2R3AA

Methyltransferase domain of human suppressor of variegation 3-9 homolog 2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
287
structure length
270
Chain Sequence
b'AEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVTFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGRVRTVCKCGAVTCRGYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SUV39H2
molecule tags Transferase
source organism Homo sapiens
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
total genus 81
structure length 270
sequence length 287
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2r3aA00
4H12A 3M54A 4RZ0A 5JHNA 3MO0A 1N3JA 4J83A 1H3IA 5JIYA 3QWPA 5T5GA 5JINA 4NJ5A 5JJ0A 3SW9A 4Z4PA 3M53A 4WUYA 3FPDA 3CBOA 3MO2A 4LDGA 5HI7A 5CPRB 3KMTA 1MVXA 3M56A 4MI5A 3RU0A 4YPEA 4YNMA 5CCLA 4J8OA 3CBMA 2QPWA 4E47A 5EX3A 1ML9A 3M58A 3RAYA 5F5EA 1PEGA 4QEOA 2O8JA 3KMAA 4YNPA 5LSXA 5KJKA 2JV0A 3QWWA 3RQ4A 3F9YA 2RFIA 4JDSA 3F9WA 3PDNA 5ARFA 4J7IA 2IGQA 5LSZA 2BQZA 4QEPA 3CBPA 3OOIA 4BUPA 5KJMA 1N6AA 3DALA 5ARGA 3TG5A 4YNDA 3OXLA 3OXGA 3VUZA 1ZKKA 4C1QA 5KJLA 4IJ8A 4J7FA 3KMJA 4YPAA 2R3AA 5TH7A 4O6FA 4FMUA 3EP0A 3M55A 3BO5A 3F9ZA 4AU7A 3VV0A 3S7DA 1MT6A 3M57A 3F9XA 2F69A 1XQHA 5T0KA 5T0MA 3DB5A 3K5KA 3S7FA 5AYFA 3QWVA 5F59A 3N71A 4O30A 3M59A 3MEKA 3HNAA 3RIBA 4MI0A 3S7JA 5EX0A 4I51A 3S8PA 2W5YA 4YPUA 5F6LA 3RJWA 5HQ8A 3OPEA 3MO5A 5KJNA 2W5ZA 5TTFA 3IHXA 1MVHA 1MUFA 1N6CA 1O9SA 3OXFA 3OS5A 4QENA 3S7BA 5EG2A 4JLGA 5F6KC 3SWCA 3TG4A 5CCMA 4NVQA 5TEGA 3M5AA 4IJDA 2G46A
chains in the Genus database with same CATH superfamily
4H12A 3M54A 4RZ0A 5JHNA 3MO0A 1N3JA 4J83A 1H3IA 5JIYA 3QWPA 5T5GA 5JINA 4NJ5A 5JJ0A 3SW9A 4Z4PA 3M53A 4WUYA 3FPDA 3CBOA 3MO2A 4LDGA 5HI7A 5CPRB 3KMTA 1MVXA 3M56A 4MI5A 3RU0A 4YPEA 4YNMA 5CCLA 4J8OA 3CBMA 2QPWA 4E47A 5EX3A 1ML9A 3M58A 3RAYA 5F5EA 1PEGA 4QEOA 2O8JA 3KMAA 4YNPA 5LSXA 5KJKA 2JV0A 3QWWA 3RQ4A 3F9YA 2RFIA 4JDSA 3F9WA 3PDNA 5ARFA 4J7IA 2IGQA 5LSZA 2BQZA 4QEPA 3CBPA 3OOIA 4BUPA 5KJMA 1N6AA 3DALA 5ARGA 3TG5A 4YNDA 3OXLA 3OXGA 3VUZA 1ZKKA 4C1QA 5KJLA 4IJ8A 4J7FA 3KMJA 4YPAA 2R3AA 5TH7A 4O6FA 4FMUA 3EP0A 3M55A 3BO5A 3F9ZA 4AU7A 3VV0A 3S7DA 1MT6A 3M57A 3F9XA 2F69A 1XQHA 5T0KA 5T0MA 3DB5A 3K5KA 3S7FA 5AYFA 3QWVA 5F59A 3N71A 4O30A 3M59A 3MEKA 3HNAA 3RIBA 4MI0A 3S7JA 5EX0A 4I51A 3S8PA 2W5YA 4YPUA 5F6LA 3RJWA 5HQ8A 3OPEA 3MO5A 5KJNA 2W5ZA 5TTFA 3IHXA 1MVHA 1MUFA 1N6CA 1O9SA 3OXFA 3OS5A 4QENA 3S7BA 5EG2A 4JLGA 5F6KC 3SWCA 3TG4A 5CCMA 4NVQA 5TEGA 3M5AA 4IJDA 2G46A
chains in the Genus database with same CATH topology
4H12A 3M54A 4RZ0A 5JHNA 3MO0A 1N3JA 4J83A 1H3IA 5JIYA 3QWPA 5T5GA 5JINA 4NJ5A 5JJ0A 3SW9A 4Z4PA 3M53A 4WUYA 3FPDA 3CBOA 3MO2A 4LDGA 5HI7A 5CPRB 3KMTA 1MVXA 3M56A 4MI5A 3RU0A 4YPEA 4YNMA 5CCLA 4J8OA 3CBMA 2QPWA 4E47A 5EX3A 1ML9A 3M58A 3RAYA 5F5EA 1PEGA 4QEOA 2O8JA 3KMAA 4YNPA 5LSXA 5KJKA 2JV0A 3QWWA 3RQ4A 3F9YA 2RFIA 4JDSA 3F9WA 3PDNA 5ARFA 4J7IA 2IGQA 5LSZA 2BQZA 4QEPA 3CBPA 3OOIA 4BUPA 5KJMA 1N6AA 3DALA 5ARGA 3TG5A 4YNDA 3OXLA 3OXGA 3VUZA 1ZKKA 4C1QA 5KJLA 4IJ8A 4J7FA 3KMJA 4YPAA 2R3AA 5TH7A 4O6FA 4FMUA 3EP0A 3M55A 3BO5A 3F9ZA 4AU7A 3VV0A 3S7DA 1MT6A 3M57A 3F9XA 2F69A 1XQHA 5T0KA 5T0MA 3DB5A 3K5KA 3S7FA 5AYFA 3QWVA 5F59A 3N71A 4O30A 3M59A 3MEKA 3HNAA 3RIBA 4MI0A 3S7JA 5EX0A 4I51A 3S8PA 2W5YA 4YPUA 5F6LA 3RJWA 5HQ8A 3OPEA 3MO5A 5KJNA 2W5ZA 5TTFA 3IHXA 1MVHA 1MUFA 1N6CA 1O9SA 3OXFA 3OS5A 4QENA 3S7BA 5EG2A 4JLGA 5F6KC 3SWCA 3TG4A 5CCMA 4NVQA 5TEGA 3M5AA 4IJDA 2G46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H12 A;  3M54 A;  4RZ0 A;  5JHN A;  3MO0 A;  1N3J A;  4J83 A;  1H3I A;  5JIY A;  3QWP A;  5T5G A;  5JIN A;  4NJ5 A;  5JJ0 A;  3SW9 A;  4Z4P A;  3M53 A;  4WUY A;  3FPD A;  3CBO A;  3MO2 A;  4LDG A;  5HI7 A;  5CPR B;  3KMT A;  1MVX A;  3M56 A;  4MI5 A;  3RU0 A;  4YPE A;  4YNM A;  5CCL A;  4J8O A;  3CBM A;  2QPW A;  4E47 A;  5EX3 A;  1ML9 A;  3M58 A;  3RAY A;  5F5E A;  1PEG A;  4QEO A;  2O8J A;  3KMA A;  4YNP A;  5LSX A;  5KJK A;  2JV0 A;  3QWW A;  3RQ4 A;  3F9Y A;  2RFI A;  4JDS A;  3F9W A;  3PDN A;  5ARF A;  4J7I A;  2IGQ A;  5LSZ A;  2BQZ A;  4QEP A;  3CBP A;  3OOI A;  4BUP A;  5KJM A;  1N6A A;  3DAL A;  5ARG A;  3TG5 A;  4YND A;  3OXL A;  3OXG A;  3VUZ A;  1ZKK A;  4C1Q A;  5KJL A;  4IJ8 A;  4J7F A;  3KMJ A;  4YPA A;  2R3A A;  5TH7 A;  4O6F A;  4FMU A;  3EP0 A;  3M55 A;  3BO5 A;  3F9Z A;  4AU7 A;  3VV0 A;  3S7D A;  1MT6 A;  3M57 A;  3F9X A;  2F69 A;  1XQH A;  5T0K A;  5T0M A;  3DB5 A;  3K5K A;  3S7F A;  5AYF A;  3QWV A;  5F59 A;  3N71 A;  4O30 A;  3M59 A;  3MEK A;  3HNA A;  3RIB A;  4MI0 A;  3S7J A;  5EX0 A;  4I51 A;  3S8P A;  2W5Y A;  4YPU A;  5F6L A;  3RJW A;  5HQ8 A;  3OPE A;  3MO5 A;  5KJN A;  2W5Z A;  5TTF A;  3IHX A;  1MVH A;  1MUF A;  1N6C A;  1O9S A;  3OXF A;  3OS5 A;  4QEN A;  3S7B A;  5EG2 A;  4JLG A;  5F6K C;  3SWC A;  3TG4 A;  5CCM A;  4NVQ A;  5TEG A;  3M5A A;  4IJD A;  2G46 A; 
#chains in the Genus database with same CATH topology
 4H12 A;  3M54 A;  4RZ0 A;  5JHN A;  3MO0 A;  1N3J A;  4J83 A;  1H3I A;  5JIY A;  3QWP A;  5T5G A;  5JIN A;  4NJ5 A;  5JJ0 A;  3SW9 A;  4Z4P A;  3M53 A;  4WUY A;  3FPD A;  3CBO A;  3MO2 A;  4LDG A;  5HI7 A;  5CPR B;  3KMT A;  1MVX A;  3M56 A;  4MI5 A;  3RU0 A;  4YPE A;  4YNM A;  5CCL A;  4J8O A;  3CBM A;  2QPW A;  4E47 A;  5EX3 A;  1ML9 A;  3M58 A;  3RAY A;  5F5E A;  1PEG A;  4QEO A;  2O8J A;  3KMA A;  4YNP A;  5LSX A;  5KJK A;  2JV0 A;  3QWW A;  3RQ4 A;  3F9Y A;  2RFI A;  4JDS A;  3F9W A;  3PDN A;  5ARF A;  4J7I A;  2IGQ A;  5LSZ A;  2BQZ A;  4QEP A;  3CBP A;  3OOI A;  4BUP A;  5KJM A;  1N6A A;  3DAL A;  5ARG A;  3TG5 A;  4YND A;  3OXL A;  3OXG A;  3VUZ A;  1ZKK A;  4C1Q A;  5KJL A;  4IJ8 A;  4J7F A;  3KMJ A;  4YPA A;  2R3A A;  5TH7 A;  4O6F A;  4FMU A;  3EP0 A;  3M55 A;  3BO5 A;  3F9Z A;  4AU7 A;  3VV0 A;  3S7D A;  1MT6 A;  3M57 A;  3F9X A;  2F69 A;  1XQH A;  5T0K A;  5T0M A;  3DB5 A;  3K5K A;  3S7F A;  5AYF A;  3QWV A;  5F59 A;  3N71 A;  4O30 A;  3M59 A;  3MEK A;  3HNA A;  3RIB A;  4MI0 A;  3S7J A;  5EX0 A;  4I51 A;  3S8P A;  2W5Y A;  4YPU A;  5F6L A;  3RJW A;  5HQ8 A;  3OPE A;  3MO5 A;  5KJN A;  2W5Z A;  5TTF A;  3IHX A;  1MVH A;  1MUF A;  1N6C A;  1O9S A;  3OXF A;  3OS5 A;  4QEN A;  3S7B A;  5EG2 A;  4JLG A;  5F6K C;  3SWC A;  3TG4 A;  5CCM A;  4NVQ A;  5TEG A;  3M5A A;  4IJD A;  2G46 A; 
#chains in the Genus database with same CATH homology
 4H12 A;  3M54 A;  4RZ0 A;  5JHN A;  3MO0 A;  1N3J A;  4J83 A;  1H3I A;  5JIY A;  3QWP A;  5T5G A;  5JIN A;  4NJ5 A;  5JJ0 A;  3SW9 A;  4Z4P A;  3M53 A;  4WUY A;  3FPD A;  3CBO A;  3MO2 A;  4LDG A;  5HI7 A;  5CPR B;  3KMT A;  1MVX A;  3M56 A;  4MI5 A;  3RU0 A;  4YPE A;  4YNM A;  5CCL A;  4J8O A;  3CBM A;  2QPW A;  4E47 A;  5EX3 A;  1ML9 A;  3M58 A;  3RAY A;  5F5E A;  1PEG A;  4QEO A;  2O8J A;  3KMA A;  4YNP A;  5LSX A;  5KJK A;  2JV0 A;  3QWW A;  3RQ4 A;  3F9Y A;  2RFI A;  4JDS A;  3F9W A;  3PDN A;  5ARF A;  4J7I A;  2IGQ A;  5LSZ A;  2BQZ A;  4QEP A;  3CBP A;  3OOI A;  4BUP A;  5KJM A;  1N6A A;  3DAL A;  5ARG A;  3TG5 A;  4YND A;  3OXL A;  3OXG A;  3VUZ A;  1ZKK A;  4C1Q A;  5KJL A;  4IJ8 A;  4J7F A;  3KMJ A;  4YPA A;  2R3A A;  5TH7 A;  4O6F A;  4FMU A;  3EP0 A;  3M55 A;  3BO5 A;  3F9Z A;  4AU7 A;  3VV0 A;  3S7D A;  1MT6 A;  3M57 A;  3F9X A;  2F69 A;  1XQH A;  5T0K A;  5T0M A;  3DB5 A;  3K5K A;  3S7F A;  5AYF A;  3QWV A;  5F59 A;  3N71 A;  4O30 A;  3M59 A;  3MEK A;  3HNA A;  3RIB A;  4MI0 A;  3S7J A;  5EX0 A;  4I51 A;  3S8P A;  2W5Y A;  4YPU A;  5F6L A;  3RJW A;  5HQ8 A;  3OPE A;  3MO5 A;  5KJN A;  2W5Z A;  5TTF A;  3IHX A;  1MVH A;  1MUF A;  1N6C A;  1O9S A;  3OXF A;  3OS5 A;  4QEN A;  3S7B A;  5EG2 A;  4JLG A;  5F6K C;  3SWC A;  3TG4 A;  5CCM A;  4NVQ A;  5TEG A;  3M5A A;  4IJD A;  2G46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...