2R3AA

Methyltransferase domain of human suppressor of variegation 3-9 homolog 2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
287
structure length
270
Chain Sequence
AEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVTFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGRVRTVCKCGAVTCRGYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
molecule keywords Histone-lysine N-methyltransferase SUV39H2
molecule tags Transferase
source organism Homo sapiens
total genus 81
structure length 270
sequence length 287
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2r3aA00
4IJ8A 4J8OA 3F9YA 4MI5A 5JJ0A 2O8JA 1XQHA 1PEGA 5F6KC 3S7JA 3VUZA 3K5KA 3M58A 4YPAA 4YPUA 3PDNA 5LSZA 5F6LA 1MUFA 5KJNA 5EG2A 3CBOA 3TG4A 4E47A 1ML9A 3TG5A 4MI0A 3M53A 3KMTA 4FMUA 4RZ0A 5AYFA 5KJKA 3BO5A 5CCLA 1MVXA 5T5GA 5JINA 4YNDA 3OXFA 3F9ZA 2IGQA 3S7DA 3VV0A 4BUPA 4O30A 5JIYA 2F69A 3OXGA 3M54A 5TEGA 5HQ8A 5ARGA 4YNMA 4NVQA 1N3JA 4H12A 5JHNA 3SWCA 4O6FA 3S8PA 3FPDA 3M56A 4QENA 3F9XA 4J83A 5F59A 3EP0A 4I51A 2BQZA 3M55A 3N71A 3KMJA 4LDGA 1ZKKA 3QWWA 5KJMA 2JV0A 2RFIA 3HNAA 3OS5A 3DB5A 5LSXA 1N6CA 3CBMA 3QWVA 4NJ5A 3DALA 5T0KA 1MVHA 5HI7A 3OXLA 3CBPA 5CPRB 3MO5A 4YPEA 3RJWA 3MEKA 4QEPA 4IJDA 3RQ4A 1MT6A 5TH7A 1N6AA 5F5EA 3M57A 5ARFA 1O9SA 3KMAA 2R3AA 3OPEA 3M59A 3M5AA 5KJLA 3S7FA 2QPWA 3IHXA 2W5ZA 4C1QA 5T0MA 5EX3A 3RIBA 5TTFA 4Z4PA 5CCMA 4YNPA 3RAYA 5EX0A 3F9WA 4AU7A 2W5YA 3MO0A 3RU0A 4QEOA 4JLGA 3S7BA 4JDSA 4J7FA 3MO2A 1H3IA 4WUYA 2G46A 3OOIA 4J7IA 3SW9A 3QWPA
chains in the Genus database with same CATH superfamily
4IJ8A 4J8OA 3F9YA 4MI5A 5JJ0A 2O8JA 1XQHA 1PEGA 5F6KC 3S7JA 3VUZA 3K5KA 3M58A 4YPAA 4YPUA 3PDNA 5LSZA 5F6LA 1MUFA 5KJNA 5EG2A 3CBOA 3TG4A 4E47A 1ML9A 3TG5A 4MI0A 3M53A 3KMTA 4FMUA 4RZ0A 5AYFA 5KJKA 3BO5A 5CCLA 1MVXA 5T5GA 5JINA 4YNDA 3OXFA 3F9ZA 2IGQA 3S7DA 3VV0A 4BUPA 4O30A 5JIYA 2F69A 3OXGA 3M54A 5TEGA 5HQ8A 5ARGA 4YNMA 4NVQA 1N3JA 4H12A 5JHNA 3SWCA 4O6FA 3S8PA 3FPDA 3M56A 4QENA 3F9XA 4J83A 5F59A 3EP0A 4I51A 2BQZA 3M55A 3N71A 3KMJA 4LDGA 1ZKKA 3QWWA 5KJMA 2JV0A 2RFIA 3HNAA 3OS5A 3DB5A 5LSXA 1N6CA 3CBMA 3QWVA 4NJ5A 3DALA 5T0KA 1MVHA 5HI7A 3OXLA 3CBPA 5CPRB 3MO5A 4YPEA 3RJWA 3MEKA 4QEPA 4IJDA 3RQ4A 1MT6A 5TH7A 1N6AA 5F5EA 3M57A 5ARFA 1O9SA 3KMAA 2R3AA 3OPEA 3M59A 3M5AA 5KJLA 3S7FA 2QPWA 3IHXA 2W5ZA 4C1QA 5T0MA 5EX3A 3RIBA 5TTFA 4Z4PA 5CCMA 4YNPA 3RAYA 5EX0A 3F9WA 4AU7A 2W5YA 3MO0A 3RU0A 4QEOA 4JLGA 3S7BA 4JDSA 4J7FA 3MO2A 1H3IA 4WUYA 2G46A 3OOIA 4J7IA 3SW9A 3QWPA
chains in the Genus database with same CATH topology
4IJ8A 4J8OA 3F9YA 4MI5A 5JJ0A 2O8JA 1XQHA 1PEGA 5F6KC 3S7JA 3VUZA 3K5KA 3M58A 4YPAA 4YPUA 3PDNA 5LSZA 5F6LA 1MUFA 5KJNA 5EG2A 3CBOA 3TG4A 4E47A 1ML9A 3TG5A 4MI0A 3M53A 3KMTA 4FMUA 4RZ0A 5AYFA 5KJKA 3BO5A 5CCLA 1MVXA 5T5GA 5JINA 4YNDA 3OXFA 3F9ZA 2IGQA 3S7DA 3VV0A 4BUPA 4O30A 5JIYA 2F69A 3OXGA 3M54A 5TEGA 5HQ8A 5ARGA 4YNMA 4NVQA 1N3JA 4H12A 5JHNA 3SWCA 4O6FA 3S8PA 3FPDA 3M56A 4QENA 3F9XA 4J83A 5F59A 3EP0A 4I51A 2BQZA 3M55A 3N71A 3KMJA 4LDGA 1ZKKA 3QWWA 5KJMA 2JV0A 2RFIA 3HNAA 3OS5A 3DB5A 5LSXA 1N6CA 3CBMA 3QWVA 4NJ5A 3DALA 5T0KA 1MVHA 5HI7A 3OXLA 3CBPA 5CPRB 3MO5A 4YPEA 3RJWA 3MEKA 4QEPA 4IJDA 3RQ4A 1MT6A 5TH7A 1N6AA 5F5EA 3M57A 5ARFA 1O9SA 3KMAA 2R3AA 3OPEA 3M59A 3M5AA 5KJLA 3S7FA 2QPWA 3IHXA 2W5ZA 4C1QA 5T0MA 5EX3A 3RIBA 5TTFA 4Z4PA 5CCMA 4YNPA 3RAYA 5EX0A 3F9WA 4AU7A 2W5YA 3MO0A 3RU0A 4QEOA 4JLGA 3S7BA 4JDSA 4J7FA 3MO2A 1H3IA 4WUYA 2G46A 3OOIA 4J7IA 3SW9A 3QWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJ8 A;  4J8O A;  3F9Y A;  4MI5 A;  5JJ0 A;  2O8J A;  1XQH A;  1PEG A;  5F6K C;  3S7J A;  3VUZ A;  3K5K A;  3M58 A;  4YPA A;  4YPU A;  3PDN A;  5LSZ A;  5F6L A;  1MUF A;  5KJN A;  5EG2 A;  3CBO A;  3TG4 A;  4E47 A;  1ML9 A;  3TG5 A;  4MI0 A;  3M53 A;  3KMT A;  4FMU A;  4RZ0 A;  5AYF A;  5KJK A;  3BO5 A;  5CCL A;  1MVX A;  5T5G A;  5JIN A;  4YND A;  3OXF A;  3F9Z A;  2IGQ A;  3S7D A;  3VV0 A;  4BUP A;  4O30 A;  5JIY A;  2F69 A;  3OXG A;  3M54 A;  5TEG A;  5HQ8 A;  5ARG A;  4YNM A;  4NVQ A;  1N3J A;  4H12 A;  5JHN A;  3SWC A;  4O6F A;  3S8P A;  3FPD A;  3M56 A;  4QEN A;  3F9X A;  4J83 A;  5F59 A;  3EP0 A;  4I51 A;  2BQZ A;  3M55 A;  3N71 A;  3KMJ A;  4LDG A;  1ZKK A;  3QWW A;  5KJM A;  2JV0 A;  2RFI A;  3HNA A;  3OS5 A;  3DB5 A;  5LSX A;  1N6C A;  3CBM A;  3QWV A;  4NJ5 A;  3DAL A;  5T0K A;  1MVH A;  5HI7 A;  3OXL A;  3CBP A;  5CPR B;  3MO5 A;  4YPE A;  3RJW A;  3MEK A;  4QEP A;  4IJD A;  3RQ4 A;  1MT6 A;  5TH7 A;  1N6A A;  5F5E A;  3M57 A;  5ARF A;  1O9S A;  3KMA A;  2R3A A;  3OPE A;  3M59 A;  3M5A A;  5KJL A;  3S7F A;  2QPW A;  3IHX A;  2W5Z A;  4C1Q A;  5T0M A;  5EX3 A;  3RIB A;  5TTF A;  4Z4P A;  5CCM A;  4YNP A;  3RAY A;  5EX0 A;  3F9W A;  4AU7 A;  2W5Y A;  3MO0 A;  3RU0 A;  4QEO A;  4JLG A;  3S7B A;  4JDS A;  4J7F A;  3MO2 A;  1H3I A;  4WUY A;  2G46 A;  3OOI A;  4J7I A;  3SW9 A;  3QWP A; 
#chains in the Genus database with same CATH topology
 4IJ8 A;  4J8O A;  3F9Y A;  4MI5 A;  5JJ0 A;  2O8J A;  1XQH A;  1PEG A;  5F6K C;  3S7J A;  3VUZ A;  3K5K A;  3M58 A;  4YPA A;  4YPU A;  3PDN A;  5LSZ A;  5F6L A;  1MUF A;  5KJN A;  5EG2 A;  3CBO A;  3TG4 A;  4E47 A;  1ML9 A;  3TG5 A;  4MI0 A;  3M53 A;  3KMT A;  4FMU A;  4RZ0 A;  5AYF A;  5KJK A;  3BO5 A;  5CCL A;  1MVX A;  5T5G A;  5JIN A;  4YND A;  3OXF A;  3F9Z A;  2IGQ A;  3S7D A;  3VV0 A;  4BUP A;  4O30 A;  5JIY A;  2F69 A;  3OXG A;  3M54 A;  5TEG A;  5HQ8 A;  5ARG A;  4YNM A;  4NVQ A;  1N3J A;  4H12 A;  5JHN A;  3SWC A;  4O6F A;  3S8P A;  3FPD A;  3M56 A;  4QEN A;  3F9X A;  4J83 A;  5F59 A;  3EP0 A;  4I51 A;  2BQZ A;  3M55 A;  3N71 A;  3KMJ A;  4LDG A;  1ZKK A;  3QWW A;  5KJM A;  2JV0 A;  2RFI A;  3HNA A;  3OS5 A;  3DB5 A;  5LSX A;  1N6C A;  3CBM A;  3QWV A;  4NJ5 A;  3DAL A;  5T0K A;  1MVH A;  5HI7 A;  3OXL A;  3CBP A;  5CPR B;  3MO5 A;  4YPE A;  3RJW A;  3MEK A;  4QEP A;  4IJD A;  3RQ4 A;  1MT6 A;  5TH7 A;  1N6A A;  5F5E A;  3M57 A;  5ARF A;  1O9S A;  3KMA A;  2R3A A;  3OPE A;  3M59 A;  3M5A A;  5KJL A;  3S7F A;  2QPW A;  3IHX A;  2W5Z A;  4C1Q A;  5T0M A;  5EX3 A;  3RIB A;  5TTF A;  4Z4P A;  5CCM A;  4YNP A;  3RAY A;  5EX0 A;  3F9W A;  4AU7 A;  2W5Y A;  3MO0 A;  3RU0 A;  4QEO A;  4JLG A;  3S7B A;  4JDS A;  4J7F A;  3MO2 A;  1H3I A;  4WUY A;  2G46 A;  3OOI A;  4J7I A;  3SW9 A;  3QWP A; 
#chains in the Genus database with same CATH homology
 4IJ8 A;  4J8O A;  3F9Y A;  4MI5 A;  5JJ0 A;  2O8J A;  1XQH A;  1PEG A;  5F6K C;  3S7J A;  3VUZ A;  3K5K A;  3M58 A;  4YPA A;  4YPU A;  3PDN A;  5LSZ A;  5F6L A;  1MUF A;  5KJN A;  5EG2 A;  3CBO A;  3TG4 A;  4E47 A;  1ML9 A;  3TG5 A;  4MI0 A;  3M53 A;  3KMT A;  4FMU A;  4RZ0 A;  5AYF A;  5KJK A;  3BO5 A;  5CCL A;  1MVX A;  5T5G A;  5JIN A;  4YND A;  3OXF A;  3F9Z A;  2IGQ A;  3S7D A;  3VV0 A;  4BUP A;  4O30 A;  5JIY A;  2F69 A;  3OXG A;  3M54 A;  5TEG A;  5HQ8 A;  5ARG A;  4YNM A;  4NVQ A;  1N3J A;  4H12 A;  5JHN A;  3SWC A;  4O6F A;  3S8P A;  3FPD A;  3M56 A;  4QEN A;  3F9X A;  4J83 A;  5F59 A;  3EP0 A;  4I51 A;  2BQZ A;  3M55 A;  3N71 A;  3KMJ A;  4LDG A;  1ZKK A;  3QWW A;  5KJM A;  2JV0 A;  2RFI A;  3HNA A;  3OS5 A;  3DB5 A;  5LSX A;  1N6C A;  3CBM A;  3QWV A;  4NJ5 A;  3DAL A;  5T0K A;  1MVH A;  5HI7 A;  3OXL A;  3CBP A;  5CPR B;  3MO5 A;  4YPE A;  3RJW A;  3MEK A;  4QEP A;  4IJD A;  3RQ4 A;  1MT6 A;  5TH7 A;  1N6A A;  5F5E A;  3M57 A;  5ARF A;  1O9S A;  3KMA A;  2R3A A;  3OPE A;  3M59 A;  3M5A A;  5KJL A;  3S7F A;  2QPW A;  3IHX A;  2W5Z A;  4C1Q A;  5T0M A;  5EX3 A;  3RIB A;  5TTF A;  4Z4P A;  5CCM A;  4YNP A;  3RAY A;  5EX0 A;  3F9W A;  4AU7 A;  2W5Y A;  3MO0 A;  3RU0 A;  4QEO A;  4JLG A;  3S7B A;  4JDS A;  4J7F A;  3MO2 A;  1H3I A;  4WUY A;  2G46 A;  3OOI A;  4J7I A;  3SW9 A;  3QWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...