEGA 5JINA 3IHXA 4IJ8A 3F9YA 3OXLA 1ML9A 5T5GA 4YNDA 3F9ZA 3S7JA 4O30A 2G46A 5JIYA 5KJNA 4MI5A 3PDNA 4LDGA 4YPUA 5AYFA 3CBOA 5F6LA 4YNMA 3OOIA 2QPWA 3S7FA 1XQHA 4MI0A 3KMAA 4QENA
chains in the Genus database with same CATH topology
3EP0A 5CCMA 3S7BA 5LSXA 4E47A 3OPEA 3M53A 3SW9A 5EX0A 2IGQA 3M54A 5KJMA 3VUZA 3TG4A 3M56A 3VV0A 1MVHA 4J7IA 5ARFA 5LSZA 1N6CA 3QWVA 3M57A 3HNAA 4JDSA 3MEKA 5F6KC 4AU7A 3M55A 1MT6A 5EX3A 2JV0A 5EG2A 3S8PA 4Z4PA 5TH7A 5F5EA 2R3AA 1ZKKA 3SWCA 2BQZA 3BO5A 3M58A 3M5AA 1H3IA 3F9XA 5JHNA 3CBPA 4J8OA 3M59A 5HI7A 1MUFA 2F69A 2W5ZA 4JLGA 4J83A 4WUYA 3OXGA 4RZ0A 2W5YA 3QWWA 3RIBA 3MO0A 3DB5A 5JJ0A 3KMJA 4QEOA 4H12A 4IJDA 5ARGA 4FMUA 4J7FA 5TTFA 5CPRB 2O8JA 3MO2A 4QEPA 5KJLA 3MO5A 3TG5A 1MVXA 5HQ8A 3CBMA 4YNPA 3F9WA 5CCLA 1PEGA 1N3JA 3OXFA 1N6AA 3RQ4A 3OS5A 3RAYA 5T0KA 4NVQA 3FPDA 3RJWA 4BUPA 5KJKA 3N71A 5T0MA 1O9SA 4O6FA 4YPAA 3K5KA 5F59A 3DALA 4C1QA 3QWPA 3S7DA 4I51A 4NJ5A 3KMTA 4YPEA 2RFIA 3RU0A 5TEGA 5JINA 3IHXA 4IJ8A 3F9YA 3OXLA 1ML9A 5T5GA 4YNDA 3F9ZA 3S7JA 4O30A 2G46A 5JIYA 5KJNA 4MI5A 3PDNA 4LDGA 4YPUA 5AYFA 3CBOA 5F6LA 4YNMA 3OOIA 2QPWA 3S7FA 1XQHA 4MI0A 3KMAA 4QENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EP0 A;  5CCM A;  3S7B A;  5LSX A;  4E47 A;  3OPE A;  3M53 A;  3SW9 A;  5EX0 A;  2IGQ A;  3M54 A;  5KJM A;  3VUZ A;  3TG4 A;  3M56 A;  3VV0 A;  1MVH A;  4J7I A;  5ARF A;  5LSZ A;  1N6C A;  3QWV A;  3M57 A;  3HNA A;  4JDS A;  3MEK A;  5F6K C;  4AU7 A;  3M55 A;  1MT6 A;  5EX3 A;  2JV0 A;  5EG2 A;  3S8P A;  4Z4P A;  5TH7 A;  5F5E A;  2R3A A;  1ZKK A;  3SWC A;  2BQZ A;  3BO5 A;  3M58 A;  3M5A A;  1H3I A;  3F9X A;  5JHN A;  3CBP A;  4J8O A;  3M59 A;  5HI7 A;  1MUF A;  2F69 A;  2W5Z A;  4JLG A;  4J83 A;  4WUY A;  3OXG A;  4RZ0 A;  2W5Y A;  3QWW A;  3RIB A;  3MO0 A;  3DB5 A;  5JJ0 A;  3KMJ A;  4QEO A;  4H12 A;  4IJD A;  5ARG A;  4FMU A;  4J7F A;  5TTF A;  5CPR B;  2O8J A;  3MO2 A;  4QEP A;  5KJL A;  3MO5 A;  3TG5 A;  1MVX A;  5HQ8 A;  3CBM A;  4YNP A;  3F9W A;  5CCL A;  1PEG A;  1N3J A;  3OXF A;  1N6A A;  3RQ4 A;  3OS5 A;  3RAY A;  5T0K A;  4NVQ A;  3FPD A;  3RJW A;  4BUP A;  5KJK A;  3N71 A;  5T0M A;  1O9S A;  4O6F A;  4YPA A;  3K5K A;  5F59 A;  3DAL A;  4C1Q A;  3QWP A;  3S7D A;  4I51 A;  4NJ5 A;  3KMT A;  4YPE A;  2RFI A;  3RU0 A;  5TEG A;  5JIN A;  3IHX A;  4IJ8 A;  3F9Y A;  3OXL A;  1ML9 A;  5T5G A;  4YND A;  3F9Z A;  3S7J A;  4O30 A;  2G46 A;  5JIY A;  5KJN A;  4MI5 A;  3PDN A;  4LDG A;  4YPU A;  5AYF A;  3CBO A;  5F6L A;  4YNM A;  3OOI A;  2QPW A;  3S7F A;  1XQH A;  4MI0 A;  3KMA A;  4QEN A; 
#chains in the Genus database with same CATH topology
 3EP0 A;  5CCM A;  3S7B A;  5LSX A;  4E47 A;  3OPE A;  3M53 A;  3SW9 A;  5EX0 A;  2IGQ A;  3M54 A;  5KJM A;  3VUZ A;  3TG4 A;  3M56 A;  3VV0 A;  1MVH A;  4J7I A;  5ARF A;  5LSZ A;  1N6C A;  3QWV A;  3M57 A;  3HNA A;  4JDS A;  3MEK A;  5F6K C;  4AU7 A;  3M55 A;  1MT6 A;  5EX3 A;  2JV0 A;  5EG2 A;  3S8P A;  4Z4P A;  5TH7 A;  5F5E A;  2R3A A;  1ZKK A;  3SWC A;  2BQZ A;  3BO5 A;  3M58 A;  3M5A A;  1H3I A;  3F9X A;  5JHN A;  3CBP A;  4J8O A;  3M59 A;  5HI7 A;  1MUF A;  2F69 A;  2W5Z A;  4JLG A;  4J83 A;  4WUY A;  3OXG A;  4RZ0 A;  2W5Y A;  3QWW A;  3RIB A;  3MO0 A;  3DB5 A;  5JJ0 A;  3KMJ A;  4QEO A;  4H12 A;  4IJD A;  5ARG A;  4FMU A;  4J7F A;  5TTF A;  5CPR B;  2O8J A;  3MO2 A;  4QEP A;  5KJL A;  3MO5 A;  3TG5 A;  1MVX A;  5HQ8 A;  3CBM A;  4YNP A;  3F9W A;  5CCL A;  1PEG A;  1N3J A;  3OXF A;  1N6A A;  3RQ4 A;  3OS5 A;  3RAY A;  5T0K A;  4NVQ A;  3FPD A;  3RJW A;  4BUP A;  5KJK A;  3N71 A;  5T0M A;  1O9S A;  4O6F A;  4YPA A;  3K5K A;  5F59 A;  3DAL A;  4C1Q A;  3QWP A;  3S7D A;  4I51 A;  4NJ5 A;  3KMT A;  4YPE A;  2RFI A;  3RU0 A;  5TEG A;  5JIN A;  3IHX A;  4IJ8 A;  3F9Y A;  3OXL A;  1ML9 A;  5T5G A;  4YND A;  3F9Z A;  3S7J A;  4O30 A;  2G46 A;  5JIY A;  5KJN A;  4MI5 A;  3PDN A;  4LDG A;  4YPU A;  5AYF A;  3CBO A;  5F6L A;  4YNM A;  3OOI A;  2QPW A;  3S7F A;  1XQH A;  4MI0 A;  3KMA A;  4QEN A; 
#chains in the Genus database with same CATH homology
 3EP0 A;  5CCM A;  3S7B A;  5LSX A;  4E47 A;  3OPE A;  3M53 A;  3SW9 A;  5EX0 A;  2IGQ A;  3M54 A;  5KJM A;  3VUZ A;  3TG4 A;  3M56 A;  3VV0 A;  1MVH A;  4J7I A;  5ARF A;  5LSZ A;  1N6C A;  3QWV A;  3M57 A;  3HNA A;  4JDS A;  3MEK A;  5F6K C;  4AU7 A;  3M55 A;  1MT6 A;  5EX3 A;  2JV0 A;  5EG2 A;  3S8P A;  4Z4P A;  5TH7 A;  5F5E A;  2R3A A;  1ZKK A;  3SWC A;  2BQZ A;  3BO5 A;  3M58 A;  3M5A A;  1H3I A;  3F9X A;  5JHN A;  3CBP A;  4J8O A;  3M59 A;  5HI7 A;  1MUF A;  2F69 A;  2W5Z A;  4JLG A;  4J83 A;  4WUY A;  3OXG A;  4RZ0 A;  2W5Y A;  3QWW A;  3RIB A;  3MO0 A;  3DB5 A;  5JJ0 A;  3KMJ A;  4QEO A;  4H12 A;  4IJD A;  5ARG A;  4FMU A;  4J7F A;  5TTF A;  5CPR B;  2O8J A;  3MO2 A;  4QEP A;  5KJL A;  3MO5 A;  3TG5 A;  1MVX A;  5HQ8 A;  3CBM A;  4YNP A;  3F9W A;  5CCL A;  1PEG A;  1N3J A;  3OXF A;  1N6A A;  3RQ4 A;  3OS5 A;  3RAY A;  5T0K A;  4NVQ A;  3FPD A;  3RJW A;  4BUP A;  5KJK A;  3N71 A;  5T0M A;  1O9S A;  4O6F A;  4YPA A;  3K5K A;  5F59 A;  3DAL A;  4C1Q A;  3QWP A;  3S7D A;  4I51 A;  4NJ5 A;  3KMT A;  4YPE A;  2RFI A;  3RU0 A;  5TEG A;  5JIN A;  3IHX A;  4IJ8 A;  3F9Y A;  3OXL A;  1ML9 A;  5T5G A;  4YND A;  3F9Z A;  3S7J A;  4O30 A;  2G46 A;  5JIY A;  5KJN A;  4MI5 A;  3PDN A;  4LDG A;  4YPU A;  5AYF A;  3CBO A;  5F6L A;  4YNM A;  3OOI A;  2QPW A;  3S7F A;  1XQH A;  4MI0 A;  3KMA A;  4QEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...