2R3AA

Methyltransferase domain of human suppressor of variegation 3-9 homolog 2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
287
structure length
270
Chain Sequence
AEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVTFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGRVRTVCKCGAVTCRGYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SUV39H2
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 270
sequence length 287
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2r3aA00
3RIBA 5HQ8A 2F69A 4YNMA 3RAYA 5CPRB 5LSZA 2O8JA 2RFIA 2JV0A 3KMJA 3OXGA 3VUZA 4LDGA 4YNDA 4J83A 3QWPA 1XQHA 5T0MA 4J8OA 4MI5A 1ZKKA 4QEPA 3M56A 2BQZA 3OPEA 5KJLA 1MVXA 1N6CA 3N71A 3CBMA 4YPAA 3OS5A 1PEGA 3S7DA 3DB5A 4QENA 4E47A 4O30A 1O9SA 3K5KA 3S7FA 3EP0A 4BUPA 4J7FA 3BO5A 3MEKA 1ML9A 3RQ4A 4JLGA 3S7JA 5HI7A 3FPDA 4Z4PA 3KMTA 3M53A 3F9WA 1H3IA 1N3JA 4MI0A 4NJ5A 4IJDA 4YNPA 5JINA 3RU0A 4AU7A 3S7BA 3TG5A 3MO0A 3QWWA 5AYFA 5F6LA 1MVHA 5T0KA 5JHNA 4QEOA 3F9YA 3M55A 3PDNA 5F5EA 5CCLA 1N6AA 3M59A 3SW9A 4C1QA 3OXFA 5CCMA 3RJWA 5F6KC 3QWVA 4JDSA 5KJMA 5TEGA 1MUFA 4RZ0A 2IGQA 4FMUA 5TTFA 5EX3A 5TH7A 3KMAA 3F9ZA 3CBOA 3M58A 1MT6A 5JJ0A 3MO5A 3DALA 4I51A 4NVQA 3SWCA 2R3AA 3OOIA 3M57A 4O6FA 3S8PA 4YPEA 2G46A 2QPWA 3M54A 3IHXA 3TG4A 3M5AA 5KJKA 5ARGA 5JIYA 3VV0A 5LSXA 5EG2A 3F9XA 2W5ZA 3MO2A 4H12A 2W5YA 3OXLA 4J7IA 5T5GA 4WUYA 5F59A 4IJ8A 3HNAA 5EX0A 4YPUA 5KJNA 5ARFA 3CBPA
chains in the Genus database with same CATH superfamily
3RIBA 5HQ8A 2F69A 4YNMA 3RAYA 5CPRB 5LSZA 2O8JA 2RFIA 2JV0A 3KMJA 3OXGA 3VUZA 4LDGA 4YNDA 4J83A 3QWPA 1XQHA 5T0MA 4J8OA 4MI5A 1ZKKA 4QEPA 3M56A 2BQZA 3OPEA 5KJLA 1MVXA 1N6CA 3N71A 3CBMA 4YPAA 3OS5A 1PEGA 3S7DA 3DB5A 4QENA 4E47A 4O30A 1O9SA 3K5KA 3S7FA 3EP0A 4BUPA 4J7FA 3BO5A 3MEKA 1ML9A 3RQ4A 4JLGA 3S7JA 5HI7A 3FPDA 4Z4PA 3KMTA 3M53A 3F9WA 1H3IA 1N3JA 4MI0A 4NJ5A 4IJDA 4YNPA 5JINA 3RU0A 4AU7A 3S7BA 3TG5A 3MO0A 3QWWA 5AYFA 5F6LA 1MVHA 5T0KA 5JHNA 4QEOA 3F9YA 3M55A 3PDNA 5F5EA 5CCLA 1N6AA 3M59A 3SW9A 4C1QA 3OXFA 5CCMA 3RJWA 5F6KC 3QWVA 4JDSA 5KJMA 5TEGA 1MUFA 4RZ0A 2IGQA 4FMUA 5TTFA 5EX3A 5TH7A 3KMAA 3F9ZA 3CBOA 3M58A 1MT6A 5JJ0A 3MO5A 3DALA 4I51A 4NVQA 3SWCA 2R3AA 3OOIA 3M57A 4O6FA 3S8PA 4YPEA 2G46A 2QPWA 3M54A 3IHXA 3TG4A 3M5AA 5KJKA 5ARGA 5JIYA 3VV0A 5LSXA 5EG2A 3F9XA 2W5ZA 3MO2A 4H12A 2W5YA 3OXLA 4J7IA 5T5GA 4WUYA 5F59A 4IJ8A 3HNAA 5EX0A 4YPUA 5KJNA 5ARFA 3CBPA
chains in the Genus database with same CATH topology
3RIBA 5HQ8A 2F69A 4YNMA 3RAYA 5CPRB 5LSZA 2O8JA 2RFIA 2JV0A 3KMJA 3OXGA 3VUZA 4LDGA 4YNDA 4J83A 3QWPA 1XQHA 5T0MA 4J8OA 4MI5A 1ZKKA 4QEPA 3M56A 2BQZA 3OPEA 5KJLA 1MVXA 1N6CA 3N71A 3CBMA 4YPAA 3OS5A 1PEGA 3S7DA 3DB5A 4QENA 4E47A 4O30A 1O9SA 3K5KA 3S7FA 3EP0A 4BUPA 4J7FA 3BO5A 3MEKA 1ML9A 3RQ4A 4JLGA 3S7JA 5HI7A 3FPDA 4Z4PA 3KMTA 3M53A 3F9WA 1H3IA 1N3JA 4MI0A 4NJ5A 4IJDA 4YNPA 5JINA 3RU0A 4AU7A 3S7BA 3TG5A 3MO0A 3QWWA 5AYFA 5F6LA 1MVHA 5T0KA 5JHNA 4QEOA 3F9YA 3M55A 3PDNA 5F5EA 5CCLA 1N6AA 3M59A 3SW9A 4C1QA 3OXFA 5CCMA 3RJWA 5F6KC 3QWVA 4JDSA 5KJMA 5TEGA 1MUFA 4RZ0A 2IGQA 4FMUA 5TTFA 5EX3A 5TH7A 3KMAA 3F9ZA 3CBOA 3M58A 1MT6A 5JJ0A 3MO5A 3DALA 4I51A 4NVQA 3SWCA 2R3AA 3OOIA 3M57A 4O6FA 3S8PA 4YPEA 2G46A 2QPWA 3M54A 3IHXA 3TG4A 3M5AA 5KJKA 5ARGA 5JIYA 3VV0A 5LSXA 5EG2A 3F9XA 2W5ZA 3MO2A 4H12A 2W5YA 3OXLA 4J7IA 5T5GA 4WUYA 5F59A 4IJ8A 3HNAA 5EX0A 4YPUA 5KJNA 5ARFA 3CBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIB A;  5HQ8 A;  2F69 A;  4YNM A;  3RAY A;  5CPR B;  5LSZ A;  2O8J A;  2RFI A;  2JV0 A;  3KMJ A;  3OXG A;  3VUZ A;  4LDG A;  4YND A;  4J83 A;  3QWP A;  1XQH A;  5T0M A;  4J8O A;  4MI5 A;  1ZKK A;  4QEP A;  3M56 A;  2BQZ A;  3OPE A;  5KJL A;  1MVX A;  1N6C A;  3N71 A;  3CBM A;  4YPA A;  3OS5 A;  1PEG A;  3S7D A;  3DB5 A;  4QEN A;  4E47 A;  4O30 A;  1O9S A;  3K5K A;  3S7F A;  3EP0 A;  4BUP A;  4J7F A;  3BO5 A;  3MEK A;  1ML9 A;  3RQ4 A;  4JLG A;  3S7J A;  5HI7 A;  3FPD A;  4Z4P A;  3KMT A;  3M53 A;  3F9W A;  1H3I A;  1N3J A;  4MI0 A;  4NJ5 A;  4IJD A;  4YNP A;  5JIN A;  3RU0 A;  4AU7 A;  3S7B A;  3TG5 A;  3MO0 A;  3QWW A;  5AYF A;  5F6L A;  1MVH A;  5T0K A;  5JHN A;  4QEO A;  3F9Y A;  3M55 A;  3PDN A;  5F5E A;  5CCL A;  1N6A A;  3M59 A;  3SW9 A;  4C1Q A;  3OXF A;  5CCM A;  3RJW A;  5F6K C;  3QWV A;  4JDS A;  5KJM A;  5TEG A;  1MUF A;  4RZ0 A;  2IGQ A;  4FMU A;  5TTF A;  5EX3 A;  5TH7 A;  3KMA A;  3F9Z A;  3CBO A;  3M58 A;  1MT6 A;  5JJ0 A;  3MO5 A;  3DAL A;  4I51 A;  4NVQ A;  3SWC A;  2R3A A;  3OOI A;  3M57 A;  4O6F A;  3S8P A;  4YPE A;  2G46 A;  2QPW A;  3M54 A;  3IHX A;  3TG4 A;  3M5A A;  5KJK A;  5ARG A;  5JIY A;  3VV0 A;  5LSX A;  5EG2 A;  3F9X A;  2W5Z A;  3MO2 A;  4H12 A;  2W5Y A;  3OXL A;  4J7I A;  5T5G A;  4WUY A;  5F59 A;  4IJ8 A;  3HNA A;  5EX0 A;  4YPU A;  5KJN A;  5ARF A;  3CBP A; 
#chains in the Genus database with same CATH topology
 3RIB A;  5HQ8 A;  2F69 A;  4YNM A;  3RAY A;  5CPR B;  5LSZ A;  2O8J A;  2RFI A;  2JV0 A;  3KMJ A;  3OXG A;  3VUZ A;  4LDG A;  4YND A;  4J83 A;  3QWP A;  1XQH A;  5T0M A;  4J8O A;  4MI5 A;  1ZKK A;  4QEP A;  3M56 A;  2BQZ A;  3OPE A;  5KJL A;  1MVX A;  1N6C A;  3N71 A;  3CBM A;  4YPA A;  3OS5 A;  1PEG A;  3S7D A;  3DB5 A;  4QEN A;  4E47 A;  4O30 A;  1O9S A;  3K5K A;  3S7F A;  3EP0 A;  4BUP A;  4J7F A;  3BO5 A;  3MEK A;  1ML9 A;  3RQ4 A;  4JLG A;  3S7J A;  5HI7 A;  3FPD A;  4Z4P A;  3KMT A;  3M53 A;  3F9W A;  1H3I A;  1N3J A;  4MI0 A;  4NJ5 A;  4IJD A;  4YNP A;  5JIN A;  3RU0 A;  4AU7 A;  3S7B A;  3TG5 A;  3MO0 A;  3QWW A;  5AYF A;  5F6L A;  1MVH A;  5T0K A;  5JHN A;  4QEO A;  3F9Y A;  3M55 A;  3PDN A;  5F5E A;  5CCL A;  1N6A A;  3M59 A;  3SW9 A;  4C1Q A;  3OXF A;  5CCM A;  3RJW A;  5F6K C;  3QWV A;  4JDS A;  5KJM A;  5TEG A;  1MUF A;  4RZ0 A;  2IGQ A;  4FMU A;  5TTF A;  5EX3 A;  5TH7 A;  3KMA A;  3F9Z A;  3CBO A;  3M58 A;  1MT6 A;  5JJ0 A;  3MO5 A;  3DAL A;  4I51 A;  4NVQ A;  3SWC A;  2R3A A;  3OOI A;  3M57 A;  4O6F A;  3S8P A;  4YPE A;  2G46 A;  2QPW A;  3M54 A;  3IHX A;  3TG4 A;  3M5A A;  5KJK A;  5ARG A;  5JIY A;  3VV0 A;  5LSX A;  5EG2 A;  3F9X A;  2W5Z A;  3MO2 A;  4H12 A;  2W5Y A;  3OXL A;  4J7I A;  5T5G A;  4WUY A;  5F59 A;  4IJ8 A;  3HNA A;  5EX0 A;  4YPU A;  5KJN A;  5ARF A;  3CBP A; 
#chains in the Genus database with same CATH homology
 3RIB A;  5HQ8 A;  2F69 A;  4YNM A;  3RAY A;  5CPR B;  5LSZ A;  2O8J A;  2RFI A;  2JV0 A;  3KMJ A;  3OXG A;  3VUZ A;  4LDG A;  4YND A;  4J83 A;  3QWP A;  1XQH A;  5T0M A;  4J8O A;  4MI5 A;  1ZKK A;  4QEP A;  3M56 A;  2BQZ A;  3OPE A;  5KJL A;  1MVX A;  1N6C A;  3N71 A;  3CBM A;  4YPA A;  3OS5 A;  1PEG A;  3S7D A;  3DB5 A;  4QEN A;  4E47 A;  4O30 A;  1O9S A;  3K5K A;  3S7F A;  3EP0 A;  4BUP A;  4J7F A;  3BO5 A;  3MEK A;  1ML9 A;  3RQ4 A;  4JLG A;  3S7J A;  5HI7 A;  3FPD A;  4Z4P A;  3KMT A;  3M53 A;  3F9W A;  1H3I A;  1N3J A;  4MI0 A;  4NJ5 A;  4IJD A;  4YNP A;  5JIN A;  3RU0 A;  4AU7 A;  3S7B A;  3TG5 A;  3MO0 A;  3QWW A;  5AYF A;  5F6L A;  1MVH A;  5T0K A;  5JHN A;  4QEO A;  3F9Y A;  3M55 A;  3PDN A;  5F5E A;  5CCL A;  1N6A A;  3M59 A;  3SW9 A;  4C1Q A;  3OXF A;  5CCM A;  3RJW A;  5F6K C;  3QWV A;  4JDS A;  5KJM A;  5TEG A;  1MUF A;  4RZ0 A;  2IGQ A;  4FMU A;  5TTF A;  5EX3 A;  5TH7 A;  3KMA A;  3F9Z A;  3CBO A;  3M58 A;  1MT6 A;  5JJ0 A;  3MO5 A;  3DAL A;  4I51 A;  4NVQ A;  3SWC A;  2R3A A;  3OOI A;  3M57 A;  4O6F A;  3S8P A;  4YPE A;  2G46 A;  2QPW A;  3M54 A;  3IHX A;  3TG4 A;  3M5A A;  5KJK A;  5ARG A;  5JIY A;  3VV0 A;  5LSX A;  5EG2 A;  3F9X A;  2W5Z A;  3MO2 A;  4H12 A;  2W5Y A;  3OXL A;  4J7I A;  5T5G A;  4WUY A;  5F59 A;  4IJ8 A;  3HNA A;  5EX0 A;  4YPU A;  5KJN A;  5ARF A;  3CBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...