4FMUA

Crystal structure of methyltransferase domain of human set domain-containing protein 2 compound: pr-snf
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
248
structure length
235
Chain Sequence
LVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Sinefungin Derivatives as Inhibitors and Structure Probes of Protein Lysine Methyltransferase SETD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 56
structure length 235
sequence length 248
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4fmuA00
4J8OA 2F69A 3F9WA 3M54A 4JLGA 4NJ5A 2IGQA 3QWVA 4Z4PA 3KMJA 3QWPA 5LSXA 3CBOA 4YNDA 3DB5A 3TG4A 4AU7A 3F9YA 3QWWA 3M58A 3S8PA 3F9ZA 2O8JA 3MO5A 4IJ8A 4LDGA 3DALA 5TEGA 3S7BA 3RQ4A 1N3JA 4MI5A 3S7JA 4YPEA 3SW9A 5LSZA 3OXLA 4IJDA 5T0KA 1PEGA 4J83A 5HQ8A 2R3AA 4YPUA 3FPDA 1N6CA 5F6LA 4FMUA 1MVXA 4J7IA 3RU0A 5JIYA 5JINA 1N6AA 1ML9A 5CCMA 5KJMA 5F6KC 3BO5A 4YNPA 3M57A 5JJ0A 3OPEA 5AYFA 5ARFA 3M55A 5EX0A 4YPAA 5TTFA 3S7FA 4RZ0A 2W5ZA 3OXFA 3M56A 5ARGA 3MO2A 3VV0A 5EG2A 3VUZA 3M59A 3K5KA 2RFIA 4E47A 5T5GA 5HI7A 5KJKA 4QEPA 3OXGA 5KJNA 5JHNA 5F59A 5T0MA 3EP0A 3N71A 1O9SA 4I51A 3IHXA 1H3IA 3RJWA 2JV0A 4C1QA 4NVQA 3CBMA 3F9XA 4O6FA 3MO0A 5TH7A 4H12A 5EX3A 4MI0A 4BUPA 3MEKA 2W5YA 4QENA 2G46A 4WUYA 3CBPA 3M53A 2BQZA 1MUFA 3OS5A 3KMTA 3PDNA 3KMAA 4J7FA 1XQHA 3M5AA 1ZKKA 4QEOA 3HNAA 5KJLA 1MT6A 3OOIA 4O30A 2QPWA 3S7DA 5F5EA 4YNMA 1MVHA 3SWCA 3RAYA 4JDSA 3TG5A 5CCLA 3RIBA 5CPRB
chains in the Genus database with same CATH superfamily
4J8OA 2F69A 3F9WA 3M54A 4JLGA 4NJ5A 2IGQA 3QWVA 4Z4PA 3KMJA 3QWPA 5LSXA 3CBOA 4YNDA 3DB5A 3TG4A 4AU7A 3F9YA 3QWWA 3M58A 3S8PA 3F9ZA 2O8JA 3MO5A 4IJ8A 4LDGA 3DALA 5TEGA 3S7BA 3RQ4A 1N3JA 4MI5A 3S7JA 4YPEA 3SW9A 5LSZA 3OXLA 4IJDA 5T0KA 1PEGA 4J83A 5HQ8A 2R3AA 4YPUA 3FPDA 1N6CA 5F6LA 4FMUA 1MVXA 4J7IA 3RU0A 5JIYA 5JINA 1N6AA 1ML9A 5CCMA 5KJMA 5F6KC 3BO5A 4YNPA 3M57A 5JJ0A 3OPEA 5AYFA 5ARFA 3M55A 5EX0A 4YPAA 5TTFA 3S7FA 4RZ0A 2W5ZA 3OXFA 3M56A 5ARGA 3MO2A 3VV0A 5EG2A 3VUZA 3M59A 3K5KA 2RFIA 4E47A 5T5GA 5HI7A 5KJKA 4QEPA 3OXGA 5KJNA 5JHNA 5F59A 5T0MA 3EP0A 3N71A 1O9SA 4I51A 3IHXA 1H3IA 3RJWA 2JV0A 4C1QA 4NVQA 3CBMA 3F9XA 4O6FA 3MO0A 5TH7A 4H12A 5EX3A 4MI0A 4BUPA 3MEKA 2W5YA 4QENA 2G46A 4WUYA 3CBPA 3M53A 2BQZA 1MUFA 3OS5A 3KMTA 3PDNA 3KMAA 4J7FA 1XQHA 3M5AA 1ZKKA 4QEOA 3HNAA 5KJLA 1MT6A 3OOIA 4O30A 2QPWA 3S7DA 5F5EA 4YNMA 1MVHA 3SWCA 3RAYA 4JDSA 3TG5A 5CCLA 3RIBA 5CPRB
chains in the Genus database with same CATH topology
4J8OA 2F69A 3F9WA 3M54A 4JLGA 4NJ5A 2IGQA 3QWVA 4Z4PA 3KMJA 3QWPA 5LSXA 3CBOA 4YNDA 3DB5A 3TG4A 4AU7A 3F9YA 3QWWA 3M58A 3S8PA 3F9ZA 2O8JA 3MO5A 4IJ8A 4LDGA 3DALA 5TEGA 3S7BA 3RQ4A 1N3JA 4MI5A 3S7JA 4YPEA 3SW9A 5LSZA 3OXLA 4IJDA 5T0KA 1PEGA 4J83A 5HQ8A 2R3AA 4YPUA 3FPDA 1N6CA 5F6LA 4FMUA 1MVXA 4J7IA 3RU0A 5JIYA 5JINA 1N6AA 1ML9A 5CCMA 5KJMA 5F6KC 3BO5A 4YNPA 3M57A 5JJ0A 3OPEA 5AYFA 5ARFA 3M55A 5EX0A 4YPAA 5TTFA 3S7FA 4RZ0A 2W5ZA 3OXFA 3M56A 5ARGA 3MO2A 3VV0A 5EG2A 3VUZA 3M59A 3K5KA 2RFIA 4E47A 5T5GA 5HI7A 5KJKA 4QEPA 3OXGA 5KJNA 5JHNA 5F59A 5T0MA 3EP0A 3N71A 1O9SA 4I51A 3IHXA 1H3IA 3RJWA 2JV0A 4C1QA 4NVQA 3CBMA 3F9XA 4O6FA 3MO0A 5TH7A 4H12A 5EX3A 4MI0A 4BUPA 3MEKA 2W5YA 4QENA 2G46A 4WUYA 3CBPA 3M53A 2BQZA 1MUFA 3OS5A 3KMTA 3PDNA 3KMAA 4J7FA 1XQHA 3M5AA 1ZKKA 4QEOA 3HNAA 5KJLA 1MT6A 3OOIA 4O30A 2QPWA 3S7DA 5F5EA 4YNMA 1MVHA 3SWCA 3RAYA 4JDSA 3TG5A 5CCLA 3RIBA 5CPRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8O A;  2F69 A;  3F9W A;  3M54 A;  4JLG A;  4NJ5 A;  2IGQ A;  3QWV A;  4Z4P A;  3KMJ A;  3QWP A;  5LSX A;  3CBO A;  4YND A;  3DB5 A;  3TG4 A;  4AU7 A;  3F9Y A;  3QWW A;  3M58 A;  3S8P A;  3F9Z A;  2O8J A;  3MO5 A;  4IJ8 A;  4LDG A;  3DAL A;  5TEG A;  3S7B A;  3RQ4 A;  1N3J A;  4MI5 A;  3S7J A;  4YPE A;  3SW9 A;  5LSZ A;  3OXL A;  4IJD A;  5T0K A;  1PEG A;  4J83 A;  5HQ8 A;  2R3A A;  4YPU A;  3FPD A;  1N6C A;  5F6L A;  4FMU A;  1MVX A;  4J7I A;  3RU0 A;  5JIY A;  5JIN A;  1N6A A;  1ML9 A;  5CCM A;  5KJM A;  5F6K C;  3BO5 A;  4YNP A;  3M57 A;  5JJ0 A;  3OPE A;  5AYF A;  5ARF A;  3M55 A;  5EX0 A;  4YPA A;  5TTF A;  3S7F A;  4RZ0 A;  2W5Z A;  3OXF A;  3M56 A;  5ARG A;  3MO2 A;  3VV0 A;  5EG2 A;  3VUZ A;  3M59 A;  3K5K A;  2RFI A;  4E47 A;  5T5G A;  5HI7 A;  5KJK A;  4QEP A;  3OXG A;  5KJN A;  5JHN A;  5F59 A;  5T0M A;  3EP0 A;  3N71 A;  1O9S A;  4I51 A;  3IHX A;  1H3I A;  3RJW A;  2JV0 A;  4C1Q A;  4NVQ A;  3CBM A;  3F9X A;  4O6F A;  3MO0 A;  5TH7 A;  4H12 A;  5EX3 A;  4MI0 A;  4BUP A;  3MEK A;  2W5Y A;  4QEN A;  2G46 A;  4WUY A;  3CBP A;  3M53 A;  2BQZ A;  1MUF A;  3OS5 A;  3KMT A;  3PDN A;  3KMA A;  4J7F A;  1XQH A;  3M5A A;  1ZKK A;  4QEO A;  3HNA A;  5KJL A;  1MT6 A;  3OOI A;  4O30 A;  2QPW A;  3S7D A;  5F5E A;  4YNM A;  1MVH A;  3SWC A;  3RAY A;  4JDS A;  3TG5 A;  5CCL A;  3RIB A;  5CPR B; 
#chains in the Genus database with same CATH topology
 4J8O A;  2F69 A;  3F9W A;  3M54 A;  4JLG A;  4NJ5 A;  2IGQ A;  3QWV A;  4Z4P A;  3KMJ A;  3QWP A;  5LSX A;  3CBO A;  4YND A;  3DB5 A;  3TG4 A;  4AU7 A;  3F9Y A;  3QWW A;  3M58 A;  3S8P A;  3F9Z A;  2O8J A;  3MO5 A;  4IJ8 A;  4LDG A;  3DAL A;  5TEG A;  3S7B A;  3RQ4 A;  1N3J A;  4MI5 A;  3S7J A;  4YPE A;  3SW9 A;  5LSZ A;  3OXL A;  4IJD A;  5T0K A;  1PEG A;  4J83 A;  5HQ8 A;  2R3A A;  4YPU A;  3FPD A;  1N6C A;  5F6L A;  4FMU A;  1MVX A;  4J7I A;  3RU0 A;  5JIY A;  5JIN A;  1N6A A;  1ML9 A;  5CCM A;  5KJM A;  5F6K C;  3BO5 A;  4YNP A;  3M57 A;  5JJ0 A;  3OPE A;  5AYF A;  5ARF A;  3M55 A;  5EX0 A;  4YPA A;  5TTF A;  3S7F A;  4RZ0 A;  2W5Z A;  3OXF A;  3M56 A;  5ARG A;  3MO2 A;  3VV0 A;  5EG2 A;  3VUZ A;  3M59 A;  3K5K A;  2RFI A;  4E47 A;  5T5G A;  5HI7 A;  5KJK A;  4QEP A;  3OXG A;  5KJN A;  5JHN A;  5F59 A;  5T0M A;  3EP0 A;  3N71 A;  1O9S A;  4I51 A;  3IHX A;  1H3I A;  3RJW A;  2JV0 A;  4C1Q A;  4NVQ A;  3CBM A;  3F9X A;  4O6F A;  3MO0 A;  5TH7 A;  4H12 A;  5EX3 A;  4MI0 A;  4BUP A;  3MEK A;  2W5Y A;  4QEN A;  2G46 A;  4WUY A;  3CBP A;  3M53 A;  2BQZ A;  1MUF A;  3OS5 A;  3KMT A;  3PDN A;  3KMA A;  4J7F A;  1XQH A;  3M5A A;  1ZKK A;  4QEO A;  3HNA A;  5KJL A;  1MT6 A;  3OOI A;  4O30 A;  2QPW A;  3S7D A;  5F5E A;  4YNM A;  1MVH A;  3SWC A;  3RAY A;  4JDS A;  3TG5 A;  5CCL A;  3RIB A;  5CPR B; 
#chains in the Genus database with same CATH homology
 4J8O A;  2F69 A;  3F9W A;  3M54 A;  4JLG A;  4NJ5 A;  2IGQ A;  3QWV A;  4Z4P A;  3KMJ A;  3QWP A;  5LSX A;  3CBO A;  4YND A;  3DB5 A;  3TG4 A;  4AU7 A;  3F9Y A;  3QWW A;  3M58 A;  3S8P A;  3F9Z A;  2O8J A;  3MO5 A;  4IJ8 A;  4LDG A;  3DAL A;  5TEG A;  3S7B A;  3RQ4 A;  1N3J A;  4MI5 A;  3S7J A;  4YPE A;  3SW9 A;  5LSZ A;  3OXL A;  4IJD A;  5T0K A;  1PEG A;  4J83 A;  5HQ8 A;  2R3A A;  4YPU A;  3FPD A;  1N6C A;  5F6L A;  4FMU A;  1MVX A;  4J7I A;  3RU0 A;  5JIY A;  5JIN A;  1N6A A;  1ML9 A;  5CCM A;  5KJM A;  5F6K C;  3BO5 A;  4YNP A;  3M57 A;  5JJ0 A;  3OPE A;  5AYF A;  5ARF A;  3M55 A;  5EX0 A;  4YPA A;  5TTF A;  3S7F A;  4RZ0 A;  2W5Z A;  3OXF A;  3M56 A;  5ARG A;  3MO2 A;  3VV0 A;  5EG2 A;  3VUZ A;  3M59 A;  3K5K A;  2RFI A;  4E47 A;  5T5G A;  5HI7 A;  5KJK A;  4QEP A;  3OXG A;  5KJN A;  5JHN A;  5F59 A;  5T0M A;  3EP0 A;  3N71 A;  1O9S A;  4I51 A;  3IHX A;  1H3I A;  3RJW A;  2JV0 A;  4C1Q A;  4NVQ A;  3CBM A;  3F9X A;  4O6F A;  3MO0 A;  5TH7 A;  4H12 A;  5EX3 A;  4MI0 A;  4BUP A;  3MEK A;  2W5Y A;  4QEN A;  2G46 A;  4WUY A;  3CBP A;  3M53 A;  2BQZ A;  1MUF A;  3OS5 A;  3KMT A;  3PDN A;  3KMA A;  4J7F A;  1XQH A;  3M5A A;  1ZKK A;  4QEO A;  3HNA A;  5KJL A;  1MT6 A;  3OOI A;  4O30 A;  2QPW A;  3S7D A;  5F5E A;  4YNM A;  1MVH A;  3SWC A;  3RAY A;  4JDS A;  3TG5 A;  5CCL A;  3RIB A;  5CPR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...