4FMUA

Crystal structure of methyltransferase domain of human set domain-containing protein 2 compound: pr-snf
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
248
structure length
235
Chain Sequence
LVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Sinefungin Derivatives as Inhibitors and Structure Probes of Protein Lysine Methyltransferase SETD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 56
structure length 235
sequence length 248
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4fmuA00
3QWPA 3M53A 2W5YA 5HI7A 4YPAA 5T5GA 5F6LA 3IHXA 5JINA 1PEGA 1N6AA 4J8OA 3CBOA 1MVXA 3OPEA 3VV0A 3RQ4A 4IJDA 4QEPA 4MI0A 2O8JA 3SW9A 3HNAA 3OS5A 4BUPA 2JV0A 3MO0A 5HQ8A 3K5KA 3M59A 5EG2A 4IJ8A 5ARGA 5EX0A 3M58A 5AYFA 3EP0A 4NJ5A 3S7DA 5TEGA 3VUZA 3S8PA 3OXFA 5KJLA 2F69A 5EX3A 4J7IA 3FPDA 3RIBA 2BQZA 3DALA 3S7FA 3DB5A 5JJ0A 5LSXA 4JLGA 3OOIA 5TH7A 3QWWA 3RAYA 5JIYA 3QWVA 2IGQA 2W5ZA 3OXGA 3F9ZA 4H12A 2QPWA 2G46A 3S7JA 2R3AA 1MT6A 5TTFA 3MO5A 3PDNA 4YNMA 3N71A 4MI5A 2RFIA 3MO2A 4QEOA 4YPEA 3CBMA 3TG4A 4FMUA 4YPUA 1ZKKA 4YNPA 5KJKA 5KJMA 5JHNA 3RJWA 1N6CA 3M57A 5F5EA 3M54A 1O9SA 3F9XA 4I51A 5KJNA 3MEKA 1XQHA 3KMAA 1MVHA 3M56A 4JDSA 4E47A 4QENA 3RU0A 3OXLA 3CBPA 3BO5A 4Z4PA 4C1QA 5CCLA 5F6KC 3M5AA 3KMTA 5CPRB 1ML9A 3F9WA 4WUYA 1H3IA 5T0MA 4RZ0A 5ARFA 1MUFA 4J7FA 3TG5A 3F9YA 1N3JA 4YNDA 3M55A 4J83A 4LDGA 3KMJA 4O6FA 5F59A 5LSZA 4NVQA 3SWCA 3S7BA 5CCMA 4AU7A 4O30A 5T0KA
chains in the Genus database with same CATH superfamily
3QWPA 3M53A 2W5YA 5HI7A 4YPAA 5T5GA 5F6LA 3IHXA 5JINA 1PEGA 1N6AA 4J8OA 3CBOA 1MVXA 3OPEA 3VV0A 3RQ4A 4IJDA 4QEPA 4MI0A 2O8JA 3SW9A 3HNAA 3OS5A 4BUPA 2JV0A 3MO0A 5HQ8A 3K5KA 3M59A 5EG2A 4IJ8A 5ARGA 5EX0A 3M58A 5AYFA 3EP0A 4NJ5A 3S7DA 5TEGA 3VUZA 3S8PA 3OXFA 5KJLA 2F69A 5EX3A 4J7IA 3FPDA 3RIBA 2BQZA 3DALA 3S7FA 3DB5A 5JJ0A 5LSXA 4JLGA 3OOIA 5TH7A 3QWWA 3RAYA 5JIYA 3QWVA 2IGQA 2W5ZA 3OXGA 3F9ZA 4H12A 2QPWA 2G46A 3S7JA 2R3AA 1MT6A 5TTFA 3MO5A 3PDNA 4YNMA 3N71A 4MI5A 2RFIA 3MO2A 4QEOA 4YPEA 3CBMA 3TG4A 4FMUA 4YPUA 1ZKKA 4YNPA 5KJKA 5KJMA 5JHNA 3RJWA 1N6CA 3M57A 5F5EA 3M54A 1O9SA 3F9XA 4I51A 5KJNA 3MEKA 1XQHA 3KMAA 1MVHA 3M56A 4JDSA 4E47A 4QENA 3RU0A 3OXLA 3CBPA 3BO5A 4Z4PA 4C1QA 5CCLA 5F6KC 3M5AA 3KMTA 5CPRB 1ML9A 3F9WA 4WUYA 1H3IA 5T0MA 4RZ0A 5ARFA 1MUFA 4J7FA 3TG5A 3F9YA 1N3JA 4YNDA 3M55A 4J83A 4LDGA 3KMJA 4O6FA 5F59A 5LSZA 4NVQA 3SWCA 3S7BA 5CCMA 4AU7A 4O30A 5T0KA
chains in the Genus database with same CATH topology
3QWPA 3M53A 2W5YA 5HI7A 4YPAA 5T5GA 5F6LA 3IHXA 5JINA 1PEGA 1N6AA 4J8OA 3CBOA 1MVXA 3OPEA 3VV0A 3RQ4A 4IJDA 4QEPA 4MI0A 2O8JA 3SW9A 3HNAA 3OS5A 4BUPA 2JV0A 3MO0A 5HQ8A 3K5KA 3M59A 5EG2A 4IJ8A 5ARGA 5EX0A 3M58A 5AYFA 3EP0A 4NJ5A 3S7DA 5TEGA 3VUZA 3S8PA 3OXFA 5KJLA 2F69A 5EX3A 4J7IA 3FPDA 3RIBA 2BQZA 3DALA 3S7FA 3DB5A 5JJ0A 5LSXA 4JLGA 3OOIA 5TH7A 3QWWA 3RAYA 5JIYA 3QWVA 2IGQA 2W5ZA 3OXGA 3F9ZA 4H12A 2QPWA 2G46A 3S7JA 2R3AA 1MT6A 5TTFA 3MO5A 3PDNA 4YNMA 3N71A 4MI5A 2RFIA 3MO2A 4QEOA 4YPEA 3CBMA 3TG4A 4FMUA 4YPUA 1ZKKA 4YNPA 5KJKA 5KJMA 5JHNA 3RJWA 1N6CA 3M57A 5F5EA 3M54A 1O9SA 3F9XA 4I51A 5KJNA 3MEKA 1XQHA 3KMAA 1MVHA 3M56A 4JDSA 4E47A 4QENA 3RU0A 3OXLA 3CBPA 3BO5A 4Z4PA 4C1QA 5CCLA 5F6KC 3M5AA 3KMTA 5CPRB 1ML9A 3F9WA 4WUYA 1H3IA 5T0MA 4RZ0A 5ARFA 1MUFA 4J7FA 3TG5A 3F9YA 1N3JA 4YNDA 3M55A 4J83A 4LDGA 3KMJA 4O6FA 5F59A 5LSZA 4NVQA 3SWCA 3S7BA 5CCMA 4AU7A 4O30A 5T0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWP A;  3M53 A;  2W5Y A;  5HI7 A;  4YPA A;  5T5G A;  5F6L A;  3IHX A;  5JIN A;  1PEG A;  1N6A A;  4J8O A;  3CBO A;  1MVX A;  3OPE A;  3VV0 A;  3RQ4 A;  4IJD A;  4QEP A;  4MI0 A;  2O8J A;  3SW9 A;  3HNA A;  3OS5 A;  4BUP A;  2JV0 A;  3MO0 A;  5HQ8 A;  3K5K A;  3M59 A;  5EG2 A;  4IJ8 A;  5ARG A;  5EX0 A;  3M58 A;  5AYF A;  3EP0 A;  4NJ5 A;  3S7D A;  5TEG A;  3VUZ A;  3S8P A;  3OXF A;  5KJL A;  2F69 A;  5EX3 A;  4J7I A;  3FPD A;  3RIB A;  2BQZ A;  3DAL A;  3S7F A;  3DB5 A;  5JJ0 A;  5LSX A;  4JLG A;  3OOI A;  5TH7 A;  3QWW A;  3RAY A;  5JIY A;  3QWV A;  2IGQ A;  2W5Z A;  3OXG A;  3F9Z A;  4H12 A;  2QPW A;  2G46 A;  3S7J A;  2R3A A;  1MT6 A;  5TTF A;  3MO5 A;  3PDN A;  4YNM A;  3N71 A;  4MI5 A;  2RFI A;  3MO2 A;  4QEO A;  4YPE A;  3CBM A;  3TG4 A;  4FMU A;  4YPU A;  1ZKK A;  4YNP A;  5KJK A;  5KJM A;  5JHN A;  3RJW A;  1N6C A;  3M57 A;  5F5E A;  3M54 A;  1O9S A;  3F9X A;  4I51 A;  5KJN A;  3MEK A;  1XQH A;  3KMA A;  1MVH A;  3M56 A;  4JDS A;  4E47 A;  4QEN A;  3RU0 A;  3OXL A;  3CBP A;  3BO5 A;  4Z4P A;  4C1Q A;  5CCL A;  5F6K C;  3M5A A;  3KMT A;  5CPR B;  1ML9 A;  3F9W A;  4WUY A;  1H3I A;  5T0M A;  4RZ0 A;  5ARF A;  1MUF A;  4J7F A;  3TG5 A;  3F9Y A;  1N3J A;  4YND A;  3M55 A;  4J83 A;  4LDG A;  3KMJ A;  4O6F A;  5F59 A;  5LSZ A;  4NVQ A;  3SWC A;  3S7B A;  5CCM A;  4AU7 A;  4O30 A;  5T0K A; 
#chains in the Genus database with same CATH topology
 3QWP A;  3M53 A;  2W5Y A;  5HI7 A;  4YPA A;  5T5G A;  5F6L A;  3IHX A;  5JIN A;  1PEG A;  1N6A A;  4J8O A;  3CBO A;  1MVX A;  3OPE A;  3VV0 A;  3RQ4 A;  4IJD A;  4QEP A;  4MI0 A;  2O8J A;  3SW9 A;  3HNA A;  3OS5 A;  4BUP A;  2JV0 A;  3MO0 A;  5HQ8 A;  3K5K A;  3M59 A;  5EG2 A;  4IJ8 A;  5ARG A;  5EX0 A;  3M58 A;  5AYF A;  3EP0 A;  4NJ5 A;  3S7D A;  5TEG A;  3VUZ A;  3S8P A;  3OXF A;  5KJL A;  2F69 A;  5EX3 A;  4J7I A;  3FPD A;  3RIB A;  2BQZ A;  3DAL A;  3S7F A;  3DB5 A;  5JJ0 A;  5LSX A;  4JLG A;  3OOI A;  5TH7 A;  3QWW A;  3RAY A;  5JIY A;  3QWV A;  2IGQ A;  2W5Z A;  3OXG A;  3F9Z A;  4H12 A;  2QPW A;  2G46 A;  3S7J A;  2R3A A;  1MT6 A;  5TTF A;  3MO5 A;  3PDN A;  4YNM A;  3N71 A;  4MI5 A;  2RFI A;  3MO2 A;  4QEO A;  4YPE A;  3CBM A;  3TG4 A;  4FMU A;  4YPU A;  1ZKK A;  4YNP A;  5KJK A;  5KJM A;  5JHN A;  3RJW A;  1N6C A;  3M57 A;  5F5E A;  3M54 A;  1O9S A;  3F9X A;  4I51 A;  5KJN A;  3MEK A;  1XQH A;  3KMA A;  1MVH A;  3M56 A;  4JDS A;  4E47 A;  4QEN A;  3RU0 A;  3OXL A;  3CBP A;  3BO5 A;  4Z4P A;  4C1Q A;  5CCL A;  5F6K C;  3M5A A;  3KMT A;  5CPR B;  1ML9 A;  3F9W A;  4WUY A;  1H3I A;  5T0M A;  4RZ0 A;  5ARF A;  1MUF A;  4J7F A;  3TG5 A;  3F9Y A;  1N3J A;  4YND A;  3M55 A;  4J83 A;  4LDG A;  3KMJ A;  4O6F A;  5F59 A;  5LSZ A;  4NVQ A;  3SWC A;  3S7B A;  5CCM A;  4AU7 A;  4O30 A;  5T0K A; 
#chains in the Genus database with same CATH homology
 3QWP A;  3M53 A;  2W5Y A;  5HI7 A;  4YPA A;  5T5G A;  5F6L A;  3IHX A;  5JIN A;  1PEG A;  1N6A A;  4J8O A;  3CBO A;  1MVX A;  3OPE A;  3VV0 A;  3RQ4 A;  4IJD A;  4QEP A;  4MI0 A;  2O8J A;  3SW9 A;  3HNA A;  3OS5 A;  4BUP A;  2JV0 A;  3MO0 A;  5HQ8 A;  3K5K A;  3M59 A;  5EG2 A;  4IJ8 A;  5ARG A;  5EX0 A;  3M58 A;  5AYF A;  3EP0 A;  4NJ5 A;  3S7D A;  5TEG A;  3VUZ A;  3S8P A;  3OXF A;  5KJL A;  2F69 A;  5EX3 A;  4J7I A;  3FPD A;  3RIB A;  2BQZ A;  3DAL A;  3S7F A;  3DB5 A;  5JJ0 A;  5LSX A;  4JLG A;  3OOI A;  5TH7 A;  3QWW A;  3RAY A;  5JIY A;  3QWV A;  2IGQ A;  2W5Z A;  3OXG A;  3F9Z A;  4H12 A;  2QPW A;  2G46 A;  3S7J A;  2R3A A;  1MT6 A;  5TTF A;  3MO5 A;  3PDN A;  4YNM A;  3N71 A;  4MI5 A;  2RFI A;  3MO2 A;  4QEO A;  4YPE A;  3CBM A;  3TG4 A;  4FMU A;  4YPU A;  1ZKK A;  4YNP A;  5KJK A;  5KJM A;  5JHN A;  3RJW A;  1N6C A;  3M57 A;  5F5E A;  3M54 A;  1O9S A;  3F9X A;  4I51 A;  5KJN A;  3MEK A;  1XQH A;  3KMA A;  1MVH A;  3M56 A;  4JDS A;  4E47 A;  4QEN A;  3RU0 A;  3OXL A;  3CBP A;  3BO5 A;  4Z4P A;  4C1Q A;  5CCL A;  5F6K C;  3M5A A;  3KMT A;  5CPR B;  1ML9 A;  3F9W A;  4WUY A;  1H3I A;  5T0M A;  4RZ0 A;  5ARF A;  1MUF A;  4J7F A;  3TG5 A;  3F9Y A;  1N3J A;  4YND A;  3M55 A;  4J83 A;  4LDG A;  3KMJ A;  4O6F A;  5F59 A;  5LSZ A;  4NVQ A;  3SWC A;  3S7B A;  5CCM A;  4AU7 A;  4O30 A;  5T0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...