5KJKA

Smyd2 in complex with az370
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
b'GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjkA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjkA01
1HZ4A 5ARFA 4FMUA 4W9RA 4H7YA 3OPEA 3CK9A 2VSYA 3MKRA 3PE4A 4G25A 1MUFA 5TEGA 4Y6CA 3CBMA 3GZ1A 3AS4A 3OXGA 3CV0A 1NZNA 3MV2B 2O8JA 4YNDA 5F6LA 1O9SA 2KCLA 4MI5A 4Z4PA 2R5SA 2V5FA 2NC9A 5F59A 4G23A 3LPZA 1HH8A 5F5EA 4CGWA 4HORA 5EX0A 3GW4A 4I9EA 1ML9A 4RZ0A 3AS8A 4WNDA 3KMJA 4JL0A 1W3BA 4HOQA 3K5KA 3M56A 2DBAA 2XGOA 3S8PA 5EG2A 3M57A 3LKUA 5JIYA 4BT9A 3F9YA 5FT9A 4YPAA 5KJKA 3S7DA 4YNPA 4BTBA 4KXKB 2JLBA 3FWVA 3RJWA 2G46A 4BUPA 2XGMA 5EKQD 3FPDA 4BT8A 3FFLA 4NRHB 4QENA 3R9AB 3MEKA 5A7DB 3AS5A 4GYYA 1WM5A 1NA0A 2KCKA 1PC2A 3EDTB 5JHNA 2LNIA 2VGXB 2J9QA 2XCCA 5CPRB 4GA0A 4RG9A 1Y8MA 4I9CA 4NVQA 5G04C 4CDRA 3CVLA 4IJ8A 2PZIA 5KJNA 1WAO1 5LSXA 2C2LA 3SF4A 3QDNA 1MVHA 2I6HA 2L6JA 4MI0A 3CBOA 5FJYA 4QEOA 4U0SA 3TGOA 2HO1A 4LEUA 3O48A 5CCLA 3VTYA 2BQZA 4AY5A 3K9IA 4AY6A 4JDSA 3NF1A 1QQEA 2FI7A 3Q15A 4N39A 4U0UA 4N3BA 2Q7FA 1H3IA 3CBPA 5DIZA 1QZ2A 1YA0A 1ELRA 2FBNA 3Q4AB 4J8FA 4WNFA 3TG4A 2WPVA 5G04J 3ESKA 3RJVA 5FZSA 2C0LA 5LSZA 1KLXA 4H12A 1A17A 3RKVA 4H7XA 1IHGA 4I2WA 4HOUA 5KJMA 2R3AA 3MV3B 1N6CA 3VUZA 3JYSA 4WNEA 3DB5A 3MO5A 3M53A 4G24A 4JLGA 4BTAA 3LYAA 2W5YA 5AYWD 5TH7A 4N2QA 5M72A 4AU7A 2P58C 4UI9C 4GPKA 3ASDA 5FTPA 2XPIA 4J8EA 3IHXA 3DALA 2UWJG 4GCNA 5AYFA 2VGXA 4J0UA 1ZKKA 5C1DA 4YPEA 4GA1A 3BEEA 2AVPA 5D0QD 3CVQA 3M5AA 4XI9A 2GW1A 5G05C 5LCWC 3ZHEB 4NJ5A 3ZFWA 2PL2A 4UQZA 2F69A 4UI9J 3BO5A 1IYGA 3RQ4A 4UQXA 4J83A 3OOIA 5EX3A 4C1QA 5TTFA 3SWCA 1ELWA 2YQ8A 3IEGA 4J8DA 3RAYA 4Y6WA 3RU0A 4A1SA 5T0MA 2VSNA 1E96B 2IF4A 5JJ7A 3S7FA 5KJLA 4GZ5A 4YNMA 5JJTA 2HR2A 5G05J 5LCWJ 5F6KC 4QEPA 2C0MA 2PQNA 3Q49B 5T5GA 3KMTA 5CHEE 3OS5A 3VV0A 1KT0A 4IN3B 3CVNA 3OXLA 3RO2A 4I51A 2ONDA 2XCBA 2Y4UA 4GCOA 4O30A 4WNGA 3MO2A 1MT6A 4G26A 3ZPJA 3ZN3A 5FZQA 2FF4A 4F3VA 1N3JA 3RO3A 3GZ2A 4HOSA 4G1TA 4YVOA 3N71A 4J8OA 3F9WA 2XGSA 1TJCA 3Q5MA 3LY9A 3S7JA 3URZA 3HYMB 2QFCA 5HI7A 3F9XA 3VTXA 4GZ6A 4WUYA 2UY1B 3KS2A 3ZHEA 4IJDA 3LY7A 4ABNA 4AM9A 3LCAA 4J7IA 4KYOB 3HNAA 4U04A 3KMAA 3M58A 2VQ2A 5BNWA 4I2ZA 1HXIA 4EQFA 3EP0A 4RG6A 3KD7A 5CCMA 3U3WA 4UQYA 5ARGA 2JV0A 3LY8A 5FZRA 2Y4TA 1XQHA 4JA9A 4GZ3A 3UPVA 4XI0A 3M54A 3OXFA 4E47A 1B89A 3TAXA 4NQ0A 3M59A 3M55A 2KATA 2IGQA 1P5QA 4LDGA 4ME2A 2PQRA 3E4BA 4XIFA 3CKBA 4JHRA 1PEGA 3SZ7A 3PDNA 5JINA 1ZU2A 2KC7A 4N3AA 4AIFA 4B94A 3S7BA 3KAEA 3RIBA 1N6AA 2MHKA 3QWWA 3ASGA 4UI9K 3MO0A 4APOA 1OUVA 5T0KA 3U4TA 2HYZA 1KT1A 3CEQA 1ZBPA 3PE3A 3CKCA 4I17A 4O6FA 3QKYA 3ASHA 2RFIA 2KCVA 2FEZA 4BWRA 3CK8A 4GYWA 2IFUA 2W5ZA 3UQ3A 3UUXA 4HOTA 2YHCA 5DBKA 1NA3A 3QOUA 4CGVA 2OOEA 2UY1A 3SW9A 3CVPA 3GYZA 5BW8C 4KBQA 3QWPA 2BUGA 4N3CA 4I1AA 3TG5A 5A6CA 1FCHA 1MVXA 2LSUA 5JJ6A 4YPUA 2LSVA 3ASFA 3MA5A 5BT1A 4N5CA 2E2EA 2FO7A 4GYOA 2QPWA 3FP3A 5JJ0A 3ULQA 4J7FA 4U07A 2VYIA 5D0OD 3QWVA 3ZGQA 3F9ZA 3Q47B 2XEVA 4GA2A 4JA7A 4YVQC 5HQ8A 3CK7A 4G2VA 1XNFA 4N2SA 2VGYA 3WXXA 2WQHA 4U0ZA
chains in the Genus database with same CATH superfamily
2FULA 3OPEA 3MKRA 2VSYA 2EILE 3DSTA 1H6OA 4C9BB 3OXGA 3CV0A 1LF8A 2X38A 2HE0A 4DK5A 4I1OB 2LXLA 2R02A 4MI5A 3G2VA 3PEUB 5KNHD 1JCSA 3ZXSA 5F5EA 1TEZA 1KZPA 1NL4A 3GW4A 1ML9A 4RQIA 4WNDA 3KMJA 2OEVA 3KSLA 4JL0A 3V30A 5CBOA 5T3RA 4IRUA 1EF1C 1E8WA 3M57A 4N5QA 1H2VC 4KZ0A 3S7DA 4UWKA 3SFYA 2MYOA 4BTBA 5ANLA 3P1UA 4BT8A 3AG4E 4U96D 2R59A 2HM8A 1NA0A 3PRZA 3FY4A 2J9QA 3U64A 4U8VD 2DIWA 1MQSA 4IJ8A 3CHQA 3SI5A 2DZNA 3UT8A 3PZ3A 1BI7B 2BEDA 3QDNA 2L6JA 3CBOA 4JW1A 4A3VA 3APDA 2I9CA 4LG6A 5FQ7A 4O1OA 1WY6A 1K8KG 4HI8A 5BV0A 4L9PA 4K5BA 5KCMA 3K9IA 4EZLA 5CRUA 2CFZA 1BU9A 3CBPA 5DIZA 3VLFA 4WNFA 3B7SA 3DPYA 3D9OA 2BKGA 1KLXA 1D8DA 3PNTB 2WMNA 3SO8A 2R3AA 3PZ4A 4BFRA 3B13A 3JUIA 4G24A 4JLGA 3CIAA 4TUUA 3MCXA 2W5YA 3TWQA 4YDYA 1TNZA 3FTSA 3RSEG 1DC2A 3ZYLA 5BXOA 4AU7A 4GPKA 1O1TA 4BESA 3HVEB 4Q94A 5D2MC 5AYFA 2PM6A 1ZKKA 3UKUG 3SNXA 4KMOA 4YPEA 4PUCA 4GA1A 3FU6A 1RZ4A 4PH4B 3D9LA 3I3NA 3RRNB 5B3SE 4J8YA 2X6JA 1K1BA 3ESLA 4WWOA 2OVFA 4IYPA 1N4QA 3AU4A 3BO5A 3UM3A 3Q73A 5AAOA 3EU5A 1SZAA 3CHMA 3RAUA 4URKA 5EX3A 2V8SE 1ELWA 3E37A 4EBAA 3RU0A 2QC9A 5T0MA 5JJ7A 3L17A 4LERA 5D66A 5LCWJ 2C0MA 2PQNA 4BSXA 3KMTA 5CHEE 4EPZA 3NQPA 2XS8A 4ACLA 4A3TA 4WAFA 3MYVA 1Z3XA 3UTMA 3S2AA 3HRAA 4L2YA 5FZQA 3NBNB 3ABLE 2FF4A 3HVEA 4JC8A 2Y0BG 4F3VA 2P9SG 4HOSA 5E75A 1BI8B 3F9WA 4LUNU 2XENA 1TJCA 2X6KA 4A63B 2AJAA 3VTXA 4C0EA 4XZ4A 1S0PA 3LY7A 2XPZA 4AV7A 3W9GA 3HNAA 2GRPB 3KMAA 4AP2A 4OAVB 3OTNA 1HXIA 4EQFA 4NIKA 3EP0A 5CCMA 3D9KA 5ENSD 4M7CA 3SFZA 3MX3A 4GU5A 1B89A 3TAXA 5ENRD 3IBEA 2LAHA 2A4ZA 3UI2A 2EIME 3T5VA 4ME2A 4DX5D 3U66A 2MOWA 2PQRA 3LVRE 4PDXA 3E4BA 1D9SA 3CKBA 3QNKA 4G11A 4ANVA 1YCSB 5T0KA 4ILHB 3TWRA 3CEQA 1FVFA 3DRAA 1MX2A 3PE3A 4ILIA 3PREA 3ASHA 2RFIA 2KCVA 5ENNA 4BWRA 4HOTA 2YHCA 4DLQA 3PEVB 4PS7A 2XZTG 2H6GA 1N54A 3FUHA 4JEUA 3ZYKA 1N4SA 3L08A 3GYZA 4F7AA 1MYOA 4KBQA 3QWPA 4N3CA 3G2SA 4I1AA 5A6CA 4TXRA 3ZXPA 4EHMA 3V31A 5BT1A 4N5CA 2J4DA 3D9JA 4GYOA 4EZKA 1YMPA 2YHEA 3HXBA 3AG3E 2WM9A 3NZUA 4CEMA 3G2UA 4U07A 3R9MA 2VYIA 2H6HA 3QWVA 3ZGQA 3HXEA 2RFMA 3Q47B 4GA2A 4AVXA 4CDNA 5EIBE 1H2UA 1DCEA 3MKQA 3CVXA 3WXXA 2WQHA 5H7PA 4DI3A 1HZ4A 5ARFA 1HX8A 2IO3C 2J08A 1TR4A 3ZU7B 3PE4A 3NOGD 4PS8A 4JD2G 5G55A 3ENEA 3CBMA 3GZ1A 3ABKE 1QBQA 3AS4A 3CGHA 3BQOA 2X6HA 4YNDA 1O9SA 2KCLA 1JPLA 2R5SA 2NC9A 4FC8A 3UXGA 4G23A 3LPZA 2AXVA 3APCA 3BG1B 4HORA 4I9EA 4BETA 4RZ0A 4F53A 4TV3A 1FVHA 5BV1A 2MRIA 3K5KA 4B89A 2FO1E 2X3MA 4JPSA 3S8PA 3LKUA 3EIQC 1X5BA 5AQBA 3UM1A 4YNPA 3EHRA 1MX4A 4KVOA 1YYHA 2G46A 4BUPA 2XGMA 1N4PA 4DJAA 4XKBA 3Q7FA 1PY1A 5KNGA 4QENA 3AS5A 3FH5A 3HXDA 3BU8A 1PC2A 3EDTB 2LNIA 1QNFA 2VGXB 1FT2A 5AIJA 4RG9A 3EU9A 3Q75A 4LNBA 1HO8A 1DCQA 4ANWA 5KJNA 1WAO1 5LSXA 2C2LA 3SF4A 4HBDA 1MVHA 3SGHA 1K1AA 5AENA 1BD8A 4XKCA 4MI0A 5FJYA 1JCQA 4QEOA 1V54E 3TGOA 3L22A 4B93B 4AY5A 2DYRE 4GMLA 2CG3A 3NF1A 4HRLA 3O4ZA 1TNOA 2FI7A 4U0UA 3FUMA 3TL5A 3E32A 1H3IA 4CYMD 5G04J 1Z3YA 3V79K 5EDSA 4GMJA 3X2QE 2DWZA 4H12A 2GRRB 1Z5SC 3LEWA 3T8MA 4I6GA 2OCCE 4HFGA 5ITZF 2WXFA 1TN6A 2LXMA 3ASNE 4I6EA 3QK0A 2XPYA 1OCOE 5EYPF 2VJ8A 5T8IA 1EDUA 3E30A 4UI9C 3ASDA 5FTPA 4DX2A 2UWJG 4MBGA 1PAQA 1IQRA 4GZCA 2VGXA 2GROB 4J0UA 3AAAC 1SA5A 3DSWA 2WXQA 4DX6D 5CBNA 3BEEA 2A5UA 3OAWA 4QFVA 1OT8A 5G05C 2X6IA 3ZHEB 2PL2A 3QC1A 2WXIA 4BERA 5HS0A 3CHPA 3D9NA 2P9PG 5JHBA 3C3QA 4YDWA 3OOIA 3JQ1A 2QY7A 5KBAA 4I1MA 5JMND 3V2OA 3WG7E 1HU3A 4A1SA 5FINA 3PH0C 1E96B 2IF4A 3CQCB 5KJLA 3R7RA 3I4GA 2RKKA 5FQ4A 3SQVA 1UN8A 2HR2A 4QEPA 2I1KA 1IXVA 2AXUA 3VV0A 3CVNA 1S63A 2PM7A 3RO2A 3PUKA 4UWFA 2B0OE 3PVLA 2AW6A 3ZPJA 3ZN3A 3B7BA 4JVSA 5LP0A 4MS6A 5LX8A 4XX5A 3MGBA 5ANRA 1N0QA 4FHJA 4YVOA 1WG0A 3N71A 4GTVA 4J8OA 4A55A 3I4RB 4JHKA 3Q5MA 3LY9A 4EBAG 3HYMB 5ENTD 1ZB1A 3EHQA 4WUYA 1N94A 3ZHEA 3EJNA 1OWMA 4CT0A 4AM9A 3LCAA 2WXOA 1NP7A 4LNGA 4I2ZA 2QYJA 4O60A 1OWNA 3FUJA 3U3WA 4U7EB 5ARGA 1OWLA 1E7UA 3LY8A 2Y4TA 3OXFA 2WXPA 3Q78A 3ZRHA 4K5CA 2KATA 2VSOE 2IGQA 5JHAA 3QARA 2RG8A 2IOSA 3DXMG 4JHRA 3GZSA 3QB2A 5JINA 1ZU2A 4ACKA 4N3AA 3ML9A 5JA4D 2ETBA 4U8HA 1DVPA 3MO0A 4OVVA 3UKRG 2J4BA 2X6FA 2Y1LE 4FJYA 5FWQA 3F6QA 3U4TA 2VGEA 3UIOC 5B1BE 1QYMA 3HDXA 4I17A 1BPOA 2P2CP 1NI1A 4HRMB 4FU3A 2W5ZA 4DLOA 3UQ3A 2EQXA 2P9NG 2QZAA 3I5PA 2XS1A 3EHMA 3QOUA 4HLLA 4DX7D 2GGFA 3TXMA 4CRWA 5CEDB 4KVMA 3ASFA 3J5PA 3MA5A 2E2EA 2FO7A 4PS3A 1E8YA 3ZVVA 2OEWA 2IU1A 2Y69E 2ETAA 4J7FA 3CSTA 2WXKA 1TJFA 3D9PA 1K3ZD 2XEVA 1N0RA 1INZA 3PZ2A 4MKTA 2H6IA 4UUCA 2J07A 3PZ1A 2EINE 4G2VA 4CCAA 3C98A 4LRZA 3LJNA 2CHWA 1EYHA 4W9RA 2NSZA 4GTMA 3CK9A 4G25A 3QAQA 1ELKA 2RD0A 4FLBA 1E90A 4J7WA 4Y6CA 3R7QA 2ZXWE 5AQ7A 3L16A 4JB8P 1NZNA 3TWWA 2O8JA 1H0AA 5CECB 4CZ2D 4GTOA 2R03A 4XEIG 4DUIA 1HH8A 4LNUD 1N95A 2GRNB 3FTXA 3KEAA 4CGWA 3C5RA 2F37A 3IXEA 1N9AA 3AS8A 3B95A 2CFUA 1W3BA 1UJJA 4M3OA 2XGOA 4JHJA 2IO2C 3NAWA 4LSZE 3C72A 2EIKE 5JIYA 3CVUA 4BT9A 3TXNA 4EECA 2XQ0A 4KXKB 2JLBA 3E34A 3U9WA 1LTXA 2IOLA 5EKQD 3FPDA 1OCRE 3FFLA 3MJWA 4GTRA 3MEKA 3FDHA 1FPPA 3HIZA 4R7LA 1S64A 2KCKA 1TNYA 5JHNA 2IONA 2WXMA 3FTZA 4GA0A 2JEKA 4CDRA 5IY5E 2LAIA 3T5XA 1U3DA 1HF8A 4I43A 1HG5A 2I6HA 3ABME 5BPPA 2ZGGA 3G2WA 4U0SA 4LEUA 3O48A 4OYSA 5CCLA 3VTYA 5G2NA 1OCCE 2V5QC 2IQCA 4GB9A 1OWOA 3Q15A 5CERB 1V55E 1QZ2A 1YA0A 2FBNA 1HE8A 2WPVA 3RJVA 2C0LA 3DSSA 4FHKA 4H7XA 1IHGA 4HQDA 4FA6A 5KJMA 3MV3B 3VUZA 3DB5A 4GTPA 3BG0B 3TWSA 4NACA 3M53A 4LCTA 3LYAA 3EHNA 5TH7A 2WMOA 4N2QA 3FH8A 3DALA 4GCNA 4D10C 2WB2A 3CQGB 2YNQA 4A1GA 3EUVA 1JCRA 5C1DA 1GW6A 3Q9UC 3SHFA 5EILA 4AEZC 3ZW3A 3DBSA 4BSZB 2J8SD 2AVPA 3Q7AA 3ZUVB 3M5AA 3BUAA 1LD8A 2ETCA 4TXPA 5LCWC 4NJ5A 1Q2ZA 4U8YD 2L6BA 2DYSE 3DSUA 4FLHA 3HHMA 1OWPA 1O1RA 1IYGA 3RQ4A 4MLPA 4HLEA 4C48B 4UWHA 2BKKB 4C1QA 5TTFA 3ZIMA 4EZJA 1H19A 2YQ8A 3L6AA 2LUHA 4Y6WA 3ULEG 1TNBA 4GTSA 3S7FA 4YNMA 5EYLA 4GZDA 3FU3A 5JJTA 3JQ0A 3TWTA 1DNPA 3FEXA 3ZKJA 1Z6TA 3Q49B 2IY0C 1KT0A 4IN3B 4F1PA 3KEZA 2XCBA 1SW6A 4GCOA 4O30A 4WNGA 2A5EA 4CT4A 3D9MA 4F1SA 5AARA 3DEOA 1N3JA 3GZ2A 3FTUA 3NZSA 1N11A 1SQMA 4HB5A 4TRQA 2BF0X 4GMRA 4P29A 3MZLB 2XGSA 1MHQA 5CEAA 3SD5A 3C3RA 3URZA 4HI9A 1E8XA 2QFCA 3IHVA 1G3NB 5HI7A 1BLXB 3IHYA 3CHSA 4ILGA 2P9UG 2CHXA 4XE0A 2KM4A 3M58A 5BNWA 1OXJA 5FIOA 3KD7A 1UN9A 3ONLA 1UJKA 2IJGX 1XQHA 4GZ3A 3UPVA 4XI0A 1TN7A 3AU5A 4ATGA 4DX1A 2KXPC 2WQ7A 5ENOD 4FP7A 2WXLA 4AOFA 3FHEA 3VLDA 2V4HC 3HXCA 1PEGA 4KT6B 1H2TC 2F0YA 4AIFA 2AWIA 4FULA 2ZU6B 3DEPA 3KAEA 2MHKA 3QWWA 2E0IA 2XRZA 1ZBPA 5T4YA 2KZTB 4U63A 4MRUA 3DWLG 1KPSB 1OY3D 2RFAA 5AJDA 2M63A 2VTBB 2CG2A 3D9IA 4BY6A 3UUXA 2EIJE 4HNAD 4UWGA 4GTTA 2NYJA 4CGVA 1RW2A 5AJLA 3FUFA 3PNLB 4RLYA 3T8KA 2BUGA 2J49A 1O1SA 3TG5A 1MVXA 3IKOB 3NB2A 2XHEA 2JABA 2QPWA 4QQIA 4DRXE 5JJ0A 5BUZA 4ANXA 3Q79A 4AXHA 3NOCD 1VDYA 3F9ZA 3PUJA 5EN5D 4C0MA 4JA7A 4YVQC 2DZOA 4BEPA 5HQ8A 2DVWA 4WWNA 1MX6A 1XNFA 4N2SA 2VGYA 4K5AB 3B7UX 3UT4A 4U0ZA 3IV0A 4FMUA 4H7YA 3FUIA 3JXIA 3HG0D 2IEJA 2NXPA 1MUFA 5HRYA 5TEGA 2L0TB 1LD7A 2KZTA 1MZCA 5J08A 3E33A 1UG3A 3ISMC 2VTBA 1TYQG 2L0IA 3MV2B 5CRVA 5F6LA 3AG2E 4Z4PA 2V5FA 2WXGA 5F59A 1TNUA 4TXQA 3UMVA 1UW4B 4F6RD 2VSXE 5E76A 5A23A 5EX0A 3APFA 1IHBA 3SY2A 3FULA 1UOHA 4HOQA 3CSFA 3M56A 4E85A 3RRMB 3JUEA 2DBAA 3DSVA 5EG2A 5HKPA 4K0RA 3F9YA 5FT9A 4YPAA 5AQ9A 5KJKA 3FUNA 2YINA 3LJ3A 3CLJA 3FWVA 4ZHBA 3RJWA 1WDYA 1L5JA 3FTYA 3ONKA 4NRHB 3CVVA 1A5EA 3R9AB 5A7DB 4HXIA 4GYYA 4HS2A 1WM5A 4ZFHA 1SVXA 3DPDA 2P9LG 3UIPC 2XCCA 5CPRB 3CVYA 1Y8MA 4I9CA 4NVQA 5G04C 3J5QB 1XGWA 2WXRA 3CVLA 2PZIA 3EIJA 1FT1A 3L82A 3C3OA 3KSQA 1HS6A 3FU5A 4GTQA 4KZCA 2LO6A 3UM0A 2HO1A 3W9FA 4G8KA 2BQZA 4AY6A 3L54A 5EIDA 1OCZE 3QJZA 4JDSA 1QQEA 1MJ0A 4N39A 4N3BA 2Q7FA 3Q4AB 1ELRA 4J8FA 3TG4A 3ESKA 5FZSA 2I2OA 1D8EA 2BTDA 5LSZA 1AWCB 1A17A 3RKVA 4X8QA 2CHZA 2ZISA 4I2WA 2F8XK 3P2BA 4HOUA 1EPUA 1N6CA 3JCKC 1NFIE 3JYSA 4WNEA 3MO5A 3UM2A 1E8ZA 1H6PA 4YDOA 1H6KA 4BTAA 2P9IG 5AYWD 4B8AA 3FUKA 5M72A 3ZNGA 1N52A 2V4LA 2P58C 3ASOE 3SBSA 2ZGDA 2XPIA 4J8EA 3HXFA 3IHXA 2V0PA 3RRUA 4TUMA 4WWPA 2R05A 2R17C 3UX4A 3SBTB 1U3CA 3L9TA 4L1BA 3VLEA 3FUEA 5D0QD 1JWFA 4L23A 3CVQA 2QYUA 3MKQB 4XI9A 3LXUX 2GW1A 3ZFWA 4UQZA 5ENPD 2F69A 2DCPA 3TWVA 4UI9J 4E6HA 5ENQD 3AG1E 5LFAA 4UQXA 4J83A 3FU0A 5AQAA 5B1AE 1O5MA 3SWCA 4V3IA 3IEGA 3PS6A 4J8DA 3RAYA 5FQ8A 1SZ9A 3JXJA 1X81A 3CVWA 1Y6IA 2VSNA 3T9KA 3DSXA 4GZ5A 1HG2A 4L7TA 4AJWA 4YDEA 4IULA 3L13A 4RSYA 2ILRA 4CDMA 5G05J 5F6KC 2I1JA 2XEHA 5T5GA 3OS5A 3B7RL 3AJIA 5FQ6A 3OXLA 4I51A 2J09A 2ONDA 4APFA 2Y4UA 4K03A 3ZYQA 3MO2A 5KWDA 1MT6A 3PZDA 3FTWA 4G26A 4ANUA 3UT7A 2OVBA 4B0ZA 3RO3A 4O1PA 4BX8A 2XZDG 4G1TA 4JEHA 2F8YA 2XEEA 4FJZA 3V2XA 2XRYA 2WVIA 3S7JA 3CR3A 1JUQA 3DXKG 3F9XA 4GZ6A 4G8LA 2UY1B 3KS2A 4IJDA 1E7VA 4HRNA 4ABNA 4J7IA 4KYOB 4U04A 4BX9A 4I6JA 2GRLA 2VQ2A 3TWUA 4DI4A 2WXJA 2H6FA 1KZOA 4RG6A 4UQYA 2P9KG 5J90A 3FH7A 2JV0A 1SA4A 5FZRA 2WQ6A 5AN8A 3FEYA 4JA9A 2R2LA 3M54A 4E47A 2KBXA 3ZYMA 4FADA 4Q96A 4NQ0A 3G2TA 3M59A 3M55A 1P5QA 2Y3AA 4LDGA 1JWGA 4U95D 3ZEFA 4HVBA 4OAUC 4XIFA 3D9HA 4JXTA 4J6IA 2PNNA 5LOZA 3SZ7A 4Z68A 3PDNA 1U2VG 2KC7A 4B94A 1HFAA 2WXNA 3S7BA 3RIBA 5CMWA 1N6AA 3ASGA 4UI9K 4APOA 4JZYA 1OUVA 2HYZA 1KT1A 5C2YA 2B6CA 4B8CB 3CKCA 3SFXA 4O6FA 3QKYA 5CMYA 2FEZA 1N4RA 3CK8A 3CHOA 4GYWA 4GAAA 2IFUA 4GPMA 1IQUA 1AP7A 3FUDA 3LVQE 1IKND 5DBKA 4UWLA 1S70B 3ULYA 1NA3A 4RVBA 3ML8A 4Q69A 3LDZA 5BXUA 2OOEA 2UY1A 3SW9A 2GRMA 3CVPA 5BW8C 3B7TA 2L9BA 2AXZA 1FCHA 2LSUA 5JJ6A 4YPUA 2LSVA 3RK6A 2GRQB 3UINC 3CHRA 1TN8A 3FP3A 3ULQA 3TJPA 4ATZD 5D0OD 2ZIRA 3LS8A 4OVUA 4DPRA 3TWXA 3Q9NC 3CK7A 2WXHA 3D3MA 2OV8A 4J8SA 4NURA 3FTVA 4L2LA
chains in the Genus database with same CATH topology
1HZ4A 5ARFA 1HX8A 4FMUA 2J08A 4W9RA 4H7YA 2NSZA 2FULA 3OPEA 3CK9A 2VSYA 3MKRA 3FUIA 3M57A 3PE4A 4G25A 3QAQA 1ELKA 2NXPA 4PS8A 1MUFA 2RD0A 4FLBA 5TEGA 1E90A 4Y6CA 3R7QA 2L0TB 5G55A 3ENEA 2KZTA 3CBMA 3GZ1A 5J08A 3L16A 3AS4A 1UG3A 3OXGA 3CGHA 4C9BB 3CV0A 2VTBA 1LF8A 2X38A 2L0IA 1NZNA 2X6HA 3MV2B 4DK5A 4YNDA 4I1OB 2O8JA 1H0AA 5F6LA 1O9SA 2KCLA 4MI5A 3G2VA 1JPLA 4Z4PA 2R5SA 2V5FA 3PEUB 2WXGA 2NC9A 4FC8A 5F59A 4G23A 3LPZA 1HH8A 2AXVA 3UMVA 1UW4B 3APCA 3ZXSA 3BG1B 3FTXA 2VSXE 5E76A 5F5EA 5A23A 4CGWA 1TEZA 4HORA 5EX0A 3APFA 3GW4A 4I9EA 1ML9A 4RZ0A 3FULA 3AS8A 4F53A 4WNDA 4TV3A 3KMJA 2CFUA 4JL0A 1W3BA 1FVHA 4HOQA 3CSFA 2MRIA 5BV1A 3K5KA 3M56A 4B89A 4E85A 3RRMB 1UJJA 2X3MA 2DBAA 4M3OA 2XGOA 4JHJA 5T3RA 4JPSA 3S8PA 4IRUA 5EG2A 1EF1C 1E8WA 3LKUA 4K0RA 3EIQC 4BT9A 3TXNA 1X5BA 3CVUA 3F9YA 5JIYA 5FT9A 4YPAA 1H2VC 5KJKA 3FUNA 2YINA 4EECA 4KZ0A 3S7DA 3LJ3A 4UWKA 4DI3A 4YNPA 4BTBA 3CLJA 2XQ0A 4KXKB 2JLBA 3FWVA 4KVOA 3RJWA 5ANLA 2G46A 1L5JA 2XGMA 4BUPA 3U9WA 3FTYA 3P1UA 2IOLA 5EKQD 4DJAA 4XKBA 3FPDA 3ONKA 4BT8A 3FFLA 1PY1A 4NRHB 3MJWA 3CVVA 4QENA 3R9AB 3MEKA 5A7DB 3AS5A 2R59A 2HM8A 3FDHA 3FH5A 4HXIA 4GYYA 3HIZA 4HS2A 1WM5A 4R7LA 1NA0A 2KCKA 1PC2A 3EDTB 3PRZA 5JHNA 2LNIA 3DPDA 2IONA 1QNFA 2VGXB 2WXMA 3FY4A 3FTZA 2J9QA 2XCCA 5CPRB 5AIJA 4GA0A 4RG9A 1Y8MA 4I9CA 3U64A 3CVYA 4NVQA 5G04C 2JEKA 2DIWA 4CDRA 1XGWA 1MQSA 1HO8A 2WXRA 3CVLA 4IJ8A 2LAIA 2PZIA 3T5XA 3CHQA 4ANWA 1U3DA 3SI5A 1WAO1 5KJNA 5LSXA 2C2LA 1HF8A 3EIJA 4I43A 3UT8A 1HG5A 3SF4A 3QDNA 1MVHA 3SGHA 5AENA 2I6HA 1HS6A 2L6JA 4MI0A 3FU5A 4XKCA 5BPPA 4KZCA 3CBOA 4JW1A 4A3VA 3G2WA 5FJYA 3APDA 4QEOA 2I9CA 2LO6A 5FQ7A 1WY6A 4U0SA 3TGOA 3L22A 2HO1A 4LEUA 3O48A 5BV0A 4OYSA 5CCLA 3VTYA 2BQZA 5G2NA 4AY5A 5KCMA 3K9IA 4AY6A 4EZLA 3L54A 4GMLA 2IQCA 4GB9A 3QJZA 2CFZA 2CG3A 4JDSA 3NF1A 1QQEA 3O4ZA 4B94A 1OWOA 2FI7A 3Q15A 4N39A 4U0UA 4N3BA 3FUMA 2Q7FA 3TL5A 1H3IA 3CBPA 5DIZA 3VLFA 1QZ2A 1YA0A 1ELRA 1HE8A 2FBNA 3B7SA 3Q4AB 4J8FA 4WNFA 3TG4A 3D9OA 2WPVA 5G04J 3ESKA 1Z3YA 5EDSA 4GMJA 3RJVA 5FZSA 2C0LA 2I2OA 2BTDA 5LSZA 2JV0A 1KLXA 3PNTB 1A17A 3RKVA 2WMNA 4H12A 4FHKA 4H7XA 1IHGA 2CHZA 3LEWA 4FA6A 4I2WA 3P2BA 4HOUA 5KJMA 2R3AA 1EPUA 3MV3B 1N6CA 3T8MA 4BFRA 3B13A 3JCKC 3JYSA 4WNEA 4I6GA 3VUZA 3DB5A 3BG0B 3MO5A 1E8ZA 3JUIA 4NACA 3M53A 4G24A 4JLGA 1H6KA 3CIAA 4HFGA 4TUUA 4BTAA 4LCTA 3LYAA 3EHNA 3MCXA 2W5YA 2WXFA 5AYWD 5TH7A 2WMOA 4I6EA 3QK0A 2XPYA 4B8AA 3FUKA 2VJ8A 5T8IA 3FTSA 1EDUA 4N2QA 5M72A 3ZYLA 1N52A 4AU7A 2V4LA 2P58C 4UI9C 4GPKA 3ASDA 5FTPA 3SBSA 2XPIA 3FH8A 4J8EA 3IHXA 3HVEB 4Q94A 2V0PA 3DALA 2UWJG 4GCNA 3RRUA 1PAQA 4D10C 2WB2A 1IQRA 5AYFA 3CQGB 4GZCA 2PM6A 2VGXA 2YNQA 4A1GA 3SWCA 4J0UA 1ZKKA 3SNXA 4WWPA 2WXQA 1GW6A 4KMOA 3SHFA 4AEZC 5C1DA 4PUCA 4YPEA 2R17C 4GA1A 3UX4A 3SBTB 3ZW3A 1U3CA 4L1BA 3FU6A 3VLEA 3DBSA 3BEEA 4PH4B 3D9LA 3I3NA 3FUEA 2AVPA 5D0QD 1JWFA 3RRNB 4L23A 2A5UA 3CVQA 3M5AA 2X6JA 3OAWA 3MKQB 4XI9A 3LXUX 4QFVA 2GW1A 5G05C 5LCWC 2X6IA 3ESLA 3ZHEB 4NJ5A 4WWOA 3ZFWA 2OVFA 2PL2A 4IYPA 3QC1A 2WXIA 4UQZA 2F69A 3AU4A 2DCPA 4UI9J 4E6HA 5LFAA 4FLHA 3BO5A 3HHMA 1OWPA 1IYGA 3CHPA 3RQ4A 4UQXA 4J83A 3D9NA 4MLPA 1SZAA 3FU0A 4HLEA 5JHBA 4UWHA 3CHMA 3OOIA 4URKA 3JQ1A 2QY7A 5EX3A 4C1QA 4I1MA 5TTFA 2V8SE 3ZIMA 4EZJA 1H19A 4V3IA 1ELWA 2YQ8A 3IEGA 3L6AA 3PS6A 4J8DA 3RAYA 4EBAA 5FQ8A 1HU3A 4Y6WA 3RU0A 4A1SA 1SZ9A 3CVWA 1Y6IA 5T0MA 2VSNA 3PH0C 1E96B 2IF4A 3CQCB 3S7FA 5JJ7A 3L17A 4GZ5A 1HG2A 3R7RA 3I4GA 5KJLA 4GZDA 4YNMA 4L7TA 4AJWA 3FU3A 4LERA 5FQ4A 4IULA 3L13A 5JJTA 4RSYA 2ILRA 1UN8A 2HR2A 4CDMA 5G05J 5LCWJ 5F6KC 3JQ0A 4QEPA 2I1JA 2I1KA 1DNPA 3FEXA 2C0MA 2PQNA 4BSXA 1Z6TA 2AXUA 3Q49B 5T5GA 3KMTA 5CHEE 4EPZA 3OS5A 3VV0A 1KT0A 3B7RL 3NQPA 3CVNA 4IN3B 5FQ6A 3OXLA 2PM7A 3KEZA 3RO2A 4I51A 3PUKA 2J09A 2ONDA 2XCBA 4ACLA 4A3TA 4WAFA 3MYVA 4UWFA 4APFA 1Z3XA 2Y4UA 4K03A 3ZYQA 3S2AA 4GCOA 3PVLA 2AW6A 4O30A 4WNGA 3MO2A 4CT4A 1MT6A 3PZDA 3FTWA 4G26A 3ZN3A 3ZPJA 4L2YA 4ANUA 3D9MA 4JVSA 3UT7A 2OVBA 4MS6A 5FZQA 4F1SA 5LP0A 2FF4A 3HVEA 4JC8A 5LX8A 4B0ZA 4F3VA 1N3JA 4XX5A 3MGBA 5ANRA 3RO3A 3GZ2A 4BX8A 3FTUA 3NZSA 4HOSA 4FHJA 4G1TA 4JEHA 1SQMA 5E75A 4YVOA 2BF0X 4TRQA 3N71A 4P29A 4FJZA 3MZLB 4J8OA 3F9WA 2XRYA 4A55A 2XGSA 1MHQA 4LUNU 2WVIA 3I4RB 1TJCA 3Q5MA 3LY9A 4JHKA 3SD5A 4EBAG 2X6KA 3S7JA 3URZA 3CR3A 1E8XA 1JUQA 3HYMB 2QFCA 3IHVA 5HI7A 3F9XA 3VTXA 4C0EA 3IHYA 4GZ6A 4XZ4A 3CHSA 1S0PA 2UY1B 4WUYA 3KS2A 3ZHEA 4IJDA 1E7VA 3LY7A 3EJNA 2XPZA 4ILGA 4AV7A 1OWMA 2CHXA 4ABNA 4CT0A 4AM9A 3LCAA 2WXOA 4J7IA 4KYOB 4XE0A 3HNAA 4U04A 4BX9A 1NP7A 4I6JA 2KM4A 3KMAA 2GRLA 3M58A 2VQ2A 4AP2A 5BNWA 4I2ZA 3OTNA 4DI4A 2WXJA 1HXIA 1OWNA 4EQFA 3EP0A 4RG6A 3KD7A 3FUJA 5CCMA 3U3WA 4UQYA 3D9KA 5J90A 1OWLA 1UN9A 3FH7A 1E7UA 3MX3A 5ARGA 3SFZA 3LY8A 3ONLA 1UJKA 2IJGX 5FZRA 2WQ6A 4GU5A 2Y4TA 1XQHA 3FEYA 4JA9A 4GZ3A 3UPVA 4XI0A 3M54A 3OXFA 4E47A 2WXPA 1B89A 3ZYMA 4FADA 3TAXA 3ZRHA 4Q96A 4NQ0A 3G2TA 3AU5A 3M59A 3IBEA 2LAHA 3M55A 2A4ZA 2KATA 2VSOE 4ATGA 2IGQA 1P5QA 2WQ7A 5JHAA 2Y3AA 3T5VA 4LDGA 1JWGA 3QARA 4FP7A 4ME2A 3ZEFA 4HVBA 3U66A 2RG8A 2MOWA 2PQRA 3LVRE 4PDXA 2WXLA 4AOFA 3FHEA 3VLDA 3E4BA 4XIFA 2IOSA 3CKBA 4JHRA 4JXTA 4J6IA 1H2TC 4KT6B 3GZSA 3QB2A 1PEGA 5LOZA 3SZ7A 3PDNA 5JINA 1ZU2A 4ACKA 2KC7A 4N3AA 4AIFA 2AWIA 3ML9A 1HFAA 3QNKA 2WXNA 2ZU6B 4G11A 4FULA 3S7BA 3KAEA 3RIBA 4ANVA 2MHKA 3QWWA 3ASGA 4U8HA 1DVPA 4UI9K 5CMWA 1N6AA 3MO0A 4OVVA 4APOA 4JZYA 2J4BA 1OUVA 5T0KA 2X6FA 4FJYA 4ILHB 5FWQA 3U4TA 2E0IA 2HYZA 1KT1A 2XRZA 3CEQA 5C2YA 1FVFA 1ZBPA 5T4YA 3PE3A 4B8CB 3CKCA 2KZTB 3HDXA 4I17A 4U63A 4MRUA 1BPOA 4ILIA 3PREA 4O6FA 3QKYA 5AJDA 3ASHA 2M63A 5CMYA 2RFIA 2KCVA 2VTBB 2FEZA 3CHOA 3CK8A 4FU3A 4GYWA 4GAAA 2IFUA 5ENNA 4BWRA 2W5ZA 4DLOA 2CG2A 3UQ3A 3D9IA 4BY6A 3UUXA 2EQXA 1IQUA 4HOTA 3FUDA 2YHCA 3LVQE 4DLQA 4UWGA 3I5PA 5DBKA 4UWLA 3PEVB 1NA3A 3EHMA 4PS7A 4RVBA 1N54A 3ML8A 4Q69A 3FUHA 3QOUA 3LDZA 4CGVA 2OOEA 2UY1A 3FUFA 4JEUA 5AJLA 3ZYKA 2GRMA 3CVPA 3PNLB 3SW9A 3L08A 3GYZA 4F7AA 5BW8C 3B7TA 4KBQA 3QWPA 2BUGA 2J49A 2L9BA 4N3CA 2GGFA 3G2SA 4I1AA 3TG5A 5A6CA 2AXZA 1FCHA 3TXMA 4CRWA 1MVXA 2LSUA 5JJ6A 4YPUA 3IKOB 4KVMA 2LSVA 3ASFA 3RK6A 3MA5A 5BT1A 4N5CA 2J4DA 2XHEA 2E2EA 2FO7A 3D9JA 4GYOA 4EZKA 4PS3A 2YHEA 3CHRA 1E8YA 3ZVVA 2QPWA 3FP3A 2IU1A 2WM9A 5JJ0A 3NZUA 3ULQA 4ANXA 5BUZA 4J7FA 4CEMA 3CSTA 3G2UA 4U07A 3TJPA 2WXKA 2VYIA 5D0OD 3QWVA 4AXHA 3ZGQA 1TJFA 1VDYA 3F9ZA 3D9PA 3Q47B 2XEVA 4GA2A 1INZA 3PUJA 4MKTA 4C0MA 3LS8A 4JA7A 4AVXA 4CDNA 4YVQC 2J07A 1H2UA 4OVUA 4U0ZA 4DPRA 3MKQA 5HQ8A 3CVXA 4WWNA 3CK7A 2WXHA 4G2VA 4CCAA 1XNFA 3D3MA 3C98A 4LRZA 4N2SA 2OV8A 2VGYA 3WXXA 2CHWA 4J8SA 4NURA 2WQHA 3FTVA 3B7UX 4L2LA 3UT4A 1EYHA 3IV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ4 A;  5ARF A;  4FMU A;  4W9R A;  4H7Y A;  3OPE A;  3CK9 A;  2VSY A;  3MKR A;  3PE4 A;  4G25 A;  1MUF A;  5TEG A;  4Y6C A;  3CBM A;  3GZ1 A;  3AS4 A;  3OXG A;  3CV0 A;  1NZN A;  3MV2 B;  2O8J A;  4YND A;  5F6L A;  1O9S A;  2KCL A;  4MI5 A;  4Z4P A;  2R5S A;  2V5F A;  2NC9 A;  5F59 A;  4G23 A;  3LPZ A;  1HH8 A;  5F5E A;  4CGW A;  4HOR A;  5EX0 A;  3GW4 A;  4I9E A;  1ML9 A;  4RZ0 A;  3AS8 A;  4WND A;  3KMJ A;  4JL0 A;  1W3B A;  4HOQ A;  3K5K A;  3M56 A;  2DBA A;  2XGO A;  3S8P A;  5EG2 A;  3M57 A;  3LKU A;  5JIY A;  4BT9 A;  3F9Y A;  5FT9 A;  4YPA A;  5KJK A;  3S7D A;  4YNP A;  4BTB A;  4KXK B;  2JLB A;  3FWV A;  3RJW A;  2G46 A;  4BUP A;  2XGM A;  5EKQ D;  3FPD A;  4BT8 A;  3FFL A;  4NRH B;  4QEN A;  3R9A B;  3MEK A;  5A7D B;  3AS5 A;  4GYY A;  1WM5 A;  1NA0 A;  2KCK A;  1PC2 A;  3EDT B;  5JHN A;  2LNI A;  2VGX B;  2J9Q A;  2XCC A;  5CPR B;  4GA0 A;  4RG9 A;  1Y8M A;  4I9C A;  4NVQ A;  5G04 C;  4CDR A;  3CVL A;  4IJ8 A;  2PZI A;  5KJN A;  1WAO 1;  5LSX A;  2C2L A;  3SF4 A;  3QDN A;  1MVH A;  2I6H A;  2L6J A;  4MI0 A;  3CBO A;  5FJY A;  4QEO A;  4U0S A;  3TGO A;  2HO1 A;  4LEU A;  3O48 A;  5CCL A;  3VTY A;  2BQZ A;  4AY5 A;  3K9I A;  4AY6 A;  4JDS A;  3NF1 A;  1QQE A;  2FI7 A;  3Q15 A;  4N39 A;  4U0U A;  4N3B A;  2Q7F A;  1H3I A;  3CBP A;  5DIZ A;  1QZ2 A;  1YA0 A;  1ELR A;  2FBN A;  3Q4A B;  4J8F A;  4WNF A;  3TG4 A;  2WPV A;  5G04 J;  3ESK A;  3RJV A;  5FZS A;  2C0L A;  5LSZ A;  1KLX A;  4H12 A;  1A17 A;  3RKV A;  4H7X A;  1IHG A;  4I2W A;  4HOU A;  5KJM A;  2R3A A;  3MV3 B;  1N6C A;  3VUZ A;  3JYS A;  4WNE A;  3DB5 A;  3MO5 A;  3M53 A;  4G24 A;  4JLG A;  4BTA A;  3LYA A;  2W5Y A;  5AYW D;  5TH7 A;  4N2Q A;  5M72 A;  4AU7 A;  2P58 C;  4UI9 C;  4GPK A;  3ASD A;  5FTP A;  2XPI A;  4J8E A;  3IHX A;  3DAL A;  2UWJ G;  4GCN A;  5AYF A;  2VGX A;  4J0U A;  1ZKK A;  5C1D A;  4YPE A;  4GA1 A;  3BEE A;  2AVP A;  5D0Q D;  3CVQ A;  3M5A A;  4XI9 A;  2GW1 A;  5G05 C;  5LCW C;  3ZHE B;  4NJ5 A;  3ZFW A;  2PL2 A;  4UQZ A;  2F69 A;  4UI9 J;  3BO5 A;  1IYG A;  3RQ4 A;  4UQX A;  4J83 A;  3OOI A;  5EX3 A;  4C1Q A;  5TTF A;  3SWC A;  1ELW A;  2YQ8 A;  3IEG A;  4J8D A;  3RAY A;  4Y6W A;  3RU0 A;  4A1S A;  5T0M A;  2VSN A;  1E96 B;  2IF4 A;  5JJ7 A;  3S7F A;  5KJL A;  4GZ5 A;  4YNM A;  5JJT A;  2HR2 A;  5G05 J;  5LCW J;  5F6K C;  4QEP A;  2C0M A;  2PQN A;  3Q49 B;  5T5G A;  3KMT A;  5CHE E;  3OS5 A;  3VV0 A;  1KT0 A;  4IN3 B;  3CVN A;  3OXL A;  3RO2 A;  4I51 A;  2OND A;  2XCB A;  2Y4U A;  4GCO A;  4O30 A;  4WNG A;  3MO2 A;  1MT6 A;  4G26 A;  3ZPJ A;  3ZN3 A;  5FZQ A;  2FF4 A;  4F3V A;  1N3J A;  3RO3 A;  3GZ2 A;  4HOS A;  4G1T A;  4YVO A;  3N71 A;  4J8O A;  3F9W A;  2XGS A;  1TJC A;  3Q5M A;  3LY9 A;  3S7J A;  3URZ A;  3HYM B;  2QFC A;  5HI7 A;  3F9X A;  3VTX A;  4GZ6 A;  4WUY A;  2UY1 B;  3KS2 A;  3ZHE A;  4IJD A;  3LY7 A;  4ABN A;  4AM9 A;  3LCA A;  4J7I A;  4KYO B;  3HNA A;  4U04 A;  3KMA A;  3M58 A;  2VQ2 A;  5BNW A;  4I2Z A;  1HXI A;  4EQF A;  3EP0 A;  4RG6 A;  3KD7 A;  5CCM A;  3U3W A;  4UQY A;  5ARG A;  2JV0 A;  3LY8 A;  5FZR A;  2Y4T A;  1XQH A;  4JA9 A;  4GZ3 A;  3UPV A;  4XI0 A;  3M54 A;  3OXF A;  4E47 A;  1B89 A;  3TAX A;  4NQ0 A;  3M59 A;  3M55 A;  2KAT A;  2IGQ A;  1P5Q A;  4LDG A;  4ME2 A;  2PQR A;  3E4B A;  4XIF A;  3CKB A;  4JHR A;  1PEG A;  3SZ7 A;  3PDN A;  5JIN A;  1ZU2 A;  2KC7 A;  4N3A A;  4AIF A;  4B94 A;  3S7B A;  3KAE A;  3RIB A;  1N6A A;  2MHK A;  3QWW A;  3ASG A;  4UI9 K;  3MO0 A;  4APO A;  1OUV A;  5T0K A;  3U4T A;  2HYZ A;  1KT1 A;  3CEQ A;  1ZBP A;  3PE3 A;  3CKC A;  4I17 A;  4O6F A;  3QKY A;  3ASH A;  2RFI A;  2KCV A;  2FEZ A;  4BWR A;  3CK8 A;  4GYW A;  2IFU A;  2W5Z A;  3UQ3 A;  3UUX A;  4HOT A;  2YHC A;  5DBK A;  1NA3 A;  3QOU A;  4CGV A;  2OOE A;  2UY1 A;  3SW9 A;  3CVP A;  3GYZ A;  5BW8 C;  4KBQ A;  3QWP A;  2BUG A;  4N3C A;  4I1A A;  3TG5 A;  5A6C A;  1FCH A;  1MVX A;  2LSU A;  5JJ6 A;  4YPU A;  2LSV A;  3ASF A;  3MA5 A;  5BT1 A;  4N5C A;  2E2E A;  2FO7 A;  4GYO A;  2QPW A;  3FP3 A;  5JJ0 A;  3ULQ A;  4J7F A;  4U07 A;  2VYI A;  5D0O D;  3QWV A;  3ZGQ A;  3F9Z A;  3Q47 B;  2XEV A;  4GA2 A;  4JA7 A;  4YVQ C;  5HQ8 A;  3CK7 A;  4G2V A;  1XNF A;  4N2S A;  2VGY A;  3WXX A;  2WQH A;  4U0Z A; 
#chains in the Genus database with same CATH topology
 2FUL A;  3OPE A;  3MKR A;  2VSY A;  2EIL E;  3DST A;  1H6O A;  4C9B B;  3OXG A;  3CV0 A;  1LF8 A;  2X38 A;  2HE0 A;  4DK5 A;  4I1O B;  2LXL A;  2R02 A;  4MI5 A;  3G2V A;  3PEU B;  5KNH D;  1JCS A;  3ZXS A;  5F5E A;  1TEZ A;  1KZP A;  1NL4 A;  3GW4 A;  1ML9 A;  4RQI A;  4WND A;  3KMJ A;  2OEV A;  3KSL A;  4JL0 A;  3V30 A;  5CBO A;  5T3R A;  4IRU A;  1EF1 C;  1E8W A;  3M57 A;  4N5Q A;  1H2V C;  4KZ0 A;  3S7D A;  4UWK A;  3SFY A;  2MYO A;  4BTB A;  5ANL A;  3P1U A;  4BT8 A;  3AG4 E;  4U96 D;  2R59 A;  2HM8 A;  1NA0 A;  3PRZ A;  3FY4 A;  2J9Q A;  3U64 A;  4U8V D;  2DIW A;  1MQS A;  4IJ8 A;  3CHQ A;  3SI5 A;  2DZN A;  3UT8 A;  3PZ3 A;  1BI7 B;  2BED A;  3QDN A;  2L6J A;  3CBO A;  4JW1 A;  4A3V A;  3APD A;  2I9C A;  4LG6 A;  5FQ7 A;  4O1O A;  1WY6 A;  1K8K G;  4HI8 A;  5BV0 A;  4L9P A;  4K5B A;  5KCM A;  3K9I A;  4EZL A;  5CRU A;  2CFZ A;  1BU9 A;  3CBP A;  5DIZ A;  3VLF A;  4WNF A;  3B7S A;  3DPY A;  3D9O A;  2BKG A;  1KLX A;  1D8D A;  3PNT B;  2WMN A;  3SO8 A;  2R3A A;  3PZ4 A;  4BFR A;  3B13 A;  3JUI A;  4G24 A;  4JLG A;  3CIA A;  4TUU A;  3MCX A;  2W5Y A;  3TWQ A;  4YDY A;  1TNZ A;  3FTS A;  3RSE G;  1DC2 A;  3ZYL A;  5BXO A;  4AU7 A;  4GPK A;  1O1T A;  4BES A;  3HVE B;  4Q94 A;  5D2M C;  5AYF A;  2PM6 A;  1ZKK A;  3UKU G;  3SNX A;  4KMO A;  4YPE A;  4PUC A;  4GA1 A;  3FU6 A;  1RZ4 A;  4PH4 B;  3D9L A;  3I3N A;  3RRN B;  5B3S E;  4J8Y A;  2X6J A;  1K1B A;  3ESL A;  4WWO A;  2OVF A;  4IYP A;  1N4Q A;  3AU4 A;  3BO5 A;  3UM3 A;  3Q73 A;  5AAO A;  3EU5 A;  1SZA A;  3CHM A;  3RAU A;  4URK A;  5EX3 A;  2V8S E;  1ELW A;  3E37 A;  4EBA A;  3RU0 A;  2QC9 A;  5T0M A;  5JJ7 A;  3L17 A;  4LER A;  5D66 A;  5LCW J;  2C0M A;  2PQN A;  4BSX A;  3KMT A;  5CHE E;  4EPZ A;  3NQP A;  2XS8 A;  4ACL A;  4A3T A;  4WAF A;  3MYV A;  1Z3X A;  3UTM A;  3S2A A;  3HRA A;  4L2Y A;  5FZQ A;  3NBN B;  3ABL E;  2FF4 A;  3HVE A;  4JC8 A;  2Y0B G;  4F3V A;  2P9S G;  4HOS A;  5E75 A;  1BI8 B;  3F9W A;  4LUN U;  2XEN A;  1TJC A;  2X6K A;  4A63 B;  2AJA A;  3VTX A;  4C0E A;  4XZ4 A;  1S0P A;  3LY7 A;  2XPZ A;  4AV7 A;  3W9G A;  3HNA A;  2GRP B;  3KMA A;  4AP2 A;  4OAV B;  3OTN A;  1HXI A;  4EQF A;  4NIK A;  3EP0 A;  5CCM A;  3D9K A;  5ENS D;  4M7C A;  3SFZ A;  3MX3 A;  4GU5 A;  1B89 A;  3TAX A;  5ENR D;  3IBE A;  2LAH A;  2A4Z A;  3UI2 A;  2EIM E;  3T5V A;  4ME2 A;  4DX5 D;  3U66 A;  2MOW A;  2PQR A;  3LVR E;  4PDX A;  3E4B A;  1D9S A;  3CKB A;  3QNK A;  4G11 A;  4ANV A;  1YCS B;  5T0K A;  4ILH B;  3TWR A;  3CEQ A;  1FVF A;  3DRA A;  1MX2 A;  3PE3 A;  4ILI A;  3PRE A;  3ASH A;  2RFI A;  2KCV A;  5ENN A;  4BWR A;  4HOT A;  2YHC A;  4DLQ A;  3PEV B;  4PS7 A;  2XZT G;  2H6G A;  1N54 A;  3FUH A;  4JEU A;  3ZYK A;  1N4S A;  3L08 A;  3GYZ A;  4F7A A;  1MYO A;  4KBQ A;  3QWP A;  4N3C A;  3G2S A;  4I1A A;  5A6C A;  4TXR A;  3ZXP A;  4EHM A;  3V31 A;  5BT1 A;  4N5C A;  2J4D A;  3D9J A;  4GYO A;  4EZK A;  1YMP A;  2YHE A;  3HXB A;  3AG3 E;  2WM9 A;  3NZU A;  4CEM A;  3G2U A;  4U07 A;  3R9M A;  2VYI A;  2H6H A;  3QWV A;  3ZGQ A;  3HXE A;  2RFM A;  3Q47 B;  4GA2 A;  4AVX A;  4CDN A;  5EIB E;  1H2U A;  1DCE A;  3MKQ A;  3CVX A;  3WXX A;  2WQH A;  5H7P A;  4DI3 A;  1HZ4 A;  5ARF A;  1HX8 A;  2IO3 C;  2J08 A;  1TR4 A;  3ZU7 B;  3PE4 A;  3NOG D;  4PS8 A;  4JD2 G;  5G55 A;  3ENE A;  3CBM A;  3GZ1 A;  3ABK E;  1QBQ A;  3AS4 A;  3CGH A;  3BQO A;  2X6H A;  4YND A;  1O9S A;  2KCL A;  1JPL A;  2R5S A;  2NC9 A;  4FC8 A;  3UXG A;  4G23 A;  3LPZ A;  2AXV A;  3APC A;  3BG1 B;  4HOR A;  4I9E A;  4BET A;  4RZ0 A;  4F53 A;  4TV3 A;  1FVH A;  5BV1 A;  2MRI A;  3K5K A;  4B89 A;  2FO1 E;  2X3M A;  4JPS A;  3S8P A;  3LKU A;  3EIQ C;  1X5B A;  5AQB A;  3UM1 A;  4YNP A;  3EHR A;  1MX4 A;  4KVO A;  1YYH A;  2G46 A;  4BUP A;  2XGM A;  1N4P A;  4DJA A;  4XKB A;  3Q7F A;  1PY1 A;  5KNG A;  4QEN A;  3AS5 A;  3FH5 A;  3HXD A;  3BU8 A;  1PC2 A;  3EDT B;  2LNI A;  1QNF A;  2VGX B;  1FT2 A;  5AIJ A;  4RG9 A;  3EU9 A;  3Q75 A;  4LNB A;  1HO8 A;  1DCQ A;  4ANW A;  5KJN A;  1WAO 1;  5LSX A;  2C2L A;  3SF4 A;  4HBD A;  1MVH A;  3SGH A;  1K1A A;  5AEN A;  1BD8 A;  4XKC A;  4MI0 A;  5FJY A;  1JCQ A;  4QEO A;  1V54 E;  3TGO A;  3L22 A;  4B93 B;  4AY5 A;  2DYR E;  4GML A;  2CG3 A;  3NF1 A;  4HRL A;  3O4Z A;  1TNO A;  2FI7 A;  4U0U A;  3FUM A;  3TL5 A;  3E32 A;  1H3I A;  4CYM D;  5G04 J;  1Z3Y A;  3V79 K;  5EDS A;  4GMJ A;  3X2Q E;  2DWZ A;  4H12 A;  2GRR B;  1Z5S C;  3LEW A;  3T8M A;  4I6G A;  2OCC E;  4HFG A;  5ITZ F;  2WXF A;  1TN6 A;  2LXM A;  3ASN E;  4I6E A;  3QK0 A;  2XPY A;  1OCO E;  5EYP F;  2VJ8 A;  5T8I A;  1EDU A;  3E30 A;  4UI9 C;  3ASD A;  5FTP A;  4DX2 A;  2UWJ G;  4MBG A;  1PAQ A;  1IQR A;  4GZC A;  2VGX A;  2GRO B;  4J0U A;  3AAA C;  1SA5 A;  3DSW A;  2WXQ A;  4DX6 D;  5CBN A;  3BEE A;  2A5U A;  3OAW A;  4QFV A;  1OT8 A;  5G05 C;  2X6I A;  3ZHE B;  2PL2 A;  3QC1 A;  2WXI A;  4BER A;  5HS0 A;  3CHP A;  3D9N A;  2P9P G;  5JHB A;  3C3Q A;  4YDW A;  3OOI A;  3JQ1 A;  2QY7 A;  5KBA A;  4I1M A;  5JMN D;  3V2O A;  3WG7 E;  1HU3 A;  4A1S A;  5FIN A;  3PH0 C;  1E96 B;  2IF4 A;  3CQC B;  5KJL A;  3R7R A;  3I4G A;  2RKK A;  5FQ4 A;  3SQV A;  1UN8 A;  2HR2 A;  4QEP A;  2I1K A;  1IXV A;  2AXU A;  3VV0 A;  3CVN A;  1S63 A;  2PM7 A;  3RO2 A;  3PUK A;  4UWF A;  2B0O E;  3PVL A;  2AW6 A;  3ZPJ A;  3ZN3 A;  3B7B A;  4JVS A;  5LP0 A;  4MS6 A;  5LX8 A;  4XX5 A;  3MGB A;  5ANR A;  1N0Q A;  4FHJ A;  4YVO A;  1WG0 A;  3N71 A;  4GTV A;  4J8O A;  4A55 A;  3I4R B;  4JHK A;  3Q5M A;  3LY9 A;  4EBA G;  3HYM B;  5ENT D;  1ZB1 A;  3EHQ A;  4WUY A;  1N94 A;  3ZHE A;  3EJN A;  1OWM A;  4CT0 A;  4AM9 A;  3LCA A;  2WXO A;  1NP7 A;  4LNG A;  4I2Z A;  2QYJ A;  4O60 A;  1OWN A;  3FUJ A;  3U3W A;  4U7E B;  5ARG A;  1OWL A;  1E7U A;  3LY8 A;  2Y4T A;  3OXF A;  2WXP A;  3Q78 A;  3ZRH A;  4K5C A;  2KAT A;  2VSO E;  2IGQ A;  5JHA A;  3QAR A;  2RG8 A;  2IOS A;  3DXM G;  4JHR A;  3GZS A;  3QB2 A;  5JIN A;  1ZU2 A;  4ACK A;  4N3A A;  3ML9 A;  5JA4 D;  2ETB A;  4U8H A;  1DVP A;  3MO0 A;  4OVV A;  3UKR G;  2J4B A;  2X6F A;  2Y1L E;  4FJY A;  5FWQ A;  3F6Q A;  3U4T A;  2VGE A;  3UIO C;  5B1B E;  1QYM A;  3HDX A;  4I17 A;  1BPO A;  2P2C P;  1NI1 A;  4HRM B;  4FU3 A;  2W5Z A;  4DLO A;  3UQ3 A;  2EQX A;  2P9N G;  2QZA A;  3I5P A;  2XS1 A;  3EHM A;  3QOU A;  4HLL A;  4DX7 D;  2GGF A;  3TXM A;  4CRW A;  5CED B;  4KVM A;  3ASF A;  3J5P A;  3MA5 A;  2E2E A;  2FO7 A;  4PS3 A;  1E8Y A;  3ZVV A;  2OEW A;  2IU1 A;  2Y69 E;  2ETA A;  4J7F A;  3CST A;  2WXK A;  1TJF A;  3D9P A;  1K3Z D;  2XEV A;  1N0R A;  1INZ A;  3PZ2 A;  4MKT A;  2H6I A;  4UUC A;  2J07 A;  3PZ1 A;  2EIN E;  4G2V A;  4CCA A;  3C98 A;  4LRZ A;  3LJN A;  2CHW A;  1EYH A;  4W9R A;  2NSZ A;  4GTM A;  3CK9 A;  4G25 A;  3QAQ A;  1ELK A;  2RD0 A;  4FLB A;  1E90 A;  4J7W A;  4Y6C A;  3R7Q A;  2ZXW E;  5AQ7 A;  3L16 A;  4JB8 P;  1NZN A;  3TWW A;  2O8J A;  1H0A A;  5CEC B;  4CZ2 D;  4GTO A;  2R03 A;  4XEI G;  4DUI A;  1HH8 A;  4LNU D;  1N95 A;  2GRN B;  3FTX A;  3KEA A;  4CGW A;  3C5R A;  2F37 A;  3IXE A;  1N9A A;  3AS8 A;  3B95 A;  2CFU A;  1W3B A;  1UJJ A;  4M3O A;  2XGO A;  4JHJ A;  2IO2 C;  3NAW A;  4LSZ E;  3C72 A;  2EIK E;  5JIY A;  3CVU A;  4BT9 A;  3TXN A;  4EEC A;  2XQ0 A;  4KXK B;  2JLB A;  3E34 A;  3U9W A;  1LTX A;  2IOL A;  5EKQ D;  3FPD A;  1OCR E;  3FFL A;  3MJW A;  4GTR A;  3MEK A;  3FDH A;  1FPP A;  3HIZ A;  4R7L A;  1S64 A;  2KCK A;  1TNY A;  5JHN A;  2ION A;  2WXM A;  3FTZ A;  4GA0 A;  2JEK A;  4CDR A;  5IY5 E;  2LAI A;  3T5X A;  1U3D A;  1HF8 A;  4I43 A;  1HG5 A;  2I6H A;  3ABM E;  5BPP A;  2ZGG A;  3G2W A;  4U0S A;  4LEU A;  3O48 A;  4OYS A;  5CCL A;  3VTY A;  5G2N A;  1OCC E;  2V5Q C;  2IQC A;  4GB9 A;  1OWO A;  3Q15 A;  5CER B;  1V55 E;  1QZ2 A;  1YA0 A;  2FBN A;  1HE8 A;  2WPV A;  3RJV A;  2C0L A;  3DSS A;  4FHK A;  4H7X A;  1IHG A;  4HQD A;  4FA6 A;  5KJM A;  3MV3 B;  3VUZ A;  3DB5 A;  4GTP A;  3BG0 B;  3TWS A;  4NAC A;  3M53 A;  4LCT A;  3LYA A;  3EHN A;  5TH7 A;  2WMO A;  4N2Q A;  3FH8 A;  3DAL A;  4GCN A;  4D10 C;  2WB2 A;  3CQG B;  2YNQ A;  4A1G A;  3EUV A;  1JCR A;  5C1D A;  1GW6 A;  3Q9U C;  3SHF A;  5EIL A;  4AEZ C;  3ZW3 A;  3DBS A;  4BSZ B;  2J8S D;  2AVP A;  3Q7A A;  3ZUV B;  3M5A A;  3BUA A;  1LD8 A;  2ETC A;  4TXP A;  5LCW C;  4NJ5 A;  1Q2Z A;  4U8Y D;  2L6B A;  2DYS E;  3DSU A;  4FLH A;  3HHM A;  1OWP A;  1O1R A;  1IYG A;  3RQ4 A;  4MLP A;  4HLE A;  4C48 B;  4UWH A;  2BKK B;  4C1Q A;  5TTF A;  3ZIM A;  4EZJ A;  1H19 A;  2YQ8 A;  3L6A A;  2LUH A;  4Y6W A;  3ULE G;  1TNB A;  4GTS A;  3S7F A;  4YNM A;  5EYL A;  4GZD A;  3FU3 A;  5JJT A;  3JQ0 A;  3TWT A;  1DNP A;  3FEX A;  3ZKJ A;  1Z6T A;  3Q49 B;  2IY0 C;  1KT0 A;  4IN3 B;  4F1P A;  3KEZ A;  2XCB A;  1SW6 A;  4GCO A;  4O30 A;  4WNG A;  2A5E A;  4CT4 A;  3D9M A;  4F1S A;  5AAR A;  3DEO A;  1N3J A;  3GZ2 A;  3FTU A;  3NZS A;  1N11 A;  1SQM A;  4HB5 A;  4TRQ A;  2BF0 X;  4GMR A;  4P29 A;  3MZL B;  2XGS A;  1MHQ A;  5CEA A;  3SD5 A;  3C3R A;  3URZ A;  4HI9 A;  1E8X A;  2QFC A;  3IHV A;  1G3N B;  5HI7 A;  1BLX B;  3IHY A;  3CHS A;  4ILG A;  2P9U G;  2CHX A;  4XE0 A;  2KM4 A;  3M58 A;  5BNW A;  1OXJ A;  5FIO A;  3KD7 A;  1UN9 A;  3ONL A;  1UJK A;  2IJG X;  1XQH A;  4GZ3 A;  3UPV A;  4XI0 A;  1TN7 A;  3AU5 A;  4ATG A;  4DX1 A;  2KXP C;  2WQ7 A;  5ENO D;  4FP7 A;  2WXL A;  4AOF A;  3FHE A;  3VLD A;  2V4H C;  3HXC A;  1PEG A;  4KT6 B;  1H2T C;  2F0Y A;  4AIF A;  2AWI A;  4FUL A;  2ZU6 B;  3DEP A;  3KAE A;  2MHK A;  3QWW A;  2E0I A;  2XRZ A;  1ZBP A;  5T4Y A;  2KZT B;  4U63 A;  4MRU A;  3DWL G;  1KPS B;  1OY3 D;  2RFA A;  5AJD A;  2M63 A;  2VTB B;  2CG2 A;  3D9I A;  4BY6 A;  3UUX A;  2EIJ E;  4HNA D;  4UWG A;  4GTT A;  2NYJ A;  4CGV A;  1RW2 A;  5AJL A;  3FUF A;  3PNL B;  4RLY A;  3T8K A;  2BUG A;  2J49 A;  1O1S A;  3TG5 A;  1MVX A;  3IKO B;  3NB2 A;  2XHE A;  2JAB A;  2QPW A;  4QQI A;  4DRX E;  5JJ0 A;  5BUZ A;  4ANX A;  3Q79 A;  4AXH A;  3NOC D;  1VDY A;  3F9Z A;  3PUJ A;  5EN5 D;  4C0M A;  4JA7 A;  4YVQ C;  2DZO A;  4BEP A;  5HQ8 A;  2DVW A;  4WWN A;  1MX6 A;  1XNF A;  4N2S A;  2VGY A;  4K5A B;  3B7U X;  3UT4 A;  4U0Z A;  3IV0 A;  4FMU A;  4H7Y A;  3FUI A;  3JXI A;  3HG0 D;  2IEJ A;  2NXP A;  1MUF A;  5HRY A;  5TEG A;  2L0T B;  1LD7 A;  2KZT A;  1MZC A;  5J08 A;  3E33 A;  1UG3 A;  3ISM C;  2VTB A;  1TYQ G;  2L0I A;  3MV2 B;  5CRV A;  5F6L A;  3AG2 E;  4Z4P A;  2V5F A;  2WXG A;  5F59 A;  1TNU A;  4TXQ A;  3UMV A;  1UW4 B;  4F6R D;  2VSX E;  5E76 A;  5A23 A;  5EX0 A;  3APF A;  1IHB A;  3SY2 A;  3FUL A;  1UOH A;  4HOQ A;  3CSF A;  3M56 A;  4E85 A;  3RRM B;  3JUE A;  2DBA A;  3DSV A;  5EG2 A;  5HKP A;  4K0R A;  3F9Y A;  5FT9 A;  4YPA A;  5AQ9 A;  5KJK A;  3FUN A;  2YIN A;  3LJ3 A;  3CLJ A;  3FWV A;  4ZHB A;  3RJW A;  1WDY A;  1L5J A;  3FTY A;  3ONK A;  4NRH B;  3CVV A;  1A5E A;  3R9A B;  5A7D B;  4HXI A;  4GYY A;  4HS2 A;  1WM5 A;  4ZFH A;  1SVX A;  3DPD A;  2P9L G;  3UIP C;  2XCC A;  5CPR B;  3CVY A;  1Y8M A;  4I9C A;  4NVQ A;  5G04 C;  3J5Q B;  1XGW A;  2WXR A;  3CVL A;  2PZI A;  3EIJ A;  1FT1 A;  3L82 A;  3C3O A;  3KSQ A;  1HS6 A;  3FU5 A;  4GTQ A;  4KZC A;  2LO6 A;  3UM0 A;  2HO1 A;  3W9F A;  4G8K A;  2BQZ A;  4AY6 A;  3L54 A;  5EID A;  1OCZ E;  3QJZ A;  4JDS A;  1QQE A;  1MJ0 A;  4N39 A;  4N3B A;  2Q7F A;  3Q4A B;  1ELR A;  4J8F A;  3TG4 A;  3ESK A;  5FZS A;  2I2O A;  1D8E A;  2BTD A;  5LSZ A;  1AWC B;  1A17 A;  3RKV A;  4X8Q A;  2CHZ A;  2ZIS A;  4I2W A;  2F8X K;  3P2B A;  4HOU A;  1EPU A;  1N6C A;  3JCK C;  1NFI E;  3JYS A;  4WNE A;  3MO5 A;  3UM2 A;  1E8Z A;  1H6P A;  4YDO A;  1H6K A;  4BTA A;  2P9I G;  5AYW D;  4B8A A;  3FUK A;  5M72 A;  3ZNG A;  1N52 A;  2V4L A;  2P58 C;  3ASO E;  3SBS A;  2ZGD A;  2XPI A;  4J8E A;  3HXF A;  3IHX A;  2V0P A;  3RRU A;  4TUM A;  4WWP A;  2R05 A;  2R17 C;  3UX4 A;  3SBT B;  1U3C A;  3L9T A;  4L1B A;  3VLE A;  3FUE A;  5D0Q D;  1JWF A;  4L23 A;  3CVQ A;  2QYU A;  3MKQ B;  4XI9 A;  3LXU X;  2GW1 A;  3ZFW A;  4UQZ A;  5ENP D;  2F69 A;  2DCP A;  3TWV A;  4UI9 J;  4E6H A;  5ENQ D;  3AG1 E;  5LFA A;  4UQX A;  4J83 A;  3FU0 A;  5AQA A;  5B1A E;  1O5M A;  3SWC A;  4V3I A;  3IEG A;  3PS6 A;  4J8D A;  3RAY A;  5FQ8 A;  1SZ9 A;  3JXJ A;  1X81 A;  3CVW A;  1Y6I A;  2VSN A;  3T9K A;  3DSX A;  4GZ5 A;  1HG2 A;  4L7T A;  4AJW A;  4YDE A;  4IUL A;  3L13 A;  4RSY A;  2ILR A;  4CDM A;  5G05 J;  5F6K C;  2I1J A;  2XEH A;  5T5G A;  3OS5 A;  3B7R L;  3AJI A;  5FQ6 A;  3OXL A;  4I51 A;  2J09 A;  2OND A;  4APF A;  2Y4U A;  4K03 A;  3ZYQ A;  3MO2 A;  5KWD A;  1MT6 A;  3PZD A;  3FTW A;  4G26 A;  4ANU A;  3UT7 A;  2OVB A;  4B0Z A;  3RO3 A;  4O1P A;  4BX8 A;  2XZD G;  4G1T A;  4JEH A;  2F8Y A;  2XEE A;  4FJZ A;  3V2X A;  2XRY A;  2WVI A;  3S7J A;  3CR3 A;  1JUQ A;  3DXK G;  3F9X A;  4GZ6 A;  4G8L A;  2UY1 B;  3KS2 A;  4IJD A;  1E7V A;  4HRN A;  4ABN A;  4J7I A;  4KYO B;  4U04 A;  4BX9 A;  4I6J A;  2GRL A;  2VQ2 A;  3TWU A;  4DI4 A;  2WXJ A;  2H6F A;  1KZO A;  4RG6 A;  4UQY A;  2P9K G;  5J90 A;  3FH7 A;  2JV0 A;  1SA4 A;  5FZR A;  2WQ6 A;  5AN8 A;  3FEY A;  4JA9 A;  2R2L A;  3M54 A;  4E47 A;  2KBX A;  3ZYM A;  4FAD A;  4Q96 A;  4NQ0 A;  3G2T A;  3M59 A;  3M55 A;  1P5Q A;  2Y3A A;  4LDG A;  1JWG A;  4U95 D;  3ZEF A;  4HVB A;  4OAU C;  4XIF A;  3D9H A;  4JXT A;  4J6I A;  2PNN A;  5LOZ A;  3SZ7 A;  4Z68 A;  3PDN A;  1U2V G;  2KC7 A;  4B94 A;  1HFA A;  2WXN A;  3S7B A;  3RIB A;  5CMW A;  1N6A A;  3ASG A;  4UI9 K;  4APO A;  4JZY A;  1OUV A;  2HYZ A;  1KT1 A;  5C2Y A;  2B6C A;  4B8C B;  3CKC A;  3SFX A;  4O6F A;  3QKY A;  5CMY A;  2FEZ A;  1N4R A;  3CK8 A;  3CHO A;  4GYW A;  4GAA A;  2IFU A;  4GPM A;  1IQU A;  1AP7 A;  3FUD A;  3LVQ E;  1IKN D;  5DBK A;  4UWL A;  1S70 B;  3ULY A;  1NA3 A;  4RVB A;  3ML8 A;  4Q69 A;  3LDZ A;  5BXU A;  2OOE A;  2UY1 A;  3SW9 A;  2GRM A;  3CVP A;  5BW8 C;  3B7T A;  2L9B A;  2AXZ A;  1FCH A;  2LSU A;  5JJ6 A;  4YPU A;  2LSV A;  3RK6 A;  2GRQ B;  3UIN C;  3CHR A;  1TN8 A;  3FP3 A;  3ULQ A;  3TJP A;  4ATZ D;  5D0O D;  2ZIR A;  3LS8 A;  4OVU A;  4DPR A;  3TWX A;  3Q9N C;  3CK7 A;  2WXH A;  3D3M A;  2OV8 A;  4J8S A;  4NUR A;  3FTV A;  4L2L A; 
#chains in the Genus database with same CATH homology
 1HZ4 A;  5ARF A;  1HX8 A;  4FMU A;  2J08 A;  4W9R A;  4H7Y A;  2NSZ A;  2FUL A;  3OPE A;  3CK9 A;  2VSY A;  3MKR A;  3FUI A;  3M57 A;  3PE4 A;  4G25 A;  3QAQ A;  1ELK A;  2NXP A;  4PS8 A;  1MUF A;  2RD0 A;  4FLB A;  5TEG A;  1E90 A;  4Y6C A;  3R7Q A;  2L0T B;  5G55 A;  3ENE A;  2KZT A;  3CBM A;  3GZ1 A;  5J08 A;  3L16 A;  3AS4 A;  1UG3 A;  3OXG A;  3CGH A;  4C9B B;  3CV0 A;  2VTB A;  1LF8 A;  2X38 A;  2L0I A;  1NZN A;  2X6H A;  3MV2 B;  4DK5 A;  4YND A;  4I1O B;  2O8J A;  1H0A A;  5F6L A;  1O9S A;  2KCL A;  4MI5 A;  3G2V A;  1JPL A;  4Z4P A;  2R5S A;  2V5F A;  3PEU B;  2WXG A;  2NC9 A;  4FC8 A;  5F59 A;  4G23 A;  3LPZ A;  1HH8 A;  2AXV A;  3UMV A;  1UW4 B;  3APC A;  3ZXS A;  3BG1 B;  3FTX A;  2VSX E;  5E76 A;  5F5E A;  5A23 A;  4CGW A;  1TEZ A;  4HOR A;  5EX0 A;  3APF A;  3GW4 A;  4I9E A;  1ML9 A;  4RZ0 A;  3FUL A;  3AS8 A;  4F53 A;  4WND A;  4TV3 A;  3KMJ A;  2CFU A;  4JL0 A;  1W3B A;  1FVH A;  4HOQ A;  3CSF A;  2MRI A;  5BV1 A;  3K5K A;  3M56 A;  4B89 A;  4E85 A;  3RRM B;  1UJJ A;  2X3M A;  2DBA A;  4M3O A;  2XGO A;  4JHJ A;  5T3R A;  4JPS A;  3S8P A;  4IRU A;  5EG2 A;  1EF1 C;  1E8W A;  3LKU A;  4K0R A;  3EIQ C;  4BT9 A;  3TXN A;  1X5B A;  3CVU A;  3F9Y A;  5JIY A;  5FT9 A;  4YPA A;  1H2V C;  5KJK A;  3FUN A;  2YIN A;  4EEC A;  4KZ0 A;  3S7D A;  3LJ3 A;  4UWK A;  4DI3 A;  4YNP A;  4BTB A;  3CLJ A;  2XQ0 A;  4KXK B;  2JLB A;  3FWV A;  4KVO A;  3RJW A;  5ANL A;  2G46 A;  1L5J A;  2XGM A;  4BUP A;  3U9W A;  3FTY A;  3P1U A;  2IOL A;  5EKQ D;  4DJA A;  4XKB A;  3FPD A;  3ONK A;  4BT8 A;  3FFL A;  1PY1 A;  4NRH B;  3MJW A;  3CVV A;  4QEN A;  3R9A B;  3MEK A;  5A7D B;  3AS5 A;  2R59 A;  2HM8 A;  3FDH A;  3FH5 A;  4HXI A;  4GYY A;  3HIZ A;  4HS2 A;  1WM5 A;  4R7L A;  1NA0 A;  2KCK A;  1PC2 A;  3EDT B;  3PRZ A;  5JHN A;  2LNI A;  3DPD A;  2ION A;  1QNF A;  2VGX B;  2WXM A;  3FY4 A;  3FTZ A;  2J9Q A;  2XCC A;  5CPR B;  5AIJ A;  4GA0 A;  4RG9 A;  1Y8M A;  4I9C A;  3U64 A;  3CVY A;  4NVQ A;  5G04 C;  2JEK A;  2DIW A;  4CDR A;  1XGW A;  1MQS A;  1HO8 A;  2WXR A;  3CVL A;  4IJ8 A;  2LAI A;  2PZI A;  3T5X A;  3CHQ A;  4ANW A;  1U3D A;  3SI5 A;  1WAO 1;  5KJN A;  5LSX A;  2C2L A;  1HF8 A;  3EIJ A;  4I43 A;  3UT8 A;  1HG5 A;  3SF4 A;  3QDN A;  1MVH A;  3SGH A;  5AEN A;  2I6H A;  1HS6 A;  2L6J A;  4MI0 A;  3FU5 A;  4XKC A;  5BPP A;  4KZC A;  3CBO A;  4JW1 A;  4A3V A;  3G2W A;  5FJY A;  3APD A;  4QEO A;  2I9C A;  2LO6 A;  5FQ7 A;  1WY6 A;  4U0S A;  3TGO A;  3L22 A;  2HO1 A;  4LEU A;  3O48 A;  5BV0 A;  4OYS A;  5CCL A;  3VTY A;  2BQZ A;  5G2N A;  4AY5 A;  5KCM A;  3K9I A;  4AY6 A;  4EZL A;  3L54 A;  4GML A;  2IQC A;  4GB9 A;  3QJZ A;  2CFZ A;  2CG3 A;  4JDS A;  3NF1 A;  1QQE A;  3O4Z A;  4B94 A;  1OWO A;  2FI7 A;  3Q15 A;  4N39 A;  4U0U A;  4N3B A;  3FUM A;  2Q7F A;  3TL5 A;  1H3I A;  3CBP A;  5DIZ A;  3VLF A;  1QZ2 A;  1YA0 A;  1ELR A;  1HE8 A;  2FBN A;  3B7S A;  3Q4A B;  4J8F A;  4WNF A;  3TG4 A;  3D9O A;  2WPV A;  5G04 J;  3ESK A;  1Z3Y A;  5EDS A;  4GMJ A;  3RJV A;  5FZS A;  2C0L A;  2I2O A;  2BTD A;  5LSZ A;  2JV0 A;  1KLX A;  3PNT B;  1A17 A;  3RKV A;  2WMN A;  4H12 A;  4FHK A;  4H7X A;  1IHG A;  2CHZ A;  3LEW A;  4FA6 A;  4I2W A;  3P2B A;  4HOU A;  5KJM A;  2R3A A;  1EPU A;  3MV3 B;  1N6C A;  3T8M A;  4BFR A;  3B13 A;  3JCK C;  3JYS A;  4WNE A;  4I6G A;  3VUZ A;  3DB5 A;  3BG0 B;  3MO5 A;  1E8Z A;  3JUI A;  4NAC A;  3M53 A;  4G24 A;  4JLG A;  1H6K A;  3CIA A;  4HFG A;  4TUU A;  4BTA A;  4LCT A;  3LYA A;  3EHN A;  3MCX A;  2W5Y A;  2WXF A;  5AYW D;  5TH7 A;  2WMO A;  4I6E A;  3QK0 A;  2XPY A;  4B8A A;  3FUK A;  2VJ8 A;  5T8I A;  3FTS A;  1EDU A;  4N2Q A;  5M72 A;  3ZYL A;  1N52 A;  4AU7 A;  2V4L A;  2P58 C;  4UI9 C;  4GPK A;  3ASD A;  5FTP A;  3SBS A;  2XPI A;  3FH8 A;  4J8E A;  3IHX A;  3HVE B;  4Q94 A;  2V0P A;  3DAL A;  2UWJ G;  4GCN A;  3RRU A;  1PAQ A;  4D10 C;  2WB2 A;  1IQR A;  5AYF A;  3CQG B;  4GZC A;  2PM6 A;  2VGX A;  2YNQ A;  4A1G A;  3SWC A;  4J0U A;  1ZKK A;  3SNX A;  4WWP A;  2WXQ A;  1GW6 A;  4KMO A;  3SHF A;  4AEZ C;  5C1D A;  4PUC A;  4YPE A;  2R17 C;  4GA1 A;  3UX4 A;  3SBT B;  3ZW3 A;  1U3C A;  4L1B A;  3FU6 A;  3VLE A;  3DBS A;  3BEE A;  4PH4 B;  3D9L A;  3I3N A;  3FUE A;  2AVP A;  5D0Q D;  1JWF A;  3RRN B;  4L23 A;  2A5U A;  3CVQ A;  3M5A A;  2X6J A;  3OAW A;  3MKQ B;  4XI9 A;  3LXU X;  4QFV A;  2GW1 A;  5G05 C;  5LCW C;  2X6I A;  3ESL A;  3ZHE B;  4NJ5 A;  4WWO A;  3ZFW A;  2OVF A;  2PL2 A;  4IYP A;  3QC1 A;  2WXI A;  4UQZ A;  2F69 A;  3AU4 A;  2DCP A;  4UI9 J;  4E6H A;  5LFA A;  4FLH A;  3BO5 A;  3HHM A;  1OWP A;  1IYG A;  3CHP A;  3RQ4 A;  4UQX A;  4J83 A;  3D9N A;  4MLP A;  1SZA A;  3FU0 A;  4HLE A;  5JHB A;  4UWH A;  3CHM A;  3OOI A;  4URK A;  3JQ1 A;  2QY7 A;  5EX3 A;  4C1Q A;  4I1M A;  5TTF A;  2V8S E;  3ZIM A;  4EZJ A;  1H19 A;  4V3I A;  1ELW A;  2YQ8 A;  3IEG A;  3L6A A;  3PS6 A;  4J8D A;  3RAY A;  4EBA A;  5FQ8 A;  1HU3 A;  4Y6W A;  3RU0 A;  4A1S A;  1SZ9 A;  3CVW A;  1Y6I A;  5T0M A;  2VSN A;  3PH0 C;  1E96 B;  2IF4 A;  3CQC B;  3S7F A;  5JJ7 A;  3L17 A;  4GZ5 A;  1HG2 A;  3R7R A;  3I4G A;  5KJL A;  4GZD A;  4YNM A;  4L7T A;  4AJW A;  3FU3 A;  4LER A;  5FQ4 A;  4IUL A;  3L13 A;  5JJT A;  4RSY A;  2ILR A;  1UN8 A;  2HR2 A;  4CDM A;  5G05 J;  5LCW J;  5F6K C;  3JQ0 A;  4QEP A;  2I1J A;  2I1K A;  1DNP A;  3FEX A;  2C0M A;  2PQN A;  4BSX A;  1Z6T A;  2AXU A;  3Q49 B;  5T5G A;  3KMT A;  5CHE E;  4EPZ A;  3OS5 A;  3VV0 A;  1KT0 A;  3B7R L;  3NQP A;  3CVN A;  4IN3 B;  5FQ6 A;  3OXL A;  2PM7 A;  3KEZ A;  3RO2 A;  4I51 A;  3PUK A;  2J09 A;  2OND A;  2XCB A;  4ACL A;  4A3T A;  4WAF A;  3MYV A;  4UWF A;  4APF A;  1Z3X A;  2Y4U A;  4K03 A;  3ZYQ A;  3S2A A;  4GCO A;  3PVL A;  2AW6 A;  4O30 A;  4WNG A;  3MO2 A;  4CT4 A;  1MT6 A;  3PZD A;  3FTW A;  4G26 A;  3ZN3 A;  3ZPJ A;  4L2Y A;  4ANU A;  3D9M A;  4JVS A;  3UT7 A;  2OVB A;  4MS6 A;  5FZQ A;  4F1S A;  5LP0 A;  2FF4 A;  3HVE A;  4JC8 A;  5LX8 A;  4B0Z A;  4F3V A;  1N3J A;  4XX5 A;  3MGB A;  5ANR A;  3RO3 A;  3GZ2 A;  4BX8 A;  3FTU A;  3NZS A;  4HOS A;  4FHJ A;  4G1T A;  4JEH A;  1SQM A;  5E75 A;  4YVO A;  2BF0 X;  4TRQ A;  3N71 A;  4P29 A;  4FJZ A;  3MZL B;  4J8O A;  3F9W A;  2XRY A;  4A55 A;  2XGS A;  1MHQ A;  4LUN U;  2WVI A;  3I4R B;  1TJC A;  3Q5M A;  3LY9 A;  4JHK A;  3SD5 A;  4EBA G;  2X6K A;  3S7J A;  3URZ A;  3CR3 A;  1E8X A;  1JUQ A;  3HYM B;  2QFC A;  3IHV A;  5HI7 A;  3F9X A;  3VTX A;  4C0E A;  3IHY A;  4GZ6 A;  4XZ4 A;  3CHS A;  1S0P A;  2UY1 B;  4WUY A;  3KS2 A;  3ZHE A;  4IJD A;  1E7V A;  3LY7 A;  3EJN A;  2XPZ A;  4ILG A;  4AV7 A;  1OWM A;  2CHX A;  4ABN A;  4CT0 A;  4AM9 A;  3LCA A;  2WXO A;  4J7I A;  4KYO B;  4XE0 A;  3HNA A;  4U04 A;  4BX9 A;  1NP7 A;  4I6J A;  2KM4 A;  3KMA A;  2GRL A;  3M58 A;  2VQ2 A;  4AP2 A;  5BNW A;  4I2Z A;  3OTN A;  4DI4 A;  2WXJ A;  1HXI A;  1OWN A;  4EQF A;  3EP0 A;  4RG6 A;  3KD7 A;  3FUJ A;  5CCM A;  3U3W A;  4UQY A;  3D9K A;  5J90 A;  1OWL A;  1UN9 A;  3FH7 A;  1E7U A;  3MX3 A;  5ARG A;  3SFZ A;  3LY8 A;  3ONL A;  1UJK A;  2IJG X;  5FZR A;  2WQ6 A;  4GU5 A;  2Y4T A;  1XQH A;  3FEY A;  4JA9 A;  4GZ3 A;  3UPV A;  4XI0 A;  3M54 A;  3OXF A;  4E47 A;  2WXP A;  1B89 A;  3ZYM A;  4FAD A;  3TAX A;  3ZRH A;  4Q96 A;  4NQ0 A;  3G2T A;  3AU5 A;  3M59 A;  3IBE A;  2LAH A;  3M55 A;  2A4Z A;  2KAT A;  2VSO E;  4ATG A;  2IGQ A;  1P5Q A;  2WQ7 A;  5JHA A;  2Y3A A;  3T5V A;  4LDG A;  1JWG A;  3QAR A;  4FP7 A;  4ME2 A;  3ZEF A;  4HVB A;  3U66 A;  2RG8 A;  2MOW A;  2PQR A;  3LVR E;  4PDX A;  2WXL A;  4AOF A;  3FHE A;  3VLD A;  3E4B A;  4XIF A;  2IOS A;  3CKB A;  4JHR A;  4JXT A;  4J6I A;  1H2T C;  4KT6 B;  3GZS A;  3QB2 A;  1PEG A;  5LOZ A;  3SZ7 A;  3PDN A;  5JIN A;  1ZU2 A;  4ACK A;  2KC7 A;  4N3A A;  4AIF A;  2AWI A;  3ML9 A;  1HFA A;  3QNK A;  2WXN A;  2ZU6 B;  4G11 A;  4FUL A;  3S7B A;  3KAE A;  3RIB A;  4ANV A;  2MHK A;  3QWW A;  3ASG A;  4U8H A;  1DVP A;  4UI9 K;  5CMW A;  1N6A A;  3MO0 A;  4OVV A;  4APO A;  4JZY A;  2J4B A;  1OUV A;  5T0K A;  2X6F A;  4FJY A;  4ILH B;  5FWQ A;  3U4T A;  2E0I A;  2HYZ A;  1KT1 A;  2XRZ A;  3CEQ A;  5C2Y A;  1FVF A;  1ZBP A;  5T4Y A;  3PE3 A;  4B8C B;  3CKC A;  2KZT B;  3HDX A;  4I17 A;  4U63 A;  4MRU A;  1BPO A;  4ILI A;  3PRE A;  4O6F A;  3QKY A;  5AJD A;  3ASH A;  2M63 A;  5CMY A;  2RFI A;  2KCV A;  2VTB B;  2FEZ A;  3CHO A;  3CK8 A;  4FU3 A;  4GYW A;  4GAA A;  2IFU A;  5ENN A;  4BWR A;  2W5Z A;  4DLO A;  2CG2 A;  3UQ3 A;  3D9I A;  4BY6 A;  3UUX A;  2EQX A;  1IQU A;  4HOT A;  3FUD A;  2YHC A;  3LVQ E;  4DLQ A;  4UWG A;  3I5P A;  5DBK A;  4UWL A;  3PEV B;  1NA3 A;  3EHM A;  4PS7 A;  4RVB A;  1N54 A;  3ML8 A;  4Q69 A;  3FUH A;  3QOU A;  3LDZ A;  4CGV A;  2OOE A;  2UY1 A;  3FUF A;  4JEU A;  5AJL A;  3ZYK A;  2GRM A;  3CVP A;  3PNL B;  3SW9 A;  3L08 A;  3GYZ A;  4F7A A;  5BW8 C;  3B7T A;  4KBQ A;  3QWP A;  2BUG A;  2J49 A;  2L9B A;  4N3C A;  2GGF A;  3G2S A;  4I1A A;  3TG5 A;  5A6C A;  2AXZ A;  1FCH A;  3TXM A;  4CRW A;  1MVX A;  2LSU A;  5JJ6 A;  4YPU A;  3IKO B;  4KVM A;  2LSV A;  3ASF A;  3RK6 A;  3MA5 A;  5BT1 A;  4N5C A;  2J4D A;  2XHE A;  2E2E A;  2FO7 A;  3D9J A;  4GYO A;  4EZK A;  4PS3 A;  2YHE A;  3CHR A;  1E8Y A;  3ZVV A;  2QPW A;  3FP3 A;  2IU1 A;  2WM9 A;  5JJ0 A;  3NZU A;  3ULQ A;  4ANX A;  5BUZ A;  4J7F A;  4CEM A;  3CST A;  3G2U A;  4U07 A;  3TJP A;  2WXK A;  2VYI A;  5D0O D;  3QWV A;  4AXH A;  3ZGQ A;  1TJF A;  1VDY A;  3F9Z A;  3D9P A;  3Q47 B;  2XEV A;  4GA2 A;  1INZ A;  3PUJ A;  4MKT A;  4C0M A;  3LS8 A;  4JA7 A;  4AVX A;  4CDN A;  4YVQ C;  2J07 A;  1H2U A;  4OVU A;  4U0Z A;  4DPR A;  3MKQ A;  5HQ8 A;  3CVX A;  4WWN A;  3CK7 A;  2WXH A;  4G2V A;  4CCA A;  1XNF A;  3D3M A;  3C98 A;  4LRZ A;  4N2S A;  2OV8 A;  2VGY A;  3WXX A;  2CHW A;  4J8S A;  4NUR A;  2WQH A;  3FTV A;  3B7U X;  4L2L A;  3UT4 A;  1EYH A;  3IV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...