5KJKA

Smyd2 in complex with az370
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjkA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjkA01
2QPWA 4KBQA 3AS4A 4NQ0A 1QQEA 1NA0A 3ASDA 4W9RA 3JYSA 4QENA 1NA3A 1XQHA 4IN3B 4G1TA 3ULQA 1PEGA 3M57A 2XGOA 2QFCA 2BUGA 4E47A 5LSZA 1N6CA 3SWCA 1HZ4A 3AS8A 2VGXA 1HXIA 3R9AB 4HORA 3KS2A 5T0MA 2JLBA 3RKVA 3RO2A 4ABNA 4BT8A 3LCAA 2XEVA 1IHGA 2HYZA 3UUXA 1ZU2A 4NRHB 4G23A 4AY6A 4AIFA 4CGVA 4GYWA 3CVPA 3TG5A 3URZA 3UQ3A 3DALA 1W3BA 4QEOA 3SZ7A 1P5QA 2P58C 2R5SA 4NJ5A 4I1AA 2Q7FA 3FPDA 2L6JA 4G25A 3EP0A 4GYYA 2FO7A 1H3IA 2MHKA 5LSXA 3KAEA 3N71A 3QDNA 3Q15A 5BNWA 2W5ZA 5EKQD 3U3WA 4HOSA 3OPEA 3CEQA 4YPAA 2XGMA 3ZGQA 3UPVA 5TH7A 2VGXB 5EX3A 3KMAA 4XIFA 5JJTA 4GZ6A 5CPRB 2ONDA 4RG6A 4J8OA 3RO3A 4UI9K 3S7DA 4I2ZA 2IFUA 2W5YA 2Y4TA 2RFIA 4FMUA 3K9IA 3OXFA 4J0UA 4J7IA 4YNDA 3ZFWA 4BUPA 4CGWA 3NF1A 3LY9A 4H7XA 2FEZA 4N3BA 2FI7A 4N2QA 4XI9A 4I2WA 4J7FA 3MV2B 3GYZA 3OOIA 3MKRA 3SF4A 4J8FA 3LKUA 5CHEE 5G04C 4GA2A 4UQYA 2KCVA 3CV0A 4HOTA 4WUYA 3KMJA 1A17A 5JJ6A 1ML9A 2VSNA 2V5FA 4YVQC 1IYGA 5KJLA 3QOUA 3S7BA 2YQ8A 4YPEA 3BEEA 2LSVA 3MO5A 3WXXA 3F9ZA 4JLGA 5TEGA 2HO1A 4UQXA 4MI0A 3QWPA 3EDTB 4EQFA 1OUVA 2FBNA 2HR2A 2C2LA 4CDRA 4U0UA 4C1QA 2PL2A 4BWRA 3M56A 4N39A 1YA0A 4JA9A 4A1SA 3FWVA 4U04A 4N3CA 2G46A 3ZPJA 4XI0A 5A6CA 4J83A 3M55A 3ASFA 3M59A 4AM9A 5HQ8A 5T5GA 2JV0A 5ARGA 3OXGA 2XCCA 5T0KA 4WNEA 3TGOA 3MO0A 2BQZA 1KT0A 2UY1A 4BTBA 3Q5MA 3PE3A 3ZHEA 1XNFA 3CVNA 2XPIA 2KATA 2KCLA 4MI5A 5KJNA 4YVOA 5FJYA 2VSYA 4IJ8A 1E96B 5BT1A 2YHCA 3U4TA 5EX0A 3RAYA 1QZ2A 4APOA 4N5CA 3E4BA 4GZ5A 4Z4PA 4RZ0A 4WNGA 3ASHA 4WNFA 3GZ1A 3IEGA 5AYFA 2FF4A 3Q47B 4JL0A 4AU7A 1FCHA 3RJVA 5FT9A 4G24A 2KC7A 4RG9A 2E2EA 4O6FA 1TJCA 4BTAA 3F9WA 4IJDA 2OOEA 4JHRA 5FTPA 2PQNA 2LSUA 3S7FA 4H7YA 3PDNA 2UY1B 3Q4AB 3MA5A 4I51A 4F3VA 3ZHEB 3VUZA 5DBKA 4AY5A 3Q49B 5BW8C 5G04J 1ELWA 3KD7A 3LY8A 4GPKA 5KJMA 3RIBA 4UI9J 1KT1A 3S8PA 4GCOA 2VQ2A 1Y8MA 3VV0A 4GYOA 3HYMB 4GCNA 4UI9C 1ZKKA 2C0MA 2Y4UA 3CBMA 2AVPA 4NVQA 2KCKA 5C1DA 2IF4A 3GZ2A 4GZ3A 3HNAA 3KMTA 1N6AA 2I6HA 2NC9A 3CKBA 1MVHA 1PC2A 1B89A 3GW4A 4KYOB 4BT9A 5JHNA 4G26A 2GW1A 5F6LA 4H12A 2F69A 3M58A 5JJ0A 3FFLA 4HOQA 5DIZA 5EG2A 3MV3B 3PE4A 4I9EA 5JIYA 3ZN3A 4YNMA 5A7DB 3CBPA 3FP3A 2J9QA 5AYWD 4Y6WA 3LPZA 3M53A 5D0OD 3CK9A 4YPUA 3TG4A 1O9SA 3F9YA 3CK7A 1ZBPA 3ESKA 5F5EA 2WPVA 5FZRA 5JJ7A 3QWWA 2LNIA 5LCWJ 5D0QD 3MEKA 2PZIA 1ELRA 3O48A 2DBAA 3OXLA 4UQZA 5LCWC 3RJWA 5JINA 4J8EA 3OS5A 3CK8A 3CVLA 4WNDA 1WM5A 5KJKA 1KLXA 2VGYA 3ASGA 4YNPA 4O30A 3DB5A 3VTYA 4LDGA 4G2VA 4HOUA 4J8DA 5F59A 3RU0A 4U07A 4Y6CA 3M54A 4I9CA 4LEUA 1N3JA 3QWVA 4B94A 3S7JA 3CBOA 3QKYA 2C0LA 4I17A 3CVQA 5CCMA 4N2SA 3M5AA 5HI7A 2XGSA 4KXKB 3CKCA 2IGQA 3IHXA 3AS5A 1MUFA 2O8JA 3SW9A 5G05J 2VYIA 3K5KA 5FZSA 3TAXA 4QEPA 4GA1A 2PQRA 2R3AA 4JA7A 1NZNA 5ARFA 5TTFA 3LYAA 5G05C 1MVXA 5FZQA 3RQ4A 1HH8A 2XCBA 3VTXA 3BO5A 2WQHA 1WAO1 4GA0A 5CCLA 4U0ZA 3LY7A 5F6KC 3MO2A 4JDSA 5M72A 4U0SA 1MT6A 4N3AA 3F9XA 4ME2A 2UWJG
chains in the Genus database with same CATH superfamily
2QYUA 4BETA 3D9NA 3IBEA 4NQ0A 4WWOA 3ZEFA 1HE8A 2EINE 3SY2A 3AG2E 5HRYA 5EIBE 3M57A 1H2VC 3PZ3A 3NBNB 5LSZA 3SWCA 1HZ4A 2XZTG 3KS2A 3JUIA 1NL4A 4ABNA 4BT8A 3UUXA 1MJ0A 1ZU2A 2LAIA 2XEEA 4CGVA 4DX1A 2R2LA 5D66A 4BFRA 4EZLA 3DALA 1A5EA 1W3BA 3RRMB 2WXMA 4QEOA 4JW1A 3PEUB 2R5SA 3NAWA 3CSFA 2Q7FA 4JXTA 5T3RA 3ONLA 3TJPA 4LG6A 3ABKE 3VLEA 3MZLB 2MHKA 4YDEA 4APFA 2F8YA 2L6BA 3JXIA 2W5ZA 5EKQD 4DLOA 4O1OA 5ENRD 4ATZD 3U3WA 3ZGQA 5EX3A 1HX8A 3KMAA 2B6CA 4GZ6A 4GMLA 2ONDA 1U2VG 4J8OA 3L54A 3ASOE 2W5YA 3V2XA 2HE0A 1ZB1A 4J0UA 3DSSA 3ZFWA 2RKKA 4M3OA 4BUPA 4DX5D 3R9MA 4CGWA 2WXRA 5KCMA 1FT1A 3FH5A 2FI7A 2P9UG 1E90A 3HXBA 3OOIA 5CRUA 3V2OA 3SF4A 2VJ8A 2J08A 3Q75A 5CHEE 3D3MA 3L82A 2KZTB 3CV0A 4PS8A 4HOTA 5G2NA 4WUYA 1PY1A 3C98A 3PNTB 3DEOA 2IO2C 2R17C 2VSNA 1IYGA 3T8KA 5KJLA 3QOUA 4IYPA 4E6HA 4JPSA 4YPEA 3MO5A 4U8VD 5TEGA 3ZXSA 2HR2A 5CMWA 3U64A 4OAVB 2PL2A 2WXNA 4ILIA 4A1SA 4EECA 4N3CA 2G46A 5B1AE 3ZPJA 3I4RB 4XI0A 4B8CB 4U8HA 1FVHA 2P9SG 1E8WA 1UW4B 1O1TA 2JV0A 5ARGA 5CEAA 3R7QA 4CT0A 3L6AA 5LP0A 5CRVA 3Q5MA 4L1BA 3UMVA 1E7VA 2XPIA 3E34A 2KATA 2WXLA 2ETBA 4N5QA 4LRZA 5FJYA 4IJ8A 2YHCA 3B7UX 3U4TA 5EX0A 1BD8A 1H6OA 1Z6TA 1KZPA 4O60A 4Z4PA 1ELKA 3ASHA 3IEGA 3MYVA 3QB2A 4X8QA 3Q47B 2GRQB 4J8YA 2HM8A 1YCSB 4TUUA 4AJWA 3F9WA 1TJCA 2ZIRA 5ENTD 4ZFHA 5FTPA 3S7FA 3UKRG 3AAAC 2UY1B 3UT7A 2IONA 2LUHA 2DVWA 3AU4A 3ZHEB 3CHSA 1EPUA 5BW8C 1BPOA 4GMRA 2AXZA 5EIDA 2VQ2A 4Q96A 5BV1A 1ZKKA 1TYQG 2IU1A 2Y4UA 4AP2A 3D9HA 3EHMA 3J5QB 2IF4A 3V31A 5CERB 3HNAA 3KMTA 2L0IA 5AQBA 2NC9A 2AWIA 1N54A 3SFYA 4F1PA 2DYRE 1NFIE 4FLHA 1B89A 3EHQA 1G3NB 3FEXA 2DIWA 1TN6A 3HIZA 3FTSA 5J90A 4HVBA 5BXOA 4TXQA 4EBAA 3PE4A 4GTSA 1N94A 3CBPA 3LPZA 3M53A 1IQRA 3ESKA 5F5EA 3FU3A 5JJ7A 3QWWA 2XENA 5D0QD 3PZDA 3MEKA 3AG4E 3RJWA 2CHZA 3TWWA 3OS5A 1OXJA 2XPZA 4U96D 3SO8A 1N4RA 3I3NA 1WM5A 3AJIA 5KJKA 4HBDA 2XPYA 2Y69E 3ASGA 4YNPA 3D9JA 4O30A 4LNUD 3ZIMA 4LDGA 4TXRA 5HS0A 4K0RA 4EZKA 5F59A 4LUNU 4I6EA 3RU0A 4G8LA 3CHOA 4FLBA 2WB2A 4URKA 1H2UA 4B94A 3HVEA 1Y6IA 3ONKA 3PREA 3L16A 3UINC 3CHMA 1JCRA 2XGSA 3CKCA 4HNAD 4JEHA 4DI3A 1MUFA 3HHMA 3TWSA 2J8SD 3IV0A 2XRYA 4GA1A 1TNUA 3S2AA 2KBXA 3O4ZA 3LYAA 5G05C 5HKPA 1MVXA 2H6FA 4UWKA 1KZOA 5FZQA 4L23A 1DNPA 3FDHA 4Q69A 3LJ3A 1PAQA 2WQHA 3P2BA 5M72A 4N3AA 3HDXA 4ME2A 3Q79A 4NIKA 4Z68A 3AS4A 1NA0A 3IXEA 3MJWA 3ULQA 2V4HC 1PEGA 5KBAA 3ENEA 4ILHB 2QFCA 3NQPA 2ILRA 1EF1C 1OWMA 2A4ZA 2MOWA 3AS8A 2VGXA 2CG3A 2WXQA 2P9IG 2JLBA 1IHGA 3D9LA 3SBSA 4GYWA 3NB2A 4BX8A 2ZXWE 4ATGA 2XS8A 3V79K 4GTVA 1QNFA 4LSZE 2L6JA 3EP0A 3RSEG 4HS2A 4EBAG 1H3IA 4U95D 3N71A 5KNHD 4HOSA 3CEQA 3MGBA 2XGMA 2MRIA 3FUKA 5TH7A 2NSZA 3PUKA 4FULA 3WG7E 2X6KA 4HQDA 1MQSA 5FWQA 4FHKA 4UI9K 3ULYA 2B0OE 3SBTB 4AVXA 4GMJA 3L17A 4B8AA 1OWOA 1GW6A 2V8SE 2ZGGA 4FJZA 1V54E 3JXJA 3OXFA 4YNDA 1TEZA 3NF1A 4H7XA 2XRZA 2FEZA 4HLEA 4N3BA 4I2WA 3GYZA 4P29A 4V3IA 3FUNA 5FQ4A 4J8FA 3LKUA 4GA2A 1YMPA 4UQYA 5FINA 2KCVA 3FULA 2WXIA 3PVLA 2X3MA 3Q7FA 3UM3A 1A17A 5JJ6A 5AIJA 3LVRE 1LD7A 3CVWA 3TWVA 2NXPA 2F0YA 5ENPD 3BEEA 1MX6A 3F6QA 4A3VA 3WXXA 2EQXA 3F9ZA 4JLGA 1N52A 2LXMA 1OUVA 4JC8A 3ZYLA 2C2LA 3HXFA 4C1QA 4BWRA 5CBNA 3C3OA 3JCKC 4N39A 1YA0A 4JA9A 3FWVA 4U04A 5A6CA 4DRXE 4J83A 3M55A 2WXOA 3PEVB 4ILGA 5T5GA 3FTUA 3C72A 3MCXA 3RRNB 3MKQB 2XCCA 2BQZA 4BTBA 3PE3A 3FUMA 2ZGDA 2J07A 5CEDB 3IHVA 2M63A 3CVUA 3TWRA 1S0PA 4I6GA 1QZ2A 3DXMG 4K5CA 4FC8A 4PH4B 4RZ0A 4WNGA 4WNFA 3UM2A 5AYFA 2FF4A 3C3QA 4PS3A 1FCHA 2CHXA 4XZ4A 4OYSA 1E7UA 5FT9A 3RRUA 3U9WA 2KC7A 3MX3A 3ABLE 4O6FA 2OOEA 2PQNA 3EU9A 2LSUA 2EIKE 3DSWA 2F8XK 2A5UA 5KNGA 3Q4AB 2AXUA 2RG8A 4I51A 2IOSA 1H19A 4QQIA 3ZYQA 4CRWA 5DBKA 2GROB 1E8XA 3Q49B 1L5JA 1S63A 1ELWA 3LY8A 2XQ0A 3RIBA 3G2TA 2L9BA 1KT1A 4BESA 1YYHA 1Y8MA 4FU3A 3VV0A 1RW2A 4KVMA 3V30A 3JQ1A 3HYMB 4UI9C 2C0MA 3MKQA 2H6GA 3CHRA 1IKND 1JWFA 5EDSA 3GZ2A 5CMYA 1N6AA 3TWQA 1OWLA 5AJLA 3CKBA 3FTVA 4FA6A 1OY3D 3GW4A 3ZKJA 4KYOB 2R02A 5F6LA 4H12A 4HXIA 3ASNE 4LERA 5JJ0A 2A5EA 2I2OA 5LFAA 3MV3B 5AENA 4D10C 2J49A 1K8KG 3IKOB 4I9EA 4FADA 3QNKA 4YNMA 3FP3A 4JB8P 5D0OD 3CK9A 3TG4A 3B7TA 2R05A 4B0ZA 1ZBPA 2CFUA 5G55A 5JHAA 2EIME 1Q2ZA 2LNIA 5ANLA 3CVXA 2BKKB 1O1RA 2V0PA 1WY6A 2CG2A 4KZCA 3HXCA 4UQZA 3OXLA 3LXUX 5LCWC 4MBGA 3ZYMA 3NZUA 4CT4A 5JMND 5E75A 1N4PA 2PM7A 1DCQA 1TNBA 4HLLA 3Q73A 4EPZA 2I1JA 4J8DA 5BUZA 4U07A 2RFAA 4I9CA 5KWDA 1K1BA 3C5RA 5AQ9A 3QJZA 4JEUA 1N4QA 2WXFA 2FO1E 3B95A 2C0LA 4I17A 3I5PA 3J5PA 5HI7A 4GTPA 3APCA 2IGQA 4J8SA 3IHXA 4EZJA 3SW9A 2V4LA 2VYIA 3K5KA 1N4SA 5FZSA 2WXHA 4QEPA 5AQAA 1Z3XA 4F7AA 3DSUA 4FJYA 4I43A 2PM6A 3VTXA 3BO5A 3QK0A 4RLYA 3DBSA 4U0ZA 1OCCE 1K1AA 4U7EB 3AG3E 4JDSA 4AEZC 4A63B 1MT6A 2WXKA 2OEWA 3UIOC 2Y1LE 3HVEB 3SHFA 1IQUA 1TN7A 2QPWA 1KPSB 4KBQA 1QQEA 1N0QA 2J4DA 3FUJA 4G1TA 5J08A 1WDYA 2XGOA 2BUGA 4GTTA 1N6CA 4RVBA 1Z5SC 4F53A 1HXIA 2X6JA 3DWLG 4WWPA 4A3TA 3EHRA 1SW6A 5T0MA 2NYJA 3RO2A 4JZYA 2XEVA 2HYZA 1MZCA 1UJKA 2DYSE 4MS6A 3DEPA 4K5AB 4NRHB 4PS7A 4L9PA 3ZUVB 1N95A 3GZSA 3TWTA 3CVPA 3TG5A 3CHQA 3UQ3A 3W9GA 3ZVVA 3VLFA 3PRZA 3TWUA 5AQ7A 4DX2A 2P58C 2WVIA 3FPDA 4G25A 4TXPA 4GZCA 4GYYA 2FO7A 3CVVA 1HG5A 4GTMA 4YPAA 4DJAA 2VGXB 5JJTA 3LVQE 4C9BB 3CIAA 1JCQA 1JWGA 4L2LA 4RG6A 3RO3A 3S7DA 4OVUA 2IFUA 2YHEA 2RFIA 4FMUA 3K9IA 4OAUC 5A23A 4J7IA 1JUQA 2WMNA 4JHKA 2QZAA 3MV2B 5JHBA 1BU9A 2QYJA 5BXUA 1DC2A 2VSOE 1RZ4A 1N0RA 3P1UA 2DZNA 4R7LA 2J4BA 4GTOA 5LX8A 5B3SE 3KMJA 3FH7A 2P9PG 1ML9A 2H6HA 4E85A 3T5XA 1FPPA 3S7BA 4CCAA 2YQ8A 4EHMA 4K03A 4TUMA 3SI5A 1FT2A 2KXPC 3SD5A 3PNLB 4UQXA 3D9KA 3QWPA 3ABME 2FBNA 2I1KA 2MYOA 2XZDG 1HO8A 4CDRA 4U0UA 2P2CP 3M56A 5T4YA 2LXLA 3PH0C 4JD2G 4BERA 2R03A 2IEJA 4XX5A 1X81A 3ASFA 4RQIA 5ANRA 3OXGA 1TNZA 2BKGA 2LO6A 4PDXA 2DZOA 1XNFA 3CVNA 4KT6B 4RSYA 2JABA 1LTXA 3LEWA 5KJNA 4YVOA 2VSYA 4O1PA 3NOGD 3UIPC 3RAYA 1OCRE 4DX6D 1FVFA 3SNXA 4A55A 4JL0A 4AU7A 2IY0C 3RJVA 2X38A 1DVPA 2QC9A 4G24A 1N9AA 2WXGA 4G8KA 2E2EA 4BTAA 4IJDA 3RAUA 2ZISA 4H7YA 3BQOA 3PDNA 3B7SA 2P9LG 3MA5A 4F3VA 1INZA 3UKUG 3FUEA 5G04J 3KD7A 2IJGX 4YDWA 3DXKG 4DK5A 3APFA 2VTBA 2AJAA 2YNQA 3L22A 4GCOA 4GYOA 1HF8A 4GCNA 2Y3AA 4ANXA 4LCTA 3L9TA 4I6JA 3CBMA 2AVPA 2EIJE 3G2WA 4NVQA 4Q94A 1X5BA 3DPYA 3FU5A 2I6HA 4CEMA 4HRNA 4L7TA 2XHEA 4KMOA 3PZ2A 4IRUA 3RK6A 4BSZB 3M58A 3FFLA 1TNYA 5DIZA 2OCCE 2BF0X 2F37A 5JIYA 3L08A 3ZN3A 2X6FA 3DPDA 1SA5A 3FH8A 2J9QA 1LF8A 5FIOA 3FUHA 2KM4A 4Y6WA 3D9OA 3QAQA 4HI8A 1HFAA 1O9SA 2CFZA 3CK7A 4CYMD 2ETCA 2WMOA 1DCEA 3LDZA 2PZIA 3EIQC 4LNBA 3O48A 2GRNB 3ULEG 3G2SA 4HI9A 4TRQA 4XE0A 2DBAA 4B89A 1BI8B 2EILE 4GTRA 4B93B 5JINA 3HXEA 4J8EA 3CK8A 1S64A 3CVLA 3SFZA 4WNDA 3TWXA 3AU5A 4DX7D 4DUIA 1KLXA 4UWGA 1D9SA 3VTYA 1BI7B 1AWCB 1XGWA 5FQ7A 4HB5A 4WAFA 2OV8A 1OWNA 1JPLA 5CECB 3BG1B 3E37A 5T8IA 2WQ6A 3UTMA 1JCSA 3M54A 1N3JA 3EUVA 1UG3A 3QWVA 4UUCA 3ZRHA 4GU5A 4CDNA 3TXMA 4A1GA 2J09A 5CCMA 3CVQA 1SZAA 3KSLA 3EIJA 3TXNA 2GRRB 5G05J 3DSTA 1LD8A 2R3AA 2QY7A 4DLQA 3LS8A 1NZNA 5ARFA 5TTFA 5D2MC 5C2YA 3ESLA 3RQ4A 1HH8A 3JQ0A 4MLPA 1U3CA 4MRUA 4UWLA 4GA0A 5CCLA 3FY4A 4DI4A 3MO2A 4J6IA 3IHYA 2PNNA 4HFGA 5ENOD 3DRAA 3F9XA 3KEZA 2UWJG 3HRAA 1SQMA 4W9RA 3ASDA 3W9FA 4YDOA 3JYSA 4QENA 1NA3A 1XQHA 4IN3B 3G2VA 1UOHA 4E47A 4CDMA 3I4GA 2IO3C 3Q78A 4AV7A 2JEKA 3QARA 3CHPA 4QFVA 3NZSA 1E8YA 2RD0A 3R9AB 4HORA 5H7PA 3RKVA 3LCAA 3CR3A 1SZ9A 1TJFA 4AOFA 3B7RL 3Q7AA 4G23A 4AY6A 4AIFA 3G2UA 1O5MA 4BSXA 1BLXB 5AN8A 3URZA 1E8ZA 3C3RA 1OCZE 1NI1A 2OEVA 1OWPA 5EILA 3SZ7A 1P5QA 1V55E 4NJ5A 3ML9A 4I1AA 2VSXE 5LSXA 3KAEA 1MX4A 3QDNA 3APDA 3Q15A 5BNWA 3T9KA 3OPEA 2KZTA 3UPVA 1QYMA 3EU5A 4G11A 4XIFA 5FQ6A 3FTZA 2DWZA 3VLDA 2GGFA 5AJDA 5CPRB 5ENNA 2Y0BG 2WXJA 4I2ZA 3FHEA 2Y4TA 4BY6A 3CQGB 2XEHA 4ACLA 3LY9A 4GTQA 3NOCD 4N2QA 4XI9A 4J7FA 4FP7A 1OCOE 1HS6A 4I1OB 4J7WA 4HRMB 3MKRA 5BPPA 4ACKA 2LAHA 5ENSD 2AXVA 5G04C 3DSVA 2BTDA 3ML8A 2V5QC 2XS1A 3Q9UC 3E33A 1NP7A 4XKCA 4ANUA 4GPMA 1SVXA 2V5FA 4XEIG 4YVQC 5E76A 4MKTA 2GRMA 3E32A 3B13A 3CQCB 2BEDA 5ITZF 3QC1A 3U66A 2LSVA 3UT8A 1MHQA 2OVBA 2HO1A 5EYLA 4MI0A 5ENQD 3EDTB 4EQFA 2VGEA 3T5VA 4F1SA 2RFMA 3UI2A 4GZDA 1TN8A 1D8DA 4FHJA 3M59A 4AM9A 5HQ8A 3PZ4A 1N11A 1HU3A 1TNOA 3TL5A 3D9IA 5T0KA 1H2TC 4WNEA 3TGOA 3MO0A 1KT0A 2UY1A 3FTXA 2I9CA 3ZNGA 3LJNA 3ZHEA 3ZYKA 3HXDA 1UN9A 2IQCA 2KCLA 3FTYA 4MI5A 4UWFA 1E96B 5BT1A 3KEAA 3CSTA 4M7CA 4APOA 1K3ZD 4K5BA 4N5CA 3E4BA 4GZ5A 4JVSA 5IY5E 3GZ1A 1EDUA 5JA4D 3E30A 3FUIA 4GB9A 4RG9A 5EYPF 4JHJA 2FULA 1U3DA 3FUDA 4JHRA 3X2QE 4BX9A 4IULA 2DCPA 5CBOA 3PS6A 3VUZA 4AY5A 2WQ7A 4HRLA 3T8MA 5LOZA 4GAAA 2E0IA 3Q9NC 4GPKA 5KJMA 4UI9J 3FU0A 2L0TB 3S8PA 3UM0A 1SA4A 1HG2A 3ISMC 1O1SA 2R59A 3B7BA 2KCKA 3UXGA 5C1DA 4GZ3A 2IOLA 3FU6A 1MVHA 1UN8A 5EN5D 1PC2A 3UM1A 3CGHA 5AARA 1S70B 4BT9A 3FTWA 4UWHA 1TR4A 4G26A 5JHNA 2GW1A 3FEYA 3ZU7B 2F69A 1D8EA 4C48B 4HOQA 4DPRA 5EG2A 4PUCA 1QBQA 1WG0A 3PZ1A 3OTNA 5A7DB 4C0MA 1AP7A 2VTBB 4U8YD 4LNGA 4NURA 3SFXA 4KVOA 5AYWD 3ZW3A 4YPUA 3ZXPA 3AG1E 3F9YA 1IXVA 3OAWA 2WPVA 5FZRA 5LCWJ 4ANVA 4F6RD 2YINA 4TV3A 3BUAA 2H6IA 4KZ0A 1EYHA 1ELRA 2X6IA 3EHNA 3SGHA 3UT4A 1UJJA 3KSQA 3FUFA 2P9KG 3DSXA 1MYOA 3SQVA 2VGYA 1IHBA 5BV0A 4OVVA 3CVYA 3DB5A 4G2VA 2AW6A 3UX4A 4HOUA 1Z3YA 4AXHA 4BEPA 4Y6CA 1H0AA 3CLJA 4LEUA 2X6HA 4ANWA 4WWNA 4L2YA 1VDYA 3PUJA 3S7JA 3EJNA 3CBOA 4C0EA 3QKYA 2GRLA 4N2SA 2WM9A 3M5AA 3D9MA 3D9PA 4KXKB 2P9NG 5B1BE 3AS5A 2O8JA 1H6PA 3TAXA 4ZHBA 2PQRA 5AAOA 2ZU6B 4JA7A 3R7RA 3JUEA 4YDYA 3L13A 4U63A 2GRPB 2XCBA 4NACA 4XKBA 1WAO1 3HG0D 2CHWA 2WXPA 3LY7A 5F6KC 5FQ8A 4CZ2D 4U0SA 2ETAA 4I1MA 3BU8A 2OVFA 1H6KA 1MX2A 3BG0B 1OT8A
chains in the Genus database with same CATH topology
1SQMA 2QPWA 3D9NA 3IBEA 3AS4A 4KBQA 4NQ0A 1QQEA 1NA0A 3ASDA 4W9RA 3JYSA 4QENA 4WWOA 2J4DA 1HE8A 3ZEFA 1NA3A 1XQHA 4IN3B 3FUJA 3MJWA 4G1TA 5J08A 3G2VA 3ULQA 1PEGA 3ENEA 3M57A 1H2VC 2XGOA 2QFCA 4ILHB 3NQPA 2BUGA 4E47A 4CDMA 2ILRA 3I4GA 4AV7A 2JEKA 5LSZA 1EF1C 1N6CA 4RVBA 1OWMA 2A4ZA 2MOWA 3QARA 1HZ4A 3SWCA 3CHPA 4QFVA 4F53A 3NZSA 3AS8A 2VGXA 1E8YA 1HXIA 2CG3A 2RD0A 2X6JA 2WXQA 4WWPA 3R9AB 4A3TA 4HORA 3KS2A 3JUIA 2JLBA 3RKVA 3RO2A 4JZYA 4ABNA 3LCAA 2XEVA 4BT8A 5T0MA 3CR3A 1IHGA 1SZ9A 1UJKA 2HYZA 3D9LA 4MS6A 1TJFA 4AOFA 3UUXA 1ZU2A 4NRHB 3B7RL 4PS7A 3SBSA 4G23A 2LAIA 4AY6A 4AIFA 3G2UA 3GZSA 4CGVA 4BSXA 4GYWA 3CVPA 4BFRA 3TG5A 4EZLA 3URZA 3CHQA 1E8ZA 3UQ3A 4BX8A 3DALA 4ATGA 1W3BA 3RRMB 3ZVVA 3VLFA 2WXMA 4QEOA 1OWPA 3PRZA 3SZ7A 1P5QA 2P58C 4JW1A 1QNFA 3PEUB 2R5SA 3ML9A 4NJ5A 4I1AA 3CSFA 2Q7FA 2WVIA 4JXTA 3ONLA 5T3RA 2L6JA 4G25A 3EP0A 3TJPA 3FPDA 4HS2A 4EBAG 3VLEA 4GZCA 4GYYA 2FO7A 3MZLB 3CVVA 1H3IA 2MHKA 2VSXE 5LSXA 3KAEA 3N71A 4APFA 3QDNA 3APDA 3Q15A 5BNWA 1HG5A 2W5ZA 5EKQD 4DLOA 3U3WA 4HOSA 3OPEA 3CEQA 4YPAA 2KZTA 3MGBA 2XGMA 3ZGQA 2MRIA 4DJAA 3FUKA 3UPVA 5TH7A 2NSZA 2VGXB 1HX8A 5EX3A 3PUKA 4G11A 3KMAA 4FULA 4XIFA 5FQ6A 5JJTA 2X6KA 3FTZA 3LVQE 1MQSA 3VLDA 4C9BB 3CIAA 5FWQA 4GZ6A 2GGFA 4GMLA 5AJDA 5CPRB 1JWGA 4L2LA 4FHKA 2ONDA 5ENNA 4RG6A 4J8OA 3RO3A 4UI9K 3S7DA 4OVUA 2WXJA 4I2ZA 3SBTB 2IFUA 3FHEA 3L17A 3L54A 4GMJA 2YHEA 4AVXA 2W5YA 2Y4TA 1OWOA 4B8AA 1GW6A 2V8SE 2RFIA 4FMUA 4BY6A 4FJZA 3K9IA 3CQGB 3OXFA 4J0UA 5A23A 4J7IA 4YNDA 3ZFWA 1TEZA 1JUQA 4M3OA 4ACLA 4BUPA 4CGWA 3NF1A 2WMNA 2WXRA 3LY9A 4H7XA 5KCMA 2FEZA 2XRZA 4HLEA 4JHKA 4N3BA 3FH5A 2FI7A 4N2QA 4XI9A 4I2WA 4J7FA 3MV2B 3GYZA 4FP7A 5JHBA 1E90A 4P29A 4V3IA 1HS6A 4I1OB 3FUNA 3MKRA 5BPPA 3OOIA 3SF4A 5FQ4A 2VSOE 4ACKA 2LAHA 2VJ8A 2J08A 2AXVA 4J8FA 3LKUA 3P1UA 5CHEE 3D3MA 4R7LA 5G04C 4GA2A 4UQYA 2KZTB 2KCVA 3CV0A 3FULA 2WXIA 3PVLA 2J4BA 2BTDA 4PS8A 4HOTA 3ML8A 2X3MA 5G2NA 4WUYA 5LX8A 1PY1A 3C98A 3KMJA 1A17A 1NP7A 3PNTB 3FH7A 5JJ6A 4XKCA 1ML9A 4ANUA 2R17C 2VSNA 2V5FA 4YVQC 5AIJA 5E76A 4E85A 3LVRE 1IYGA 3T5XA 4MKTA 5KJLA 3QOUA 3CVWA 2GRMA 3S7BA 4IYPA 2YQ8A 4CCAA 4K03A 2NXPA 4E6HA 3B13A 3SI5A 3CQCB 4JPSA 4YPEA 3QC1A 3SD5A 3BEEA 3U66A 5T0KA 4A3VA 2LSVA 3UT8A 3MO5A 3WXXA 1MHQA 2OVBA 2EQXA 3PNLB 3F9ZA 4JLGA 5TEGA 2HO1A 1N52A 4UQXA 4MI0A 3D9KA 3QWPA 3EDTB 4EQFA 1OUVA 2FBNA 4JC8A 3ZYLA 2HR2A 2I1KA 3ZXSA 3T5VA 4F1SA 5CMWA 1HO8A 2C2LA 4CDRA 3U64A 4U0UA 4GZDA 2PL2A 4C1QA 4BWRA 2WXNA 4ILIA 3JCKC 3M56A 5T4YA 4N39A 1YA0A 4JA9A 4A1SA 4EECA 3FWVA 3PH0C 4U04A 4N3CA 2G46A 3ZPJA 3I4RB 4XI0A 5A6CA 4FHJA 4XX5A 4B8CB 4J83A 3M55A 3ASFA 2WXOA 1FVHA 3PEVB 4ILGA 4U8HA 3M59A 1E8WA 4AM9A 1UW4B 5HQ8A 3FTUA 5T5GA 3MCXA 5ANRA 5ARGA 3OXGA 3RRNB 2JV0A 1HU3A 3MKQB 3L6AA 3R7QA 2XCCA 3D9IA 3TL5A 4CT0A 1H2TC 4WNEA 3TGOA 2LO6A 5LP0A 2BQZA 1KT0A 2UY1A 3FTXA 3MO0A 2I9CA 4PDXA 4BTBA 3Q5MA 3PE3A 4L1BA 3UMVA 1E7VA 3ZHEA 1XNFA 3CVNA 2XPIA 4KT6B 4RSYA 3ZYKA 3FUMA 1UN9A 3LEWA 2J07A 2KATA 2WXLA 2IQCA 2KCLA 3FTYA 4MI5A 3IHVA 5KJNA 2M63A 4YVOA 4LRZA 4UWFA 2VSYA 5FJYA 1E96B 3CVUA 5BT1A 2YHCA 4IJ8A 3B7UX 3U4TA 3CSTA 5EX0A 1S0PA 3RAYA 4I6GA 1QZ2A 1Z6TA 4APOA 4N5CA 3E4BA 4FC8A 4GZ5A 1FVFA 4PH4B 4Z4PA 1ELKA 4JVSA 4RZ0A 4WNGA 3ASHA 4WNFA 3GZ1A 3IEGA 1EDUA 3MYVA 3CBOA 5AYFA 2FF4A 3QB2A 3Q47B 3SNXA 4A55A 4JL0A 4PS3A 4AU7A 1FCHA 2CHXA 4XZ4A 4OYSA 3RJVA 2HM8A 3FUIA 2X38A 1DVPA 1E7UA 5FT9A 4G24A 3RRUA 4TUUA 3U9WA 4AJWA 2WXGA 2KC7A 4GB9A 4RG9A 3MX3A 2E2EA 4O6FA 1TJCA 4BTAA 3F9WA 4IJDA 4JHJA 2OOEA 2FULA 1U3DA 3FUDA 4JHRA 5FTPA 2PQNA 4BX9A 2LSUA 4IULA 3S7FA 4H7YA 3PDNA 2DCPA 2A5UA 3B7SA 2UY1B 3UT7A 3Q4AB 2IONA 2AXUA 3PS6A 3MA5A 2RG8A 4I51A 3AU4A 4F3VA 2IOSA 3ZHEB 1H19A 3CHSA 1EPUA 3ZYQA 1INZA 4CRWA 3VUZA 5DBKA 4AY5A 2WQ7A 3T8MA 1E8XA 3FUEA 5LOZA 3Q49B 4GAAA 1L5JA 5G04J 5BW8C 2E0IA 1ELWA 2IJGX 3KD7A 1BPOA 3LY8A 4GPKA 5KJMA 2XQ0A 4DK5A 3APFA 3RIBA 4UI9J 3G2TA 2VTBA 3FU0A 2L9BA 1KT1A 2L0TB 2YNQA 2AXZA 3L22A 3S8PA 4GCOA 2VQ2A 1Y8MA 4FU3A 4Q96A 3VV0A 4GYOA 5BV1A 1HF8A 4KVMA 3JQ1A 1HG2A 3HYMB 4GCNA 2Y3AA 4UI9C 4ANXA 1ZKKA 2C0MA 2IU1A 2Y4UA 3MKQA 3CHRA 4I6JA 4LCTA 4AP2A 3CBMA 2AVPA 3G2WA 1JWFA 3EHMA 2R59A 4NVQA 2KCKA 4Q94A 5C1DA 2IF4A 5EDSA 1X5BA 3GZ2A 4GZ3A 5CMYA 3FU5A 3HNAA 3KMTA 2L0IA 1N6AA 2I6HA 2NC9A 2AWIA 2IOLA 1OWLA 4CEMA 5AJLA 1N54A 3CKBA 3FU6A 1MVHA 1UN8A 4L7TA 1PC2A 2XHEA 3FTVA 4FLHA 1B89A 4KMOA 4FA6A 3CGHA 3GW4A 4KYOB 4BT9A 3FTWA 3FEXA 4UWHA 5JHNA 2DIWA 4G26A 4IRUA 2GW1A 5F6LA 3HIZA 3FTSA 3FEYA 5J90A 4HVBA 4H12A 4HXIA 2F69A 3RK6A 3M58A 4LERA 5JJ0A 4EBAA 3FFLA 4HOQA 4DPRA 5DIZA 4PUCA 5EG2A 2I2OA 5LFAA 3MV3B 5AENA 3OTNA 3PE4A 4D10C 2J49A 3IKOB 4I9EA 2BF0X 5JIYA 4FADA 3L08A 3QNKA 3ZN3A 4YNMA 2X6FA 5A7DB 4C0MA 3DPDA 2VTBB 4NURA 3CBPA 3FH8A 4KVOA 3FP3A 2J9QA 1LF8A 5AYWD 3FUHA 2KM4A 4Y6WA 3ZW3A 3D9OA 3LPZA 3QAQA 3M53A 5D0OD 3CK9A 4YPUA 3TG4A 1HFAA 1O9SA 1IQRA 2CFZA 3B7TA 3F9YA 4B0ZA 3CK7A 1ZBPA 2CFUA 5G55A 3ESKA 2WMOA 3OAWA 5JHAA 5F5EA 3FU3A 2WPVA 5FZRA 5JJ7A 3QWWA 2LNIA 5ANLA 5LCWJ 5D0QD 4ANVA 3CVXA 2YINA 3PZDA 4TV3A 3MEKA 3LDZA 4KZ0A 1EYHA 2PZIA 3EIQC 1ELRA 2V0PA 1WY6A 2CG2A 4KZCA 2X6IA 3O48A 3EHNA 3G2SA 4XE0A 3SGHA 4TRQA 2DBAA 3OXLA 3LXUX 4UQZA 3UT4A 5LCWC 1UJJA 3RJWA 2CHZA 4B89A 3ZYMA 3NZUA 5JINA 4J8EA 3FUFA 4CT4A 3OS5A 3CK8A 5E75A 3CVLA 3SFZA 2XPZA 4WNDA 3I3NA 2PM7A 3AU5A 1WM5A 5KJKA 2XPYA 1KLXA 2VGYA 4UWGA 5BV0A 3ASGA 4OVVA 3D9JA 4YNPA 4O30A 3CVYA 3ZIMA 3DB5A 3VTYA 4EPZA 4LDGA 4G2VA 2AW6A 2I1JA 3UX4A 1XGWA 4K0RA 5FQ7A 4HOUA 4J8DA 2OV8A 4WAFA 4EZKA 1OWNA 5BUZA 5F59A 1Z3YA 4LUNU 4AXHA 4I6EA 1JPLA 3BG1B 3RU0A 5T8IA 2WQ6A 4U07A 4Y6CA 3M54A 4I9CA 1H0AA 3CLJA 4LEUA 1N3JA 3QWVA 1UG3A 2X6HA 3CHOA 4ANWA 4WWNA 4L2YA 4FLBA 3ZRHA 4GU5A 1VDYA 4URKA 4CDNA 1H2UA 2WB2A 3QJZA 4JEUA 4B94A 3PUJA 3S7JA 3HVEA 3EJNA 2WXFA 3TXMA 1Y6IA 4A1GA 4C0EA 3ONKA 2J09A 3PREA 3L16A 3QKYA 2C0LA 4I17A 3CVQA 2GRLA 5CCMA 4N2SA 2WM9A 3CHMA 3I5PA 1SZAA 3M5AA 3D9MA 3D9PA 2XGSA 5HI7A 4KXKB 3CKCA 3APCA 4JEHA 4J8SA 3AS5A 3EIJA 4DI3A 3TXNA 1MUFA 2IGQA 2O8JA 3IHXA 4EZJA 3SW9A 5G05J 2V4LA 2VYIA 3HHMA 3K5KA 5FZSA 3TAXA 2WXHA 4QEPA 3IV0A 2XRYA 4GA1A 2PQRA 3S2AA 2R3AA 2QY7A 4DLQA 2ZU6B 3LS8A 3O4ZA 1NZNA 4JA7A 1Z3XA 5ARFA 4F7AA 3LYAA 5G05C 5TTFA 3R7RA 1MVXA 4UWKA 5FZQA 4FJYA 4L23A 5C2YA 3L13A 3ESLA 3RQ4A 1DNPA 4U63A 1HH8A 4I43A 3JQ0A 2PM6A 3FDHA 2XCBA 3LJ3A 4MLPA 4Q69A 4NACA 3VTXA 1U3CA 3BO5A 3QK0A 4MRUA 1PAQA 4XKBA 4UWLA 2WQHA 3DBSA 1WAO1 4GA0A 5CCLA 3FY4A 4U0ZA 3LY7A 2CHWA 2WXPA 4DI4A 5F6KC 3MO2A 3P2BA 5FQ8A 4JDSA 5M72A 4J6IA 4U0SA 4AEZC 3IHYA 4HFGA 1MT6A 4N3AA 2WXKA 3HDXA 3F9XA 4ME2A 4I1MA 2OVFA 2UWJG 3KEZA 1H6KA 3HVEB 3SHFA 3BG0B 1IQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPW A;  4KBQ A;  3AS4 A;  4NQ0 A;  1QQE A;  1NA0 A;  3ASD A;  4W9R A;  3JYS A;  4QEN A;  1NA3 A;  1XQH A;  4IN3 B;  4G1T A;  3ULQ A;  1PEG A;  3M57 A;  2XGO A;  2QFC A;  2BUG A;  4E47 A;  5LSZ A;  1N6C A;  3SWC A;  1HZ4 A;  3AS8 A;  2VGX A;  1HXI A;  3R9A B;  4HOR A;  3KS2 A;  5T0M A;  2JLB A;  3RKV A;  3RO2 A;  4ABN A;  4BT8 A;  3LCA A;  2XEV A;  1IHG A;  2HYZ A;  3UUX A;  1ZU2 A;  4NRH B;  4G23 A;  4AY6 A;  4AIF A;  4CGV A;  4GYW A;  3CVP A;  3TG5 A;  3URZ A;  3UQ3 A;  3DAL A;  1W3B A;  4QEO A;  3SZ7 A;  1P5Q A;  2P58 C;  2R5S A;  4NJ5 A;  4I1A A;  2Q7F A;  3FPD A;  2L6J A;  4G25 A;  3EP0 A;  4GYY A;  2FO7 A;  1H3I A;  2MHK A;  5LSX A;  3KAE A;  3N71 A;  3QDN A;  3Q15 A;  5BNW A;  2W5Z A;  5EKQ D;  3U3W A;  4HOS A;  3OPE A;  3CEQ A;  4YPA A;  2XGM A;  3ZGQ A;  3UPV A;  5TH7 A;  2VGX B;  5EX3 A;  3KMA A;  4XIF A;  5JJT A;  4GZ6 A;  5CPR B;  2OND A;  4RG6 A;  4J8O A;  3RO3 A;  4UI9 K;  3S7D A;  4I2Z A;  2IFU A;  2W5Y A;  2Y4T A;  2RFI A;  4FMU A;  3K9I A;  3OXF A;  4J0U A;  4J7I A;  4YND A;  3ZFW A;  4BUP A;  4CGW A;  3NF1 A;  3LY9 A;  4H7X A;  2FEZ A;  4N3B A;  2FI7 A;  4N2Q A;  4XI9 A;  4I2W A;  4J7F A;  3MV2 B;  3GYZ A;  3OOI A;  3MKR A;  3SF4 A;  4J8F A;  3LKU A;  5CHE E;  5G04 C;  4GA2 A;  4UQY A;  2KCV A;  3CV0 A;  4HOT A;  4WUY A;  3KMJ A;  1A17 A;  5JJ6 A;  1ML9 A;  2VSN A;  2V5F A;  4YVQ C;  1IYG A;  5KJL A;  3QOU A;  3S7B A;  2YQ8 A;  4YPE A;  3BEE A;  2LSV A;  3MO5 A;  3WXX A;  3F9Z A;  4JLG A;  5TEG A;  2HO1 A;  4UQX A;  4MI0 A;  3QWP A;  3EDT B;  4EQF A;  1OUV A;  2FBN A;  2HR2 A;  2C2L A;  4CDR A;  4U0U A;  4C1Q A;  2PL2 A;  4BWR A;  3M56 A;  4N39 A;  1YA0 A;  4JA9 A;  4A1S A;  3FWV A;  4U04 A;  4N3C A;  2G46 A;  3ZPJ A;  4XI0 A;  5A6C A;  4J83 A;  3M55 A;  3ASF A;  3M59 A;  4AM9 A;  5HQ8 A;  5T5G A;  2JV0 A;  5ARG A;  3OXG A;  2XCC A;  5T0K A;  4WNE A;  3TGO A;  3MO0 A;  2BQZ A;  1KT0 A;  2UY1 A;  4BTB A;  3Q5M A;  3PE3 A;  3ZHE A;  1XNF A;  3CVN A;  2XPI A;  2KAT A;  2KCL A;  4MI5 A;  5KJN A;  4YVO A;  5FJY A;  2VSY A;  4IJ8 A;  1E96 B;  5BT1 A;  2YHC A;  3U4T A;  5EX0 A;  3RAY A;  1QZ2 A;  4APO A;  4N5C A;  3E4B A;  4GZ5 A;  4Z4P A;  4RZ0 A;  4WNG A;  3ASH A;  4WNF A;  3GZ1 A;  3IEG A;  5AYF A;  2FF4 A;  3Q47 B;  4JL0 A;  4AU7 A;  1FCH A;  3RJV A;  5FT9 A;  4G24 A;  2KC7 A;  4RG9 A;  2E2E A;  4O6F A;  1TJC A;  4BTA A;  3F9W A;  4IJD A;  2OOE A;  4JHR A;  5FTP A;  2PQN A;  2LSU A;  3S7F A;  4H7Y A;  3PDN A;  2UY1 B;  3Q4A B;  3MA5 A;  4I51 A;  4F3V A;  3ZHE B;  3VUZ A;  5DBK A;  4AY5 A;  3Q49 B;  5BW8 C;  5G04 J;  1ELW A;  3KD7 A;  3LY8 A;  4GPK A;  5KJM A;  3RIB A;  4UI9 J;  1KT1 A;  3S8P A;  4GCO A;  2VQ2 A;  1Y8M A;  3VV0 A;  4GYO A;  3HYM B;  4GCN A;  4UI9 C;  1ZKK A;  2C0M A;  2Y4U A;  3CBM A;  2AVP A;  4NVQ A;  2KCK A;  5C1D A;  2IF4 A;  3GZ2 A;  4GZ3 A;  3HNA A;  3KMT A;  1N6A A;  2I6H A;  2NC9 A;  3CKB A;  1MVH A;  1PC2 A;  1B89 A;  3GW4 A;  4KYO B;  4BT9 A;  5JHN A;  4G26 A;  2GW1 A;  5F6L A;  4H12 A;  2F69 A;  3M58 A;  5JJ0 A;  3FFL A;  4HOQ A;  5DIZ A;  5EG2 A;  3MV3 B;  3PE4 A;  4I9E A;  5JIY A;  3ZN3 A;  4YNM A;  5A7D B;  3CBP A;  3FP3 A;  2J9Q A;  5AYW D;  4Y6W A;  3LPZ A;  3M53 A;  5D0O D;  3CK9 A;  4YPU A;  3TG4 A;  1O9S A;  3F9Y A;  3CK7 A;  1ZBP A;  3ESK A;  5F5E A;  2WPV A;  5FZR A;  5JJ7 A;  3QWW A;  2LNI A;  5LCW J;  5D0Q D;  3MEK A;  2PZI A;  1ELR A;  3O48 A;  2DBA A;  3OXL A;  4UQZ A;  5LCW C;  3RJW A;  5JIN A;  4J8E A;  3OS5 A;  3CK8 A;  3CVL A;  4WND A;  1WM5 A;  5KJK A;  1KLX A;  2VGY A;  3ASG A;  4YNP A;  4O30 A;  3DB5 A;  3VTY A;  4LDG A;  4G2V A;  4HOU A;  4J8D A;  5F59 A;  3RU0 A;  4U07 A;  4Y6C A;  3M54 A;  4I9C A;  4LEU A;  1N3J A;  3QWV A;  4B94 A;  3S7J A;  3CBO A;  3QKY A;  2C0L A;  4I17 A;  3CVQ A;  5CCM A;  4N2S A;  3M5A A;  5HI7 A;  2XGS A;  4KXK B;  3CKC A;  2IGQ A;  3IHX A;  3AS5 A;  1MUF A;  2O8J A;  3SW9 A;  5G05 J;  2VYI A;  3K5K A;  5FZS A;  3TAX A;  4QEP A;  4GA1 A;  2PQR A;  2R3A A;  4JA7 A;  1NZN A;  5ARF A;  5TTF A;  3LYA A;  5G05 C;  1MVX A;  5FZQ A;  3RQ4 A;  1HH8 A;  2XCB A;  3VTX A;  3BO5 A;  2WQH A;  1WAO 1;  4GA0 A;  5CCL A;  4U0Z A;  3LY7 A;  5F6K C;  3MO2 A;  4JDS A;  5M72 A;  4U0S A;  1MT6 A;  4N3A A;  3F9X A;  4ME2 A;  2UWJ G; 
#chains in the Genus database with same CATH topology
 2QYU A;  4BET A;  3D9N A;  3IBE A;  4NQ0 A;  4WWO A;  3ZEF A;  1HE8 A;  2EIN E;  3SY2 A;  3AG2 E;  5HRY A;  5EIB E;  3M57 A;  1H2V C;  3PZ3 A;  3NBN B;  5LSZ A;  3SWC A;  1HZ4 A;  2XZT G;  3KS2 A;  3JUI A;  1NL4 A;  4ABN A;  4BT8 A;  3UUX A;  1MJ0 A;  1ZU2 A;  2LAI A;  2XEE A;  4CGV A;  4DX1 A;  2R2L A;  5D66 A;  4BFR A;  4EZL A;  3DAL A;  1A5E A;  1W3B A;  3RRM B;  2WXM A;  4QEO A;  4JW1 A;  3PEU B;  2R5S A;  3NAW A;  3CSF A;  2Q7F A;  4JXT A;  5T3R A;  3ONL A;  3TJP A;  4LG6 A;  3ABK E;  3VLE A;  3MZL B;  2MHK A;  4YDE A;  4APF A;  2F8Y A;  2L6B A;  3JXI A;  2W5Z A;  5EKQ D;  4DLO A;  4O1O A;  5ENR D;  4ATZ D;  3U3W A;  3ZGQ A;  5EX3 A;  1HX8 A;  3KMA A;  2B6C A;  4GZ6 A;  4GML A;  2OND A;  1U2V G;  4J8O A;  3L54 A;  3ASO E;  2W5Y A;  3V2X A;  2HE0 A;  1ZB1 A;  4J0U A;  3DSS A;  3ZFW A;  2RKK A;  4M3O A;  4BUP A;  4DX5 D;  3R9M A;  4CGW A;  2WXR A;  5KCM A;  1FT1 A;  3FH5 A;  2FI7 A;  2P9U G;  1E90 A;  3HXB A;  3OOI A;  5CRU A;  3V2O A;  3SF4 A;  2VJ8 A;  2J08 A;  3Q75 A;  5CHE E;  3D3M A;  3L82 A;  2KZT B;  3CV0 A;  4PS8 A;  4HOT A;  5G2N A;  4WUY A;  1PY1 A;  3C98 A;  3PNT B;  3DEO A;  2IO2 C;  2R17 C;  2VSN A;  1IYG A;  3T8K A;  5KJL A;  3QOU A;  4IYP A;  4E6H A;  4JPS A;  4YPE A;  3MO5 A;  4U8V D;  5TEG A;  3ZXS A;  2HR2 A;  5CMW A;  3U64 A;  4OAV B;  2PL2 A;  2WXN A;  4ILI A;  4A1S A;  4EEC A;  4N3C A;  2G46 A;  5B1A E;  3ZPJ A;  3I4R B;  4XI0 A;  4B8C B;  4U8H A;  1FVH A;  2P9S G;  1E8W A;  1UW4 B;  1O1T A;  2JV0 A;  5ARG A;  5CEA A;  3R7Q A;  4CT0 A;  3L6A A;  5LP0 A;  5CRV A;  3Q5M A;  4L1B A;  3UMV A;  1E7V A;  2XPI A;  3E34 A;  2KAT A;  2WXL A;  2ETB A;  4N5Q A;  4LRZ A;  5FJY A;  4IJ8 A;  2YHC A;  3B7U X;  3U4T A;  5EX0 A;  1BD8 A;  1H6O A;  1Z6T A;  1KZP A;  4O60 A;  4Z4P A;  1ELK A;  3ASH A;  3IEG A;  3MYV A;  3QB2 A;  4X8Q A;  3Q47 B;  2GRQ B;  4J8Y A;  2HM8 A;  1YCS B;  4TUU A;  4AJW A;  3F9W A;  1TJC A;  2ZIR A;  5ENT D;  4ZFH A;  5FTP A;  3S7F A;  3UKR G;  3AAA C;  2UY1 B;  3UT7 A;  2ION A;  2LUH A;  2DVW A;  3AU4 A;  3ZHE B;  3CHS A;  1EPU A;  5BW8 C;  1BPO A;  4GMR A;  2AXZ A;  5EID A;  2VQ2 A;  4Q96 A;  5BV1 A;  1ZKK A;  1TYQ G;  2IU1 A;  2Y4U A;  4AP2 A;  3D9H A;  3EHM A;  3J5Q B;  2IF4 A;  3V31 A;  5CER B;  3HNA A;  3KMT A;  2L0I A;  5AQB A;  2NC9 A;  2AWI A;  1N54 A;  3SFY A;  4F1P A;  2DYR E;  1NFI E;  4FLH A;  1B89 A;  3EHQ A;  1G3N B;  3FEX A;  2DIW A;  1TN6 A;  3HIZ A;  3FTS A;  5J90 A;  4HVB A;  5BXO A;  4TXQ A;  4EBA A;  3PE4 A;  4GTS A;  1N94 A;  3CBP A;  3LPZ A;  3M53 A;  1IQR A;  3ESK A;  5F5E A;  3FU3 A;  5JJ7 A;  3QWW A;  2XEN A;  5D0Q D;  3PZD A;  3MEK A;  3AG4 E;  3RJW A;  2CHZ A;  3TWW A;  3OS5 A;  1OXJ A;  2XPZ A;  4U96 D;  3SO8 A;  1N4R A;  3I3N A;  1WM5 A;  3AJI A;  5KJK A;  4HBD A;  2XPY A;  2Y69 E;  3ASG A;  4YNP A;  3D9J A;  4O30 A;  4LNU D;  3ZIM A;  4LDG A;  4TXR A;  5HS0 A;  4K0R A;  4EZK A;  5F59 A;  4LUN U;  4I6E A;  3RU0 A;  4G8L A;  3CHO A;  4FLB A;  2WB2 A;  4URK A;  1H2U A;  4B94 A;  3HVE A;  1Y6I A;  3ONK A;  3PRE A;  3L16 A;  3UIN C;  3CHM A;  1JCR A;  2XGS A;  3CKC A;  4HNA D;  4JEH A;  4DI3 A;  1MUF A;  3HHM A;  3TWS A;  2J8S D;  3IV0 A;  2XRY A;  4GA1 A;  1TNU A;  3S2A A;  2KBX A;  3O4Z A;  3LYA A;  5G05 C;  5HKP A;  1MVX A;  2H6F A;  4UWK A;  1KZO A;  5FZQ A;  4L23 A;  1DNP A;  3FDH A;  4Q69 A;  3LJ3 A;  1PAQ A;  2WQH A;  3P2B A;  5M72 A;  4N3A A;  3HDX A;  4ME2 A;  3Q79 A;  4NIK A;  4Z68 A;  3AS4 A;  1NA0 A;  3IXE A;  3MJW A;  3ULQ A;  2V4H C;  1PEG A;  5KBA A;  3ENE A;  4ILH B;  2QFC A;  3NQP A;  2ILR A;  1EF1 C;  1OWM A;  2A4Z A;  2MOW A;  3AS8 A;  2VGX A;  2CG3 A;  2WXQ A;  2P9I G;  2JLB A;  1IHG A;  3D9L A;  3SBS A;  4GYW A;  3NB2 A;  4BX8 A;  2ZXW E;  4ATG A;  2XS8 A;  3V79 K;  4GTV A;  1QNF A;  4LSZ E;  2L6J A;  3EP0 A;  3RSE G;  4HS2 A;  4EBA G;  1H3I A;  4U95 D;  3N71 A;  5KNH D;  4HOS A;  3CEQ A;  3MGB A;  2XGM A;  2MRI A;  3FUK A;  5TH7 A;  2NSZ A;  3PUK A;  4FUL A;  3WG7 E;  2X6K A;  4HQD A;  1MQS A;  5FWQ A;  4FHK A;  4UI9 K;  3ULY A;  2B0O E;  3SBT B;  4AVX A;  4GMJ A;  3L17 A;  4B8A A;  1OWO A;  1GW6 A;  2V8S E;  2ZGG A;  4FJZ A;  1V54 E;  3JXJ A;  3OXF A;  4YND A;  1TEZ A;  3NF1 A;  4H7X A;  2XRZ A;  2FEZ A;  4HLE A;  4N3B A;  4I2W A;  3GYZ A;  4P29 A;  4V3I A;  3FUN A;  5FQ4 A;  4J8F A;  3LKU A;  4GA2 A;  1YMP A;  4UQY A;  5FIN A;  2KCV A;  3FUL A;  2WXI A;  3PVL A;  2X3M A;  3Q7F A;  3UM3 A;  1A17 A;  5JJ6 A;  5AIJ A;  3LVR E;  1LD7 A;  3CVW A;  3TWV A;  2NXP A;  2F0Y A;  5ENP D;  3BEE A;  1MX6 A;  3F6Q A;  4A3V A;  3WXX A;  2EQX A;  3F9Z A;  4JLG A;  1N52 A;  2LXM A;  1OUV A;  4JC8 A;  3ZYL A;  2C2L A;  3HXF A;  4C1Q A;  4BWR A;  5CBN A;  3C3O A;  3JCK C;  4N39 A;  1YA0 A;  4JA9 A;  3FWV A;  4U04 A;  5A6C A;  4DRX E;  4J83 A;  3M55 A;  2WXO A;  3PEV B;  4ILG A;  5T5G A;  3FTU A;  3C72 A;  3MCX A;  3RRN B;  3MKQ B;  2XCC A;  2BQZ A;  4BTB A;  3PE3 A;  3FUM A;  2ZGD A;  2J07 A;  5CED B;  3IHV A;  2M63 A;  3CVU A;  3TWR A;  1S0P A;  4I6G A;  1QZ2 A;  3DXM G;  4K5C A;  4FC8 A;  4PH4 B;  4RZ0 A;  4WNG A;  4WNF A;  3UM2 A;  5AYF A;  2FF4 A;  3C3Q A;  4PS3 A;  1FCH A;  2CHX A;  4XZ4 A;  4OYS A;  1E7U A;  5FT9 A;  3RRU A;  3U9W A;  2KC7 A;  3MX3 A;  3ABL E;  4O6F A;  2OOE A;  2PQN A;  3EU9 A;  2LSU A;  2EIK E;  3DSW A;  2F8X K;  2A5U A;  5KNG A;  3Q4A B;  2AXU A;  2RG8 A;  4I51 A;  2IOS A;  1H19 A;  4QQI A;  3ZYQ A;  4CRW A;  5DBK A;  2GRO B;  1E8X A;  3Q49 B;  1L5J A;  1S63 A;  1ELW A;  3LY8 A;  2XQ0 A;  3RIB A;  3G2T A;  2L9B A;  1KT1 A;  4BES A;  1YYH A;  1Y8M A;  4FU3 A;  3VV0 A;  1RW2 A;  4KVM A;  3V30 A;  3JQ1 A;  3HYM B;  4UI9 C;  2C0M A;  3MKQ A;  2H6G A;  3CHR A;  1IKN D;  1JWF A;  5EDS A;  3GZ2 A;  5CMY A;  1N6A A;  3TWQ A;  1OWL A;  5AJL A;  3CKB A;  3FTV A;  4FA6 A;  1OY3 D;  3GW4 A;  3ZKJ A;  4KYO B;  2R02 A;  5F6L A;  4H12 A;  4HXI A;  3ASN E;  4LER A;  5JJ0 A;  2A5E A;  2I2O A;  5LFA A;  3MV3 B;  5AEN A;  4D10 C;  2J49 A;  1K8K G;  3IKO B;  4I9E A;  4FAD A;  3QNK A;  4YNM A;  3FP3 A;  4JB8 P;  5D0O D;  3CK9 A;  3TG4 A;  3B7T A;  2R05 A;  4B0Z A;  1ZBP A;  2CFU A;  5G55 A;  5JHA A;  2EIM E;  1Q2Z A;  2LNI A;  5ANL A;  3CVX A;  2BKK B;  1O1R A;  2V0P A;  1WY6 A;  2CG2 A;  4KZC A;  3HXC A;  4UQZ A;  3OXL A;  3LXU X;  5LCW C;  4MBG A;  3ZYM A;  3NZU A;  4CT4 A;  5JMN D;  5E75 A;  1N4P A;  2PM7 A;  1DCQ A;  1TNB A;  4HLL A;  3Q73 A;  4EPZ A;  2I1J A;  4J8D A;  5BUZ A;  4U07 A;  2RFA A;  4I9C A;  5KWD A;  1K1B A;  3C5R A;  5AQ9 A;  3QJZ A;  4JEU A;  1N4Q A;  2WXF A;  2FO1 E;  3B95 A;  2C0L A;  4I17 A;  3I5P A;  3J5P A;  5HI7 A;  4GTP A;  3APC A;  2IGQ A;  4J8S A;  3IHX A;  4EZJ A;  3SW9 A;  2V4L A;  2VYI A;  3K5K A;  1N4S A;  5FZS A;  2WXH A;  4QEP A;  5AQA A;  1Z3X A;  4F7A A;  3DSU A;  4FJY A;  4I43 A;  2PM6 A;  3VTX A;  3BO5 A;  3QK0 A;  4RLY A;  3DBS A;  4U0Z A;  1OCC E;  1K1A A;  4U7E B;  3AG3 E;  4JDS A;  4AEZ C;  4A63 B;  1MT6 A;  2WXK A;  2OEW A;  3UIO C;  2Y1L E;  3HVE B;  3SHF A;  1IQU A;  1TN7 A;  2QPW A;  1KPS B;  4KBQ A;  1QQE A;  1N0Q A;  2J4D A;  3FUJ A;  4G1T A;  5J08 A;  1WDY A;  2XGO A;  2BUG A;  4GTT A;  1N6C A;  4RVB A;  1Z5S C;  4F53 A;  1HXI A;  2X6J A;  3DWL G;  4WWP A;  4A3T A;  3EHR A;  1SW6 A;  5T0M A;  2NYJ A;  3RO2 A;  4JZY A;  2XEV A;  2HYZ A;  1MZC A;  1UJK A;  2DYS E;  4MS6 A;  3DEP A;  4K5A B;  4NRH B;  4PS7 A;  4L9P A;  3ZUV B;  1N95 A;  3GZS A;  3TWT A;  3CVP A;  3TG5 A;  3CHQ A;  3UQ3 A;  3W9G A;  3ZVV A;  3VLF A;  3PRZ A;  3TWU A;  5AQ7 A;  4DX2 A;  2P58 C;  2WVI A;  3FPD A;  4G25 A;  4TXP A;  4GZC A;  4GYY A;  2FO7 A;  3CVV A;  1HG5 A;  4GTM A;  4YPA A;  4DJA A;  2VGX B;  5JJT A;  3LVQ E;  4C9B B;  3CIA A;  1JCQ A;  1JWG A;  4L2L A;  4RG6 A;  3RO3 A;  3S7D A;  4OVU A;  2IFU A;  2YHE A;  2RFI A;  4FMU A;  3K9I A;  4OAU C;  5A23 A;  4J7I A;  1JUQ A;  2WMN A;  4JHK A;  2QZA A;  3MV2 B;  5JHB A;  1BU9 A;  2QYJ A;  5BXU A;  1DC2 A;  2VSO E;  1RZ4 A;  1N0R A;  3P1U A;  2DZN A;  4R7L A;  2J4B A;  4GTO A;  5LX8 A;  5B3S E;  3KMJ A;  3FH7 A;  2P9P G;  1ML9 A;  2H6H A;  4E85 A;  3T5X A;  1FPP A;  3S7B A;  4CCA A;  2YQ8 A;  4EHM A;  4K03 A;  4TUM A;  3SI5 A;  1FT2 A;  2KXP C;  3SD5 A;  3PNL B;  4UQX A;  3D9K A;  3QWP A;  3ABM E;  2FBN A;  2I1K A;  2MYO A;  2XZD G;  1HO8 A;  4CDR A;  4U0U A;  2P2C P;  3M56 A;  5T4Y A;  2LXL A;  3PH0 C;  4JD2 G;  4BER A;  2R03 A;  2IEJ A;  4XX5 A;  1X81 A;  3ASF A;  4RQI A;  5ANR A;  3OXG A;  1TNZ A;  2BKG A;  2LO6 A;  4PDX A;  2DZO A;  1XNF A;  3CVN A;  4KT6 B;  4RSY A;  2JAB A;  1LTX A;  3LEW A;  5KJN A;  4YVO A;  2VSY A;  4O1P A;  3NOG D;  3UIP C;  3RAY A;  1OCR E;  4DX6 D;  1FVF A;  3SNX A;  4A55 A;  4JL0 A;  4AU7 A;  2IY0 C;  3RJV A;  2X38 A;  1DVP A;  2QC9 A;  4G24 A;  1N9A A;  2WXG A;  4G8K A;  2E2E A;  4BTA A;  4IJD A;  3RAU A;  2ZIS A;  4H7Y A;  3BQO A;  3PDN A;  3B7S A;  2P9L G;  3MA5 A;  4F3V A;  1INZ A;  3UKU G;  3FUE A;  5G04 J;  3KD7 A;  2IJG X;  4YDW A;  3DXK G;  4DK5 A;  3APF A;  2VTB A;  2AJA A;  2YNQ A;  3L22 A;  4GCO A;  4GYO A;  1HF8 A;  4GCN A;  2Y3A A;  4ANX A;  4LCT A;  3L9T A;  4I6J A;  3CBM A;  2AVP A;  2EIJ E;  3G2W A;  4NVQ A;  4Q94 A;  1X5B A;  3DPY A;  3FU5 A;  2I6H A;  4CEM A;  4HRN A;  4L7T A;  2XHE A;  4KMO A;  3PZ2 A;  4IRU A;  3RK6 A;  4BSZ B;  3M58 A;  3FFL A;  1TNY A;  5DIZ A;  2OCC E;  2BF0 X;  2F37 A;  5JIY A;  3L08 A;  3ZN3 A;  2X6F A;  3DPD A;  1SA5 A;  3FH8 A;  2J9Q A;  1LF8 A;  5FIO A;  3FUH A;  2KM4 A;  4Y6W A;  3D9O A;  3QAQ A;  4HI8 A;  1HFA A;  1O9S A;  2CFZ A;  3CK7 A;  4CYM D;  2ETC A;  2WMO A;  1DCE A;  3LDZ A;  2PZI A;  3EIQ C;  4LNB A;  3O48 A;  2GRN B;  3ULE G;  3G2S A;  4HI9 A;  4TRQ A;  4XE0 A;  2DBA A;  4B89 A;  1BI8 B;  2EIL E;  4GTR A;  4B93 B;  5JIN A;  3HXE A;  4J8E A;  3CK8 A;  1S64 A;  3CVL A;  3SFZ A;  4WND A;  3TWX A;  3AU5 A;  4DX7 D;  4DUI A;  1KLX A;  4UWG A;  1D9S A;  3VTY A;  1BI7 B;  1AWC B;  1XGW A;  5FQ7 A;  4HB5 A;  4WAF A;  2OV8 A;  1OWN A;  1JPL A;  5CEC B;  3BG1 B;  3E37 A;  5T8I A;  2WQ6 A;  3UTM A;  1JCS A;  3M54 A;  1N3J A;  3EUV A;  1UG3 A;  3QWV A;  4UUC A;  3ZRH A;  4GU5 A;  4CDN A;  3TXM A;  4A1G A;  2J09 A;  5CCM A;  3CVQ A;  1SZA A;  3KSL A;  3EIJ A;  3TXN A;  2GRR B;  5G05 J;  3DST A;  1LD8 A;  2R3A A;  2QY7 A;  4DLQ A;  3LS8 A;  1NZN A;  5ARF A;  5TTF A;  5D2M C;  5C2Y A;  3ESL A;  3RQ4 A;  1HH8 A;  3JQ0 A;  4MLP A;  1U3C A;  4MRU A;  4UWL A;  4GA0 A;  5CCL A;  3FY4 A;  4DI4 A;  3MO2 A;  4J6I A;  3IHY A;  2PNN A;  4HFG A;  5ENO D;  3DRA A;  3F9X A;  3KEZ A;  2UWJ G;  3HRA A;  1SQM A;  4W9R A;  3ASD A;  3W9F A;  4YDO A;  3JYS A;  4QEN A;  1NA3 A;  1XQH A;  4IN3 B;  3G2V A;  1UOH A;  4E47 A;  4CDM A;  3I4G A;  2IO3 C;  3Q78 A;  4AV7 A;  2JEK A;  3QAR A;  3CHP A;  4QFV A;  3NZS A;  1E8Y A;  2RD0 A;  3R9A B;  4HOR A;  5H7P A;  3RKV A;  3LCA A;  3CR3 A;  1SZ9 A;  1TJF A;  4AOF A;  3B7R L;  3Q7A A;  4G23 A;  4AY6 A;  4AIF A;  3G2U A;  1O5M A;  4BSX A;  1BLX B;  5AN8 A;  3URZ A;  1E8Z A;  3C3R A;  1OCZ E;  1NI1 A;  2OEV A;  1OWP A;  5EIL A;  3SZ7 A;  1P5Q A;  1V55 E;  4NJ5 A;  3ML9 A;  4I1A A;  2VSX E;  5LSX A;  3KAE A;  1MX4 A;  3QDN A;  3APD A;  3Q15 A;  5BNW A;  3T9K A;  3OPE A;  2KZT A;  3UPV A;  1QYM A;  3EU5 A;  4G11 A;  4XIF A;  5FQ6 A;  3FTZ A;  2DWZ A;  3VLD A;  2GGF A;  5AJD A;  5CPR B;  5ENN A;  2Y0B G;  2WXJ A;  4I2Z A;  3FHE A;  2Y4T A;  4BY6 A;  3CQG B;  2XEH A;  4ACL A;  3LY9 A;  4GTQ A;  3NOC D;  4N2Q A;  4XI9 A;  4J7F A;  4FP7 A;  1OCO E;  1HS6 A;  4I1O B;  4J7W A;  4HRM B;  3MKR A;  5BPP A;  4ACK A;  2LAH A;  5ENS D;  2AXV A;  5G04 C;  3DSV A;  2BTD A;  3ML8 A;  2V5Q C;  2XS1 A;  3Q9U C;  3E33 A;  1NP7 A;  4XKC A;  4ANU A;  4GPM A;  1SVX A;  2V5F A;  4XEI G;  4YVQ C;  5E76 A;  4MKT A;  2GRM A;  3E32 A;  3B13 A;  3CQC B;  2BED A;  5ITZ F;  3QC1 A;  3U66 A;  2LSV A;  3UT8 A;  1MHQ A;  2OVB A;  2HO1 A;  5EYL A;  4MI0 A;  5ENQ D;  3EDT B;  4EQF A;  2VGE A;  3T5V A;  4F1S A;  2RFM A;  3UI2 A;  4GZD A;  1TN8 A;  1D8D A;  4FHJ A;  3M59 A;  4AM9 A;  5HQ8 A;  3PZ4 A;  1N11 A;  1HU3 A;  1TNO A;  3TL5 A;  3D9I A;  5T0K A;  1H2T C;  4WNE A;  3TGO A;  3MO0 A;  1KT0 A;  2UY1 A;  3FTX A;  2I9C A;  3ZNG A;  3LJN A;  3ZHE A;  3ZYK A;  3HXD A;  1UN9 A;  2IQC A;  2KCL A;  3FTY A;  4MI5 A;  4UWF A;  1E96 B;  5BT1 A;  3KEA A;  3CST A;  4M7C A;  4APO A;  1K3Z D;  4K5B A;  4N5C A;  3E4B A;  4GZ5 A;  4JVS A;  5IY5 E;  3GZ1 A;  1EDU A;  5JA4 D;  3E30 A;  3FUI A;  4GB9 A;  4RG9 A;  5EYP F;  4JHJ A;  2FUL A;  1U3D A;  3FUD A;  4JHR A;  3X2Q E;  4BX9 A;  4IUL A;  2DCP A;  5CBO A;  3PS6 A;  3VUZ A;  4AY5 A;  2WQ7 A;  4HRL A;  3T8M A;  5LOZ A;  4GAA A;  2E0I A;  3Q9N C;  4GPK A;  5KJM A;  4UI9 J;  3FU0 A;  2L0T B;  3S8P A;  3UM0 A;  1SA4 A;  1HG2 A;  3ISM C;  1O1S A;  2R59 A;  3B7B A;  2KCK A;  3UXG A;  5C1D A;  4GZ3 A;  2IOL A;  3FU6 A;  1MVH A;  1UN8 A;  5EN5 D;  1PC2 A;  3UM1 A;  3CGH A;  5AAR A;  1S70 B;  4BT9 A;  3FTW A;  4UWH A;  1TR4 A;  4G26 A;  5JHN A;  2GW1 A;  3FEY A;  3ZU7 B;  2F69 A;  1D8E A;  4C48 B;  4HOQ A;  4DPR A;  5EG2 A;  4PUC A;  1QBQ A;  1WG0 A;  3PZ1 A;  3OTN A;  5A7D B;  4C0M A;  1AP7 A;  2VTB B;  4U8Y D;  4LNG A;  4NUR A;  3SFX A;  4KVO A;  5AYW D;  3ZW3 A;  4YPU A;  3ZXP A;  3AG1 E;  3F9Y A;  1IXV A;  3OAW A;  2WPV A;  5FZR A;  5LCW J;  4ANV A;  4F6R D;  2YIN A;  4TV3 A;  3BUA A;  2H6I A;  4KZ0 A;  1EYH A;  1ELR A;  2X6I A;  3EHN A;  3SGH A;  3UT4 A;  1UJJ A;  3KSQ A;  3FUF A;  2P9K G;  3DSX A;  1MYO A;  3SQV A;  2VGY A;  1IHB A;  5BV0 A;  4OVV A;  3CVY A;  3DB5 A;  4G2V A;  2AW6 A;  3UX4 A;  4HOU A;  1Z3Y A;  4AXH A;  4BEP A;  4Y6C A;  1H0A A;  3CLJ A;  4LEU A;  2X6H A;  4ANW A;  4WWN A;  4L2Y A;  1VDY A;  3PUJ A;  3S7J A;  3EJN A;  3CBO A;  4C0E A;  3QKY A;  2GRL A;  4N2S A;  2WM9 A;  3M5A A;  3D9M A;  3D9P A;  4KXK B;  2P9N G;  5B1B E;  3AS5 A;  2O8J A;  1H6P A;  3TAX A;  4ZHB A;  2PQR A;  5AAO A;  2ZU6 B;  4JA7 A;  3R7R A;  3JUE A;  4YDY A;  3L13 A;  4U63 A;  2GRP B;  2XCB A;  4NAC A;  4XKB A;  1WAO 1;  3HG0 D;  2CHW A;  2WXP A;  3LY7 A;  5F6K C;  5FQ8 A;  4CZ2 D;  4U0S A;  2ETA A;  4I1M A;  3BU8 A;  2OVF A;  1H6K A;  1MX2 A;  3BG0 B;  1OT8 A; 
#chains in the Genus database with same CATH homology
 1SQM A;  2QPW A;  3D9N A;  3IBE A;  3AS4 A;  4KBQ A;  4NQ0 A;  1QQE A;  1NA0 A;  3ASD A;  4W9R A;  3JYS A;  4QEN A;  4WWO A;  2J4D A;  1HE8 A;  3ZEF A;  1NA3 A;  1XQH A;  4IN3 B;  3FUJ A;  3MJW A;  4G1T A;  5J08 A;  3G2V A;  3ULQ A;  1PEG A;  3ENE A;  3M57 A;  1H2V C;  2XGO A;  2QFC A;  4ILH B;  3NQP A;  2BUG A;  4E47 A;  4CDM A;  2ILR A;  3I4G A;  4AV7 A;  2JEK A;  5LSZ A;  1EF1 C;  1N6C A;  4RVB A;  1OWM A;  2A4Z A;  2MOW A;  3QAR A;  1HZ4 A;  3SWC A;  3CHP A;  4QFV A;  4F53 A;  3NZS A;  3AS8 A;  2VGX A;  1E8Y A;  1HXI A;  2CG3 A;  2RD0 A;  2X6J A;  2WXQ A;  4WWP A;  3R9A B;  4A3T A;  4HOR A;  3KS2 A;  3JUI A;  2JLB A;  3RKV A;  3RO2 A;  4JZY A;  4ABN A;  3LCA A;  2XEV A;  4BT8 A;  5T0M A;  3CR3 A;  1IHG A;  1SZ9 A;  1UJK A;  2HYZ A;  3D9L A;  4MS6 A;  1TJF A;  4AOF A;  3UUX A;  1ZU2 A;  4NRH B;  3B7R L;  4PS7 A;  3SBS A;  4G23 A;  2LAI A;  4AY6 A;  4AIF A;  3G2U A;  3GZS A;  4CGV A;  4BSX A;  4GYW A;  3CVP A;  4BFR A;  3TG5 A;  4EZL A;  3URZ A;  3CHQ A;  1E8Z A;  3UQ3 A;  4BX8 A;  3DAL A;  4ATG A;  1W3B A;  3RRM B;  3ZVV A;  3VLF A;  2WXM A;  4QEO A;  1OWP A;  3PRZ A;  3SZ7 A;  1P5Q A;  2P58 C;  4JW1 A;  1QNF A;  3PEU B;  2R5S A;  3ML9 A;  4NJ5 A;  4I1A A;  3CSF A;  2Q7F A;  2WVI A;  4JXT A;  3ONL A;  5T3R A;  2L6J A;  4G25 A;  3EP0 A;  3TJP A;  3FPD A;  4HS2 A;  4EBA G;  3VLE A;  4GZC A;  4GYY A;  2FO7 A;  3MZL B;  3CVV A;  1H3I A;  2MHK A;  2VSX E;  5LSX A;  3KAE A;  3N71 A;  4APF A;  3QDN A;  3APD A;  3Q15 A;  5BNW A;  1HG5 A;  2W5Z A;  5EKQ D;  4DLO A;  3U3W A;  4HOS A;  3OPE A;  3CEQ A;  4YPA A;  2KZT A;  3MGB A;  2XGM A;  3ZGQ A;  2MRI A;  4DJA A;  3FUK A;  3UPV A;  5TH7 A;  2NSZ A;  2VGX B;  1HX8 A;  5EX3 A;  3PUK A;  4G11 A;  3KMA A;  4FUL A;  4XIF A;  5FQ6 A;  5JJT A;  2X6K A;  3FTZ A;  3LVQ E;  1MQS A;  3VLD A;  4C9B B;  3CIA A;  5FWQ A;  4GZ6 A;  2GGF A;  4GML A;  5AJD A;  5CPR B;  1JWG A;  4L2L A;  4FHK A;  2OND A;  5ENN A;  4RG6 A;  4J8O A;  3RO3 A;  4UI9 K;  3S7D A;  4OVU A;  2WXJ A;  4I2Z A;  3SBT B;  2IFU A;  3FHE A;  3L17 A;  3L54 A;  4GMJ A;  2YHE A;  4AVX A;  2W5Y A;  2Y4T A;  1OWO A;  4B8A A;  1GW6 A;  2V8S E;  2RFI A;  4FMU A;  4BY6 A;  4FJZ A;  3K9I A;  3CQG B;  3OXF A;  4J0U A;  5A23 A;  4J7I A;  4YND A;  3ZFW A;  1TEZ A;  1JUQ A;  4M3O A;  4ACL A;  4BUP A;  4CGW A;  3NF1 A;  2WMN A;  2WXR A;  3LY9 A;  4H7X A;  5KCM A;  2FEZ A;  2XRZ A;  4HLE A;  4JHK A;  4N3B A;  3FH5 A;  2FI7 A;  4N2Q A;  4XI9 A;  4I2W A;  4J7F A;  3MV2 B;  3GYZ A;  4FP7 A;  5JHB A;  1E90 A;  4P29 A;  4V3I A;  1HS6 A;  4I1O B;  3FUN A;  3MKR A;  5BPP A;  3OOI A;  3SF4 A;  5FQ4 A;  2VSO E;  4ACK A;  2LAH A;  2VJ8 A;  2J08 A;  2AXV A;  4J8F A;  3LKU A;  3P1U A;  5CHE E;  3D3M A;  4R7L A;  5G04 C;  4GA2 A;  4UQY A;  2KZT B;  2KCV A;  3CV0 A;  3FUL A;  2WXI A;  3PVL A;  2J4B A;  2BTD A;  4PS8 A;  4HOT A;  3ML8 A;  2X3M A;  5G2N A;  4WUY A;  5LX8 A;  1PY1 A;  3C98 A;  3KMJ A;  1A17 A;  1NP7 A;  3PNT B;  3FH7 A;  5JJ6 A;  4XKC A;  1ML9 A;  4ANU A;  2R17 C;  2VSN A;  2V5F A;  4YVQ C;  5AIJ A;  5E76 A;  4E85 A;  3LVR E;  1IYG A;  3T5X A;  4MKT A;  5KJL A;  3QOU A;  3CVW A;  2GRM A;  3S7B A;  4IYP A;  2YQ8 A;  4CCA A;  4K03 A;  2NXP A;  4E6H A;  3B13 A;  3SI5 A;  3CQC B;  4JPS A;  4YPE A;  3QC1 A;  3SD5 A;  3BEE A;  3U66 A;  5T0K A;  4A3V A;  2LSV A;  3UT8 A;  3MO5 A;  3WXX A;  1MHQ A;  2OVB A;  2EQX A;  3PNL B;  3F9Z A;  4JLG A;  5TEG A;  2HO1 A;  1N52 A;  4UQX A;  4MI0 A;  3D9K A;  3QWP A;  3EDT B;  4EQF A;  1OUV A;  2FBN A;  4JC8 A;  3ZYL A;  2HR2 A;  2I1K A;  3ZXS A;  3T5V A;  4F1S A;  5CMW A;  1HO8 A;  2C2L A;  4CDR A;  3U64 A;  4U0U A;  4GZD A;  2PL2 A;  4C1Q A;  4BWR A;  2WXN A;  4ILI A;  3JCK C;  3M56 A;  5T4Y A;  4N39 A;  1YA0 A;  4JA9 A;  4A1S A;  4EEC A;  3FWV A;  3PH0 C;  4U04 A;  4N3C A;  2G46 A;  3ZPJ A;  3I4R B;  4XI0 A;  5A6C A;  4FHJ A;  4XX5 A;  4B8C B;  4J83 A;  3M55 A;  3ASF A;  2WXO A;  1FVH A;  3PEV B;  4ILG A;  4U8H A;  3M59 A;  1E8W A;  4AM9 A;  1UW4 B;  5HQ8 A;  3FTU A;  5T5G A;  3MCX A;  5ANR A;  5ARG A;  3OXG A;  3RRN B;  2JV0 A;  1HU3 A;  3MKQ B;  3L6A A;  3R7Q A;  2XCC A;  3D9I A;  3TL5 A;  4CT0 A;  1H2T C;  4WNE A;  3TGO A;  2LO6 A;  5LP0 A;  2BQZ A;  1KT0 A;  2UY1 A;  3FTX A;  3MO0 A;  2I9C A;  4PDX A;  4BTB A;  3Q5M A;  3PE3 A;  4L1B A;  3UMV A;  1E7V A;  3ZHE A;  1XNF A;  3CVN A;  2XPI A;  4KT6 B;  4RSY A;  3ZYK A;  3FUM A;  1UN9 A;  3LEW A;  2J07 A;  2KAT A;  2WXL A;  2IQC A;  2KCL A;  3FTY A;  4MI5 A;  3IHV A;  5KJN A;  2M63 A;  4YVO A;  4LRZ A;  4UWF A;  2VSY A;  5FJY A;  1E96 B;  3CVU A;  5BT1 A;  2YHC A;  4IJ8 A;  3B7U X;  3U4T A;  3CST A;  5EX0 A;  1S0P A;  3RAY A;  4I6G A;  1QZ2 A;  1Z6T A;  4APO A;  4N5C A;  3E4B A;  4FC8 A;  4GZ5 A;  1FVF A;  4PH4 B;  4Z4P A;  1ELK A;  4JVS A;  4RZ0 A;  4WNG A;  3ASH A;  4WNF A;  3GZ1 A;  3IEG A;  1EDU A;  3MYV A;  3CBO A;  5AYF A;  2FF4 A;  3QB2 A;  3Q47 B;  3SNX A;  4A55 A;  4JL0 A;  4PS3 A;  4AU7 A;  1FCH A;  2CHX A;  4XZ4 A;  4OYS A;  3RJV A;  2HM8 A;  3FUI A;  2X38 A;  1DVP A;  1E7U A;  5FT9 A;  4G24 A;  3RRU A;  4TUU A;  3U9W A;  4AJW A;  2WXG A;  2KC7 A;  4GB9 A;  4RG9 A;  3MX3 A;  2E2E A;  4O6F A;  1TJC A;  4BTA A;  3F9W A;  4IJD A;  4JHJ A;  2OOE A;  2FUL A;  1U3D A;  3FUD A;  4JHR A;  5FTP A;  2PQN A;  4BX9 A;  2LSU A;  4IUL A;  3S7F A;  4H7Y A;  3PDN A;  2DCP A;  2A5U A;  3B7S A;  2UY1 B;  3UT7 A;  3Q4A B;  2ION A;  2AXU A;  3PS6 A;  3MA5 A;  2RG8 A;  4I51 A;  3AU4 A;  4F3V A;  2IOS A;  3ZHE B;  1H19 A;  3CHS A;  1EPU A;  3ZYQ A;  1INZ A;  4CRW A;  3VUZ A;  5DBK A;  4AY5 A;  2WQ7 A;  3T8M A;  1E8X A;  3FUE A;  5LOZ A;  3Q49 B;  4GAA A;  1L5J A;  5G04 J;  5BW8 C;  2E0I A;  1ELW A;  2IJG X;  3KD7 A;  1BPO A;  3LY8 A;  4GPK A;  5KJM A;  2XQ0 A;  4DK5 A;  3APF A;  3RIB A;  4UI9 J;  3G2T A;  2VTB A;  3FU0 A;  2L9B A;  1KT1 A;  2L0T B;  2YNQ A;  2AXZ A;  3L22 A;  3S8P A;  4GCO A;  2VQ2 A;  1Y8M A;  4FU3 A;  4Q96 A;  3VV0 A;  4GYO A;  5BV1 A;  1HF8 A;  4KVM A;  3JQ1 A;  1HG2 A;  3HYM B;  4GCN A;  2Y3A A;  4UI9 C;  4ANX A;  1ZKK A;  2C0M A;  2IU1 A;  2Y4U A;  3MKQ A;  3CHR A;  4I6J A;  4LCT A;  4AP2 A;  3CBM A;  2AVP A;  3G2W A;  1JWF A;  3EHM A;  2R59 A;  4NVQ A;  2KCK A;  4Q94 A;  5C1D A;  2IF4 A;  5EDS A;  1X5B A;  3GZ2 A;  4GZ3 A;  5CMY A;  3FU5 A;  3HNA A;  3KMT A;  2L0I A;  1N6A A;  2I6H A;  2NC9 A;  2AWI A;  2IOL A;  1OWL A;  4CEM A;  5AJL A;  1N54 A;  3CKB A;  3FU6 A;  1MVH A;  1UN8 A;  4L7T A;  1PC2 A;  2XHE A;  3FTV A;  4FLH A;  1B89 A;  4KMO A;  4FA6 A;  3CGH A;  3GW4 A;  4KYO B;  4BT9 A;  3FTW A;  3FEX A;  4UWH A;  5JHN A;  2DIW A;  4G26 A;  4IRU A;  2GW1 A;  5F6L A;  3HIZ A;  3FTS A;  3FEY A;  5J90 A;  4HVB A;  4H12 A;  4HXI A;  2F69 A;  3RK6 A;  3M58 A;  4LER A;  5JJ0 A;  4EBA A;  3FFL A;  4HOQ A;  4DPR A;  5DIZ A;  4PUC A;  5EG2 A;  2I2O A;  5LFA A;  3MV3 B;  5AEN A;  3OTN A;  3PE4 A;  4D10 C;  2J49 A;  3IKO B;  4I9E A;  2BF0 X;  5JIY A;  4FAD A;  3L08 A;  3QNK A;  3ZN3 A;  4YNM A;  2X6F A;  5A7D B;  4C0M A;  3DPD A;  2VTB B;  4NUR A;  3CBP A;  3FH8 A;  4KVO A;  3FP3 A;  2J9Q A;  1LF8 A;  5AYW D;  3FUH A;  2KM4 A;  4Y6W A;  3ZW3 A;  3D9O A;  3LPZ A;  3QAQ A;  3M53 A;  5D0O D;  3CK9 A;  4YPU A;  3TG4 A;  1HFA A;  1O9S A;  1IQR A;  2CFZ A;  3B7T A;  3F9Y A;  4B0Z A;  3CK7 A;  1ZBP A;  2CFU A;  5G55 A;  3ESK A;  2WMO A;  3OAW A;  5JHA A;  5F5E A;  3FU3 A;  2WPV A;  5FZR A;  5JJ7 A;  3QWW A;  2LNI A;  5ANL A;  5LCW J;  5D0Q D;  4ANV A;  3CVX A;  2YIN A;  3PZD A;  4TV3 A;  3MEK A;  3LDZ A;  4KZ0 A;  1EYH A;  2PZI A;  3EIQ C;  1ELR A;  2V0P A;  1WY6 A;  2CG2 A;  4KZC A;  2X6I A;  3O48 A;  3EHN A;  3G2S A;  4XE0 A;  3SGH A;  4TRQ A;  2DBA A;  3OXL A;  3LXU X;  4UQZ A;  3UT4 A;  5LCW C;  1UJJ A;  3RJW A;  2CHZ A;  4B89 A;  3ZYM A;  3NZU A;  5JIN A;  4J8E A;  3FUF A;  4CT4 A;  3OS5 A;  3CK8 A;  5E75 A;  3CVL A;  3SFZ A;  2XPZ A;  4WND A;  3I3N A;  2PM7 A;  3AU5 A;  1WM5 A;  5KJK A;  2XPY A;  1KLX A;  2VGY A;  4UWG A;  5BV0 A;  3ASG A;  4OVV A;  3D9J A;  4YNP A;  4O30 A;  3CVY A;  3ZIM A;  3DB5 A;  3VTY A;  4EPZ A;  4LDG A;  4G2V A;  2AW6 A;  2I1J A;  3UX4 A;  1XGW A;  4K0R A;  5FQ7 A;  4HOU A;  4J8D A;  2OV8 A;  4WAF A;  4EZK A;  1OWN A;  5BUZ A;  5F59 A;  1Z3Y A;  4LUN U;  4AXH A;  4I6E A;  1JPL A;  3BG1 B;  3RU0 A;  5T8I A;  2WQ6 A;  4U07 A;  4Y6C A;  3M54 A;  4I9C A;  1H0A A;  3CLJ A;  4LEU A;  1N3J A;  3QWV A;  1UG3 A;  2X6H A;  3CHO A;  4ANW A;  4WWN A;  4L2Y A;  4FLB A;  3ZRH A;  4GU5 A;  1VDY A;  4URK A;  4CDN A;  1H2U A;  2WB2 A;  3QJZ A;  4JEU A;  4B94 A;  3PUJ A;  3S7J A;  3HVE A;  3EJN A;  2WXF A;  3TXM A;  1Y6I A;  4A1G A;  4C0E A;  3ONK A;  2J09 A;  3PRE A;  3L16 A;  3QKY A;  2C0L A;  4I17 A;  3CVQ A;  2GRL A;  5CCM A;  4N2S A;  2WM9 A;  3CHM A;  3I5P A;  1SZA A;  3M5A A;  3D9M A;  3D9P A;  2XGS A;  5HI7 A;  4KXK B;  3CKC A;  3APC A;  4JEH A;  4J8S A;  3AS5 A;  3EIJ A;  4DI3 A;  3TXN A;  1MUF A;  2IGQ A;  2O8J A;  3IHX A;  4EZJ A;  3SW9 A;  5G05 J;  2V4L A;  2VYI A;  3HHM A;  3K5K A;  5FZS A;  3TAX A;  2WXH A;  4QEP A;  3IV0 A;  2XRY A;  4GA1 A;  2PQR A;  3S2A A;  2R3A A;  2QY7 A;  4DLQ A;  2ZU6 B;  3LS8 A;  3O4Z A;  1NZN A;  4JA7 A;  1Z3X A;  5ARF A;  4F7A A;  3LYA A;  5G05 C;  5TTF A;  3R7R A;  1MVX A;  4UWK A;  5FZQ A;  4FJY A;  4L23 A;  5C2Y A;  3L13 A;  3ESL A;  3RQ4 A;  1DNP A;  4U63 A;  1HH8 A;  4I43 A;  3JQ0 A;  2PM6 A;  3FDH A;  2XCB A;  3LJ3 A;  4MLP A;  4Q69 A;  4NAC A;  3VTX A;  1U3C A;  3BO5 A;  3QK0 A;  4MRU A;  1PAQ A;  4XKB A;  4UWL A;  2WQH A;  3DBS A;  1WAO 1;  4GA0 A;  5CCL A;  3FY4 A;  4U0Z A;  3LY7 A;  2CHW A;  2WXP A;  4DI4 A;  5F6K C;  3MO2 A;  3P2B A;  5FQ8 A;  4JDS A;  5M72 A;  4J6I A;  4U0S A;  4AEZ C;  3IHY A;  4HFG A;  1MT6 A;  4N3A A;  2WXK A;  3HDX A;  3F9X A;  4ME2 A;  4I1M A;  2OVF A;  2UWJ G;  3KEZ A;  1H6K A;  3HVE B;  3SHF A;  3BG0 B;  1IQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...