5KJKA

Smyd2 in complex with az370
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjkA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjkA01
5F6LA 1ZBPA 4UQXA 3CBOA 5F5EA 3TGOA 4YPAA 2Y4TA 3KMJA 4N3BA 2R3AA 5T5GA 2XGSA 1HH8A 4B94A 3M55A 2RFIA 4YNPA 1XQHA 5AYWD 2KCKA 5M72A 4KYOB 4J83A 3MA5A 1QZ2A 2XCCA 3JYSA 3HYMB 4GZ5A 3GW4A 4GPKA 4YNDA 3S7JA 4H7YA 3ULQA 3PDNA 3K9IA 2LSVA 4I2ZA 4CDRA 3KMTA 3M5AA 5EG2A 1N6CA 2FI7A 3RQ4A 4YVOA 4KXKB 3DB5A 3RO2A 4I1AA 3RU0A 2WPVA 3CVQA 1Y8MA 5JJTA 5G05C 1A17A 3MKRA 1P5QA 2VSYA 1WAO1 4I9CA 5CCMA 3FP3A 3NF1A 4HOQA 5G04J 1N6AA 3QDNA 4WNFA 5G04C 3CKCA 5KJLA 1WM5A 2L6JA 2FEZA 1ELRA 4QENA 4G24A 3RJWA 3LYAA 3TG4A 4JDSA 3OXGA 4N2SA 4JHRA 1ZKKA 3SWCA 3WXXA 2C0LA 2GW1A 3CVNA 3QWPA 3MO0A 4BUPA 3LY9A 2HYZA 2W5ZA 2BUGA 4U07A 5TEGA 2J9QA 2VYIA 5AYFA 4GA0A 1HZ4A 4N3AA 2C0MA 4AU7A 5TH7A 4HORA 2FBNA 2VGXB 4ABNA 2UWJG 3OXFA 3ZFWA 5JJ6A 3RIBA 4J7FA 5BNWA 4Y6WA 4F3VA 5JINA 4WUYA 2XGMA 5ARGA 5D0OD 4AIFA 3CBPA 2VGYA 5DIZA 2C2LA 5CPRB 1OUVA 5D0QD 1KT0A 2Y4UA 4JL0A 2V5FA 1PC2A 5EX3A 5BW8C 5TTFA 4GYOA 5LSZA 3F9YA 1KT1A 4RG6A 5LCWJ 2NC9A 1HXIA 3HNAA 4GYYA 4J8FA 3QWWA 3RKVA 3ASDA 4BT8A 1KLXA 3Q15A 3EDTB 4BTBA 5C1DA 3VTYA 2IGQA 3U3WA 4IJDA 4MI0A 3CK8A 5FJYA 3S7FA 5BT1A 2I6HA 4GA1A 5LSXA 4GZ3A 4GZ6A 3LCAA 2KATA 3N71A 4ME2A 4N3CA 3PE3A 5FZSA 3IHXA 2UY1A 3FPDA 2PQRA 3MO2A 1W3BA 3Q47B 3CK9A 4YVQC 4N2QA 3DALA 1NZNA 2XCBA 4JLGA 3QWVA 4BT9A 2DBAA 4UI9J 3GYZA 3ASGA 4IN3B 4J0UA 3F9WA 4AM9A 2R5SA 4XI9A 1IHGA 1B89A 3LY7A 4FMUA 4G25A 3M57A 2FO7A 4A1SA 2HR2A 5FT9A 3QKYA 4UI9K 3UPVA 2O8JA 4WNDA 4NJ5A 2WQHA 1FCHA 3M58A 1MT6A 4YPEA 5CHEE 1N3JA 4JA7A 5ARFA 2KCLA 3OS5A 4J7IA 4HOSA 3VUZA 3MV2B 2AVPA 5A6CA 3AS8A 5JHNA 1XNFA 2FF4A 2E2EA 4QEOA 4I2WA 2KCVA 3CKBA 4EQFA 1YA0A 4U0ZA 4UQZA 5EX0A 4AY5A 4WNEA 3ASFA 3OOIA 3CK7A 4Z4PA 2QFCA 5T0MA 4GCNA 2JV0A 2QPWA 3S7DA 3Q49B 4GA2A 5FZRA 1ML9A 1PEGA 2XEVA 3GZ2A 4YNMA 4Y6CA 3URZA 4XI0A 2PQNA 3FFLA 5HQ8A 4O30A 3SZ7A 3OPEA 3Q4AB 4N5CA 3VV0A 3CBMA 2MHKA 4E47A 3Q5MA 3FWVA 3AS5A 3ZGQA 5KJKA 5F59A 4U0SA 4BTAA 4CGVA 1MVXA 3KS2A 4H7XA 4KBQA 4WNGA 2LSUA 4JA9A 4O6FA 5LCWC 3S8PA 4N39A 3ZHEA 1MUFA 1O9SA 4NQ0A 3RO3A 4W9RA 4AY6A 2IFUA 1NA0A 3VTXA 2KC7A 3R9AB 1ZU2A 3LPZA 1IYGA 5JJ0A 2IF4A 4C1QA 4RZ0A 2JLBA 2W5YA 3ESKA 2UY1B 5EKQD 4U0UA 5HI7A 4IJ8A 4I17A 3SF4A 3RAYA 3MEKA 5T0KA 3KAEA 4G1TA 2BQZA 2VQ2A 4G26A 4UI9C 2XGOA 4NVQA 5F6KC 4J8DA 3K5KA 2LNIA 4MI5A 1NA3A 5JJ7A 3GZ1A 4U04A 3TAXA 3IEGA 3AS4A 3LKUA 1MVHA 5FTPA 3QOUA 3SW9A 4G23A 3BO5A 2G46A 4YPUA 5G05J 3OXLA 4UQYA 3CEQA 4APOA 3S7BA 3CVPA 4J8EA 4LDGA 3TG5A 4G2VA 3MO5A 3CV0A 4I9EA 5DBKA 4RG9A 3ZN3A 2PL2A 2XPIA 4J8OA 3M59A 3LY8A 4LEUA 1TJCA 3UQ3A 3F9ZA 3KMAA 3F9XA 3M56A 4BWRA 5FZQA 2Q7FA 2OOEA 2HO1A 3RJVA 3PE4A 4NRHB 2YHCA 3O48A 4H12A 4GCOA 3U4TA 4CGWA 1QQEA 2VGXA 5JIYA 2YQ8A 5KJMA 2PZIA 2VSNA 3UUXA 3M53A 3M54A 3E4BA 3MV3B 5CCLA 2F69A 3BEEA 1E96B 3CVLA 4I51A 5KJNA 4QEPA 2P58C 4HOTA 3ZPJA 4HOUA 1H3IA 4XIFA 3KD7A 5A7DB 3EP0A 3ASHA 4GYWA 2ONDA 3ZHEB 1ELWA
chains in the Genus database with same CATH superfamily
2H6IA 4YPAA 1QYMA 3QB2A 4TXRA 3BG1B 2RFIA 5CMWA 5ENOD 4FHJA 2WXGA 5M72A 2HM8A 3MA5A 4RQIA 1N0QA 1S63A 3ML8A 3RAUA 4YNDA 1Z3XA 3ULQA 1DCEA 3ZYMA 2P9PG 3ZEFA 3UM3A 2FI7A 1N6CA 3RQ4A 3DB5A 3RO2A 2KZTA 3RU0A 2IO3C 2DVWA 2OCCE 5BV1A 2RD0A 2WPVA 3UIPC 3CVQA 4OVVA 5JJTA 1XGWA 2CG2A 4GAAA 3KEAA 4L7TA 4CT0A 1P5QA 4TXQA 2GGFA 3PRZA 3HXFA 3FP3A 4HOQA 2X6IA 4BSXA 3R9MA 3QDNA 5HS0A 3FDHA 3CKCA 1HE8A 5KJLA 3SI5A 2CHZA 1ELRA 3AG2E 5KWDA 3LYAA 3FUHA 4HLLA 4A63B 3T9KA 4N2SA 4JHRA 4EHMA 3J5PA 2GW1A 2EIJE 2GROB 3ENEA 3MO0A 3F6QA 2HYZA 2W5ZA 5A23A 4U07A 5TEGA 3CSTA 2CFUA 1HZ4A 4DX5D 1BLXB 5TH7A 4HORA 3PUKA 4JC8A 5E76A 1NP7A 2UWJG 3ZU7B 3JUIA 3TWWA 2RFAA 3PZDA 1N9AA 2LAHA 5JINA 2XGMA 5ARGA 3FU0A 2YNQA 3FY4A 4I6JA 2DIWA 4AIFA 3UM0A 3AU4A 1YCSB 2LAIA 1DCQA 2YINA 5CPRB 2PM7A 2V5FA 4ANXA 5LSZA 5TTFA 1KPSB 3F9YA 5LCWJ 2LO6A 2NC9A 4AEZC 4I6GA 3ASDA 1KLXA 3UKRG 3Q15A 3EDTB 5C1DA 3CHMA 3VTYA 3ONLA 3IBEA 2P2CP 4K03A 3S7FA 5BT1A 4GA1A 4GZ3A 1QNFA 4R7LA 3UKUG 2KATA 3N71A 1L5JA 3G2WA 3IHXA 4N3CA 2PQRA 4B8CB 1W3BA 3TWUA 4YVQC 1K1AA 3JQ0A 3QWVA 3AG3E 1V55E 3GYZA 3ASGA 4L1BA 3B7SA 3IHYA 4AM9A 2KZTB 1IHGA 2FO7A 4J6IA 3IKOB 1TNZA 2OVFA 5FIOA 4UI9K 3UPVA 2O8JA 4WNDA 5CRVA 5CHEE 5E75A 2MYOA 4RVBA 5ARFA 5FQ7A 3VLDA 3ZW3A 3OS5A 2WXIA 4J7IA 3DSUA 4HOSA 3VUZA 4TXPA 3AS8A 4IYPA 3AG1E 4GTPA 4I2WA 3FTYA 2V8SE 1JCQA 3ASFA 3OOIA 1BI7B 2QFCA 3C3QA 3LXUX 4ATZD 3MJWA 4FADA 1LD8A 1ML9A 1TNBA 3Q73A 2A5UA 4GTRA 4LNGA 5T3RA 5BV0A 1V54E 3FFLA 1YYHA 5HQ8A 4O30A 5AQBA 2R05A 4APFA 4L2YA 3CHQA 3HIZA 4BEPA 5D66A 3AS5A 5KJKA 3EHQA 4PS7A 2IQCA 3ESLA 3PNTB 4GTOA 3EIJA 4GMLA 2IOLA 3D9IA 4UWKA 2XS1A 4U96D 2WMNA 3S8PA 4U7EB 3ZHEA 3HHMA 3ZUVB 4LNUD 5CERB 1Z3YA 3MYVA 2E0IA 3UT8A 2IFUA 1ELKA 1OXJA 3VTXA 1TNOA 3B7RL 2JLBA 3FTSA 2MOWA 4TRQA 3QARA 5B1BE 4ANVA 4U0UA 3T5VA 2ZXWE 4NURA 2NXPA 3FUJA 2BQZA 1TEZA 3D9JA 4G26A 4UI9C 1OWMA 5EYPF 4NVQA 2Y0BG 3EUVA 5F6KC 3K5KA 1OWNA 4HQDA 5BPPA 5JJ7A 2WB2A 4U04A 3W9GA 3PS6A 3TAXA 3TWQA 5FTPA 3QOUA 4G23A 3BO5A 2G46A 4CDMA 4YPUA 4UQYA 4KMOA 3S7BA 3KSLA 4EBAA 3NOGD 4C0MA 4L9PA 1DC2A 3TG5A 1A5EA 3G2VA 3MO5A 3ZN3A 4CCAA 4BFRA 2XPIA 1S70B 4J8OA 5EYLA 2RFMA 5ENPD 2XS8A 2WXKA 3C5RA 3UQ3A 3F9ZA 1N4QA 3LVQE 1PY1A 2KXPC 2I1JA 2X6FA 4MLPA 5G2NA 4FU3A 3RJVA 4NIKA 4DX1A 4EZJA 3O48A 1MYOA 4E85A 4CGWA 1Y6IA 5JIYA 1JWFA 2VSNA 3FU3A 4PS8A 3FTZA 3E4BA 4F7AA 3MV3B 4GTMA 3CVVA 3CVLA 1YMPA 3L16A 4ILHB 4QEPA 2P58C 5J90A 4OVUA 1N0RA 3DSVA 4J7WA 5ENNA 1UN8A 4HOUA 1H3IA 4XIFA 3KD7A 5A7DB 3V2OA 4GYWA 3ZHEB 3ABME 3OTNA 1ZBPA 4U63A 4C48B 3TGOA 4LRZA 3KMJA 2OEWA 2XGSA 3DSWA 3MX3A 3Q9NC 3FTVA 4AP2A 3M55A 4YNPA 3IXEA 4KZ0A 4WWNA 3APDA 4ZFHA 2XCCA 3FU5A 3GW4A 3TWXA 3S7JA 1KZPA 3PDNA 3K9IA 3U66A 3KMTA 3UINC 3PZ1A 5EG2A 2Y69E 4YVOA 3CHOA 1OCCE 3P2BA 4HXIA 3ZNGA 3MKRA 2VSYA 3SD5A 5G04J 4DI4A 3DWLG 1WY6A 3HXCA 3RRMB 3RRUA 2XPYA 1WM5A 2L6JA 4KZCA 3V79K 4QENA 4G24A 1FVFA 5AQ7A 3P1UA 4JPSA 1HO8A 3C3OA 3WXXA 3D9PA 1KZOA 4GTVA 2BUGA 1N95A 5EILA 5AYFA 3E37A 2OV8A 3D3MA 3LS8A 3CVWA 4L23A 3ZFWA 4J7FA 5BNWA 4Y6WA 1AP7A 2PM6A 3BU8A 1HF8A 4ANWA 1N11A 3DSTA 4GU5A 5FINA 1OCZE 3PEVB 3R7QA 2XQ0A 5JHBA 4OAVB 1OUVA 4OAUC 4A3TA 4GYOA 4RG6A 1FPPA 4J8FA 4K5AB 4FHKA 5B1AE 4JEHA 1MQSA 3U3WA 4MI0A 3CR3A 3T5XA 3CK8A 5JA4D 5FJYA 3UI2A 2I6HA 3QJZA 1IQRA 4GZ6A 5ENSD 3PE3A 3G2TA 1SVXA 5AQAA 3MO2A 4EZLA 3SBTB 3DALA 1NZNA 3EHNA 4BT9A 3BUAA 3EU9A 4LERA 3FEXA 3DBSA 4QQIA 3ZYKA 4XEIG 3D9HA 4G25A 5FQ8A 1OCRE 3UT7A 2ETCA 3QKYA 3JXIA 1SA4A 1H6OA 5ITZF 2WQHA 1FCHA 4AOFA 4JA7A 4XKCA 5ANLA 3DSXA 3MV2B 5JMND 3IHVA 1O1TA 4CRWA 2GRLA 2IONA 5FWQA 2KCVA 3C98A 1YA0A 3HXBA 4U0ZA 1HS6A 3ZYLA 1LTXA 3FTWA 4AY5A 2WXFA 4AVXA 4G8LA 3SBSA 2QPWA 2BF0X 3S7DA 4GA2A 3TWSA 2GRNB 5HKPA 2QY7A 2CFZA 2LXMA 2XENA 3FUEA 2F37A 1BI8B 4Y6CA 3URZA 3DXKG 3SZ7A 2WXHA 2B0OE 1E7VA 2QYUA 3MZLB 3FTXA 1TN7A 2AXZA 2EILE 1HU3A 3VV0A 5AJDA 1OY3D 3JUEA 4C9BB 3G2UA 4GTTA 1AWCB 4BESA 1FT1A 3FWVA 2X6KA 4U0SA 3NBNB 5KCMA 1MVXA 5T8IA 4WWPA 4J8SA 3CVUA 4H7XA 4KBQA 4WNGA 5CEAA 1O1RA 2B6CA 2LSUA 1D8EA 4G11A 4A55A 3VLEA 4PH4B 4N39A 3CQCB 3DPYA 3Q7FA 1O9SA 1LF8A 4W9RA 4AY6A 1UN9A 5EIDA 1MX4A 1OWPA 3L13A 2KC7A 3G2SA 1ZU2A 3Q9UC 3ZKJA 2W5YA 3LDZA 4B89A 1JPLA 5EKQD 1DNPA 4HRNA 5HI7A 3TWTA 3TWVA 3RAYA 1VDYA 3KAEA 2R2LA 4XE0A 4B0ZA 2M63A 4PDXA 4JHKA 2J08A 5CEDB 3DSSA 3IEGA 3Q78A 2LXLA 1MVHA 4LSZE 4UWHA 2H6HA 4J8EA 2J09A 3FHEA 4FJZA 5KBAA 3L82A 4RG9A 2PL2A 3M59A 5AENA 4ACKA 4LEUA 2L9BA 2VJ8A 4CDNA 3KSQA 3W9FA 1UOHA 1H2UA 3KMAA 3AU5A 1JCSA 4FA6A 5IY5E 2DZNA 4BWRA 2Q7FA 2OVBA 2DYRE 3ULEG 3MGBA 4Q69A 1TR4A 3DRAA 1TNYA 4NRHB 3SFZA 2YHCA 3ZVVA 4H12A 4YDEA 2GRMA 3U4TA 3PREA 4F6RD 2VGXA 3V2XA 2YQ8A 2ZGGA 3B7TA 5KJMA 3UUXA 3CVYA 2P9NG 3M53A 4Q94A 1TYQG 2WMOA 1RW2A 3DXMG 5KJNA 2JEKA 4KVOA 3JQ1A 4JXTA 2P9SG 1RZ4A 4MKTA 3ASHA 2ONDA 3IV0A 3QNKA 2I9CA 2DYSE 2MRIA 5F6LA 1H6KA 4UQXA 3ZXSA 3CBOA 4N3BA 4RLYA 2R3AA 5T5GA 3NQPA 4JW1A 5D2MC 3U9WA 1HH8A 4LNBA 3NZUA 4WAFA 4M3OA 4U8YD 3FUFA 5AYWD 3D9LA 4KYOB 2WXRA 1NL4A 4BSZB 2KBXA 3JYSA 4GPKA 4UWLA 5C2YA 3M5AA 4URKA 2NYJA 4IULA 3ZRHA 1Q2ZA 4K5CA 4KXKB 4I1AA 1SA5A 4K5BA 2V0PA 5G05C 4BX9A 1A17A 2EIKE 1WG0A 2F8YA 1WDYA 4I9CA 3MCXA 5EIBE 3QAQA 5T4YA 4WNFA 2WXLA 5G04C 1IQUA 1N4RA 2AW6A 4G8KA 3E30A 2ETAA 3L54A 3V30A 4L2LA 1X81A 3LVRE 4B93B 3RJWA 1HG2A 3TG4A 3AAAC 3I4RB 1MX6A 1EDUA 1ZKKA 3SWCA 2H6FA 3CVNA 3QWPA 4BUPA 1BPOA 2X6JA 2F8XK 2VYIA 4WWOA 4LG6A 3D9KA 3C72A 4GA0A 1QBQA 4ANUA 2XZDG 1H2VC 2AWIA 2VGXB 3OXFA 2X3MA 5JJ6A 5AQ9A 4HI8A 4WUYA 5H7PA 1BU9A 4JD2G 4LCTA 4GB9A 4DX7D 3CIAA 3RSEG 5DIZA 2C2LA 4XX5A 5D0QD 1KT0A 2R59A 2WXNA 4JL0A 4EBAG 3QC1A 5BW8C 4JVSA 2XEEA 3NB2A 1HXIA 3HNAA 4GYYA 4DRXE 3QWWA 3RKVA 4BTBA 1G3NB 2ZISA 4O60A 2IGQA 4IJDA 1IKND 1E8WA 3PVLA 4ME2A 4U95D 2UY1A 4GPMA 2V4HC 3Q47B 3CK9A 4N2QA 5BXOA 3UTMA 4BERA 3L17A 2DBAA 3T8KA 3T8MA 4UI9J 4KVMA 2PNNA 3L6AA 4IN3B 3F9WA 4XI9A 5KNGA 5ENQD 3LY7A 2X38A 4FLHA 3M57A 4A1SA 4U8HA 2J07A 4NJ5A 1H2TC 4YPEA 1N3JA 2GRRB 3UX4A 4HFGA 4CYMD 5FQ6A 4E6HA 3LJNA 2AVPA 3PNLB 1XNFA 4ATGA 2E2EA 4QEOA 1H0AA 4AJWA 5AAOA 3ML9A 4JB8P 3APFA 3B95A 4WNEA 1TJFA 3LJ3A 2ZU6B 1MJ0A 1U2VG 3CK7A 4HRLA 2Y3AA 3CHRA 5T0MA 4FC8A 2IO2C 2JV0A 3V31A 3R7RA 4I1OB 2QYJA 1PEGA 2VSXE 3GZ2A 4XI0A 2PQNA 1DVPA 4DX6D 3Q4AB 4N5CA 3U64A 5CRUA 3CBMA 2MHKA 3MKQA 5LFAA 4F1SA 1UG3A 4E47A 3Q5MA 4Z68A 5F59A 5BXUA 5KNHD 4HNAD 4CGVA 4JZYA 2IOSA 2WXOA 1BD8A 3KS2A 3CHSA 4MRUA 3AG4E 5LCWC 3Q7AA 4GTQA 3TL5A 1HX8A 1MUFA 1LD7A 3FEYA 1UJJA 5BUZA 4NQ0A 3I4GA 2DZOA 3SY2A 2H6GA 4DPRA 3R9AB 4HVBA 1N4PA 3LPZA 4BETA 1IYGA 3EU5A 5JJ0A 4RZ0A 1EPUA 2DWZA 3D9MA 3CGHA 3ISMC 3ESKA 3Q75A 2UY1B 2ZIRA 4GZCA 2OEVA 4U8VD 5CMYA 4O1OA 4D10C 4CT4A 4I17A 4HLEA 5T0KA 4G1TA 4ZHBA 4GZDA 2CG3A 3EHMA 1OCOE 4O1PA 2XGOA 4J8DA 1NA3A 1HFAA 3GZ1A 2CHXA 4YDOA 3B13A 4PS3A 3OXLA 3ZYQA 3CEQA 3PH0C 4DX2A 5AN8A 3RK6A 3TWRA 3CVPA 4G2VA 3WG7E 3CV0A 4I9EA 5DBKA 2IU1A 3TJPA 3HDXA 5ENRD 3LY8A 2AXVA 1TJCA 1HG5A 3SO8A 3L9TA 2R17C 5FZQA 1D8DA 4MS6A 2OOEA 2V4LA 2HO1A 2VGEA 3AJIA 1S0PA 3PZ3A 3SFXA 3TXMA 4J8YA 1QQEA 2PZIA 3UM2A 3APCA 3ABKE 3M54A 3I3NA 2RG8A 4X8QA 2XZTG 2WXJA 3MKQB 1GW6A 5CCLA 2QZAA 2XPZA 3ZIMA 2R03A 4TUUA 4HOTA 2L0IA 4GMJA 4MBGA 3CSFA 2P9LG 3ASNE 1E7UA 2LUHA 1ELWA 2L0TB 3UMVA 5F5EA 2Y4TA 3FU6A 4B94A 5AARA 2WXPA 1XQHA 2FULA 2KCKA 5CBNA 2A4ZA 4J83A 3O4ZA 1QZ2A 3PZ4A 3HYMB 4GZ5A 4H7YA 5ANRA 2LSVA 4I2ZA 4CDRA 1MHQA 4BX8A 4FJYA 4I1MA 2WM9A 4YDYA 1U3CA 1Y8MA 1INZA 2WXQA 3DEPA 1E90A 1WAO1 2J4BA 5CCMA 3NF1A 1N6AA 2WQ7A 2GRQB 3FUIA 2BEDA 3JCKC 3D9OA 2I1KA 4QFVA 4XZ4A 1MX2A 1PAQA 3SGHA 2FEZA 4XKBA 5EDSA 2J4DA 4UUCA 3DEOA 4JDSA 3OXGA 3FH5A 2C0LA 3HXDA 2XRZA 3LY9A 4CZ2D 2YHEA 2EIME 2J9QA 4EPZA 3HRAA 1FVHA 4N3AA 3S2AA 1NFIE 3SFYA 2C0MA 2NSZA 4AU7A 2X6HA 3EHRA 2FBNA 4DLQA 4ABNA 2WVIA 4CEMA 3FUMA 3RIBA 1SZ9A 2AXUA 4F3VA 5D0OD 3EIQC 5ENTD 3Q79A 3CBPA 2VGYA 3UM1A 4PUCA 1K8KG 2IEJA 3NZSA 4B8AA 1N94A 1SQMA 1UJKA 2Y4UA 4DJAA 4FLBA 1PC2A 5EX3A 1H6PA 4RSYA 1KT1A 1FT2A 4BT8A 2P9IG 4AV7A 3VLFA 4FP7A 3ULYA 1EF1C 5CECB 4UWGA 5LSXA 3FH8A 4AXHA 3LCAA 3UIOC 3ZXPA 5FZSA 2ILRA 1UW4B 1Z5SC 2J49A 4Q96A 3FPDA 3FUNA 1N54A 2XCBA 4JLGA 2XEHA 4DUIA 3NAWA 4J0UA 3L08A 1ZB1A 2R5SA 2RKKA 1B89A 5FQ4A 4FMUA 4F53A 2EINE 2HR2A 5FT9A 2I2OA 3L22A 4P29A 2P9UG 3M58A 1MT6A 1K1BA 3D9NA 3SHFA 2KCLA 1JWGA 2KM4A 4N5QA 3CVXA 1NI1A 2BKGA 3HG0D 5A6CA 4JHJA 5JHNA 4ILGA 2FF4A 3SNXA 5B3SE 1OWOA 3JXJA 3ONKA 4EQFA 3CKBA 2BTDA 3HVEA 3CQGB 4UQZA 5EX0A 4K0RA 2V5QC 4Z4PA 4GCNA 3Q49B 2WQ6A 1X5BA 4BY6A 2XRYA 4HRMB 5FZRA 4HBDA 3FH7A 1TN8A 2XEVA 4YNMA 5CBOA 4LUNU 1MZCA 3OPEA 2R02A 2VSOE 2JABA 2DCPA 2Y1LE 4TUMA 5G55A 4DI3A 4YDWA 4TV3A 1IXVA 4HS2A 5J08A 4OYSA 3LEWA 5LP0A 3ZGQA 5AJLA 2ETBA 3FTUA 4BTAA 2F0YA 1N4SA 4M7CA 1SW6A 4JA9A 1JCRA 1O1SA 3X2QE 4O6FA 2ZGDA 1E8XA 2VTBA 3RO3A 2L6BA 2BKKB 1NA0A 1U3DA 5LOZA 2A5EA 3OAWA 1N52A 3TXNA 5JHAA 2IF4A 4C1QA 2J8SD 1K3ZD 3BQOA 3ABLE 4IJ8A 4JEUA 3B7BA 4IRUA 3SF4A 3MEKA 2IY0C 4C0EA 4DLOA 2VQ2A 3E33A 2P9KG 1E8ZA 2FO1E 4NACA 2LNIA 4MI5A 2IJGX 4EECA 1TN6A 3GZSA 3B7UX 2WXMA 4F1PA 3AS4A 3LKUA 2GRPB 3SW9A 3PZ2A 1H19A 5G05J 4DK5A 3FUKA 4APOA 3QK0A 4LDGA 5LX8A 3BG0B 3UT4A 2AJAA 3FULA 3FUDA 3E34A 3I5PA 3PEUB 3HXEA 3DPDA 1OWLA 4UWFA 1Z6TA 3HVEB 5HRYA 4I6EA 1E8YA 3C3RA 3M56A 3F9XA 1SZAA 4HI9A 4A3VA 4A1GA 4ACLA 4HB5A 2QC9A 1JUQA 3PE4A 1IHBA 3RRNB 1S64A 5EN5D 3KEZA 3J5QB 4GCOA 2XHEA 1D9SA 3CLJA 1EYHA 3NOCD 4FULA 3E32A 3PUJA 2F69A 3BEEA 1E96B 1O5MA 5AIJA 4I51A 4V3IA 2EQXA 3EJNA 4GMRA 4GTSA 3SQVA 1TNUA 4EZKA 2HE0A 3CHPA 3UXGA 4ILIA 3ZPJA 3ASOE 1OT8A 3EP0A 2CHWA 4KT6B 2VTBB 4I43A
chains in the Genus database with same CATH topology
2L0TB 5F6LA 3UMVA 1H6KA 1ZBPA 4UQXA 3ZXSA 4U63A 3CBOA 5F5EA 3TGOA 4YPAA 4LRZA 2Y4TA 3KMJA 4N3BA 2R3AA 5T5GA 3QB2A 3NQPA 2XGSA 3FU6A 3MX3A 4JW1A 3U9WA 1HH8A 4B94A 3NZUA 4WAFA 3BG1B 3FTVA 4AP2A 3M55A 4M3OA 2RFIA 4YNPA 5CMWA 2WXPA 3FUFA 1XQHA 5AYWD 4FHJA 4KZ0A 2FULA 2KCKA 2WXGA 5M72A 2HM8A 4WWNA 2A4ZA 3D9LA 4KYOB 4J83A 3O4ZA 3MA5A 2WXRA 3APDA 1QZ2A 2XCCA 3JYSA 3ML8A 3HYMB 4GZ5A 3FU5A 3GW4A 4GPKA 4YNDA 4UWLA 3S7JA 1Z3XA 4H7YA 5ANRA 3ULQA 3PDNA 3K9IA 2LSVA 4I2ZA 3U66A 5C2YA 4CDRA 3KMTA 3ZYMA 3ZEFA 3M5AA 4URKA 5EG2A 1N6CA 2FI7A 4IULA 1MHQA 3ZRHA 3RQ4A 4YVOA 4KXKB 3DB5A 3CHOA 3RO2A 2KZTA 4I1AA 4BX8A 4FJYA 4I1MA 3RU0A 2WM9A 3P2BA 5BV1A 2RD0A 2WPVA 1U3CA 2V0PA 3CVQA 1Y8MA 4OVVA 1XGWA 2CG2A 2WXQA 4GAAA 4HXIA 5G05C 4BX9A 5JJTA 1INZA 1A17A 3MKRA 4L7TA 4CT0A 1E90A 1P5QA 2VSYA 1WAO1 2GGFA 4I9CA 3PRZA 3SD5A 2J4BA 3FP3A 3NF1A 2X6IA 4HOQA 5G04J 4DI4A 4BSXA 5CCMA 3MCXA 3QDNA 1N6AA 2WQ7A 1WY6A 3FDHA 3QAQA 5T4YA 3FUIA 4WNFA 2WXLA 5G04C 1IQUA 3JCKC 3D9OA 3RRMB 2I1KA 2AW6A 1HE8A 3CKCA 2XPYA 3RRUA 4EQFA 5KJLA 4QFVA 4XZ4A 1WM5A 3SI5A 1PAQA 2L6JA 3SGHA 2FEZA 4KZCA 3L54A 2CHZA 4XKBA 5EDSA 1ELRA 4QENA 4L2LA 3LVRE 2J4DA 4G24A 3RJWA 3LYAA 1FVFA 1HG2A 3TG4A 3FUHA 4JDSA 3I4RB 3OXGA 1EDUA 3P1UA 4JPSA 4JHRA 4N2SA 1ZKKA 1HO8A 3SWCA 3FH5A 2C0LA 2GW1A 3CVNA 3D9PA 3ENEA 3QWPA 3WXXA 3MO0A 4BUPA 2XRZA 3LY9A 2HYZA 2W5ZA 5A23A 2BUGA 4U07A 2YHEA 5TEGA 1BPOA 2J9QA 4EPZA 3CSTA 2X6JA 2VYIA 4WWOA 3D9KA 1FVHA 5AYFA 4GA0A 2CFUA 1HZ4A 4ANUA 4N3AA 1H2VC 3S2AA 2C0MA 2OV8A 2NSZA 4AU7A 2X6HA 2AWIA 3D3MA 5TH7A 4HORA 2FBNA 3PUKA 2VGXB 3LS8A 4JC8A 5E76A 3CVWA 1NP7A 4DLQA 4ABNA 2UWJG 4L23A 2WVIA 3JUIA 3OXFA 4CEMA 3ZFWA 2X3MA 5JJ6A 3FUMA 3PZDA 3RIBA 1SZ9A 4J7FA 5BNWA 2LAHA 4Y6WA 2AXUA 4F3VA 2PM6A 4WUYA 5JINA 1HF8A 4ANWA 4LCTA 2XGMA 5ARGA 3FU0A 2YNQA 3FY4A 4GU5A 4GB9A 4I6JA 5D0OD 2DIWA 3EIQC 4AIFA 3CBPA 3PEVB 3AU4A 2VGYA 3CIAA 2LAIA 3R7QA 2XQ0A 4PUCA 5DIZA 5JHBA 2YINA 2C2LA 3NZSA 4B8AA 4XX5A 1SQMA 5CPRB 1OUVA 5D0QD 1UJKA 1KT0A 2Y4UA 2R59A 2WXNA 4FLBA 2PM7A 2V5FA 1PC2A 4JL0A 5EX3A 4ANXA 4DJAA 4EBAG 3QC1A 4A3TA 5BW8C 5TTFA 4GYOA 4RSYA 5LSZA 3F9YA 4JVSA 1KT1A 4RG6A 5LCWJ 2LO6A 2NC9A 4AEZC 1HXIA 4I6GA 4GYYA 4J8FA 3QWWA 3RKVA 3ASDA 4FHKA 4BT8A 3HNAA 1KLXA 3Q15A 3EDTB 4BTBA 5C1DA 3CHMA 3VTYA 3ONLA 3IBEA 4JEHA 1MQSA 4AV7A 3U3WA 2IGQA 4IJDA 4MI0A 3VLFA 3CR3A 3T5XA 1E8WA 3CK8A 4FP7A 3PVLA 1EF1C 4K03A 4UWGA 5FJYA 3S7FA 5BT1A 2I6HA 4GA1A 3FH8A 4GZ3A 5LSXA 1QNFA 3QJZA 1IQRA 4R7LA 4AXHA 4GZ6A 3LCAA 2KATA 3N71A 1L5JA 3G2WA 4ME2A 4N3CA 2ILRA 3PE3A 3G2TA 5FZSA 3IHXA 1UW4B 2J49A 2UY1A 4Q96A 2PQRA 3FUNA 4EZLA 1N54A 4B8CB 1W3BA 3FPDA 3Q47B 3CK9A 3MO2A 3SBTB 4YVQC 4N2QA 3DALA 1NZNA 3EHNA 2XCBA 3L17A 4JLGA 3JQ0A 3QWVA 4BT9A 2DBAA 4LERA 3T8MA 3FEXA 4UI9J 3GYZA 3ASGA 4KVMA 3DBSA 3L6AA 4IN3B 4J0UA 3B7SA 4L1BA 3IHYA 3F9WA 3ZYKA 3L08A 4AM9A 2KZTB 3QNKA 2R5SA 4XI9A 1IHGA 1B89A 5FQ4A 3LY7A 4FMUA 4G25A 5FQ8A 2X38A 4FLHA 4F53A 3M57A 2FO7A 4J6IA 4A1SA 3IKOB 2OVFA 2HR2A 4U8HA 3UT7A 5FT9A 3QKYA 4UI9K 2J07A 3UPVA 2I2OA 3L22A 2O8JA 4WNDA 4P29A 4NJ5A 2WQHA 1FCHA 1H2TC 3M58A 1MT6A 4YPEA 5CHEE 1N3JA 5E75A 4AOFA 4JA7A 3D9NA 4RVBA 3UX4A 5ARFA 5FQ7A 3SHFA 2KCLA 4HFGA 3VLDA 3ZW3A 1JWGA 3OS5A 4XKCA 5FQ6A 2KM4A 2WXIA 4J7IA 5ANLA 4E6HA 3CVXA 4HOSA 3VUZA 3MV2B 2AVPA 5A6CA 3AS8A 4JHJA 3IHVA 3PNLB 5JHNA 4ILGA 1XNFA 4IYPA 2FF4A 3SNXA 4ATGA 4CRWA 1OWOA 2GRLA 2IONA 5FWQA 2E2EA 4QEOA 3ONKA 4I2WA 1H0AA 2KCVA 3CKBA 3FTYA 3C98A 3ML9A 1YA0A 2BTDA 3HVEA 3CQGB 2V8SE 4U0ZA 4UQZA 1HS6A 3APFA 5EX0A 3ZYLA 3FTWA 4AY5A 4K0RA 4WNEA 1TJFA 3LJ3A 2WXFA 4AVXA 2ZU6B 3ASFA 3OOIA 3SBSA 3CK7A 4Z4PA 2QFCA 2Y3AA 3CHRA 5T0MA 3LXUX 4GCNA 4FC8A 3MJWA 2JV0A 2QPWA 2BF0X 3S7DA 4FADA 3Q49B 4GA2A 4I1OB 1X5BA 3R7RA 4BY6A 2WQ6A 2QY7A 2XRYA 2CFZA 5FZRA 3FUEA 3FH7A 1ML9A 1MVXA 1PEGA 2A5UA 2VSXE 2XEVA 3GZ2A 4YNMA 4Y6CA 5T3RA 4XI0A 2PQNA 3URZA 5BV0A 3FFLA 5HQ8A 4O30A 4LUNU 3SZ7A 1DVPA 2WXHA 3OPEA 4APFA 3Q4AB 1E7VA 2VSOE 3MZLB 4N5CA 3FTXA 2AXZA 2DCPA 1HU3A 4L2YA 3U64A 3VV0A 3CHQA 3CBMA 3HIZA 5AJDA 2MHKA 3MKQA 5G55A 4TV3A 4DI3A 5LFAA 4F1SA 1UG3A 4E47A 4C9BB 4HS2A 3G2UA 3Q5MA 3FWVA 5J08A 4OYSA 3LEWA 3AS5A 3ZGQA 5KJKA 5LP0A 5F59A 5AJLA 4PS7A 2IQCA 3ESLA 3PNTB 2X6KA 4U0SA 3FTUA 5KCMA 3EIJA 4GMLA 4JZYA 4WWPA 5T8IA 2IOSA 2WXOA 4BTAA 4CGVA 4J8SA 3CVUA 3KS2A 4H7XA 4KBQA 4WNGA 2IOLA 3CHSA 3D9IA 2LSUA 4G11A 4MRUA 4JA9A 4A55A 4UWKA 3VLEA 4PH4B 4O6FA 5LCWC 2WMNA 3S8PA 4N39A 1E8XA 3ZHEA 3TL5A 3CQCB 1HX8A 2VTBA 1MUFA 3HHMA 1O9SA 3FEYA 1UJJA 1LF8A 5BUZA 4NQ0A 1Z3YA 3RO3A 4W9RA 3I4GA 3MYVA 4AY6A 1UN9A 2E0IA 3UT8A 2IFUA 1NA0A 1ELKA 1U3DA 1OWPA 5LOZA 3VTXA 3L13A 2KC7A 3R9AB 3G2SA 4DPRA 3B7RL 1ZU2A 4HVBA 3OAWA 1N52A 3TXNA 3LPZA 1IYGA 5JJ0A 5JHAA 2IF4A 4C1QA 4RZ0A 1EPUA 2JLBA 3D9MA 3FTSA 2W5YA 2MOWA 3CGHA 3LDZA 3ESKA 4TRQA 3QARA 4B89A 1JPLA 4ANVA 2UY1B 5EKQD 4U0UA 3T5VA 1DNPA 5HI7A 4GZCA 4IJ8A 5CMYA 4JEUA 4D10C 4IRUA 4CT4A 4NURA 4I17A 3SF4A 4HLEA 2NXPA 3MEKA 1VDYA 3KAEA 5T0KA 4G1TA 3RAYA 3FUJA 4XE0A 2BQZA 4C0EA 1TEZA 4DLOA 2VQ2A 3D9JA 4G26A 4GZDA 2M63A 2CG3A 3EHMA 4UI9C 1OWMA 4PDXA 4B0ZA 2XGOA 4JHKA 4NVQA 1E8ZA 5F6KC 4J8DA 3K5KA 2J08A 4NACA 2LNIA 4MI5A 1OWNA 2IJGX 5BPPA 1NA3A 1HFAA 5JJ7A 4EECA 3GZ1A 3GZSA 4U04A 2WB2A 3B7UX 3PS6A 2CHXA 2WXMA 3IEGA 3TAXA 3AS4A 3LKUA 1MVHA 5FTPA 3B13A 3QOUA 3SW9A 4G23A 4UWHA 2G46A 4CDMA 3BO5A 4YPUA 1H19A 4PS3A 5G05J 3OXLA 4UQYA 3CEQA 3FUKA 3PH0C 3ZYQA 4KMOA 4APOA 4DK5A 3S7BA 3RK6A 4EBAA 3QK0A 3CVPA 4J8EA 2J09A 4C0MA 4LDGA 3FHEA 3BG0B 5LX8A 3UT4A 3TG5A 4G2VA 3G2VA 4FJZA 3FULA 3MO5A 3CV0A 4I9EA 5DBKA 3FUDA 4RG9A 3ZN3A 4CCAA 3I5PA 3PEUB 4BFRA 2IU1A 2PL2A 2XPIA 4J8OA 3M59A 3DPDA 1OWLA 4UWFA 5AENA 3TJPA 1Z6TA 3HDXA 4ACKA 3LY8A 4LEUA 2L9BA 3HVEB 2AXVA 2VJ8A 4CDNA 1TJCA 4I6EA 2WXKA 3UQ3A 3F9ZA 1HG5A 1H2UA 3LVQE 1E8YA 3KMAA 3AU5A 3M56A 4FA6A 3F9XA 2R17C 4BWRA 1PY1A 5FZQA 2Q7FA 2OVBA 1SZAA 4MS6A 2OOEA 2V4LA 4AJWA 2I1JA 3MGBA 4A3VA 4A1GA 2HO1A 2X6FA 4ACLA 4Q69A 4MLPA 1JUQA 5G2NA 4FU3A 3PE4A 3RJVA 4NRHB 3SFZA 1S0PA 2YHCA 3RRNB 4EZJA 3O48A 3ZVVA 4E85A 4H12A 2GRMA 3KEZA 4GCOA 3TXMA 3U4TA 4CGWA 3PREA 1Y6IA 2XHEA 1QQEA 2VGXA 1JWFA 2YQ8A 5JIYA 3B7TA 3CLJA 2PZIA 5KJMA 2VSNA 3UUXA 3APCA 3CVYA 3M53A 1EYHA 3FU3A 3M54A 4Q94A 4PS8A 3I3NA 3FTZA 2RG8A 4FULA 3E4BA 4F7AA 2WXJA 3MKQB 1GW6A 3MV3B 3PUJA 5CCLA 3BEEA 1E96B 2F69A 2XPZA 2WMOA 3CVVA 5AIJA 3CVLA 3ZIMA 4I51A 4TUUA 4V3IA 2EQXA 3EJNA 3L16A 4ILHB 5KJNA 2JEKA 4QEPA 2P58C 5J90A 4HOTA 4KVOA 4OVUA 4EZKA 3JQ1A 3CHPA 4JXTA 4ILIA 3ZPJA 5ENNA 1UN8A 2L0IA 4HOUA 1H3IA 4GMJA 4XIFA 3KD7A 5A7DB 3CSFA 3EP0A 2CHWA 4MKTA 3ASHA 4GYWA 2ONDA 1E7UA 3ZHEB 4KT6B 3IV0A 2VTBB 1ELWA 4I43A 3OTNA 2I9CA 2MRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6L A;  1ZBP A;  4UQX A;  3CBO A;  5F5E A;  3TGO A;  4YPA A;  2Y4T A;  3KMJ A;  4N3B A;  2R3A A;  5T5G A;  2XGS A;  1HH8 A;  4B94 A;  3M55 A;  2RFI A;  4YNP A;  1XQH A;  5AYW D;  2KCK A;  5M72 A;  4KYO B;  4J83 A;  3MA5 A;  1QZ2 A;  2XCC A;  3JYS A;  3HYM B;  4GZ5 A;  3GW4 A;  4GPK A;  4YND A;  3S7J A;  4H7Y A;  3ULQ A;  3PDN A;  3K9I A;  2LSV A;  4I2Z A;  4CDR A;  3KMT A;  3M5A A;  5EG2 A;  1N6C A;  2FI7 A;  3RQ4 A;  4YVO A;  4KXK B;  3DB5 A;  3RO2 A;  4I1A A;  3RU0 A;  2WPV A;  3CVQ A;  1Y8M A;  5JJT A;  5G05 C;  1A17 A;  3MKR A;  1P5Q A;  2VSY A;  1WAO 1;  4I9C A;  5CCM A;  3FP3 A;  3NF1 A;  4HOQ A;  5G04 J;  1N6A A;  3QDN A;  4WNF A;  5G04 C;  3CKC A;  5KJL A;  1WM5 A;  2L6J A;  2FEZ A;  1ELR A;  4QEN A;  4G24 A;  3RJW A;  3LYA A;  3TG4 A;  4JDS A;  3OXG A;  4N2S A;  4JHR A;  1ZKK A;  3SWC A;  3WXX A;  2C0L A;  2GW1 A;  3CVN A;  3QWP A;  3MO0 A;  4BUP A;  3LY9 A;  2HYZ A;  2W5Z A;  2BUG A;  4U07 A;  5TEG A;  2J9Q A;  2VYI A;  5AYF A;  4GA0 A;  1HZ4 A;  4N3A A;  2C0M A;  4AU7 A;  5TH7 A;  4HOR A;  2FBN A;  2VGX B;  4ABN A;  2UWJ G;  3OXF A;  3ZFW A;  5JJ6 A;  3RIB A;  4J7F A;  5BNW A;  4Y6W A;  4F3V A;  5JIN A;  4WUY A;  2XGM A;  5ARG A;  5D0O D;  4AIF A;  3CBP A;  2VGY A;  5DIZ A;  2C2L A;  5CPR B;  1OUV A;  5D0Q D;  1KT0 A;  2Y4U A;  4JL0 A;  2V5F A;  1PC2 A;  5EX3 A;  5BW8 C;  5TTF A;  4GYO A;  5LSZ A;  3F9Y A;  1KT1 A;  4RG6 A;  5LCW J;  2NC9 A;  1HXI A;  3HNA A;  4GYY A;  4J8F A;  3QWW A;  3RKV A;  3ASD A;  4BT8 A;  1KLX A;  3Q15 A;  3EDT B;  4BTB A;  5C1D A;  3VTY A;  2IGQ A;  3U3W A;  4IJD A;  4MI0 A;  3CK8 A;  5FJY A;  3S7F A;  5BT1 A;  2I6H A;  4GA1 A;  5LSX A;  4GZ3 A;  4GZ6 A;  3LCA A;  2KAT A;  3N71 A;  4ME2 A;  4N3C A;  3PE3 A;  5FZS A;  3IHX A;  2UY1 A;  3FPD A;  2PQR A;  3MO2 A;  1W3B A;  3Q47 B;  3CK9 A;  4YVQ C;  4N2Q A;  3DAL A;  1NZN A;  2XCB A;  4JLG A;  3QWV A;  4BT9 A;  2DBA A;  4UI9 J;  3GYZ A;  3ASG A;  4IN3 B;  4J0U A;  3F9W A;  4AM9 A;  2R5S A;  4XI9 A;  1IHG A;  1B89 A;  3LY7 A;  4FMU A;  4G25 A;  3M57 A;  2FO7 A;  4A1S A;  2HR2 A;  5FT9 A;  3QKY A;  4UI9 K;  3UPV A;  2O8J A;  4WND A;  4NJ5 A;  2WQH A;  1FCH A;  3M58 A;  1MT6 A;  4YPE A;  5CHE E;  1N3J A;  4JA7 A;  5ARF A;  2KCL A;  3OS5 A;  4J7I A;  4HOS A;  3VUZ A;  3MV2 B;  2AVP A;  5A6C A;  3AS8 A;  5JHN A;  1XNF A;  2FF4 A;  2E2E A;  4QEO A;  4I2W A;  2KCV A;  3CKB A;  4EQF A;  1YA0 A;  4U0Z A;  4UQZ A;  5EX0 A;  4AY5 A;  4WNE A;  3ASF A;  3OOI A;  3CK7 A;  4Z4P A;  2QFC A;  5T0M A;  4GCN A;  2JV0 A;  2QPW A;  3S7D A;  3Q49 B;  4GA2 A;  5FZR A;  1ML9 A;  1PEG A;  2XEV A;  3GZ2 A;  4YNM A;  4Y6C A;  3URZ A;  4XI0 A;  2PQN A;  3FFL A;  5HQ8 A;  4O30 A;  3SZ7 A;  3OPE A;  3Q4A B;  4N5C A;  3VV0 A;  3CBM A;  2MHK A;  4E47 A;  3Q5M A;  3FWV A;  3AS5 A;  3ZGQ A;  5KJK A;  5F59 A;  4U0S A;  4BTA A;  4CGV A;  1MVX A;  3KS2 A;  4H7X A;  4KBQ A;  4WNG A;  2LSU A;  4JA9 A;  4O6F A;  5LCW C;  3S8P A;  4N39 A;  3ZHE A;  1MUF A;  1O9S A;  4NQ0 A;  3RO3 A;  4W9R A;  4AY6 A;  2IFU A;  1NA0 A;  3VTX A;  2KC7 A;  3R9A B;  1ZU2 A;  3LPZ A;  1IYG A;  5JJ0 A;  2IF4 A;  4C1Q A;  4RZ0 A;  2JLB A;  2W5Y A;  3ESK A;  2UY1 B;  5EKQ D;  4U0U A;  5HI7 A;  4IJ8 A;  4I17 A;  3SF4 A;  3RAY A;  3MEK A;  5T0K A;  3KAE A;  4G1T A;  2BQZ A;  2VQ2 A;  4G26 A;  4UI9 C;  2XGO A;  4NVQ A;  5F6K C;  4J8D A;  3K5K A;  2LNI A;  4MI5 A;  1NA3 A;  5JJ7 A;  3GZ1 A;  4U04 A;  3TAX A;  3IEG A;  3AS4 A;  3LKU A;  1MVH A;  5FTP A;  3QOU A;  3SW9 A;  4G23 A;  3BO5 A;  2G46 A;  4YPU A;  5G05 J;  3OXL A;  4UQY A;  3CEQ A;  4APO A;  3S7B A;  3CVP A;  4J8E A;  4LDG A;  3TG5 A;  4G2V A;  3MO5 A;  3CV0 A;  4I9E A;  5DBK A;  4RG9 A;  3ZN3 A;  2PL2 A;  2XPI A;  4J8O A;  3M59 A;  3LY8 A;  4LEU A;  1TJC A;  3UQ3 A;  3F9Z A;  3KMA A;  3F9X A;  3M56 A;  4BWR A;  5FZQ A;  2Q7F A;  2OOE A;  2HO1 A;  3RJV A;  3PE4 A;  4NRH B;  2YHC A;  3O48 A;  4H12 A;  4GCO A;  3U4T A;  4CGW A;  1QQE A;  2VGX A;  5JIY A;  2YQ8 A;  5KJM A;  2PZI A;  2VSN A;  3UUX A;  3M53 A;  3M54 A;  3E4B A;  3MV3 B;  5CCL A;  2F69 A;  3BEE A;  1E96 B;  3CVL A;  4I51 A;  5KJN A;  4QEP A;  2P58 C;  4HOT A;  3ZPJ A;  4HOU A;  1H3I A;  4XIF A;  3KD7 A;  5A7D B;  3EP0 A;  3ASH A;  4GYW A;  2OND A;  3ZHE B;  1ELW A; 
#chains in the Genus database with same CATH topology
 2H6I A;  4YPA A;  1QYM A;  3QB2 A;  4TXR A;  3BG1 B;  2RFI A;  5CMW A;  5ENO D;  4FHJ A;  2WXG A;  5M72 A;  2HM8 A;  3MA5 A;  4RQI A;  1N0Q A;  1S63 A;  3ML8 A;  3RAU A;  4YND A;  1Z3X A;  3ULQ A;  1DCE A;  3ZYM A;  2P9P G;  3ZEF A;  3UM3 A;  2FI7 A;  1N6C A;  3RQ4 A;  3DB5 A;  3RO2 A;  2KZT A;  3RU0 A;  2IO3 C;  2DVW A;  2OCC E;  5BV1 A;  2RD0 A;  2WPV A;  3UIP C;  3CVQ A;  4OVV A;  5JJT A;  1XGW A;  2CG2 A;  4GAA A;  3KEA A;  4L7T A;  4CT0 A;  1P5Q A;  4TXQ A;  2GGF A;  3PRZ A;  3HXF A;  3FP3 A;  4HOQ A;  2X6I A;  4BSX A;  3R9M A;  3QDN A;  5HS0 A;  3FDH A;  3CKC A;  1HE8 A;  5KJL A;  3SI5 A;  2CHZ A;  1ELR A;  3AG2 E;  5KWD A;  3LYA A;  3FUH A;  4HLL A;  4A63 B;  3T9K A;  4N2S A;  4JHR A;  4EHM A;  3J5P A;  2GW1 A;  2EIJ E;  2GRO B;  3ENE A;  3MO0 A;  3F6Q A;  2HYZ A;  2W5Z A;  5A23 A;  4U07 A;  5TEG A;  3CST A;  2CFU A;  1HZ4 A;  4DX5 D;  1BLX B;  5TH7 A;  4HOR A;  3PUK A;  4JC8 A;  5E76 A;  1NP7 A;  2UWJ G;  3ZU7 B;  3JUI A;  3TWW A;  2RFA A;  3PZD A;  1N9A A;  2LAH A;  5JIN A;  2XGM A;  5ARG A;  3FU0 A;  2YNQ A;  3FY4 A;  4I6J A;  2DIW A;  4AIF A;  3UM0 A;  3AU4 A;  1YCS B;  2LAI A;  1DCQ A;  2YIN A;  5CPR B;  2PM7 A;  2V5F A;  4ANX A;  5LSZ A;  5TTF A;  1KPS B;  3F9Y A;  5LCW J;  2LO6 A;  2NC9 A;  4AEZ C;  4I6G A;  3ASD A;  1KLX A;  3UKR G;  3Q15 A;  3EDT B;  5C1D A;  3CHM A;  3VTY A;  3ONL A;  3IBE A;  2P2C P;  4K03 A;  3S7F A;  5BT1 A;  4GA1 A;  4GZ3 A;  1QNF A;  4R7L A;  3UKU G;  2KAT A;  3N71 A;  1L5J A;  3G2W A;  3IHX A;  4N3C A;  2PQR A;  4B8C B;  1W3B A;  3TWU A;  4YVQ C;  1K1A A;  3JQ0 A;  3QWV A;  3AG3 E;  1V55 E;  3GYZ A;  3ASG A;  4L1B A;  3B7S A;  3IHY A;  4AM9 A;  2KZT B;  1IHG A;  2FO7 A;  4J6I A;  3IKO B;  1TNZ A;  2OVF A;  5FIO A;  4UI9 K;  3UPV A;  2O8J A;  4WND A;  5CRV A;  5CHE E;  5E75 A;  2MYO A;  4RVB A;  5ARF A;  5FQ7 A;  3VLD A;  3ZW3 A;  3OS5 A;  2WXI A;  4J7I A;  3DSU A;  4HOS A;  3VUZ A;  4TXP A;  3AS8 A;  4IYP A;  3AG1 E;  4GTP A;  4I2W A;  3FTY A;  2V8S E;  1JCQ A;  3ASF A;  3OOI A;  1BI7 B;  2QFC A;  3C3Q A;  3LXU X;  4ATZ D;  3MJW A;  4FAD A;  1LD8 A;  1ML9 A;  1TNB A;  3Q73 A;  2A5U A;  4GTR A;  4LNG A;  5T3R A;  5BV0 A;  1V54 E;  3FFL A;  1YYH A;  5HQ8 A;  4O30 A;  5AQB A;  2R05 A;  4APF A;  4L2Y A;  3CHQ A;  3HIZ A;  4BEP A;  5D66 A;  3AS5 A;  5KJK A;  3EHQ A;  4PS7 A;  2IQC A;  3ESL A;  3PNT B;  4GTO A;  3EIJ A;  4GML A;  2IOL A;  3D9I A;  4UWK A;  2XS1 A;  4U96 D;  2WMN A;  3S8P A;  4U7E B;  3ZHE A;  3HHM A;  3ZUV B;  4LNU D;  5CER B;  1Z3Y A;  3MYV A;  2E0I A;  3UT8 A;  2IFU A;  1ELK A;  1OXJ A;  3VTX A;  1TNO A;  3B7R L;  2JLB A;  3FTS A;  2MOW A;  4TRQ A;  3QAR A;  5B1B E;  4ANV A;  4U0U A;  3T5V A;  2ZXW E;  4NUR A;  2NXP A;  3FUJ A;  2BQZ A;  1TEZ A;  3D9J A;  4G26 A;  4UI9 C;  1OWM A;  5EYP F;  4NVQ A;  2Y0B G;  3EUV A;  5F6K C;  3K5K A;  1OWN A;  4HQD A;  5BPP A;  5JJ7 A;  2WB2 A;  4U04 A;  3W9G A;  3PS6 A;  3TAX A;  3TWQ A;  5FTP A;  3QOU A;  4G23 A;  3BO5 A;  2G46 A;  4CDM A;  4YPU A;  4UQY A;  4KMO A;  3S7B A;  3KSL A;  4EBA A;  3NOG D;  4C0M A;  4L9P A;  1DC2 A;  3TG5 A;  1A5E A;  3G2V A;  3MO5 A;  3ZN3 A;  4CCA A;  4BFR A;  2XPI A;  1S70 B;  4J8O A;  5EYL A;  2RFM A;  5ENP D;  2XS8 A;  2WXK A;  3C5R A;  3UQ3 A;  3F9Z A;  1N4Q A;  3LVQ E;  1PY1 A;  2KXP C;  2I1J A;  2X6F A;  4MLP A;  5G2N A;  4FU3 A;  3RJV A;  4NIK A;  4DX1 A;  4EZJ A;  3O48 A;  1MYO A;  4E85 A;  4CGW A;  1Y6I A;  5JIY A;  1JWF A;  2VSN A;  3FU3 A;  4PS8 A;  3FTZ A;  3E4B A;  4F7A A;  3MV3 B;  4GTM A;  3CVV A;  3CVL A;  1YMP A;  3L16 A;  4ILH B;  4QEP A;  2P58 C;  5J90 A;  4OVU A;  1N0R A;  3DSV A;  4J7W A;  5ENN A;  1UN8 A;  4HOU A;  1H3I A;  4XIF A;  3KD7 A;  5A7D B;  3V2O A;  4GYW A;  3ZHE B;  3ABM E;  3OTN A;  1ZBP A;  4U63 A;  4C48 B;  3TGO A;  4LRZ A;  3KMJ A;  2OEW A;  2XGS A;  3DSW A;  3MX3 A;  3Q9N C;  3FTV A;  4AP2 A;  3M55 A;  4YNP A;  3IXE A;  4KZ0 A;  4WWN A;  3APD A;  4ZFH A;  2XCC A;  3FU5 A;  3GW4 A;  3TWX A;  3S7J A;  1KZP A;  3PDN A;  3K9I A;  3U66 A;  3KMT A;  3UIN C;  3PZ1 A;  5EG2 A;  2Y69 E;  4YVO A;  3CHO A;  1OCC E;  3P2B A;  4HXI A;  3ZNG A;  3MKR A;  2VSY A;  3SD5 A;  5G04 J;  4DI4 A;  3DWL G;  1WY6 A;  3HXC A;  3RRM B;  3RRU A;  2XPY A;  1WM5 A;  2L6J A;  4KZC A;  3V79 K;  4QEN A;  4G24 A;  1FVF A;  5AQ7 A;  3P1U A;  4JPS A;  1HO8 A;  3C3O A;  3WXX A;  3D9P A;  1KZO A;  4GTV A;  2BUG A;  1N95 A;  5EIL A;  5AYF A;  3E37 A;  2OV8 A;  3D3M A;  3LS8 A;  3CVW A;  4L23 A;  3ZFW A;  4J7F A;  5BNW A;  4Y6W A;  1AP7 A;  2PM6 A;  3BU8 A;  1HF8 A;  4ANW A;  1N11 A;  3DST A;  4GU5 A;  5FIN A;  1OCZ E;  3PEV B;  3R7Q A;  2XQ0 A;  5JHB A;  4OAV B;  1OUV A;  4OAU C;  4A3T A;  4GYO A;  4RG6 A;  1FPP A;  4J8F A;  4K5A B;  4FHK A;  5B1A E;  4JEH A;  1MQS A;  3U3W A;  4MI0 A;  3CR3 A;  3T5X A;  3CK8 A;  5JA4 D;  5FJY A;  3UI2 A;  2I6H A;  3QJZ A;  1IQR A;  4GZ6 A;  5ENS D;  3PE3 A;  3G2T A;  1SVX A;  5AQA A;  3MO2 A;  4EZL A;  3SBT B;  3DAL A;  1NZN A;  3EHN A;  4BT9 A;  3BUA A;  3EU9 A;  4LER A;  3FEX A;  3DBS A;  4QQI A;  3ZYK A;  4XEI G;  3D9H A;  4G25 A;  5FQ8 A;  1OCR E;  3UT7 A;  2ETC A;  3QKY A;  3JXI A;  1SA4 A;  1H6O A;  5ITZ F;  2WQH A;  1FCH A;  4AOF A;  4JA7 A;  4XKC A;  5ANL A;  3DSX A;  3MV2 B;  5JMN D;  3IHV A;  1O1T A;  4CRW A;  2GRL A;  2ION A;  5FWQ A;  2KCV A;  3C98 A;  1YA0 A;  3HXB A;  4U0Z A;  1HS6 A;  3ZYL A;  1LTX A;  3FTW A;  4AY5 A;  2WXF A;  4AVX A;  4G8L A;  3SBS A;  2QPW A;  2BF0 X;  3S7D A;  4GA2 A;  3TWS A;  2GRN B;  5HKP A;  2QY7 A;  2CFZ A;  2LXM A;  2XEN A;  3FUE A;  2F37 A;  1BI8 B;  4Y6C A;  3URZ A;  3DXK G;  3SZ7 A;  2WXH A;  2B0O E;  1E7V A;  2QYU A;  3MZL B;  3FTX A;  1TN7 A;  2AXZ A;  2EIL E;  1HU3 A;  3VV0 A;  5AJD A;  1OY3 D;  3JUE A;  4C9B B;  3G2U A;  4GTT A;  1AWC B;  4BES A;  1FT1 A;  3FWV A;  2X6K A;  4U0S A;  3NBN B;  5KCM A;  1MVX A;  5T8I A;  4WWP A;  4J8S A;  3CVU A;  4H7X A;  4KBQ A;  4WNG A;  5CEA A;  1O1R A;  2B6C A;  2LSU A;  1D8E A;  4G11 A;  4A55 A;  3VLE A;  4PH4 B;  4N39 A;  3CQC B;  3DPY A;  3Q7F A;  1O9S A;  1LF8 A;  4W9R A;  4AY6 A;  1UN9 A;  5EID A;  1MX4 A;  1OWP A;  3L13 A;  2KC7 A;  3G2S A;  1ZU2 A;  3Q9U C;  3ZKJ A;  2W5Y A;  3LDZ A;  4B89 A;  1JPL A;  5EKQ D;  1DNP A;  4HRN A;  5HI7 A;  3TWT A;  3TWV A;  3RAY A;  1VDY A;  3KAE A;  2R2L A;  4XE0 A;  4B0Z A;  2M63 A;  4PDX A;  4JHK A;  2J08 A;  5CED B;  3DSS A;  3IEG A;  3Q78 A;  2LXL A;  1MVH A;  4LSZ E;  4UWH A;  2H6H A;  4J8E A;  2J09 A;  3FHE A;  4FJZ A;  5KBA A;  3L82 A;  4RG9 A;  2PL2 A;  3M59 A;  5AEN A;  4ACK A;  4LEU A;  2L9B A;  2VJ8 A;  4CDN A;  3KSQ A;  3W9F A;  1UOH A;  1H2U A;  3KMA A;  3AU5 A;  1JCS A;  4FA6 A;  5IY5 E;  2DZN A;  4BWR A;  2Q7F A;  2OVB A;  2DYR E;  3ULE G;  3MGB A;  4Q69 A;  1TR4 A;  3DRA A;  1TNY A;  4NRH B;  3SFZ A;  2YHC A;  3ZVV A;  4H12 A;  4YDE A;  2GRM A;  3U4T A;  3PRE A;  4F6R D;  2VGX A;  3V2X A;  2YQ8 A;  2ZGG A;  3B7T A;  5KJM A;  3UUX A;  3CVY A;  2P9N G;  3M53 A;  4Q94 A;  1TYQ G;  2WMO A;  1RW2 A;  3DXM G;  5KJN A;  2JEK A;  4KVO A;  3JQ1 A;  4JXT A;  2P9S G;  1RZ4 A;  4MKT A;  3ASH A;  2OND A;  3IV0 A;  3QNK A;  2I9C A;  2DYS E;  2MRI A;  5F6L A;  1H6K A;  4UQX A;  3ZXS A;  3CBO A;  4N3B A;  4RLY A;  2R3A A;  5T5G A;  3NQP A;  4JW1 A;  5D2M C;  3U9W A;  1HH8 A;  4LNB A;  3NZU A;  4WAF A;  4M3O A;  4U8Y D;  3FUF A;  5AYW D;  3D9L A;  4KYO B;  2WXR A;  1NL4 A;  4BSZ B;  2KBX A;  3JYS A;  4GPK A;  4UWL A;  5C2Y A;  3M5A A;  4URK A;  2NYJ A;  4IUL A;  3ZRH A;  1Q2Z A;  4K5C A;  4KXK B;  4I1A A;  1SA5 A;  4K5B A;  2V0P A;  5G05 C;  4BX9 A;  1A17 A;  2EIK E;  1WG0 A;  2F8Y A;  1WDY A;  4I9C A;  3MCX A;  5EIB E;  3QAQ A;  5T4Y A;  4WNF A;  2WXL A;  5G04 C;  1IQU A;  1N4R A;  2AW6 A;  4G8K A;  3E30 A;  2ETA A;  3L54 A;  3V30 A;  4L2L A;  1X81 A;  3LVR E;  4B93 B;  3RJW A;  1HG2 A;  3TG4 A;  3AAA C;  3I4R B;  1MX6 A;  1EDU A;  1ZKK A;  3SWC A;  2H6F A;  3CVN A;  3QWP A;  4BUP A;  1BPO A;  2X6J A;  2F8X K;  2VYI A;  4WWO A;  4LG6 A;  3D9K A;  3C72 A;  4GA0 A;  1QBQ A;  4ANU A;  2XZD G;  1H2V C;  2AWI A;  2VGX B;  3OXF A;  2X3M A;  5JJ6 A;  5AQ9 A;  4HI8 A;  4WUY A;  5H7P A;  1BU9 A;  4JD2 G;  4LCT A;  4GB9 A;  4DX7 D;  3CIA A;  3RSE G;  5DIZ A;  2C2L A;  4XX5 A;  5D0Q D;  1KT0 A;  2R59 A;  2WXN A;  4JL0 A;  4EBA G;  3QC1 A;  5BW8 C;  4JVS A;  2XEE A;  3NB2 A;  1HXI A;  3HNA A;  4GYY A;  4DRX E;  3QWW A;  3RKV A;  4BTB A;  1G3N B;  2ZIS A;  4O60 A;  2IGQ A;  4IJD A;  1IKN D;  1E8W A;  3PVL A;  4ME2 A;  4U95 D;  2UY1 A;  4GPM A;  2V4H C;  3Q47 B;  3CK9 A;  4N2Q A;  5BXO A;  3UTM A;  4BER A;  3L17 A;  2DBA A;  3T8K A;  3T8M A;  4UI9 J;  4KVM A;  2PNN A;  3L6A A;  4IN3 B;  3F9W A;  4XI9 A;  5KNG A;  5ENQ D;  3LY7 A;  2X38 A;  4FLH A;  3M57 A;  4A1S A;  4U8H A;  2J07 A;  4NJ5 A;  1H2T C;  4YPE A;  1N3J A;  2GRR B;  3UX4 A;  4HFG A;  4CYM D;  5FQ6 A;  4E6H A;  3LJN A;  2AVP A;  3PNL B;  1XNF A;  4ATG A;  2E2E A;  4QEO A;  1H0A A;  4AJW A;  5AAO A;  3ML9 A;  4JB8 P;  3APF A;  3B95 A;  4WNE A;  1TJF A;  3LJ3 A;  2ZU6 B;  1MJ0 A;  1U2V G;  3CK7 A;  4HRL A;  2Y3A A;  3CHR A;  5T0M A;  4FC8 A;  2IO2 C;  2JV0 A;  3V31 A;  3R7R A;  4I1O B;  2QYJ A;  1PEG A;  2VSX E;  3GZ2 A;  4XI0 A;  2PQN A;  1DVP A;  4DX6 D;  3Q4A B;  4N5C A;  3U64 A;  5CRU A;  3CBM A;  2MHK A;  3MKQ A;  5LFA A;  4F1S A;  1UG3 A;  4E47 A;  3Q5M A;  4Z68 A;  5F59 A;  5BXU A;  5KNH D;  4HNA D;  4CGV A;  4JZY A;  2IOS A;  2WXO A;  1BD8 A;  3KS2 A;  3CHS A;  4MRU A;  3AG4 E;  5LCW C;  3Q7A A;  4GTQ A;  3TL5 A;  1HX8 A;  1MUF A;  1LD7 A;  3FEY A;  1UJJ A;  5BUZ A;  4NQ0 A;  3I4G A;  2DZO A;  3SY2 A;  2H6G A;  4DPR A;  3R9A B;  4HVB A;  1N4P A;  3LPZ A;  4BET A;  1IYG A;  3EU5 A;  5JJ0 A;  4RZ0 A;  1EPU A;  2DWZ A;  3D9M A;  3CGH A;  3ISM C;  3ESK A;  3Q75 A;  2UY1 B;  2ZIR A;  4GZC A;  2OEV A;  4U8V D;  5CMY A;  4O1O A;  4D10 C;  4CT4 A;  4I17 A;  4HLE A;  5T0K A;  4G1T A;  4ZHB A;  4GZD A;  2CG3 A;  3EHM A;  1OCO E;  4O1P A;  2XGO A;  4J8D A;  1NA3 A;  1HFA A;  3GZ1 A;  2CHX A;  4YDO A;  3B13 A;  4PS3 A;  3OXL A;  3ZYQ A;  3CEQ A;  3PH0 C;  4DX2 A;  5AN8 A;  3RK6 A;  3TWR A;  3CVP A;  4G2V A;  3WG7 E;  3CV0 A;  4I9E A;  5DBK A;  2IU1 A;  3TJP A;  3HDX A;  5ENR D;  3LY8 A;  2AXV A;  1TJC A;  1HG5 A;  3SO8 A;  3L9T A;  2R17 C;  5FZQ A;  1D8D A;  4MS6 A;  2OOE A;  2V4L A;  2HO1 A;  2VGE A;  3AJI A;  1S0P A;  3PZ3 A;  3SFX A;  3TXM A;  4J8Y A;  1QQE A;  2PZI A;  3UM2 A;  3APC A;  3ABK E;  3M54 A;  3I3N A;  2RG8 A;  4X8Q A;  2XZT G;  2WXJ A;  3MKQ B;  1GW6 A;  5CCL A;  2QZA A;  2XPZ A;  3ZIM A;  2R03 A;  4TUU A;  4HOT A;  2L0I A;  4GMJ A;  4MBG A;  3CSF A;  2P9L G;  3ASN E;  1E7U A;  2LUH A;  1ELW A;  2L0T B;  3UMV A;  5F5E A;  2Y4T A;  3FU6 A;  4B94 A;  5AAR A;  2WXP A;  1XQH A;  2FUL A;  2KCK A;  5CBN A;  2A4Z A;  4J83 A;  3O4Z A;  1QZ2 A;  3PZ4 A;  3HYM B;  4GZ5 A;  4H7Y A;  5ANR A;  2LSV A;  4I2Z A;  4CDR A;  1MHQ A;  4BX8 A;  4FJY A;  4I1M A;  2WM9 A;  4YDY A;  1U3C A;  1Y8M A;  1INZ A;  2WXQ A;  3DEP A;  1E90 A;  1WAO 1;  2J4B A;  5CCM A;  3NF1 A;  1N6A A;  2WQ7 A;  2GRQ B;  3FUI A;  2BED A;  3JCK C;  3D9O A;  2I1K A;  4QFV A;  4XZ4 A;  1MX2 A;  1PAQ A;  3SGH A;  2FEZ A;  4XKB A;  5EDS A;  2J4D A;  4UUC A;  3DEO A;  4JDS A;  3OXG A;  3FH5 A;  2C0L A;  3HXD A;  2XRZ A;  3LY9 A;  4CZ2 D;  2YHE A;  2EIM E;  2J9Q A;  4EPZ A;  3HRA A;  1FVH A;  4N3A A;  3S2A A;  1NFI E;  3SFY A;  2C0M A;  2NSZ A;  4AU7 A;  2X6H A;  3EHR A;  2FBN A;  4DLQ A;  4ABN A;  2WVI A;  4CEM A;  3FUM A;  3RIB A;  1SZ9 A;  2AXU A;  4F3V A;  5D0O D;  3EIQ C;  5ENT D;  3Q79 A;  3CBP A;  2VGY A;  3UM1 A;  4PUC A;  1K8K G;  2IEJ A;  3NZS A;  4B8A A;  1N94 A;  1SQM A;  1UJK A;  2Y4U A;  4DJA A;  4FLB A;  1PC2 A;  5EX3 A;  1H6P A;  4RSY A;  1KT1 A;  1FT2 A;  4BT8 A;  2P9I G;  4AV7 A;  3VLF A;  4FP7 A;  3ULY A;  1EF1 C;  5CEC B;  4UWG A;  5LSX A;  3FH8 A;  4AXH A;  3LCA A;  3UIO C;  3ZXP A;  5FZS A;  2ILR A;  1UW4 B;  1Z5S C;  2J49 A;  4Q96 A;  3FPD A;  3FUN A;  1N54 A;  2XCB A;  4JLG A;  2XEH A;  4DUI A;  3NAW A;  4J0U A;  3L08 A;  1ZB1 A;  2R5S A;  2RKK A;  1B89 A;  5FQ4 A;  4FMU A;  4F53 A;  2EIN E;  2HR2 A;  5FT9 A;  2I2O A;  3L22 A;  4P29 A;  2P9U G;  3M58 A;  1MT6 A;  1K1B A;  3D9N A;  3SHF A;  2KCL A;  1JWG A;  2KM4 A;  4N5Q A;  3CVX A;  1NI1 A;  2BKG A;  3HG0 D;  5A6C A;  4JHJ A;  5JHN A;  4ILG A;  2FF4 A;  3SNX A;  5B3S E;  1OWO A;  3JXJ A;  3ONK A;  4EQF A;  3CKB A;  2BTD A;  3HVE A;  3CQG B;  4UQZ A;  5EX0 A;  4K0R A;  2V5Q C;  4Z4P A;  4GCN A;  3Q49 B;  2WQ6 A;  1X5B A;  4BY6 A;  2XRY A;  4HRM B;  5FZR A;  4HBD A;  3FH7 A;  1TN8 A;  2XEV A;  4YNM A;  5CBO A;  4LUN U;  1MZC A;  3OPE A;  2R02 A;  2VSO E;  2JAB A;  2DCP A;  2Y1L E;  4TUM A;  5G55 A;  4DI3 A;  4YDW A;  4TV3 A;  1IXV A;  4HS2 A;  5J08 A;  4OYS A;  3LEW A;  5LP0 A;  3ZGQ A;  5AJL A;  2ETB A;  3FTU A;  4BTA A;  2F0Y A;  1N4S A;  4M7C A;  1SW6 A;  4JA9 A;  1JCR A;  1O1S A;  3X2Q E;  4O6F A;  2ZGD A;  1E8X A;  2VTB A;  3RO3 A;  2L6B A;  2BKK B;  1NA0 A;  1U3D A;  5LOZ A;  2A5E A;  3OAW A;  1N52 A;  3TXN A;  5JHA A;  2IF4 A;  4C1Q A;  2J8S D;  1K3Z D;  3BQO A;  3ABL E;  4IJ8 A;  4JEU A;  3B7B A;  4IRU A;  3SF4 A;  3MEK A;  2IY0 C;  4C0E A;  4DLO A;  2VQ2 A;  3E33 A;  2P9K G;  1E8Z A;  2FO1 E;  4NAC A;  2LNI A;  4MI5 A;  2IJG X;  4EEC A;  1TN6 A;  3GZS A;  3B7U X;  2WXM A;  4F1P A;  3AS4 A;  3LKU A;  2GRP B;  3SW9 A;  3PZ2 A;  1H19 A;  5G05 J;  4DK5 A;  3FUK A;  4APO A;  3QK0 A;  4LDG A;  5LX8 A;  3BG0 B;  3UT4 A;  2AJA A;  3FUL A;  3FUD A;  3E34 A;  3I5P A;  3PEU B;  3HXE A;  3DPD A;  1OWL A;  4UWF A;  1Z6T A;  3HVE B;  5HRY A;  4I6E A;  1E8Y A;  3C3R A;  3M56 A;  3F9X A;  1SZA A;  4HI9 A;  4A3V A;  4A1G A;  4ACL A;  4HB5 A;  2QC9 A;  1JUQ A;  3PE4 A;  1IHB A;  3RRN B;  1S64 A;  5EN5 D;  3KEZ A;  3J5Q B;  4GCO A;  2XHE A;  1D9S A;  3CLJ A;  1EYH A;  3NOC D;  4FUL A;  3E32 A;  3PUJ A;  2F69 A;  3BEE A;  1E96 B;  1O5M A;  5AIJ A;  4I51 A;  4V3I A;  2EQX A;  3EJN A;  4GMR A;  4GTS A;  3SQV A;  1TNU A;  4EZK A;  2HE0 A;  3CHP A;  3UXG A;  4ILI A;  3ZPJ A;  3ASO E;  1OT8 A;  3EP0 A;  2CHW A;  4KT6 B;  2VTB B;  4I43 A; 
#chains in the Genus database with same CATH homology
 2L0T B;  5F6L A;  3UMV A;  1H6K A;  1ZBP A;  4UQX A;  3ZXS A;  4U63 A;  3CBO A;  5F5E A;  3TGO A;  4YPA A;  4LRZ A;  2Y4T A;  3KMJ A;  4N3B A;  2R3A A;  5T5G A;  3QB2 A;  3NQP A;  2XGS A;  3FU6 A;  3MX3 A;  4JW1 A;  3U9W A;  1HH8 A;  4B94 A;  3NZU A;  4WAF A;  3BG1 B;  3FTV A;  4AP2 A;  3M55 A;  4M3O A;  2RFI A;  4YNP A;  5CMW A;  2WXP A;  3FUF A;  1XQH A;  5AYW D;  4FHJ A;  4KZ0 A;  2FUL A;  2KCK A;  2WXG A;  5M72 A;  2HM8 A;  4WWN A;  2A4Z A;  3D9L A;  4KYO B;  4J83 A;  3O4Z A;  3MA5 A;  2WXR A;  3APD A;  1QZ2 A;  2XCC A;  3JYS A;  3ML8 A;  3HYM B;  4GZ5 A;  3FU5 A;  3GW4 A;  4GPK A;  4YND A;  4UWL A;  3S7J A;  1Z3X A;  4H7Y A;  5ANR A;  3ULQ A;  3PDN A;  3K9I A;  2LSV A;  4I2Z A;  3U66 A;  5C2Y A;  4CDR A;  3KMT A;  3ZYM A;  3ZEF A;  3M5A A;  4URK A;  5EG2 A;  1N6C A;  2FI7 A;  4IUL A;  1MHQ A;  3ZRH A;  3RQ4 A;  4YVO A;  4KXK B;  3DB5 A;  3CHO A;  3RO2 A;  2KZT A;  4I1A A;  4BX8 A;  4FJY A;  4I1M A;  3RU0 A;  2WM9 A;  3P2B A;  5BV1 A;  2RD0 A;  2WPV A;  1U3C A;  2V0P A;  3CVQ A;  1Y8M A;  4OVV A;  1XGW A;  2CG2 A;  2WXQ A;  4GAA A;  4HXI A;  5G05 C;  4BX9 A;  5JJT A;  1INZ A;  1A17 A;  3MKR A;  4L7T A;  4CT0 A;  1E90 A;  1P5Q A;  2VSY A;  1WAO 1;  2GGF A;  4I9C A;  3PRZ A;  3SD5 A;  2J4B A;  3FP3 A;  3NF1 A;  2X6I A;  4HOQ A;  5G04 J;  4DI4 A;  4BSX A;  5CCM A;  3MCX A;  3QDN A;  1N6A A;  2WQ7 A;  1WY6 A;  3FDH A;  3QAQ A;  5T4Y A;  3FUI A;  4WNF A;  2WXL A;  5G04 C;  1IQU A;  3JCK C;  3D9O A;  3RRM B;  2I1K A;  2AW6 A;  1HE8 A;  3CKC A;  2XPY A;  3RRU A;  4EQF A;  5KJL A;  4QFV A;  4XZ4 A;  1WM5 A;  3SI5 A;  1PAQ A;  2L6J A;  3SGH A;  2FEZ A;  4KZC A;  3L54 A;  2CHZ A;  4XKB A;  5EDS A;  1ELR A;  4QEN A;  4L2L A;  3LVR E;  2J4D A;  4G24 A;  3RJW A;  3LYA A;  1FVF A;  1HG2 A;  3TG4 A;  3FUH A;  4JDS A;  3I4R B;  3OXG A;  1EDU A;  3P1U A;  4JPS A;  4JHR A;  4N2S A;  1ZKK A;  1HO8 A;  3SWC A;  3FH5 A;  2C0L A;  2GW1 A;  3CVN A;  3D9P A;  3ENE A;  3QWP A;  3WXX A;  3MO0 A;  4BUP A;  2XRZ A;  3LY9 A;  2HYZ A;  2W5Z A;  5A23 A;  2BUG A;  4U07 A;  2YHE A;  5TEG A;  1BPO A;  2J9Q A;  4EPZ A;  3CST A;  2X6J A;  2VYI A;  4WWO A;  3D9K A;  1FVH A;  5AYF A;  4GA0 A;  2CFU A;  1HZ4 A;  4ANU A;  4N3A A;  1H2V C;  3S2A A;  2C0M A;  2OV8 A;  2NSZ A;  4AU7 A;  2X6H A;  2AWI A;  3D3M A;  5TH7 A;  4HOR A;  2FBN A;  3PUK A;  2VGX B;  3LS8 A;  4JC8 A;  5E76 A;  3CVW A;  1NP7 A;  4DLQ A;  4ABN A;  2UWJ G;  4L23 A;  2WVI A;  3JUI A;  3OXF A;  4CEM A;  3ZFW A;  2X3M A;  5JJ6 A;  3FUM A;  3PZD A;  3RIB A;  1SZ9 A;  4J7F A;  5BNW A;  2LAH A;  4Y6W A;  2AXU A;  4F3V A;  2PM6 A;  4WUY A;  5JIN A;  1HF8 A;  4ANW A;  4LCT A;  2XGM A;  5ARG A;  3FU0 A;  2YNQ A;  3FY4 A;  4GU5 A;  4GB9 A;  4I6J A;  5D0O D;  2DIW A;  3EIQ C;  4AIF A;  3CBP A;  3PEV B;  3AU4 A;  2VGY A;  3CIA A;  2LAI A;  3R7Q A;  2XQ0 A;  4PUC A;  5DIZ A;  5JHB A;  2YIN A;  2C2L A;  3NZS A;  4B8A A;  4XX5 A;  1SQM A;  5CPR B;  1OUV A;  5D0Q D;  1UJK A;  1KT0 A;  2Y4U A;  2R59 A;  2WXN A;  4FLB A;  2PM7 A;  2V5F A;  1PC2 A;  4JL0 A;  5EX3 A;  4ANX A;  4DJA A;  4EBA G;  3QC1 A;  4A3T A;  5BW8 C;  5TTF A;  4GYO A;  4RSY A;  5LSZ A;  3F9Y A;  4JVS A;  1KT1 A;  4RG6 A;  5LCW J;  2LO6 A;  2NC9 A;  4AEZ C;  1HXI A;  4I6G A;  4GYY A;  4J8F A;  3QWW A;  3RKV A;  3ASD A;  4FHK A;  4BT8 A;  3HNA A;  1KLX A;  3Q15 A;  3EDT B;  4BTB A;  5C1D A;  3CHM A;  3VTY A;  3ONL A;  3IBE A;  4JEH A;  1MQS A;  4AV7 A;  3U3W A;  2IGQ A;  4IJD A;  4MI0 A;  3VLF A;  3CR3 A;  3T5X A;  1E8W A;  3CK8 A;  4FP7 A;  3PVL A;  1EF1 C;  4K03 A;  4UWG A;  5FJY A;  3S7F A;  5BT1 A;  2I6H A;  4GA1 A;  3FH8 A;  4GZ3 A;  5LSX A;  1QNF A;  3QJZ A;  1IQR A;  4R7L A;  4AXH A;  4GZ6 A;  3LCA A;  2KAT A;  3N71 A;  1L5J A;  3G2W A;  4ME2 A;  4N3C A;  2ILR A;  3PE3 A;  3G2T A;  5FZS A;  3IHX A;  1UW4 B;  2J49 A;  2UY1 A;  4Q96 A;  2PQR A;  3FUN A;  4EZL A;  1N54 A;  4B8C B;  1W3B A;  3FPD A;  3Q47 B;  3CK9 A;  3MO2 A;  3SBT B;  4YVQ C;  4N2Q A;  3DAL A;  1NZN A;  3EHN A;  2XCB A;  3L17 A;  4JLG A;  3JQ0 A;  3QWV A;  4BT9 A;  2DBA A;  4LER A;  3T8M A;  3FEX A;  4UI9 J;  3GYZ A;  3ASG A;  4KVM A;  3DBS A;  3L6A A;  4IN3 B;  4J0U A;  3B7S A;  4L1B A;  3IHY A;  3F9W A;  3ZYK A;  3L08 A;  4AM9 A;  2KZT B;  3QNK A;  2R5S A;  4XI9 A;  1IHG A;  1B89 A;  5FQ4 A;  3LY7 A;  4FMU A;  4G25 A;  5FQ8 A;  2X38 A;  4FLH A;  4F53 A;  3M57 A;  2FO7 A;  4J6I A;  4A1S A;  3IKO B;  2OVF A;  2HR2 A;  4U8H A;  3UT7 A;  5FT9 A;  3QKY A;  4UI9 K;  2J07 A;  3UPV A;  2I2O A;  3L22 A;  2O8J A;  4WND A;  4P29 A;  4NJ5 A;  2WQH A;  1FCH A;  1H2T C;  3M58 A;  1MT6 A;  4YPE A;  5CHE E;  1N3J A;  5E75 A;  4AOF A;  4JA7 A;  3D9N A;  4RVB A;  3UX4 A;  5ARF A;  5FQ7 A;  3SHF A;  2KCL A;  4HFG A;  3VLD A;  3ZW3 A;  1JWG A;  3OS5 A;  4XKC A;  5FQ6 A;  2KM4 A;  2WXI A;  4J7I A;  5ANL A;  4E6H A;  3CVX A;  4HOS A;  3VUZ A;  3MV2 B;  2AVP A;  5A6C A;  3AS8 A;  4JHJ A;  3IHV A;  3PNL B;  5JHN A;  4ILG A;  1XNF A;  4IYP A;  2FF4 A;  3SNX A;  4ATG A;  4CRW A;  1OWO A;  2GRL A;  2ION A;  5FWQ A;  2E2E A;  4QEO A;  3ONK A;  4I2W A;  1H0A A;  2KCV A;  3CKB A;  3FTY A;  3C98 A;  3ML9 A;  1YA0 A;  2BTD A;  3HVE A;  3CQG B;  2V8S E;  4U0Z A;  4UQZ A;  1HS6 A;  3APF A;  5EX0 A;  3ZYL A;  3FTW A;  4AY5 A;  4K0R A;  4WNE A;  1TJF A;  3LJ3 A;  2WXF A;  4AVX A;  2ZU6 B;  3ASF A;  3OOI A;  3SBS A;  3CK7 A;  4Z4P A;  2QFC A;  2Y3A A;  3CHR A;  5T0M A;  3LXU X;  4GCN A;  4FC8 A;  3MJW A;  2JV0 A;  2QPW A;  2BF0 X;  3S7D A;  4FAD A;  3Q49 B;  4GA2 A;  4I1O B;  1X5B A;  3R7R A;  4BY6 A;  2WQ6 A;  2QY7 A;  2XRY A;  2CFZ A;  5FZR A;  3FUE A;  3FH7 A;  1ML9 A;  1MVX A;  1PEG A;  2A5U A;  2VSX E;  2XEV A;  3GZ2 A;  4YNM A;  4Y6C A;  5T3R A;  4XI0 A;  2PQN A;  3URZ A;  5BV0 A;  3FFL A;  5HQ8 A;  4O30 A;  4LUN U;  3SZ7 A;  1DVP A;  2WXH A;  3OPE A;  4APF A;  3Q4A B;  1E7V A;  2VSO E;  3MZL B;  4N5C A;  3FTX A;  2AXZ A;  2DCP A;  1HU3 A;  4L2Y A;  3U64 A;  3VV0 A;  3CHQ A;  3CBM A;  3HIZ A;  5AJD A;  2MHK A;  3MKQ A;  5G55 A;  4TV3 A;  4DI3 A;  5LFA A;  4F1S A;  1UG3 A;  4E47 A;  4C9B B;  4HS2 A;  3G2U A;  3Q5M A;  3FWV A;  5J08 A;  4OYS A;  3LEW A;  3AS5 A;  3ZGQ A;  5KJK A;  5LP0 A;  5F59 A;  5AJL A;  4PS7 A;  2IQC A;  3ESL A;  3PNT B;  2X6K A;  4U0S A;  3FTU A;  5KCM A;  3EIJ A;  4GML A;  4JZY A;  4WWP A;  5T8I A;  2IOS A;  2WXO A;  4BTA A;  4CGV A;  4J8S A;  3CVU A;  3KS2 A;  4H7X A;  4KBQ A;  4WNG A;  2IOL A;  3CHS A;  3D9I A;  2LSU A;  4G11 A;  4MRU A;  4JA9 A;  4A55 A;  4UWK A;  3VLE A;  4PH4 B;  4O6F A;  5LCW C;  2WMN A;  3S8P A;  4N39 A;  1E8X A;  3ZHE A;  3TL5 A;  3CQC B;  1HX8 A;  2VTB A;  1MUF A;  3HHM A;  1O9S A;  3FEY A;  1UJJ A;  1LF8 A;  5BUZ A;  4NQ0 A;  1Z3Y A;  3RO3 A;  4W9R A;  3I4G A;  3MYV A;  4AY6 A;  1UN9 A;  2E0I A;  3UT8 A;  2IFU A;  1NA0 A;  1ELK A;  1U3D A;  1OWP A;  5LOZ A;  3VTX A;  3L13 A;  2KC7 A;  3R9A B;  3G2S A;  4DPR A;  3B7R L;  1ZU2 A;  4HVB A;  3OAW A;  1N52 A;  3TXN A;  3LPZ A;  1IYG A;  5JJ0 A;  5JHA A;  2IF4 A;  4C1Q A;  4RZ0 A;  1EPU A;  2JLB A;  3D9M A;  3FTS A;  2W5Y A;  2MOW A;  3CGH A;  3LDZ A;  3ESK A;  4TRQ A;  3QAR A;  4B89 A;  1JPL A;  4ANV A;  2UY1 B;  5EKQ D;  4U0U A;  3T5V A;  1DNP A;  5HI7 A;  4GZC A;  4IJ8 A;  5CMY A;  4JEU A;  4D10 C;  4IRU A;  4CT4 A;  4NUR A;  4I17 A;  3SF4 A;  4HLE A;  2NXP A;  3MEK A;  1VDY A;  3KAE A;  5T0K A;  4G1T A;  3RAY A;  3FUJ A;  4XE0 A;  2BQZ A;  4C0E A;  1TEZ A;  4DLO A;  2VQ2 A;  3D9J A;  4G26 A;  4GZD A;  2M63 A;  2CG3 A;  3EHM A;  4UI9 C;  1OWM A;  4PDX A;  4B0Z A;  2XGO A;  4JHK A;  4NVQ A;  1E8Z A;  5F6K C;  4J8D A;  3K5K A;  2J08 A;  4NAC A;  2LNI A;  4MI5 A;  1OWN A;  2IJG X;  5BPP A;  1NA3 A;  1HFA A;  5JJ7 A;  4EEC A;  3GZ1 A;  3GZS A;  4U04 A;  2WB2 A;  3B7U X;  3PS6 A;  2CHX A;  2WXM A;  3IEG A;  3TAX A;  3AS4 A;  3LKU A;  1MVH A;  5FTP A;  3B13 A;  3QOU A;  3SW9 A;  4G23 A;  4UWH A;  2G46 A;  4CDM A;  3BO5 A;  4YPU A;  1H19 A;  4PS3 A;  5G05 J;  3OXL A;  4UQY A;  3CEQ A;  3FUK A;  3PH0 C;  3ZYQ A;  4KMO A;  4APO A;  4DK5 A;  3S7B A;  3RK6 A;  4EBA A;  3QK0 A;  3CVP A;  4J8E A;  2J09 A;  4C0M A;  4LDG A;  3FHE A;  3BG0 B;  5LX8 A;  3UT4 A;  3TG5 A;  4G2V A;  3G2V A;  4FJZ A;  3FUL A;  3MO5 A;  3CV0 A;  4I9E A;  5DBK A;  3FUD A;  4RG9 A;  3ZN3 A;  4CCA A;  3I5P A;  3PEU B;  4BFR A;  2IU1 A;  2PL2 A;  2XPI A;  4J8O A;  3M59 A;  3DPD A;  1OWL A;  4UWF A;  5AEN A;  3TJP A;  1Z6T A;  3HDX A;  4ACK A;  3LY8 A;  4LEU A;  2L9B A;  3HVE B;  2AXV A;  2VJ8 A;  4CDN A;  1TJC A;  4I6E A;  2WXK A;  3UQ3 A;  3F9Z A;  1HG5 A;  1H2U A;  3LVQ E;  1E8Y A;  3KMA A;  3AU5 A;  3M56 A;  4FA6 A;  3F9X A;  2R17 C;  4BWR A;  1PY1 A;  5FZQ A;  2Q7F A;  2OVB A;  1SZA A;  4MS6 A;  2OOE A;  2V4L A;  4AJW A;  2I1J A;  3MGB A;  4A3V A;  4A1G A;  2HO1 A;  2X6F A;  4ACL A;  4Q69 A;  4MLP A;  1JUQ A;  5G2N A;  4FU3 A;  3PE4 A;  3RJV A;  4NRH B;  3SFZ A;  1S0P A;  2YHC A;  3RRN B;  4EZJ A;  3O48 A;  3ZVV A;  4E85 A;  4H12 A;  2GRM A;  3KEZ A;  4GCO A;  3TXM A;  3U4T A;  4CGW A;  3PRE A;  1Y6I A;  2XHE A;  1QQE A;  2VGX A;  1JWF A;  2YQ8 A;  5JIY A;  3B7T A;  3CLJ A;  2PZI A;  5KJM A;  2VSN A;  3UUX A;  3APC A;  3CVY A;  3M53 A;  1EYH A;  3FU3 A;  3M54 A;  4Q94 A;  4PS8 A;  3I3N A;  3FTZ A;  2RG8 A;  4FUL A;  3E4B A;  4F7A A;  2WXJ A;  3MKQ B;  1GW6 A;  3MV3 B;  3PUJ A;  5CCL A;  3BEE A;  1E96 B;  2F69 A;  2XPZ A;  2WMO A;  3CVV A;  5AIJ A;  3CVL A;  3ZIM A;  4I51 A;  4TUU A;  4V3I A;  2EQX A;  3EJN A;  3L16 A;  4ILH B;  5KJN A;  2JEK A;  4QEP A;  2P58 C;  5J90 A;  4HOT A;  4KVO A;  4OVU A;  4EZK A;  3JQ1 A;  3CHP A;  4JXT A;  4ILI A;  3ZPJ A;  5ENN A;  1UN8 A;  2L0I A;  4HOU A;  1H3I A;  4GMJ A;  4XIF A;  3KD7 A;  5A7D B;  3CSF A;  3EP0 A;  2CHW A;  4MKT A;  3ASH A;  4GYW A;  2OND A;  1E7U A;  3ZHE B;  4KT6 B;  3IV0 A;  2VTB B;  1ELW A;  4I43 A;  3OTN A;  2I9C A;  2MRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...