2R3AA

Methyltransferase domain of human suppressor of variegation 3-9 homolog 2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
287
structure length
270
Chain Sequence
AEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVTFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGRVRTVCKCGAVTCRGYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SUV39H2
total genus 81
structure length 270
sequence length 287
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2r3aA00
3OXLA 1O9SA 3HNAA 1ZKKA 4JDSA 3M53A 5TH7A 3S7JA 5ARFA 4NJ5A 5JIYA 2JV0A 2F69A 5CPRB 2O8JA 5JINA 3QWVA 3OS5A 5ARGA 3MO5A 4MI5A 3QWPA 3QWWA 3RU0A 1PEGA 5TEGA 2QPWA 4J7FA 3S7FA 5JHNA 2IGQA 4QEOA 4C1QA 5KJLA 4YNPA 3S8PA 3OPEA 1XQHA 3M56A 3OXGA 3IHXA 4YNDA 3S7DA 3M5AA 3BO5A 4I51A 4IJDA 5T0MA 4O30A 4LDGA 3KMTA 3KMJA 3F9XA 2G46A 4FMUA 3RAYA 4J7IA 3M59A 4RZ0A 4BUPA 5AYFA 3OOIA 5KJKA 5CCMA 5KJNA 3DALA 5TTFA 5F6KC 3TG4A 4J8OA 5KJMA 3SW9A 3S7BA 5F6LA 2BQZA 1N3JA 3N71A 4IJ8A 3CBPA 3RIBA 3EP0A 5F59A 2R3AA 5EG2A 4YPUA 3MO2A 5T5GA 4NVQA 3DB5A 3TG5A 3PDNA 1MVXA 3VV0A 4YPEA 4YNMA 3RQ4A 1MUFA 5T0KA 4MI0A 4QEPA 2W5YA 2RFIA 3M58A 5JJ0A 3KMAA 1ML9A 4H12A 5LSXA 1MVHA 3M54A 5CCLA 4O6FA 4AU7A 1N6AA 3M57A 3CBMA 3CBOA 1N6CA 4JLGA 3SWCA 5HQ8A 2W5ZA 3MEKA 5EX0A 3M55A 3F9YA 3F9ZA 4J83A 3FPDA 3RJWA 4WUYA 3VUZA 4Z4PA 4YPAA 5F5EA 5HI7A 1H3IA 4QENA 3F9WA 4E47A 1MT6A 5LSZA 3OXFA 5EX3A 3K5KA 3MO0A
chains in the Genus database with same CATH superfamily
3OXLA 1O9SA 3HNAA 1ZKKA 4JDSA 3M53A 5TH7A 3S7JA 5ARFA 4NJ5A 5JIYA 2JV0A 2F69A 5CPRB 2O8JA 5JINA 3QWVA 3OS5A 5ARGA 3MO5A 4MI5A 3QWPA 3QWWA 3RU0A 1PEGA 5TEGA 2QPWA 4J7FA 3S7FA 5JHNA 2IGQA 4QEOA 4C1QA 5KJLA 4YNPA 3S8PA 3OPEA 1XQHA 3M56A 3OXGA 3IHXA 4YNDA 3S7DA 3M5AA 3BO5A 4I51A 4IJDA 5T0MA 4O30A 4LDGA 3KMTA 3KMJA 3F9XA 2G46A 4FMUA 3RAYA 4J7IA 3M59A 4RZ0A 4BUPA 5AYFA 3OOIA 5KJKA 5CCMA 5KJNA 3DALA 5TTFA 5F6KC 3TG4A 4J8OA 5KJMA 3SW9A 3S7BA 5F6LA 2BQZA 1N3JA 3N71A 4IJ8A 3CBPA 3RIBA 3EP0A 5F59A 2R3AA 5EG2A 4YPUA 3MO2A 5T5GA 4NVQA 3DB5A 3TG5A 3PDNA 1MVXA 3VV0A 4YPEA 4YNMA 3RQ4A 1MUFA 5T0KA 4MI0A 4QEPA 2W5YA 2RFIA 3M58A 5JJ0A 3KMAA 1ML9A 4H12A 5LSXA 1MVHA 3M54A 5CCLA 4O6FA 4AU7A 1N6AA 3M57A 3CBMA 3CBOA 1N6CA 4JLGA 3SWCA 5HQ8A 2W5ZA 3MEKA 5EX0A 3M55A 3F9YA 3F9ZA 4J83A 3FPDA 3RJWA 4WUYA 3VUZA 4Z4PA 4YPAA 5F5EA 5HI7A 1H3IA 4QENA 3F9WA 4E47A 1MT6A 5LSZA 3OXFA 5EX3A 3K5KA 3MO0A
chains in the Genus database with same CATH topology
3OXLA 1O9SA 3HNAA 1ZKKA 4JDSA 3M53A 5TH7A 3S7JA 5ARFA 4NJ5A 5JIYA 2JV0A 2F69A 5CPRB 2O8JA 5JINA 3QWVA 3OS5A 5ARGA 3MO5A 4MI5A 3QWPA 3QWWA 3RU0A 1PEGA 5TEGA 2QPWA 4J7FA 3S7FA 5JHNA 2IGQA 4QEOA 4C1QA 5KJLA 4YNPA 3S8PA 3OPEA 1XQHA 3M56A 3OXGA 3IHXA 4YNDA 3S7DA 3M5AA 3BO5A 4I51A 4IJDA 5T0MA 4O30A 4LDGA 3KMTA 3KMJA 3F9XA 2G46A 4FMUA 3RAYA 4J7IA 3M59A 4RZ0A 4BUPA 5AYFA 3OOIA 5KJKA 5CCMA 5KJNA 3DALA 5TTFA 5F6KC 3TG4A 4J8OA 5KJMA 3SW9A 3S7BA 5F6LA 2BQZA 1N3JA 3N71A 4IJ8A 3CBPA 3RIBA 3EP0A 5F59A 2R3AA 5EG2A 4YPUA 3MO2A 5T5GA 4NVQA 3DB5A 3TG5A 3PDNA 1MVXA 3VV0A 4YPEA 4YNMA 3RQ4A 1MUFA 5T0KA 4MI0A 4QEPA 2W5YA 2RFIA 3M58A 5JJ0A 3KMAA 1ML9A 4H12A 5LSXA 1MVHA 3M54A 5CCLA 4O6FA 4AU7A 1N6AA 3M57A 3CBMA 3CBOA 1N6CA 4JLGA 3SWCA 5HQ8A 2W5ZA 3MEKA 5EX0A 3M55A 3F9YA 3F9ZA 4J83A 3FPDA 3RJWA 4WUYA 3VUZA 4Z4PA 4YPAA 5F5EA 5HI7A 1H3IA 4QENA 3F9WA 4E47A 1MT6A 5LSZA 3OXFA 5EX3A 3K5KA 3MO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXL A;  1O9S A;  3HNA A;  1ZKK A;  4JDS A;  3M53 A;  5TH7 A;  3S7J A;  5ARF A;  4NJ5 A;  5JIY A;  2JV0 A;  2F69 A;  5CPR B;  2O8J A;  5JIN A;  3QWV A;  3OS5 A;  5ARG A;  3MO5 A;  4MI5 A;  3QWP A;  3QWW A;  3RU0 A;  1PEG A;  5TEG A;  2QPW A;  4J7F A;  3S7F A;  5JHN A;  2IGQ A;  4QEO A;  4C1Q A;  5KJL A;  4YNP A;  3S8P A;  3OPE A;  1XQH A;  3M56 A;  3OXG A;  3IHX A;  4YND A;  3S7D A;  3M5A A;  3BO5 A;  4I51 A;  4IJD A;  5T0M A;  4O30 A;  4LDG A;  3KMT A;  3KMJ A;  3F9X A;  2G46 A;  4FMU A;  3RAY A;  4J7I A;  3M59 A;  4RZ0 A;  4BUP A;  5AYF A;  3OOI A;  5KJK A;  5CCM A;  5KJN A;  3DAL A;  5TTF A;  5F6K C;  3TG4 A;  4J8O A;  5KJM A;  3SW9 A;  3S7B A;  5F6L A;  2BQZ A;  1N3J A;  3N71 A;  4IJ8 A;  3CBP A;  3RIB A;  3EP0 A;  5F59 A;  2R3A A;  5EG2 A;  4YPU A;  3MO2 A;  5T5G A;  4NVQ A;  3DB5 A;  3TG5 A;  3PDN A;  1MVX A;  3VV0 A;  4YPE A;  4YNM A;  3RQ4 A;  1MUF A;  5T0K A;  4MI0 A;  4QEP A;  2W5Y A;  2RFI A;  3M58 A;  5JJ0 A;  3KMA A;  1ML9 A;  4H12 A;  5LSX A;  1MVH A;  3M54 A;  5CCL A;  4O6F A;  4AU7 A;  1N6A A;  3M57 A;  3CBM A;  3CBO A;  1N6C A;  4JLG A;  3SWC A;  5HQ8 A;  2W5Z A;  3MEK A;  5EX0 A;  3M55 A;  3F9Y A;  3F9Z A;  4J83 A;  3FPD A;  3RJW A;  4WUY A;  3VUZ A;  4Z4P A;  4YPA A;  5F5E A;  5HI7 A;  1H3I A;  4QEN A;  3F9W A;  4E47 A;  1MT6 A;  5LSZ A;  3OXF A;  5EX3 A;  3K5K A;  3MO0 A; 
#chains in the Genus database with same CATH topology
 3OXL A;  1O9S A;  3HNA A;  1ZKK A;  4JDS A;  3M53 A;  5TH7 A;  3S7J A;  5ARF A;  4NJ5 A;  5JIY A;  2JV0 A;  2F69 A;  5CPR B;  2O8J A;  5JIN A;  3QWV A;  3OS5 A;  5ARG A;  3MO5 A;  4MI5 A;  3QWP A;  3QWW A;  3RU0 A;  1PEG A;  5TEG A;  2QPW A;  4J7F A;  3S7F A;  5JHN A;  2IGQ A;  4QEO A;  4C1Q A;  5KJL A;  4YNP A;  3S8P A;  3OPE A;  1XQH A;  3M56 A;  3OXG A;  3IHX A;  4YND A;  3S7D A;  3M5A A;  3BO5 A;  4I51 A;  4IJD A;  5T0M A;  4O30 A;  4LDG A;  3KMT A;  3KMJ A;  3F9X A;  2G46 A;  4FMU A;  3RAY A;  4J7I A;  3M59 A;  4RZ0 A;  4BUP A;  5AYF A;  3OOI A;  5KJK A;  5CCM A;  5KJN A;  3DAL A;  5TTF A;  5F6K C;  3TG4 A;  4J8O A;  5KJM A;  3SW9 A;  3S7B A;  5F6L A;  2BQZ A;  1N3J A;  3N71 A;  4IJ8 A;  3CBP A;  3RIB A;  3EP0 A;  5F59 A;  2R3A A;  5EG2 A;  4YPU A;  3MO2 A;  5T5G A;  4NVQ A;  3DB5 A;  3TG5 A;  3PDN A;  1MVX A;  3VV0 A;  4YPE A;  4YNM A;  3RQ4 A;  1MUF A;  5T0K A;  4MI0 A;  4QEP A;  2W5Y A;  2RFI A;  3M58 A;  5JJ0 A;  3KMA A;  1ML9 A;  4H12 A;  5LSX A;  1MVH A;  3M54 A;  5CCL A;  4O6F A;  4AU7 A;  1N6A A;  3M57 A;  3CBM A;  3CBO A;  1N6C A;  4JLG A;  3SWC A;  5HQ8 A;  2W5Z A;  3MEK A;  5EX0 A;  3M55 A;  3F9Y A;  3F9Z A;  4J83 A;  3FPD A;  3RJW A;  4WUY A;  3VUZ A;  4Z4P A;  4YPA A;  5F5E A;  5HI7 A;  1H3I A;  4QEN A;  3F9W A;  4E47 A;  1MT6 A;  5LSZ A;  3OXF A;  5EX3 A;  3K5K A;  3MO0 A; 
#chains in the Genus database with same CATH homology
 3OXL A;  1O9S A;  3HNA A;  1ZKK A;  4JDS A;  3M53 A;  5TH7 A;  3S7J A;  5ARF A;  4NJ5 A;  5JIY A;  2JV0 A;  2F69 A;  5CPR B;  2O8J A;  5JIN A;  3QWV A;  3OS5 A;  5ARG A;  3MO5 A;  4MI5 A;  3QWP A;  3QWW A;  3RU0 A;  1PEG A;  5TEG A;  2QPW A;  4J7F A;  3S7F A;  5JHN A;  2IGQ A;  4QEO A;  4C1Q A;  5KJL A;  4YNP A;  3S8P A;  3OPE A;  1XQH A;  3M56 A;  3OXG A;  3IHX A;  4YND A;  3S7D A;  3M5A A;  3BO5 A;  4I51 A;  4IJD A;  5T0M A;  4O30 A;  4LDG A;  3KMT A;  3KMJ A;  3F9X A;  2G46 A;  4FMU A;  3RAY A;  4J7I A;  3M59 A;  4RZ0 A;  4BUP A;  5AYF A;  3OOI A;  5KJK A;  5CCM A;  5KJN A;  3DAL A;  5TTF A;  5F6K C;  3TG4 A;  4J8O A;  5KJM A;  3SW9 A;  3S7B A;  5F6L A;  2BQZ A;  1N3J A;  3N71 A;  4IJ8 A;  3CBP A;  3RIB A;  3EP0 A;  5F59 A;  2R3A A;  5EG2 A;  4YPU A;  3MO2 A;  5T5G A;  4NVQ A;  3DB5 A;  3TG5 A;  3PDN A;  1MVX A;  3VV0 A;  4YPE A;  4YNM A;  3RQ4 A;  1MUF A;  5T0K A;  4MI0 A;  4QEP A;  2W5Y A;  2RFI A;  3M58 A;  5JJ0 A;  3KMA A;  1ML9 A;  4H12 A;  5LSX A;  1MVH A;  3M54 A;  5CCL A;  4O6F A;  4AU7 A;  1N6A A;  3M57 A;  3CBM A;  3CBO A;  1N6C A;  4JLG A;  3SWC A;  5HQ8 A;  2W5Z A;  3MEK A;  5EX0 A;  3M55 A;  3F9Y A;  3F9Z A;  4J83 A;  3FPD A;  3RJW A;  4WUY A;  3VUZ A;  4Z4P A;  4YPA A;  5F5E A;  5HI7 A;  1H3I A;  4QEN A;  3F9W A;  4E47 A;  1MT6 A;  5LSZ A;  3OXF A;  5EX3 A;  3K5K A;  3MO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...