4FMUA

Crystal structure of methyltransferase domain of human set domain-containing protein 2 compound: pr-snf
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
248
structure length
235
Chain Sequence
LVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sinefungin Derivatives as Inhibitors and Structure Probes of Protein Lysine Methyltransferase SETD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD2
total genus 56
structure length 235
sequence length 248
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4fmuA00
4IJ8A 5CCMA 3F9YA 4Z4PA 3VUZA 3M54A 4NJ5A 5EX0A 5EG2A 5ARGA 1MVHA 3DALA 4YPAA 3RU0A 3S7FA 3SWCA 3M5AA 3N71A 3CBOA 4QEPA 3S7BA 3VV0A 5F59A 3KMTA 3M53A 4J8OA 2QPWA 1N6CA 4H12A 4YPEA 5KJNA 2BQZA 3RQ4A 3S7JA 3FPDA 4RZ0A 4YNMA 4BUPA 5CPRB 5F5EA 3M56A 3MEKA 4WUYA 4J83A 2W5YA 3K5KA 3MO2A 4E47A 3MO5A 1ML9A 3TG4A 4I51A 5HI7A 4O6FA 3F9ZA 1O9SA 3KMJA 3CBMA 3HNAA 2R3AA 2RFIA 5F6KC 4LDGA 3QWWA 2JV0A 1N6AA 3F9WA 1MVXA 3OOIA 3OXLA 1ZKKA 3CBPA 4J7IA 5CCLA 3M58A 2IGQA 3S7DA 3M57A 3DB5A 3EP0A 3RJWA 3RAYA 5TTFA 5EX3A 4QEOA 3QWPA 5LSXA 4JDSA 1H3IA 5JINA 1XQHA 5AYFA 5KJKA 5T5GA 4C1QA 5LSZA 5T0KA 3MO0A 5JIYA 5KJLA 2G46A 2F69A 4IJDA 3PDNA 5JHNA 4MI0A 2W5ZA 4YPUA 4QENA 3RIBA 3TG5A 3IHXA 4FMUA 1MUFA 5HQ8A 5TEGA 5JJ0A 3S8PA 1PEGA 3OXGA 3OXFA 1MT6A 5ARFA 3M59A 4JLGA 5KJMA 4NVQA 4YNPA 3OPEA 3KMAA 4O30A 4J7FA 1N3JA 5T0MA 2O8JA 5TH7A 4AU7A 3QWVA 3M55A 3OS5A 4YNDA 5F6LA 3SW9A 3F9XA 3BO5A 4MI5A
chains in the Genus database with same CATH superfamily
4IJ8A 5CCMA 3F9YA 4Z4PA 3VUZA 3M54A 4NJ5A 5EX0A 5EG2A 5ARGA 1MVHA 3DALA 4YPAA 3RU0A 3S7FA 3SWCA 3M5AA 3N71A 3CBOA 4QEPA 3S7BA 3VV0A 5F59A 3KMTA 3M53A 4J8OA 2QPWA 1N6CA 4H12A 4YPEA 5KJNA 2BQZA 3RQ4A 3S7JA 3FPDA 4RZ0A 4YNMA 4BUPA 5CPRB 5F5EA 3M56A 3MEKA 4WUYA 4J83A 2W5YA 3K5KA 3MO2A 4E47A 3MO5A 1ML9A 3TG4A 4I51A 5HI7A 4O6FA 3F9ZA 1O9SA 3KMJA 3CBMA 3HNAA 2R3AA 2RFIA 5F6KC 4LDGA 3QWWA 2JV0A 1N6AA 3F9WA 1MVXA 3OOIA 3OXLA 1ZKKA 3CBPA 4J7IA 5CCLA 3M58A 2IGQA 3S7DA 3M57A 3DB5A 3EP0A 3RJWA 3RAYA 5TTFA 5EX3A 4QEOA 3QWPA 5LSXA 4JDSA 1H3IA 5JINA 1XQHA 5AYFA 5KJKA 5T5GA 4C1QA 5LSZA 5T0KA 3MO0A 5JIYA 5KJLA 2G46A 2F69A 4IJDA 3PDNA 5JHNA 4MI0A 2W5ZA 4YPUA 4QENA 3RIBA 3TG5A 3IHXA 4FMUA 1MUFA 5HQ8A 5TEGA 5JJ0A 3S8PA 1PEGA 3OXGA 3OXFA 1MT6A 5ARFA 3M59A 4JLGA 5KJMA 4NVQA 4YNPA 3OPEA 3KMAA 4O30A 4J7FA 1N3JA 5T0MA 2O8JA 5TH7A 4AU7A 3QWVA 3M55A 3OS5A 4YNDA 5F6LA 3SW9A 3F9XA 3BO5A 4MI5A
chains in the Genus database with same CATH topology
4IJ8A 5CCMA 3F9YA 4Z4PA 3VUZA 3M54A 4NJ5A 5EX0A 5EG2A 5ARGA 1MVHA 3DALA 4YPAA 3RU0A 3S7FA 3SWCA 3M5AA 3N71A 3CBOA 4QEPA 3S7BA 3VV0A 5F59A 3KMTA 3M53A 4J8OA 2QPWA 1N6CA 4H12A 4YPEA 5KJNA 2BQZA 3RQ4A 3S7JA 3FPDA 4RZ0A 4YNMA 4BUPA 5CPRB 5F5EA 3M56A 3MEKA 4WUYA 4J83A 2W5YA 3K5KA 3MO2A 4E47A 3MO5A 1ML9A 3TG4A 4I51A 5HI7A 4O6FA 3F9ZA 1O9SA 3KMJA 3CBMA 3HNAA 2R3AA 2RFIA 5F6KC 4LDGA 3QWWA 2JV0A 1N6AA 3F9WA 1MVXA 3OOIA 3OXLA 1ZKKA 3CBPA 4J7IA 5CCLA 3M58A 2IGQA 3S7DA 3M57A 3DB5A 3EP0A 3RJWA 3RAYA 5TTFA 5EX3A 4QEOA 3QWPA 5LSXA 4JDSA 1H3IA 5JINA 1XQHA 5AYFA 5KJKA 5T5GA 4C1QA 5LSZA 5T0KA 3MO0A 5JIYA 5KJLA 2G46A 2F69A 4IJDA 3PDNA 5JHNA 4MI0A 2W5ZA 4YPUA 4QENA 3RIBA 3TG5A 3IHXA 4FMUA 1MUFA 5HQ8A 5TEGA 5JJ0A 3S8PA 1PEGA 3OXGA 3OXFA 1MT6A 5ARFA 3M59A 4JLGA 5KJMA 4NVQA 4YNPA 3OPEA 3KMAA 4O30A 4J7FA 1N3JA 5T0MA 2O8JA 5TH7A 4AU7A 3QWVA 3M55A 3OS5A 4YNDA 5F6LA 3SW9A 3F9XA 3BO5A 4MI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJ8 A;  5CCM A;  3F9Y A;  4Z4P A;  3VUZ A;  3M54 A;  4NJ5 A;  5EX0 A;  5EG2 A;  5ARG A;  1MVH A;  3DAL A;  4YPA A;  3RU0 A;  3S7F A;  3SWC A;  3M5A A;  3N71 A;  3CBO A;  4QEP A;  3S7B A;  3VV0 A;  5F59 A;  3KMT A;  3M53 A;  4J8O A;  2QPW A;  1N6C A;  4H12 A;  4YPE A;  5KJN A;  2BQZ A;  3RQ4 A;  3S7J A;  3FPD A;  4RZ0 A;  4YNM A;  4BUP A;  5CPR B;  5F5E A;  3M56 A;  3MEK A;  4WUY A;  4J83 A;  2W5Y A;  3K5K A;  3MO2 A;  4E47 A;  3MO5 A;  1ML9 A;  3TG4 A;  4I51 A;  5HI7 A;  4O6F A;  3F9Z A;  1O9S A;  3KMJ A;  3CBM A;  3HNA A;  2R3A A;  2RFI A;  5F6K C;  4LDG A;  3QWW A;  2JV0 A;  1N6A A;  3F9W A;  1MVX A;  3OOI A;  3OXL A;  1ZKK A;  3CBP A;  4J7I A;  5CCL A;  3M58 A;  2IGQ A;  3S7D A;  3M57 A;  3DB5 A;  3EP0 A;  3RJW A;  3RAY A;  5TTF A;  5EX3 A;  4QEO A;  3QWP A;  5LSX A;  4JDS A;  1H3I A;  5JIN A;  1XQH A;  5AYF A;  5KJK A;  5T5G A;  4C1Q A;  5LSZ A;  5T0K A;  3MO0 A;  5JIY A;  5KJL A;  2G46 A;  2F69 A;  4IJD A;  3PDN A;  5JHN A;  4MI0 A;  2W5Z A;  4YPU A;  4QEN A;  3RIB A;  3TG5 A;  3IHX A;  4FMU A;  1MUF A;  5HQ8 A;  5TEG A;  5JJ0 A;  3S8P A;  1PEG A;  3OXG A;  3OXF A;  1MT6 A;  5ARF A;  3M59 A;  4JLG A;  5KJM A;  4NVQ A;  4YNP A;  3OPE A;  3KMA A;  4O30 A;  4J7F A;  1N3J A;  5T0M A;  2O8J A;  5TH7 A;  4AU7 A;  3QWV A;  3M55 A;  3OS5 A;  4YND A;  5F6L A;  3SW9 A;  3F9X A;  3BO5 A;  4MI5 A; 
#chains in the Genus database with same CATH topology
 4IJ8 A;  5CCM A;  3F9Y A;  4Z4P A;  3VUZ A;  3M54 A;  4NJ5 A;  5EX0 A;  5EG2 A;  5ARG A;  1MVH A;  3DAL A;  4YPA A;  3RU0 A;  3S7F A;  3SWC A;  3M5A A;  3N71 A;  3CBO A;  4QEP A;  3S7B A;  3VV0 A;  5F59 A;  3KMT A;  3M53 A;  4J8O A;  2QPW A;  1N6C A;  4H12 A;  4YPE A;  5KJN A;  2BQZ A;  3RQ4 A;  3S7J A;  3FPD A;  4RZ0 A;  4YNM A;  4BUP A;  5CPR B;  5F5E A;  3M56 A;  3MEK A;  4WUY A;  4J83 A;  2W5Y A;  3K5K A;  3MO2 A;  4E47 A;  3MO5 A;  1ML9 A;  3TG4 A;  4I51 A;  5HI7 A;  4O6F A;  3F9Z A;  1O9S A;  3KMJ A;  3CBM A;  3HNA A;  2R3A A;  2RFI A;  5F6K C;  4LDG A;  3QWW A;  2JV0 A;  1N6A A;  3F9W A;  1MVX A;  3OOI A;  3OXL A;  1ZKK A;  3CBP A;  4J7I A;  5CCL A;  3M58 A;  2IGQ A;  3S7D A;  3M57 A;  3DB5 A;  3EP0 A;  3RJW A;  3RAY A;  5TTF A;  5EX3 A;  4QEO A;  3QWP A;  5LSX A;  4JDS A;  1H3I A;  5JIN A;  1XQH A;  5AYF A;  5KJK A;  5T5G A;  4C1Q A;  5LSZ A;  5T0K A;  3MO0 A;  5JIY A;  5KJL A;  2G46 A;  2F69 A;  4IJD A;  3PDN A;  5JHN A;  4MI0 A;  2W5Z A;  4YPU A;  4QEN A;  3RIB A;  3TG5 A;  3IHX A;  4FMU A;  1MUF A;  5HQ8 A;  5TEG A;  5JJ0 A;  3S8P A;  1PEG A;  3OXG A;  3OXF A;  1MT6 A;  5ARF A;  3M59 A;  4JLG A;  5KJM A;  4NVQ A;  4YNP A;  3OPE A;  3KMA A;  4O30 A;  4J7F A;  1N3J A;  5T0M A;  2O8J A;  5TH7 A;  4AU7 A;  3QWV A;  3M55 A;  3OS5 A;  4YND A;  5F6L A;  3SW9 A;  3F9X A;  3BO5 A;  4MI5 A; 
#chains in the Genus database with same CATH homology
 4IJ8 A;  5CCM A;  3F9Y A;  4Z4P A;  3VUZ A;  3M54 A;  4NJ5 A;  5EX0 A;  5EG2 A;  5ARG A;  1MVH A;  3DAL A;  4YPA A;  3RU0 A;  3S7F A;  3SWC A;  3M5A A;  3N71 A;  3CBO A;  4QEP A;  3S7B A;  3VV0 A;  5F59 A;  3KMT A;  3M53 A;  4J8O A;  2QPW A;  1N6C A;  4H12 A;  4YPE A;  5KJN A;  2BQZ A;  3RQ4 A;  3S7J A;  3FPD A;  4RZ0 A;  4YNM A;  4BUP A;  5CPR B;  5F5E A;  3M56 A;  3MEK A;  4WUY A;  4J83 A;  2W5Y A;  3K5K A;  3MO2 A;  4E47 A;  3MO5 A;  1ML9 A;  3TG4 A;  4I51 A;  5HI7 A;  4O6F A;  3F9Z A;  1O9S A;  3KMJ A;  3CBM A;  3HNA A;  2R3A A;  2RFI A;  5F6K C;  4LDG A;  3QWW A;  2JV0 A;  1N6A A;  3F9W A;  1MVX A;  3OOI A;  3OXL A;  1ZKK A;  3CBP A;  4J7I A;  5CCL A;  3M58 A;  2IGQ A;  3S7D A;  3M57 A;  3DB5 A;  3EP0 A;  3RJW A;  3RAY A;  5TTF A;  5EX3 A;  4QEO A;  3QWP A;  5LSX A;  4JDS A;  1H3I A;  5JIN A;  1XQH A;  5AYF A;  5KJK A;  5T5G A;  4C1Q A;  5LSZ A;  5T0K A;  3MO0 A;  5JIY A;  5KJL A;  2G46 A;  2F69 A;  4IJD A;  3PDN A;  5JHN A;  4MI0 A;  2W5Z A;  4YPU A;  4QEN A;  3RIB A;  3TG5 A;  3IHX A;  4FMU A;  1MUF A;  5HQ8 A;  5TEG A;  5JJ0 A;  3S8P A;  1PEG A;  3OXG A;  3OXF A;  1MT6 A;  5ARF A;  3M59 A;  4JLG A;  5KJM A;  4NVQ A;  4YNP A;  3OPE A;  3KMA A;  4O30 A;  4J7F A;  1N3J A;  5T0M A;  2O8J A;  5TH7 A;  4AU7 A;  3QWV A;  3M55 A;  3OS5 A;  4YND A;  5F6L A;  3SW9 A;  3F9X A;  3BO5 A;  4MI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...