2R3AA

Methyltransferase domain of human suppressor of variegation 3-9 homolog 2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
287
structure length
270
Chain Sequence
AEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVTFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGRVRTVCKCGAVTCRGYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SUV39H2
publication title Structural biology of human H3K9 methyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 270
sequence length 287
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2r3aA00
3M57A 3RAYA 3OXGA 4YNDA 1N6AA 3DALA 3M54A 4YNPA 2O8JA 4YNMA 5EX0A 2W5ZA 5F5EA 4LDGA 2IGQA 5CCLA 3SW9A 5TEGA 3EP0A 3OXLA 4IJ8A 4QENA 3F9ZA 2RFIA 4FMUA 4J83A 3CBPA 4YPEA 3M56A 1O9SA 1ML9A 3BO5A 3M58A 3M59A 4RZ0A 4MI5A 3N71A 2JV0A 3S7FA 5CPRB 3FPDA 4J7IA 4NVQA 3S7BA 3RIBA 3F9WA 5T0MA 1MT6A 3KMTA 3PDNA 4O30A 1MVXA 5F6LA 4QEOA 3RQ4A 5JIYA 2F69A 5JHNA 5T5GA 3S7DA 4JLGA 3MEKA 4WUYA 3K5KA 3OS5A 3OOIA 5EX3A 1XQHA 5LSZA 5F6KC 4IJDA 3F9XA 3MO2A 3QWPA 4BUPA 1MVHA 1ZKKA 3OPEA 5KJNA 5KJMA 2QPWA 3KMJA 1MUFA 3MO0A 3RJWA 3QWWA 4Z4PA 3F9YA 4J7FA 3MO5A 3VUZA 3IHXA 3QWVA 5EG2A 5TH7A 3SWCA 5JINA 3S8PA 5HI7A 4J8OA 3TG4A 4C1QA 4O6FA 4YPAA 5F59A 3DB5A 4JDSA 3RU0A 1N6CA 4AU7A 3TG5A 5LSXA 5KJKA 4H12A 5ARGA 3S7JA 2BQZA 3M55A 4E47A 3CBOA 5CCMA 4NJ5A 2G46A 5AYFA 3KMAA 5HQ8A 4I51A 3HNAA 3CBMA 1PEGA 4MI0A 4YPUA 5KJLA 3OXFA 2W5YA 2R3AA 5T0KA 3VV0A 3M5AA 1H3IA 1N3JA 5ARFA 5TTFA 4QEPA 5JJ0A 3M53A
chains in the Genus database with same CATH superfamily
3M57A 3RAYA 3OXGA 4YNDA 1N6AA 3DALA 3M54A 4YNPA 2O8JA 4YNMA 5EX0A 2W5ZA 5F5EA 4LDGA 2IGQA 5CCLA 3SW9A 5TEGA 3EP0A 3OXLA 4IJ8A 4QENA 3F9ZA 2RFIA 4FMUA 4J83A 3CBPA 4YPEA 3M56A 1O9SA 1ML9A 3BO5A 3M58A 3M59A 4RZ0A 4MI5A 3N71A 2JV0A 3S7FA 5CPRB 3FPDA 4J7IA 4NVQA 3S7BA 3RIBA 3F9WA 5T0MA 1MT6A 3KMTA 3PDNA 4O30A 1MVXA 5F6LA 4QEOA 3RQ4A 5JIYA 2F69A 5JHNA 5T5GA 3S7DA 4JLGA 3MEKA 4WUYA 3K5KA 3OS5A 3OOIA 5EX3A 1XQHA 5LSZA 5F6KC 4IJDA 3F9XA 3MO2A 3QWPA 4BUPA 1MVHA 1ZKKA 3OPEA 5KJNA 5KJMA 2QPWA 3KMJA 1MUFA 3MO0A 3RJWA 3QWWA 4Z4PA 3F9YA 4J7FA 3MO5A 3VUZA 3IHXA 3QWVA 5EG2A 5TH7A 3SWCA 5JINA 3S8PA 5HI7A 4J8OA 3TG4A 4C1QA 4O6FA 4YPAA 5F59A 3DB5A 4JDSA 3RU0A 1N6CA 4AU7A 3TG5A 5LSXA 5KJKA 4H12A 5ARGA 3S7JA 2BQZA 3M55A 4E47A 3CBOA 5CCMA 4NJ5A 2G46A 5AYFA 3KMAA 5HQ8A 4I51A 3HNAA 3CBMA 1PEGA 4MI0A 4YPUA 5KJLA 3OXFA 2W5YA 2R3AA 5T0KA 3VV0A 3M5AA 1H3IA 1N3JA 5ARFA 5TTFA 4QEPA 5JJ0A 3M53A
chains in the Genus database with same CATH topology
3M57A 3RAYA 3OXGA 4YNDA 1N6AA 3DALA 3M54A 4YNPA 2O8JA 4YNMA 5EX0A 2W5ZA 5F5EA 4LDGA 2IGQA 5CCLA 3SW9A 5TEGA 3EP0A 3OXLA 4IJ8A 4QENA 3F9ZA 2RFIA 4FMUA 4J83A 3CBPA 4YPEA 3M56A 1O9SA 1ML9A 3BO5A 3M58A 3M59A 4RZ0A 4MI5A 3N71A 2JV0A 3S7FA 5CPRB 3FPDA 4J7IA 4NVQA 3S7BA 3RIBA 3F9WA 5T0MA 1MT6A 3KMTA 3PDNA 4O30A 1MVXA 5F6LA 4QEOA 3RQ4A 5JIYA 2F69A 5JHNA 5T5GA 3S7DA 4JLGA 3MEKA 4WUYA 3K5KA 3OS5A 3OOIA 5EX3A 1XQHA 5LSZA 5F6KC 4IJDA 3F9XA 3MO2A 3QWPA 4BUPA 1MVHA 1ZKKA 3OPEA 5KJNA 5KJMA 2QPWA 3KMJA 1MUFA 3MO0A 3RJWA 3QWWA 4Z4PA 3F9YA 4J7FA 3MO5A 3VUZA 3IHXA 3QWVA 5EG2A 5TH7A 3SWCA 5JINA 3S8PA 5HI7A 4J8OA 3TG4A 4C1QA 4O6FA 4YPAA 5F59A 3DB5A 4JDSA 3RU0A 1N6CA 4AU7A 3TG5A 5LSXA 5KJKA 4H12A 5ARGA 3S7JA 2BQZA 3M55A 4E47A 3CBOA 5CCMA 4NJ5A 2G46A 5AYFA 3KMAA 5HQ8A 4I51A 3HNAA 3CBMA 1PEGA 4MI0A 4YPUA 5KJLA 3OXFA 2W5YA 2R3AA 5T0KA 3VV0A 3M5AA 1H3IA 1N3JA 5ARFA 5TTFA 4QEPA 5JJ0A 3M53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M57 A;  3RAY A;  3OXG A;  4YND A;  1N6A A;  3DAL A;  3M54 A;  4YNP A;  2O8J A;  4YNM A;  5EX0 A;  2W5Z A;  5F5E A;  4LDG A;  2IGQ A;  5CCL A;  3SW9 A;  5TEG A;  3EP0 A;  3OXL A;  4IJ8 A;  4QEN A;  3F9Z A;  2RFI A;  4FMU A;  4J83 A;  3CBP A;  4YPE A;  3M56 A;  1O9S A;  1ML9 A;  3BO5 A;  3M58 A;  3M59 A;  4RZ0 A;  4MI5 A;  3N71 A;  2JV0 A;  3S7F A;  5CPR B;  3FPD A;  4J7I A;  4NVQ A;  3S7B A;  3RIB A;  3F9W A;  5T0M A;  1MT6 A;  3KMT A;  3PDN A;  4O30 A;  1MVX A;  5F6L A;  4QEO A;  3RQ4 A;  5JIY A;  2F69 A;  5JHN A;  5T5G A;  3S7D A;  4JLG A;  3MEK A;  4WUY A;  3K5K A;  3OS5 A;  3OOI A;  5EX3 A;  1XQH A;  5LSZ A;  5F6K C;  4IJD A;  3F9X A;  3MO2 A;  3QWP A;  4BUP A;  1MVH A;  1ZKK A;  3OPE A;  5KJN A;  5KJM A;  2QPW A;  3KMJ A;  1MUF A;  3MO0 A;  3RJW A;  3QWW A;  4Z4P A;  3F9Y A;  4J7F A;  3MO5 A;  3VUZ A;  3IHX A;  3QWV A;  5EG2 A;  5TH7 A;  3SWC A;  5JIN A;  3S8P A;  5HI7 A;  4J8O A;  3TG4 A;  4C1Q A;  4O6F A;  4YPA A;  5F59 A;  3DB5 A;  4JDS A;  3RU0 A;  1N6C A;  4AU7 A;  3TG5 A;  5LSX A;  5KJK A;  4H12 A;  5ARG A;  3S7J A;  2BQZ A;  3M55 A;  4E47 A;  3CBO A;  5CCM A;  4NJ5 A;  2G46 A;  5AYF A;  3KMA A;  5HQ8 A;  4I51 A;  3HNA A;  3CBM A;  1PEG A;  4MI0 A;  4YPU A;  5KJL A;  3OXF A;  2W5Y A;  2R3A A;  5T0K A;  3VV0 A;  3M5A A;  1H3I A;  1N3J A;  5ARF A;  5TTF A;  4QEP A;  5JJ0 A;  3M53 A; 
#chains in the Genus database with same CATH topology
 3M57 A;  3RAY A;  3OXG A;  4YND A;  1N6A A;  3DAL A;  3M54 A;  4YNP A;  2O8J A;  4YNM A;  5EX0 A;  2W5Z A;  5F5E A;  4LDG A;  2IGQ A;  5CCL A;  3SW9 A;  5TEG A;  3EP0 A;  3OXL A;  4IJ8 A;  4QEN A;  3F9Z A;  2RFI A;  4FMU A;  4J83 A;  3CBP A;  4YPE A;  3M56 A;  1O9S A;  1ML9 A;  3BO5 A;  3M58 A;  3M59 A;  4RZ0 A;  4MI5 A;  3N71 A;  2JV0 A;  3S7F A;  5CPR B;  3FPD A;  4J7I A;  4NVQ A;  3S7B A;  3RIB A;  3F9W A;  5T0M A;  1MT6 A;  3KMT A;  3PDN A;  4O30 A;  1MVX A;  5F6L A;  4QEO A;  3RQ4 A;  5JIY A;  2F69 A;  5JHN A;  5T5G A;  3S7D A;  4JLG A;  3MEK A;  4WUY A;  3K5K A;  3OS5 A;  3OOI A;  5EX3 A;  1XQH A;  5LSZ A;  5F6K C;  4IJD A;  3F9X A;  3MO2 A;  3QWP A;  4BUP A;  1MVH A;  1ZKK A;  3OPE A;  5KJN A;  5KJM A;  2QPW A;  3KMJ A;  1MUF A;  3MO0 A;  3RJW A;  3QWW A;  4Z4P A;  3F9Y A;  4J7F A;  3MO5 A;  3VUZ A;  3IHX A;  3QWV A;  5EG2 A;  5TH7 A;  3SWC A;  5JIN A;  3S8P A;  5HI7 A;  4J8O A;  3TG4 A;  4C1Q A;  4O6F A;  4YPA A;  5F59 A;  3DB5 A;  4JDS A;  3RU0 A;  1N6C A;  4AU7 A;  3TG5 A;  5LSX A;  5KJK A;  4H12 A;  5ARG A;  3S7J A;  2BQZ A;  3M55 A;  4E47 A;  3CBO A;  5CCM A;  4NJ5 A;  2G46 A;  5AYF A;  3KMA A;  5HQ8 A;  4I51 A;  3HNA A;  3CBM A;  1PEG A;  4MI0 A;  4YPU A;  5KJL A;  3OXF A;  2W5Y A;  2R3A A;  5T0K A;  3VV0 A;  3M5A A;  1H3I A;  1N3J A;  5ARF A;  5TTF A;  4QEP A;  5JJ0 A;  3M53 A; 
#chains in the Genus database with same CATH homology
 3M57 A;  3RAY A;  3OXG A;  4YND A;  1N6A A;  3DAL A;  3M54 A;  4YNP A;  2O8J A;  4YNM A;  5EX0 A;  2W5Z A;  5F5E A;  4LDG A;  2IGQ A;  5CCL A;  3SW9 A;  5TEG A;  3EP0 A;  3OXL A;  4IJ8 A;  4QEN A;  3F9Z A;  2RFI A;  4FMU A;  4J83 A;  3CBP A;  4YPE A;  3M56 A;  1O9S A;  1ML9 A;  3BO5 A;  3M58 A;  3M59 A;  4RZ0 A;  4MI5 A;  3N71 A;  2JV0 A;  3S7F A;  5CPR B;  3FPD A;  4J7I A;  4NVQ A;  3S7B A;  3RIB A;  3F9W A;  5T0M A;  1MT6 A;  3KMT A;  3PDN A;  4O30 A;  1MVX A;  5F6L A;  4QEO A;  3RQ4 A;  5JIY A;  2F69 A;  5JHN A;  5T5G A;  3S7D A;  4JLG A;  3MEK A;  4WUY A;  3K5K A;  3OS5 A;  3OOI A;  5EX3 A;  1XQH A;  5LSZ A;  5F6K C;  4IJD A;  3F9X A;  3MO2 A;  3QWP A;  4BUP A;  1MVH A;  1ZKK A;  3OPE A;  5KJN A;  5KJM A;  2QPW A;  3KMJ A;  1MUF A;  3MO0 A;  3RJW A;  3QWW A;  4Z4P A;  3F9Y A;  4J7F A;  3MO5 A;  3VUZ A;  3IHX A;  3QWV A;  5EG2 A;  5TH7 A;  3SWC A;  5JIN A;  3S8P A;  5HI7 A;  4J8O A;  3TG4 A;  4C1Q A;  4O6F A;  4YPA A;  5F59 A;  3DB5 A;  4JDS A;  3RU0 A;  1N6C A;  4AU7 A;  3TG5 A;  5LSX A;  5KJK A;  4H12 A;  5ARG A;  3S7J A;  2BQZ A;  3M55 A;  4E47 A;  3CBO A;  5CCM A;  4NJ5 A;  2G46 A;  5AYF A;  3KMA A;  5HQ8 A;  4I51 A;  3HNA A;  3CBM A;  1PEG A;  4MI0 A;  4YPU A;  5KJL A;  3OXF A;  2W5Y A;  2R3A A;  5T0K A;  3VV0 A;  3M5A A;  1H3I A;  1N3J A;  5ARF A;  5TTF A;  4QEP A;  5JJ0 A;  3M53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...