5KJKA

Smyd2 in complex with az370
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
total genus 151
structure length 429
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjkA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjkA01
3F9ZA 4G24A 3VTYA 5EX3A 5TH7A 3O48A 2R5SA 1KLXA 5G05J 3RAYA 1PEGA 4UI9K 4O30A 4O6FA 2IFUA 2C0MA 4J8EA 2IF4A 2BQZA 3QOUA 3RJWA 4ME2A 3RIBA 1NA0A 3ULQA 3M5AA 4I2ZA 4G2VA 2P58C 5JHNA 3CKBA 2UWJG 2JV0A 3CK7A 4GA0A 3MV2B 5G04C 3UQ3A 4WNFA 3VTXA 3VV0A 3TG5A 5C1DA 5LSZA 3Q5MA 3GW4A 4WNDA 4I2WA 4LEUA 4MI5A 5KJLA 2VSNA 4N3BA 4BTBA 3Q4AB 2VGXA 5A7DB 3OXGA 3ZHEA 3EP0A 4YNDA 4HOUA 2LSVA 4NRHB 4IJ8A 2I6HA 3PE3A 4GYYA 4JDSA 3RO2A 3DB5A 3DALA 3GYZA 2GW1A 3F9YA 2E2EA 5FJYA 4FMUA 4QENA 2HYZA 3KAEA 4ABNA 4I1AA 2QFCA 4JA7A 3UUXA 4GYWA 4GYOA 4GA1A 4I17A 3KS2A 3LY8A 3M53A 2PZIA 5BT1A 5JJ7A 5BNWA 3S7BA 4AY5A 3LKUA 3MEKA 4HORA 4YVQC 3KMJA 5FTPA 1OUVA 3CVQA 4BWRA 1MVXA 4U04A 4U0ZA 3JYSA 2KCKA 4AIFA 3Q15A 4J0UA 3CEQA 3CVLA 1P5QA 3TG4A 3M55A 4KBQA 2JLBA 2XCBA 2VSYA 3CVPA 5F59A 2LSUA 3AS4A 4UI9C 4NVQA 5JINA 2FO7A 4J8DA 3F9XA 4XI0A 2DBAA 4H12A 3CK8A 4UI9J 3OXFA 2LNIA 4AY6A 4U07A 3QDNA 5D0QD 4EQFA 1B89A 3M57A 1HZ4A 4UQYA 4QEPA 5T0MA 4H7YA 3ESKA 4RG9A 5ARFA 4J7IA 3KD7A 3MV3B 4CGVA 4RG6A 4MI0A 1ZBPA 5CCLA 5LCWJ 5M72A 4Z4PA 4LDGA 3RU0A 2G46A 5BW8C 2XEVA 1NA3A 5FZQA 4U0SA 5LCWC 4GCOA 2PQRA 3U3WA 3Q47B 5JJ6A 4N39A 3N71A 4UQXA 2WPVA 3IHXA 3WXXA 1HH8A 4F3VA 4J8OA 4GZ3A 1KT0A 3S8PA 1FCHA 1Y8MA 3R9AB 2PQNA 3LY7A 4JHRA 3AS8A 3ZN3A 1O9SA 3RQ4A 3S7JA 4B94A 1W3BA 5JJTA 5CHEE 5G04J 2YQ8A 3OXLA 5HQ8A 1PC2A 3FPDA 3MA5A 2F69A 2HO1A 1N3JA 4AM9A 3OPEA 4NJ5A 3MO0A 5FZRA 2KATA 5F6KC 5JIYA 2O8JA 4YPAA 5KJMA 3TAXA 4J7FA 3LYAA 3FWVA 4N3CA 3FFLA 2Y4TA 3QWWA 4YVOA 5FZSA 3MO2A 1QZ2A 2IGQA 1XNFA 5F6LA 1KT1A 4Y6CA 4E47A 5T0KA 4G23A 1N6AA 5TEGA 3CBPA 1N6CA 1TJCA 4HOQA 2Q7FA 4UQZA 4GZ6A 2KC7A 3M54A 4J83A 2QPWA 3NF1A 1ZKKA 3KMAA 1A17A 3ZHEB 2L6JA 5EX0A 3CVNA 4U0UA 2XGSA 2FF4A 4XI9A 2XPIA 3GZ2A 4HOSA 2J9QA 4XIFA 2W5ZA 3MKRA 4Y6WA 2UY1A 3CBOA 5T5GA 5D0OD 4W9RA 3F9WA 5G05C 2W5YA 4BTAA 5EG2A 2KCVA 4YPUA 3HYMB 4GA2A 4GPKA 5DIZA 3KMTA 1YA0A 2FBNA 4RZ0A 5A6CA 3ASFA 1ELWA 3M58A 5AYFA 2MHKA 2BUGA 3K5KA 3TGOA 1MUFA 3RKVA 2C2LA 1WM5A 4G26A 2OOEA 5KJKA 5F5EA 3LY9A 3FP3A 3SWCA 3SZ7A 3ZFWA 4YNMA 3SW9A 4JA9A 2PL2A 2XGOA 4YNPA 3CV0A 5LSXA 4JL0A 3RJVA 4KXKB 4A1SA 4JLGA 3CBMA 1H3IA 5TTFA 3OS5A 2C0LA 2KCLA 2NC9A 3ZGQA 3URZA 2VYIA 4G25A 3PDNA 1XQHA 5ARGA 4BT8A 4AU7A 4J8FA 1E96B 4BT9A 3ASHA 3ASGA 3K9IA 5AYWD 2V5FA 3UPVA 2XCCA 2HR2A 3AS5A 5JJ0A 3EDTB 3S7DA 4WNEA 3CK9A 3QWPA 2FEZA 4N5CA 4YPEA 5CCMA 1IHGA 1ZU2A 4GZ5A 1ELRA 3VUZA 3U4TA 3BO5A 5KJNA 3ZPJA 4N2SA 4H7XA 4HOTA 4IJDA 4KYOB 5EKQD 3RO3A 2YHCA 2UY1B 5CPRB 5DBKA 3CKCA 3M59A 4CDRA 4N3AA 3LPZA 4APOA 3E4BA 3LCAA 5FT9A 1IYGA 3IEGA 1ML9A 4WUYA 3HNAA 4QEOA 2R3AA 1MT6A 4NQ0A 4IN3B 1QQEA 4I9EA 4I51A 3Q49B 3MO5A 3OOIA 4CGWA 2Y4UA 2VGYA 2FI7A 3ASDA 4I9CA 2VGXB 3M56A 2ONDA 1MVHA 4N2QA 3QKYA 4GCNA 1WAO1 2AVPA 3SF4A 3S7FA 2RFIA 3BEEA 4C1QA 2WQHA 3GZ1A 5HI7A 4G1TA 2XGMA 3QWVA 3PE4A 1NZNA 1HXIA 4WNGA 2VQ2A 4BUPA
chains in the Genus database with same CATH superfamily
4OYSA 3SHFA 3F9ZA 3FU5A 1NFIE 5EX3A 1KZOA 5TH7A 3R7RA 2AXUA 5G05J 4R7LA 2NXPA 3UT4A 3FU0A 4BSXA 4DRXE 4L7TA 2C0MA 4J8EA 5CEAA 3QOUA 4LUNU 3ENEA 3M5AA 4I2ZA 3L9TA 4DX6D 4Q96A 1SVXA 4CT4A 1N4RA 5CMWA 2WXKA 4I6EA 2WQ6A 3V31A 3VTXA 3B7SA 3UM0A 2E0IA 3MX3A 2X3MA 3TG5A 2IEJA 4APFA 3GW4A 4V3IA 3ABKE 4MI5A 3BQOA 5KJLA 4WWOA 1U2VG 1UJKA 3ZYLA 2VGXA 1V54E 3ZHEA 3Q9UC 2EILE 4NRHB 2J08A 3RO2A 3DB5A 3GYZA 3WG7E 4DJAA 2GW1A 5FJYA 4DLOA 5BV0A 3UIPC 4ABNA 4I1AA 1TNOA 4GYWA 4KZ0A 3LY8A 3SBSA 4FHJA 2VTBA 3DEPA 3NOCD 2VSOE 5FTPA 3FUIA 5KNHD 1OUVA 3QB2A 4LNGA 2NYJA 3LVRE 4AIFA 4J0UA 1OT8A 3CVLA 3TG4A 1UN9A 4KBQA 5BXUA 3NAWA 3FTSA 1TR4A 1Q2ZA 3DSVA 4NVQA 4J8SA 2Y1LE 3FTWA 4QQIA 4ZFHA 4WWPA 3EHMA 2WQ7A 3OXFA 3TWVA 3CLJA 3QDNA 4EQFA 1B89A 4BESA 4F53A 3ESKA 3ZNGA 1N4QA 1EDUA 3MV3B 3SGHA 2WXQA 5CCLA 1MX2A 1MYOA 5BW8C 5FZQA 1KZPA 4U0SA 2XEHA 4GCOA 2ETAA 3U3WA 4U63A 4N39A 2OCCE 1HH8A 3J5PA 4ATGA 4GMLA 4GZ3A 1FCHA 2V4HC 3L13A 3LY7A 3CVUA 3CHSA 3RQ4A 1AP7A 2RG8A 3FTXA 1DVPA 5G04J 2P2CP 3AG4E 1PC2A 4XX5A 1VDYA 3FUDA 2DZOA 3OTNA 3L17A 3B7UX 1N3JA 3MO0A 2LO6A 4G8LA 1TNUA 3C3QA 4KVMA 2Y3AA 4J7FA 3EJNA 3FFLA 1E8WA 1OCOE 3Q7AA 2IO2C 2GRMA 1QZ2A 2IGQA 4L2YA 1XNFA 4B8AA 4I1OB 3UM1A 1YCSB 5EYLA 3D9OA 2OEWA 3D9MA 5TEGA 4LSZE 3AJIA 4U8YD 4HOQA 3TL5A 2WM9A 3B7RL 4MLPA 1ZKKA 4C48B 2L6JA 5FQ7A 4U7EB 2DIWA 2KM4A 3CVNA 3ZU7B 4U0UA 4JHKA 3FH7A 2FF4A 2BKGA 5EN5D 3GZ2A 4XZ4A 3DSTA 2OVFA 1K1AA 2WXIA 3CBOA 5T5GA 1E8ZA 3LXUX 4HLEA 2WXRA 1FVFA 1WDYA 4AJWA 1NL4A 1YA0A 2FBNA 4RZ0A 2CHXA 4K0RA 1H6KA 5ANRA 5AYFA 4FU3A 2BUGA 1V55E 5C2YA 4GPMA 2XRZA 3CSFA 5EYPF 3W9FA 5CERB 5D66A 3SZ7A 3D9NA 5EIBE 2PL2A 3MYVA 3T8KA 3PH0C 4PUCA 4A1SA 3ZIMA 5LP0A 4OAVB 5AARA 2OV8A 1NI1A 3FUEA 4UWLA 3PDNA 1XQHA 3DSXA 4GTMA 2P9UG 1H2TC 4AU7A 1SA5A 3FHEA 2HR2A 5JJ0A 3DPDA 3EDTB 2J8SD 2LAIA 3QWPA 3FULA 2EIJE 2I9CA 4YPEA 3ULEG 4FLHA 3ZEFA 5BXOA 2QZAA 3ZPJA 5EKQD 3RO3A 4B8CB 1BI7B 3CKCA 4FLBA 1Z6TA 3FUJA 4CCAA 3E4BA 4C9BB 1YMPA 5CRVA 5FT9A 1IYGA 4ILHB 3S2AA 3IEGA 1ML9A 3DWLG 3JQ0A 3HNAA 4URKA 3FDHA 5CMYA 4PS8A 2J07A 3QK0A 4I51A 3MO5A 3NOGD 3UMVA 2X6IA 4EZKA 1TYQG 2IOLA 3HDXA 1QYMA 1PAQA 4F1PA 1UG3A 3ML9A 3PUJA 4I9CA 2ONDA 4N5QA 2AWIA 4N2QA 3W9GA 1FT1A 2VGEA 2AVPA 2RFIA 2CG3A 4EBAG 3QWVA 3PE4A 1E90A 3U9WA 3C5RA 5ANLA 2VQ2A 5CRUA 3SQVA 3VLFA 4LCTA 2RD0A 4TXRA 4RSYA 3G2UA 1HX8A 3PUKA 2X38A 2Y0BG 1H6OA 5J08A 3RAYA 4UWHA 1PEGA 4A55A 4UI9K 3D3MA 4DX5D 1RW2A 2IF4A 2ETCA 1DNPA 4ME2A 1NA0A 4G2VA 2P58C 4FJYA 3RRNB 2M63A 1H2UA 3VLEA 1O1RA 4LERA 3V30A 4WNFA 1JUQA 3Q5MA 4GTSA 4WNDA 4I2WA 4LEUA 5BPPA 1N11A 3FTVA 2WXOA 2GRRB 2VSNA 3HHMA 1N4SA 4BTBA 3Q4AB 4AVXA 1JWFA 4YNDA 3C98A 4ACKA 3KEZA 4HOUA 2I6HA 4JDSA 2J09A 3F9YA 1H0AA 3LVQE 2H6IA 3TXMA 5ENQD 2HYZA 3EHRA 2WXFA 4B93B 2XZDG 3MZLB 4ANUA 1HG5A 4I17A 2H6GA 5BT1A 2X6HA 3LKUA 2GRNB 2AXVA 1TEZA 3MEKA 4YVQC 3KMJA 4HVBA 4BSZB 3CVQA 4FJZA 4BWRA 3RAUA 3IKOB 1MVXA 4U04A 3JYSA 3RRMB 1SQMA 3EHQA 3KEAA 2KCKA 2X6FA 4ATZD 1SZ9A 2ZXWE 3CEQA 1P5QA 2A4ZA 2JLBA 2XCBA 5AAOA 2LSUA 4J8DA 1E7UA 3FH5A 1HO8A 2DBAA 2VSXE 3L54A 3CK8A 4UI9J 1S0PA 4CYMD 2WB2A 3PRZA 4AY6A 4U07A 4Q94A 3LJNA 4OAUC 2FO1E 1HZ4A 2P9PG 2ETBA 2LXLA 5T0MA 4RG9A 1E8YA 4ILIA 2PM6A 4CGVA 3UKRG 4RG6A 2DZNA 1H19A 2GRPB 5M72A 3D9PA 1KPSB 1NA3A 4AP2A 4JHJA 2IJGX 2CHZA 2AXZA 4UQXA 1D8DA 4C0EA 1IQRA 1TNZA 3IHXA 4LNBA 4HXIA 4UUCA 1KT0A 1Y8MA 3ESLA 4M7CA 3R9AB 4JHRA 3HXCA 1O9SA 3ZN3A 4XKBA 2I1JA 3EU5A 3S7JA 5JJTA 4WAFA 3OXLA 4DX7D 1Z3YA 3Q9NC 1MJ0A 1DCQA 4FULA 4XE0A 2BEDA 5E76A 2P9SG 3APDA 4NJ5A 1FPPA 1X81A 2KATA 5F6KC 2WXJA 3SO8A 1OWNA 3PNLB 2ZISA 3ML8A 3TAXA 3DSSA 3FWVA 3LYAA 4HNAD 2Y4TA 4IULA 5FZSA 3PZ4A 1IHBA 3MO2A 4KT6B 3V2XA 3JQ1A 3P2BA 3V79K 1E8XA 2XS8A 3V2OA 1N6AA 3UI2A 3CBPA 5AQ7A 1TJCA 3CR3A 4UQZA 2V5QC 2ILRA 3M54A 4FC8A 1UW4B 3KMAA 1Z3XA 3ZHEB 3HIZA 5FIOA 3UM2A 2MYOA 5EILA 4Z68A 4Y6WA 2UY1A 2BKKB 3CVVA 3PZ1A 5D0OD 3MGBA 2CHWA 4BFRA 3FH8A 1JCSA 5EG2A 3D9KA 4UWKA 3UIOC 4FP7A 2H6FA 3AG1E 3IHYA 3OAWA 1YYHA 1OWOA 3PS6A 1ELKA 1ELWA 3ZW3A 5AQBA 4DI4A 1INZA 3E30A 3TJPA 3RKVA 1UOHA 3FP3A 4DX1A 3ZFWA 3AG3E 4JA9A 2XGOA 3L16A 1QBQA 3CV0A 4K5AB 2WMNA 5ENRD 1HF8A 4JLGA 5TTFA 5LOZA 2NC9A 3J5QB 2AJAA 2VYIA 2J49A 4U96D 4BT9A 5JMND 1N9AA 3ASGA 3UX4A 5AYWD 2XCCA 4MRUA 2KZTA 4HB5A 1K3ZD 3E33A 5ENOD 3D9IA 4IRUA 5CCMA 1ELRA 3TWUA 3VUZA 5KJNA 5T4YA 4DUIA 3U66A 2L6BA 4NURA 2YHCA 3T5XA 5CPRB 5DBKA 3DXMG 4DK5A 3B7BA 1K8KG 3LPZA 3D9LA 1H2VC 1EF1C 2VTBB 4MS6A 3UTMA 1N0QA 2WXLA 5LX8A 1IXVA 1MT6A 4NQ0A 1QQEA 1TJFA 1IQUA 3L82A 4BY6A 3JUIA 2Y4UA 3TXNA 3FTUA 2VJ8A 4P29A 3TWRA 2LUHA 4KMOA 5G55A 4I6GA 3ASDA 2VGXB 2LXMA 3E32A 1D8EA 1S64A 3QKYA 4GCNA 1WAO1 2GROB 3RK6A 3AU4A 4DPRA 3S7FA 2WXHA 1UJJA 5ENPD 1A5EA 5HI7A 4G1TA 2XGMA 5FQ6A 1HXIA 4WNGA 1JCRA 4BUPA 1RZ4A 3HXEA 3SNXA 4G24A 3PEVB 3UINC 1S63A 2ZIRA 4F6RD 3O48A 2R5SA 1KLXA 4HRMB 4EHMA 3QNKA 1DCEA 3HXFA 4O6FA 1LD7A 3ULQA 3B13A 2XHEA 4I1MA 3T9KA 1LF8A 5JHNA 4J6IA 3I4RB 4WWNA 1OCZE 2JV0A 2R02A 3MV2B 3PEUB 3UQ3A 4J7WA 4L1BA 3QC1A 4GTVA 1MX4A 2R05A 2P9KG 4PH4B 3X2QE 2JEKA 3HVEA 4TUMA 4GMJA 1OXJA 1PY1A 3MCXA 1EPUA 4N3BA 1N94A 3AG2E 4X8QA 5A7DB 4UWGA 4EBAA 3HXBA 1UN8A 4GTPA 4O60A 5AN8A 3EP0A 5HKPA 3CVYA 4IJ8A 4GYYA 3FUKA 3DALA 2WXMA 1LD8A 4YDEA 3O4ZA 2BTDA 4TUUA 3KAEA 2QFCA 2YINA 4JA7A 4GA1A 1HS6A 1OWMA 2PZIA 2R2LA 4PS7A 5AJLA 4AY5A 3DRAA 3QARA 3E37A 1AWCB 3DBSA 4FHKA 3IHVA 2KBXA 3R9MA 3DXKG 3FTYA 1LTXA 3M55A 3MKQA 3KSQA 1N0RA 4K5CA 2VSYA 3AS4A 4UI9C 2RFAA 4UWFA 2XENA 3IXEA 4RVBA 4H12A 4J8YA 2FULA 4BEPA 1N54A 5D0QD 4F7AA 3M57A 4AV7A 4CDMA 4XEIG 3PREA 1XGWA 4H7YA 5ARFA 2GGFA 3NBNB 4Z4PA 4ANWA 3RU0A 2G46A 5AJDA 5CECB 4RLYA 2P9LG 3HG0D 1O1TA 5ENNA 3TWTA 3BUAA 4J8OA 2IONA 5AQ9A 3IBEA 2RKKA 1MZCA 3CQCB 1TN7A 5HRYA 3FUHA 4B94A 5CHEE 5KWDA 2L0TB 1G3NB 3APFA 5HQ8A 2XPZA 3Q73A 3U64A 4BETA 2CFZA 3MA5A 3CIAA 1BD8A 2HO1A 3ASOE 4GMRA 3BU8A 3SD5A 3JCKC 3OPEA 1NP7A 2P9NG 5JIYA 2O8JA 2KZTB 3BG0B 1D9SA 4CEMA 2PNNA 4YVOA 3SFYA 4Q69A 2F8XK 1HE8A 2V8SE 3ISMC 3JXIA 5F6LA 4Y6CA 4IYPA 5B3SE 4G23A 2B6CA 5CBNA 1N6CA 2MOWA 5D2MC 2Q7FA 2DCPA 4XKCA 4GZ6A 2KC7A 4E6HA 4J83A 1E7VA 2F37A 3ZXPA 2QYUA 5EDSA 2J4DA 3CHQA 3I3NA 4RQIA 2X6JA 3DSUA 3L6AA 4XI9A 3SBTB 2J9QA 3Q79A 5G2NA 4AXHA 2JABA 2HE0A 3JUEA 3Q75A 2DWZA 5G05C 2W5YA 2AW6A 3ZVVA 4YPUA 2A5EA 3EUVA 5DIZA 1EYHA 4HI9A 3KMTA 3LS8A 5A6CA 4TV3A 1WY6A 1FT2A 3DEOA 4EZLA 2MHKA 2WXNA 4JB8P 1HFAA 4HS2A 3K5KA 2F8YA 2C2LA 4U95D 2OVBA 2BF0X 1L5JA 2QY7A 1BLXB 3LY9A 4DX2A 1TNYA 3CSTA 5E75A 4HFGA 4EZJA 5LSXA 4JL0A 3RJVA 3CBMA 4L2LA 2KXPC 3R7QA 3OS5A 2KCLA 4CDNA 4I43A 3ZGQA 3URZA 1SA4A 2EINE 2H6HA 4A3VA 5ITZF 4JXTA 4J8FA 1E96B 3ASHA 3K9IA 3UKUG 3QAQA 5IY5E 1OWPA 3FUNA 3S7DA 3G2WA 4WNEA 4HBDA 3CK9A 5A23A 1IHGA 4GZ5A 1IKND 3U4TA 2CFUA 3PZDA 3PVLA 4N2SA 3MKQB 4ZHBA 4HOTA 4KYOB 2IO3C 1O5MA 3ONKA 2NSZA 4MKTA 4N3AA 3APCA 4APOA 2OEVA 1TNBA 1JPLA 1BI8B 4A1GA 4WUYA 4TRQA 2R3AA 4A3TA 4IN3B 1HG2A 3I5PA 4CT0A 3C3RA 4CGWA 3ONLA 3DSWA 3RRUA 3FTZA 4TXPA 4E85A 1MVHA 3CVXA 2B0OE 4OVUA 5JA4D 3TWXA 4GZDA 4K5BA 4KZCA 1H6PA 3ZYQA 3PZ3A 1NZNA 4YDOA 4JEUA 3NB2A 4GTQA 1S70B 2XEEA 5FWQA 4BX8A 3BG1B 4LG6A 4PDXA 3ABME 3VTYA 1JWGA 2DYRE 4GU5A 4O30A 2IFUA 2BQZA 3RJWA 5JHBA 3FEXA 3RIBA 1TN8A 3ULYA 2IU1A 2HM8A 3TWWA 3CKBA 2UWJG 3CK7A 4GA0A 5G04C 3VV0A 5C1DA 5LSZA 3B7TA 3IV0A 1FVHA 4JPSA 3T8MA 3MJWA 2XS1A 3OXGA 2CG2A 3L08A 1WG0A 2LSVA 3PE3A 5FQ4A 1GW6A 2E2EA 4FMUA 4QENA 4B0ZA 1MX6A 2WVIA 5CBOA 2I1KA 4HRLA 3FU3A 5B1BE 3UUXA 3NZUA 4GYOA 3KS2A 3M53A 1OY3D 3QJZA 4G8KA 4CRWA 5JJ7A 3LJ3A 1X5BA 5BNWA 3S7BA 4JZYA 2GRLA 4M3OA 4HORA 2EQXA 3UM3A 4U0ZA 3Q15A 3JXJA 5B1AE 3SI5A 4JC8A 2MRIA 3CVPA 5F59A 4NACA 3I4GA 5JINA 2FO7A 3F9XA 3LEWA 4XI0A 2X6KA 3FUMA 4JD2G 2LNIA 4GB9A 3ABLE 4UQYA 4QEPA 4J7IA 3KD7A 4MI0A 3HXDA 5LFAA 1ZBPA 5LCWJ 4A63B 1SW6A 4HQDA 4LDGA 2F0YA 3C3OA 5T8IA 2DYSE 2XEVA 5JHAA 3CHOA 3LDZA 3EIJA 2XRYA 5LCWC 4GTRA 2PQRA 5KNGA 2QYJA 3Q47B 4FADA 5KBAA 5JJ6A 4DLQA 3N71A 2WPVA 3P1UA 2QC9A 4ILGA 3WXXA 4F3VA 3F6QA 4B89A 4I6JA 3S8PA 2PQNA 4OVVA 2GRQB 3AS8A 2R59A 1W3BA 2YQ8A 1Y6IA 3FPDA 2F69A 4GZCA 2V4LA 4D10C 4EECA 4AM9A 5FZRA 1QNFA 4GTOA 1O1SA 4YPAA 5KJMA 3EIQC 4N3CA 4ACLA 3QWWA 4EPZA 4ANXA 5BV1A 2YHEA 2IOSA 3GZSA 2XPYA 5CEDB 2LAHA 1KT1A 4E47A 3UXGA 5T0KA 5H7PA 4BERA 4L9PA 5AQAA 4K03A 3TWSA 3ZKJA 4U8HA 3ZYKA 1SZAA 2PM7A 3L22A 2QPWA 3NF1A 4YDWA 4HLLA 1A17A 4QFVA 1DC2A 4CZ2D 4YDYA 5EX0A 4L23A 1BU9A 1OCRE 2XGSA 3FUFA 4HI8A 4DI3A 3HVEB 2XPIA 4HOSA 2YNQA 5HS0A 3CVWA 4XIFA 4NIKA 2W5ZA 3B95A 3C72A 3PNTB 4U8VD 3MKRA 3ZUVB 3EHNA 3KSLA 4W9RA 2WXPA 3F9WA 3ZXSA 4AEZC 1OWLA 3ZYMA 4BTAA 1TN6A 3RSEG 5AIJA 2KCVA 3SY2A 2XQ0A 3HYMB 2ZGGA 4GA2A 4GPKA 3FU6A 3FY4A 3Q78A 4C0MA 3ASFA 1U3CA 1BPOA 3G2VA 3M58A 2WMOA 2I2OA 3CHPA 3HRAA 1N4PA 2EIKE 3TGOA 1MUFA 1WM5A 4G26A 2OOEA 5KJKA 1ZB1A 5F5EA 3D9JA 1JCQA 2ZU6B 3SWCA 5ENSD 2P9IG 4YNMA 3SW9A 1OCCE 4MBGA 2XZTG 4YNPA 4BX9A 2L0IA 3PZ2A 2EIME 4KXKB 3NQPA 3SFXA 1H3IA 2C0LA 5FQ8A 3G2TA 4HRNA 5EIDA 4KVOA 4O1PA 4G25A 5ARGA 4BT8A 5J90A 2ZGDA 4JEHA 2V5FA 3ASNE 1MQSA 3UPVA 5FINA 5T3RA 3AS5A 1HU3A 3SFZA 2FEZA 4LNUD 2IQCA 4N5CA 1ZU2A 3UT7A 2Y69E 3VLDA 3BO5A 3FEYA 4H7XA 4IJDA 2WXGA 4PS3A 3DPYA 2UY1B 1N52A 1Z5SC 2V0PA 3M59A 3D9HA 1N95A 4CDRA 4JVSA 5ENTD 2IY0C 3G2SA 5BUZA 5AENA 3AAAC 3LCAA 4G11A 1K1BA 3E34A 3UT8A 3NZSA 2R17C 2DVWA 2A5UA 3T5VA 4O1OA 4QEOA 2RFMA 4ANVA 3ZRHA 3CGHA 4I9EA 4GTTA 3Q49B 4AOFA 3OOIA 5KCMA 2VGYA 2J4BA 4F1SA 2FI7A 3EU9A 3M56A 4FA6A 3AU5A 4JW1A 1MHQA 3Q7FA 3SF4A 2R03A 4C1QA 3BEEA 1U3DA 2WQHA 3CHMA 3CHRA 3GZ1A 3TWQA 4GAAA 4TXQA 4LRZA 2L9BA 3CQGB
chains in the Genus database with same CATH topology
4OYSA 3SHFA 3VLFA 5FWQA 3F9ZA 4LCTA 4BX8A 3BG1B 4G24A 3PEVB 3FU5A 4PDXA 2RD0A 3VTYA 4RSYA 5EX3A 3G2UA 5TH7A 3R7RA 3O48A 1HX8A 2AXUA 2R5SA 1KLXA 2X38A 3PUKA 5G05J 1JWGA 4R7LA 2NXPA 5J08A 3RAYA 4GU5A 4UWHA 3QNKA 1PEGA 4A55A 4UI9K 3UT4A 4O30A 3D3MA 3FU0A 4BSXA 4O6FA 4L7TA 2IFUA 2C0MA 4J8EA 2IF4A 2BQZA 3QOUA 3RJWA 5JHBA 1DNPA 3FEXA 4LUNU 3ENEA 4ME2A 3RIBA 1NA0A 3ULQA 3M5AA 3B13A 4I2ZA 2XHEA 4G2VA 4I1MA 2P58C 1LF8A 2IU1A 4FJYA 3RRNB 2M63A 4Q96A 1H2UA 2HM8A 4CT4A 5JHNA 3VLEA 4J6IA 5CMWA 2WXKA 3CKBA 3I4RB 4LERA 4WWNA 2UWJG 2JV0A 3CK7A 4I6EA 4GA0A 3MV2B 3PEUB 2WQ6A 5G04C 3UQ3A 4WNFA 3VTXA 3B7SA 4L1BA 2E0IA 3QC1A 3VV0A 3MX3A 2X3MA 3TG5A 5C1DA 4APFA 4PH4B 5LSZA 1JUQA 3Q5MA 3B7TA 3GW4A 4V3IA 4WNDA 4I2WA 3IV0A 4LEUA 5BPPA 1FVHA 2JEKA 3HVEA 4JPSA 3FTVA 3MJWA 3T8MA 4MI5A 4GMJA 2WXOA 1PY1A 5KJLA 3MCXA 1EPUA 2VSNA 3HHMA 4N3BA 4WWOA 1UJKA 3ZYLA 4BTBA 3Q4AB 2VGXA 5A7DB 4UWGA 3OXGA 4EBAA 4AVXA 1UN8A 2CG2A 3L08A 1JWFA 3ZHEA 3EP0A 4YNDA 3C98A 4ACKA 3KEZA 4HOUA 2LSVA 3CVYA 4NRHB 4IJ8A 2I6HA 3PE3A 2J08A 4GYYA 4JDSA 3RO2A 3FUKA 3DB5A 2J09A 3DALA 3GYZA 4DJAA 2WXMA 2GW1A 5FQ4A 1H0AA 3F9YA 1GW6A 2E2EA 3LVQE 3O4ZA 5FJYA 4FMUA 4B0ZA 4DLOA 5BV0A 4QENA 2WVIA 2BTDA 3TXMA 2I1KA 4TUUA 2HYZA 2WXFA 3FU3A 3KAEA 4ABNA 3MZLB 4I1AA 4ANUA 2QFCA 2YINA 4JA7A 3UUXA 4GYWA 3NZUA 4GA1A 4GYOA 4KZ0A 1HG5A 3KS2A 3LY8A 4I17A 3M53A 1HS6A 1OWMA 3SBSA 2PZIA 3QJZA 4PS7A 4CRWA 5AJLA 5BT1A 5JJ7A 3LJ3A 2X6HA 4FHJA 1X5BA 5BNWA 3S7BA 4AY5A 3LKUA 2VTBA 4JZYA 2AXVA 1TEZA 2VSOE 3MEKA 2GRLA 4M3OA 4HORA 4YVQC 3QARA 5FTPA 3FUIA 4HVBA 3KMJA 1OUVA 2EQXA 3QB2A 3CVQA 4FJZA 4BWRA 3DBSA 4FHKA 3IKOB 1MVXA 4U04A 3IHVA 4U0ZA 3JYSA 3RRMB 1SQMA 3LVRE 2KCKA 2X6FA 4AIFA 3Q15A 1SZ9A 4J0UA 3CEQA 3CVLA 1P5QA 3FTYA 3TG4A 3M55A 3MKQA 1UN9A 4KBQA 2A4ZA 3SI5A 2JLBA 3FTSA 4JC8A 2XCBA 2MRIA 2VSYA 3CVPA 2LSUA 5F59A 3AS4A 4NACA 4UI9C 3I4GA 4NVQA 5JINA 2FO7A 4J8DA 3F9XA 3LEWA 4UWFA 1E7UA 4XI0A 3FH5A 4J8SA 1HO8A 2DBAA 2X6KA 3FTWA 4RVBA 2VSXE 3L54A 4H12A 3CK8A 4UI9J 1S0PA 4WWPA 3EHMA 3PRZA 2WQ7A 2WB2A 3FUMA 3OXFA 2LNIA 2FULA 4AY6A 4U07A 4Q94A 4GB9A 3CLJA 1N54A 3QDNA 5D0QD 4EQFA 1B89A 4F7AA 4AV7A 3M57A 4CDMA 1HZ4A 4UQYA 3PREA 1XGWA 4QEPA 4F53A 4H7YA 3ESKA 4RG9A 5ARFA 5T0MA 1E8YA 4J7IA 4ILIA 2GGFA 1EDUA 2PM6A 3KD7A 3MV3B 4RG6A 4CGVA 5LFAA 1ZBPA 4MI0A 3SGHA 2WXQA 5CCLA 1H19A 5LCWJ 3D9PA 5M72A 4Z4PA 4LDGA 4ANWA 3RU0A 2G46A 5BW8C 5T8IA 5AJDA 2XEVA 1NA3A 5FZQA 4AP2A 5JHAA 3CHOA 3LDZA 3EIJA 4JHJA 4U0SA 2IJGX 2XRYA 5LCWC 4GCOA 2PQRA 2CHZA 2AXZA 5ENNA 3U3WA 3Q47B 4FADA 4U63A 5JJ6A 4DLQA 4N39A 3N71A 4UQXA 4C0EA 1IQRA 2WPVA 3P1UA 4ILGA 3WXXA 3IHXA 4HXIA 1HH8A 4F3VA 4B89A 4ATGA 4I6JA 4GMLA 4J8OA 2IONA 1KT0A 4GZ3A 3S8PA 1FCHA 1Y8MA 3ESLA 3IBEA 3R9AB 2PQNA 4OVVA 3L13A 3LY7A 3CVUA 4JHRA 3AS8A 3CHSA 3ZN3A 1O9SA 4XKBA 3CQCB 2I1JA 2R59A 3S7JA 3RQ4A 2RG8A 3FTXA 3FUHA 4B94A 1W3BA 1DVPA 5JJTA 5CHEE 5G04J 2L0TB 2YQ8A 1Y6IA 4WAFA 3OXLA 1Z3YA 3APFA 5HQ8A 4FULA 2XPZA 1PC2A 4XX5A 4XE0A 3U64A 1VDYA 2CFZA 3MA5A 4GZCA 3CIAA 2F69A 3FUDA 3FPDA 2HO1A 5E76A 2V4LA 3APDA 3OTNA 3L17A 3B7UX 4D10C 1N3JA 4EECA 3SD5A 4AM9A 3JCKC 3MO0A 3OPEA 4NJ5A 1NP7A 2LO6A 5FZRA 1QNFA 2KATA 5F6KC 5JIYA 2O8JA 2WXJA 4YPAA 2KZTB 3BG0B 1OWNA 4KVMA 2Y3AA 4CEMA 3PNLB 5KJMA 3EIQC 3ML8A 3TAXA 4J7FA 3LYAA 3FWVA 4N3CA 3EJNA 3FFLA 1E8WA 2Y4TA 4IULA 4ACLA 3QWWA 4YVOA 5FZSA 4EPZA 4Q69A 4ANXA 3MO2A 1HE8A 2V8SE 2GRMA 2YHEA 1QZ2A 4KT6B 4L2YA 1XNFA 4B8AA 5BV1A 2IOSA 2IGQA 3GZSA 4I1OB 3JQ1A 5F6LA 3P2BA 2XPYA 2LAHA 1KT1A 1E8XA 4Y6CA 4E47A 4IYPA 5T0KA 3D9OA 3D9MA 4K03A 4G23A 1N6AA 5TEGA 4U8HA 3CBPA 1N6CA 1TJCA 2MOWA 4HOQA 2Q7FA 3ZYKA 1SZAA 3CR3A 3TL5A 4UQZA 2PM7A 2DCPA 3L22A 4XKCA 4GZ6A 2KC7A 2ILRA 2WM9A 4E6HA 2QPWA 3M54A 3NF1A 1UW4B 3B7RL 4FC8A 4MLPA 4J83A 1ZKKA 1E7VA 3KMAA 1A17A 1Z3XA 3ZHEB 4QFVA 2L6JA 5EDSA 5FQ7A 2J4DA 3HIZA 2DIWA 3CHQA 5EX0A 2KM4A 3I3NA 4L23A 3CVNA 4U0UA 4JHKA 3FH7A 2XGSA 3FUFA 2FF4A 2X6JA 4DI3A 3HVEB 3L6AA 4XI9A 3SBTB 2XPIA 3GZ2A 4HOSA 2YNQA 3CVWA 2J9QA 4XIFA 2W5ZA 4XZ4A 5G2NA 3PNTB 4AXHA 3MKRA 2OVFA 2WXIA 4Y6WA 2UY1A 3CBOA 3CVVA 5T5GA 5D0OD 3EHNA 3MGBA 2CHWA 1E8ZA 4W9RA 4BFRA 3LXUX 2WXPA 3FH8A 3F9WA 5G05C 3ZXSA 2W5YA 4AEZC 1OWLA 3ZYMA 2AW6A 4BTAA 4HLEA 5EG2A 2WXRA 3D9KA 5AIJA 1FVFA 2KCVA 4UWKA 3ZVVA 4YPUA 2XQ0A 3HYMB 4AJWA 4FP7A 4GA2A 4GPKA 3IHYA 5DIZA 3OAWA 1EYHA 3FU6A 3KMTA 3FY4A 1YA0A 2FBNA 4RZ0A 1OWOA 2CHXA 3LS8A 4K0RA 3PS6A 4C0MA 5A6CA 1ELKA 3ASFA 1U3CA 1ELWA 4TV3A 1H6KA 1BPOA 3G2VA 1WY6A 5ANRA 3M58A 5AYFA 3ZW3A 2WMOA 2I2OA 3CHPA 4EZLA 2MHKA 2WXNA 4FU3A 1HFAA 4HS2A 2BUGA 4DI4A 3K5KA 3TGOA 5C2YA 2XRZA 1MUFA 1INZA 3CSFA 3TJPA 3RKVA 2C2LA 2OVBA 2BF0X 1WM5A 1L5JA 2OOEA 4G26A 2QY7A 5KJKA 5F5EA 3LY9A 3D9JA 3FP3A 2ZU6B 3SWCA 3SZ7A 3D9NA 3ZFWA 4YNMA 3SW9A 3CSTA 5E75A 4JA9A 4HFGA 2PL2A 4EZJA 2XGOA 4YNPA 3MYVA 3L16A 4BX9A 3CV0A 2L0IA 5LSXA 4JL0A 2WMNA 3RJVA 3PH0C 4KXKB 3NQPA 4PUCA 1HF8A 4A1SA 3ZIMA 5LP0A 3CBMA 1H3IA 4JLGA 4L2LA 5LOZA 3R7QA 3OS5A 5TTFA 2C0LA 5FQ8A 2KCLA 2OV8A 3G2TA 4CDNA 2NC9A 4I43A 3ZGQA 3URZA 2VYIA 3FUEA 4KVOA 4UWLA 4G25A 2J49A 3PDNA 1XQHA 5ARGA 4A3VA 4BT8A 1H2TC 4AU7A 4JXTA 4J8FA 1E96B 4BT9A 5J90A 3ASHA 3ASGA 3K9IA 4JEHA 3UX4A 3FHEA 5AYWD 2V5FA 3UPVA 1MQSA 2XCCA 3QAQA 4MRUA 2KZTA 2HR2A 5T3RA 3AS5A 5JJ0A 1OWPA 3DPDA 1HU3A 3EDTB 3FUNA 3S7DA 3G2WA 2LAIA 3SFZA 4WNEA 3CK9A 3FULA 2FEZA 3QWPA 5A23A 3D9IA 4IRUA 2IQCA 4N5CA 2I9CA 4YPEA 5CCMA 1IHGA 1ZU2A 4GZ5A 1ELRA 4FLHA 3UT7A 3VLDA 3VUZA 3U4TA 3ZEFA 2CFUA 3PZDA 3PVLA 5KJNA 3BO5A 5T4YA 3ZPJA 4N2SA 3MKQB 3FEYA 3U66A 4H7XA 4HOTA 4IJDA 2WXGA 4KYOB 4NURA 4PS3A 5EKQD 3RO3A 2YHCA 3ONKA 4B8CB 2UY1B 3T5XA 1N52A 2NSZA 2V0PA 5DBKA 5CPRB 3CKCA 3M59A 4FLBA 4DK5A 1Z6TA 3FUJA 4JVSA 4MKTA 4N3AA 3LPZA 4CCAA 4CDRA 3APCA 3D9LA 1H2VC 3E4BA 4APOA 3G2SA 5BUZA 4C9BB 5AENA 1EF1C 3LCAA 4G11A 5FT9A 1IYGA 3UT8A 4ILHB 3S2AA 2VTBB 4MS6A 3IEGA 3NZSA 1JPLA 1ML9A 4A1GA 2R17C 3JQ0A 4WUYA 2A5UA 2WXLA 3HNAA 4TRQA 3T5VA 4URKA 5LX8A 4QEOA 2R3AA 3FDHA 4ANVA 3ZRHA 5CMYA 4NQ0A 4PS8A 2J07A 4A3TA 4IN3B 3CGHA 1MT6A 1HG2A 1QQEA 1TJFA 4I9EA 3I5PA 3QK0A 4I51A 3Q49B 4CT0A 3MO5A 4AOFA 1IQUA 4BY6A 3UMVA 2X6IA 3OOIA 4EZKA 3JUIA 5KCMA 4CGWA 2IOLA 2Y4UA 3TXNA 2VGYA 3HDXA 3ONLA 3FTUA 2VJ8A 3RRUA 2J4BA 4P29A 1PAQA 4KMOA 5G55A 1UG3A 4I6GA 4F1SA 3ML9A 2FI7A 3ASDA 3PUJA 2VGXB 4I9CA 3FTZA 4E85A 3M56A 2ONDA 4FA6A 2AWIA 1MVHA 4N2QA 3AU5A 4JW1A 3CVXA 4OVUA 3QKYA 1MHQA 4GCNA 1WAO1 2AVPA 3SF4A 3RK6A 3AU4A 4DPRA 3S7FA 2RFIA 3BEEA 2WXHA 4C1QA 1UJJA 1U3DA 2WQHA 3CHMA 3CHRA 3GZ1A 2CG3A 4GZDA 5HI7A 4G1TA 4KZCA 2XGMA 4GAAA 4EBAG 3QWVA 3PE4A 3ZYQA 1E90A 1NZNA 4LRZA 5FQ6A 1HXIA 4JEUA 3U9WA 4WNGA 5ANLA 2VQ2A 4BUPA 2L9BA 3SNXA 3CQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9Z A;  4G24 A;  3VTY A;  5EX3 A;  5TH7 A;  3O48 A;  2R5S A;  1KLX A;  5G05 J;  3RAY A;  1PEG A;  4UI9 K;  4O30 A;  4O6F A;  2IFU A;  2C0M A;  4J8E A;  2IF4 A;  2BQZ A;  3QOU A;  3RJW A;  4ME2 A;  3RIB A;  1NA0 A;  3ULQ A;  3M5A A;  4I2Z A;  4G2V A;  2P58 C;  5JHN A;  3CKB A;  2UWJ G;  2JV0 A;  3CK7 A;  4GA0 A;  3MV2 B;  5G04 C;  3UQ3 A;  4WNF A;  3VTX A;  3VV0 A;  3TG5 A;  5C1D A;  5LSZ A;  3Q5M A;  3GW4 A;  4WND A;  4I2W A;  4LEU A;  4MI5 A;  5KJL A;  2VSN A;  4N3B A;  4BTB A;  3Q4A B;  2VGX A;  5A7D B;  3OXG A;  3ZHE A;  3EP0 A;  4YND A;  4HOU A;  2LSV A;  4NRH B;  4IJ8 A;  2I6H A;  3PE3 A;  4GYY A;  4JDS A;  3RO2 A;  3DB5 A;  3DAL A;  3GYZ A;  2GW1 A;  3F9Y A;  2E2E A;  5FJY A;  4FMU A;  4QEN A;  2HYZ A;  3KAE A;  4ABN A;  4I1A A;  2QFC A;  4JA7 A;  3UUX A;  4GYW A;  4GYO A;  4GA1 A;  4I17 A;  3KS2 A;  3LY8 A;  3M53 A;  2PZI A;  5BT1 A;  5JJ7 A;  5BNW A;  3S7B A;  4AY5 A;  3LKU A;  3MEK A;  4HOR A;  4YVQ C;  3KMJ A;  5FTP A;  1OUV A;  3CVQ A;  4BWR A;  1MVX A;  4U04 A;  4U0Z A;  3JYS A;  2KCK A;  4AIF A;  3Q15 A;  4J0U A;  3CEQ A;  3CVL A;  1P5Q A;  3TG4 A;  3M55 A;  4KBQ A;  2JLB A;  2XCB A;  2VSY A;  3CVP A;  5F59 A;  2LSU A;  3AS4 A;  4UI9 C;  4NVQ A;  5JIN A;  2FO7 A;  4J8D A;  3F9X A;  4XI0 A;  2DBA A;  4H12 A;  3CK8 A;  4UI9 J;  3OXF A;  2LNI A;  4AY6 A;  4U07 A;  3QDN A;  5D0Q D;  4EQF A;  1B89 A;  3M57 A;  1HZ4 A;  4UQY A;  4QEP A;  5T0M A;  4H7Y A;  3ESK A;  4RG9 A;  5ARF A;  4J7I A;  3KD7 A;  3MV3 B;  4CGV A;  4RG6 A;  4MI0 A;  1ZBP A;  5CCL A;  5LCW J;  5M72 A;  4Z4P A;  4LDG A;  3RU0 A;  2G46 A;  5BW8 C;  2XEV A;  1NA3 A;  5FZQ A;  4U0S A;  5LCW C;  4GCO A;  2PQR A;  3U3W A;  3Q47 B;  5JJ6 A;  4N39 A;  3N71 A;  4UQX A;  2WPV A;  3IHX A;  3WXX A;  1HH8 A;  4F3V A;  4J8O A;  4GZ3 A;  1KT0 A;  3S8P A;  1FCH A;  1Y8M A;  3R9A B;  2PQN A;  3LY7 A;  4JHR A;  3AS8 A;  3ZN3 A;  1O9S A;  3RQ4 A;  3S7J A;  4B94 A;  1W3B A;  5JJT A;  5CHE E;  5G04 J;  2YQ8 A;  3OXL A;  5HQ8 A;  1PC2 A;  3FPD A;  3MA5 A;  2F69 A;  2HO1 A;  1N3J A;  4AM9 A;  3OPE A;  4NJ5 A;  3MO0 A;  5FZR A;  2KAT A;  5F6K C;  5JIY A;  2O8J A;  4YPA A;  5KJM A;  3TAX A;  4J7F A;  3LYA A;  3FWV A;  4N3C A;  3FFL A;  2Y4T A;  3QWW A;  4YVO A;  5FZS A;  3MO2 A;  1QZ2 A;  2IGQ A;  1XNF A;  5F6L A;  1KT1 A;  4Y6C A;  4E47 A;  5T0K A;  4G23 A;  1N6A A;  5TEG A;  3CBP A;  1N6C A;  1TJC A;  4HOQ A;  2Q7F A;  4UQZ A;  4GZ6 A;  2KC7 A;  3M54 A;  4J83 A;  2QPW A;  3NF1 A;  1ZKK A;  3KMA A;  1A17 A;  3ZHE B;  2L6J A;  5EX0 A;  3CVN A;  4U0U A;  2XGS A;  2FF4 A;  4XI9 A;  2XPI A;  3GZ2 A;  4HOS A;  2J9Q A;  4XIF A;  2W5Z A;  3MKR A;  4Y6W A;  2UY1 A;  3CBO A;  5T5G A;  5D0O D;  4W9R A;  3F9W A;  5G05 C;  2W5Y A;  4BTA A;  5EG2 A;  2KCV A;  4YPU A;  3HYM B;  4GA2 A;  4GPK A;  5DIZ A;  3KMT A;  1YA0 A;  2FBN A;  4RZ0 A;  5A6C A;  3ASF A;  1ELW A;  3M58 A;  5AYF A;  2MHK A;  2BUG A;  3K5K A;  3TGO A;  1MUF A;  3RKV A;  2C2L A;  1WM5 A;  4G26 A;  2OOE A;  5KJK A;  5F5E A;  3LY9 A;  3FP3 A;  3SWC A;  3SZ7 A;  3ZFW A;  4YNM A;  3SW9 A;  4JA9 A;  2PL2 A;  2XGO A;  4YNP A;  3CV0 A;  5LSX A;  4JL0 A;  3RJV A;  4KXK B;  4A1S A;  4JLG A;  3CBM A;  1H3I A;  5TTF A;  3OS5 A;  2C0L A;  2KCL A;  2NC9 A;  3ZGQ A;  3URZ A;  2VYI A;  4G25 A;  3PDN A;  1XQH A;  5ARG A;  4BT8 A;  4AU7 A;  4J8F A;  1E96 B;  4BT9 A;  3ASH A;  3ASG A;  3K9I A;  5AYW D;  2V5F A;  3UPV A;  2XCC A;  2HR2 A;  3AS5 A;  5JJ0 A;  3EDT B;  3S7D A;  4WNE A;  3CK9 A;  3QWP A;  2FEZ A;  4N5C A;  4YPE A;  5CCM A;  1IHG A;  1ZU2 A;  4GZ5 A;  1ELR A;  3VUZ A;  3U4T A;  3BO5 A;  5KJN A;  3ZPJ A;  4N2S A;  4H7X A;  4HOT A;  4IJD A;  4KYO B;  5EKQ D;  3RO3 A;  2YHC A;  2UY1 B;  5CPR B;  5DBK A;  3CKC A;  3M59 A;  4CDR A;  4N3A A;  3LPZ A;  4APO A;  3E4B A;  3LCA A;  5FT9 A;  1IYG A;  3IEG A;  1ML9 A;  4WUY A;  3HNA A;  4QEO A;  2R3A A;  1MT6 A;  4NQ0 A;  4IN3 B;  1QQE A;  4I9E A;  4I51 A;  3Q49 B;  3MO5 A;  3OOI A;  4CGW A;  2Y4U A;  2VGY A;  2FI7 A;  3ASD A;  4I9C A;  2VGX B;  3M56 A;  2OND A;  1MVH A;  4N2Q A;  3QKY A;  4GCN A;  1WAO 1;  2AVP A;  3SF4 A;  3S7F A;  2RFI A;  3BEE A;  4C1Q A;  2WQH A;  3GZ1 A;  5HI7 A;  4G1T A;  2XGM A;  3QWV A;  3PE4 A;  1NZN A;  1HXI A;  4WNG A;  2VQ2 A;  4BUP A; 
#chains in the Genus database with same CATH topology
 4OYS A;  3SHF A;  3F9Z A;  3FU5 A;  1NFI E;  5EX3 A;  1KZO A;  5TH7 A;  3R7R A;  2AXU A;  5G05 J;  4R7L A;  2NXP A;  3UT4 A;  3FU0 A;  4BSX A;  4DRX E;  4L7T A;  2C0M A;  4J8E A;  5CEA A;  3QOU A;  4LUN U;  3ENE A;  3M5A A;  4I2Z A;  3L9T A;  4DX6 D;  4Q96 A;  1SVX A;  4CT4 A;  1N4R A;  5CMW A;  2WXK A;  4I6E A;  2WQ6 A;  3V31 A;  3VTX A;  3B7S A;  3UM0 A;  2E0I A;  3MX3 A;  2X3M A;  3TG5 A;  2IEJ A;  4APF A;  3GW4 A;  4V3I A;  3ABK E;  4MI5 A;  3BQO A;  5KJL A;  4WWO A;  1U2V G;  1UJK A;  3ZYL A;  2VGX A;  1V54 E;  3ZHE A;  3Q9U C;  2EIL E;  4NRH B;  2J08 A;  3RO2 A;  3DB5 A;  3GYZ A;  3WG7 E;  4DJA A;  2GW1 A;  5FJY A;  4DLO A;  5BV0 A;  3UIP C;  4ABN A;  4I1A A;  1TNO A;  4GYW A;  4KZ0 A;  3LY8 A;  3SBS A;  4FHJ A;  2VTB A;  3DEP A;  3NOC D;  2VSO E;  5FTP A;  3FUI A;  5KNH D;  1OUV A;  3QB2 A;  4LNG A;  2NYJ A;  3LVR E;  4AIF A;  4J0U A;  1OT8 A;  3CVL A;  3TG4 A;  1UN9 A;  4KBQ A;  5BXU A;  3NAW A;  3FTS A;  1TR4 A;  1Q2Z A;  3DSV A;  4NVQ A;  4J8S A;  2Y1L E;  3FTW A;  4QQI A;  4ZFH A;  4WWP A;  3EHM A;  2WQ7 A;  3OXF A;  3TWV A;  3CLJ A;  3QDN A;  4EQF A;  1B89 A;  4BES A;  4F53 A;  3ESK A;  3ZNG A;  1N4Q A;  1EDU A;  3MV3 B;  3SGH A;  2WXQ A;  5CCL A;  1MX2 A;  1MYO A;  5BW8 C;  5FZQ A;  1KZP A;  4U0S A;  2XEH A;  4GCO A;  2ETA A;  3U3W A;  4U63 A;  4N39 A;  2OCC E;  1HH8 A;  3J5P A;  4ATG A;  4GML A;  4GZ3 A;  1FCH A;  2V4H C;  3L13 A;  3LY7 A;  3CVU A;  3CHS A;  3RQ4 A;  1AP7 A;  2RG8 A;  3FTX A;  1DVP A;  5G04 J;  2P2C P;  3AG4 E;  1PC2 A;  4XX5 A;  1VDY A;  3FUD A;  2DZO A;  3OTN A;  3L17 A;  3B7U X;  1N3J A;  3MO0 A;  2LO6 A;  4G8L A;  1TNU A;  3C3Q A;  4KVM A;  2Y3A A;  4J7F A;  3EJN A;  3FFL A;  1E8W A;  1OCO E;  3Q7A A;  2IO2 C;  2GRM A;  1QZ2 A;  2IGQ A;  4L2Y A;  1XNF A;  4B8A A;  4I1O B;  3UM1 A;  1YCS B;  5EYL A;  3D9O A;  2OEW A;  3D9M A;  5TEG A;  4LSZ E;  3AJI A;  4U8Y D;  4HOQ A;  3TL5 A;  2WM9 A;  3B7R L;  4MLP A;  1ZKK A;  4C48 B;  2L6J A;  5FQ7 A;  4U7E B;  2DIW A;  2KM4 A;  3CVN A;  3ZU7 B;  4U0U A;  4JHK A;  3FH7 A;  2FF4 A;  2BKG A;  5EN5 D;  3GZ2 A;  4XZ4 A;  3DST A;  2OVF A;  1K1A A;  2WXI A;  3CBO A;  5T5G A;  1E8Z A;  3LXU X;  4HLE A;  2WXR A;  1FVF A;  1WDY A;  4AJW A;  1NL4 A;  1YA0 A;  2FBN A;  4RZ0 A;  2CHX A;  4K0R A;  1H6K A;  5ANR A;  5AYF A;  4FU3 A;  2BUG A;  1V55 E;  5C2Y A;  4GPM A;  2XRZ A;  3CSF A;  5EYP F;  3W9F A;  5CER B;  5D66 A;  3SZ7 A;  3D9N A;  5EIB E;  2PL2 A;  3MYV A;  3T8K A;  3PH0 C;  4PUC A;  4A1S A;  3ZIM A;  5LP0 A;  4OAV B;  5AAR A;  2OV8 A;  1NI1 A;  3FUE A;  4UWL A;  3PDN A;  1XQH A;  3DSX A;  4GTM A;  2P9U G;  1H2T C;  4AU7 A;  1SA5 A;  3FHE A;  2HR2 A;  5JJ0 A;  3DPD A;  3EDT B;  2J8S D;  2LAI A;  3QWP A;  3FUL A;  2EIJ E;  2I9C A;  4YPE A;  3ULE G;  4FLH A;  3ZEF A;  5BXO A;  2QZA A;  3ZPJ A;  5EKQ D;  3RO3 A;  4B8C B;  1BI7 B;  3CKC A;  4FLB A;  1Z6T A;  3FUJ A;  4CCA A;  3E4B A;  4C9B B;  1YMP A;  5CRV A;  5FT9 A;  1IYG A;  4ILH B;  3S2A A;  3IEG A;  1ML9 A;  3DWL G;  3JQ0 A;  3HNA A;  4URK A;  3FDH A;  5CMY A;  4PS8 A;  2J07 A;  3QK0 A;  4I51 A;  3MO5 A;  3NOG D;  3UMV A;  2X6I A;  4EZK A;  1TYQ G;  2IOL A;  3HDX A;  1QYM A;  1PAQ A;  4F1P A;  1UG3 A;  3ML9 A;  3PUJ A;  4I9C A;  2OND A;  4N5Q A;  2AWI A;  4N2Q A;  3W9G A;  1FT1 A;  2VGE A;  2AVP A;  2RFI A;  2CG3 A;  4EBA G;  3QWV A;  3PE4 A;  1E90 A;  3U9W A;  3C5R A;  5ANL A;  2VQ2 A;  5CRU A;  3SQV A;  3VLF A;  4LCT A;  2RD0 A;  4TXR A;  4RSY A;  3G2U A;  1HX8 A;  3PUK A;  2X38 A;  2Y0B G;  1H6O A;  5J08 A;  3RAY A;  4UWH A;  1PEG A;  4A55 A;  4UI9 K;  3D3M A;  4DX5 D;  1RW2 A;  2IF4 A;  2ETC A;  1DNP A;  4ME2 A;  1NA0 A;  4G2V A;  2P58 C;  4FJY A;  3RRN B;  2M63 A;  1H2U A;  3VLE A;  1O1R A;  4LER A;  3V30 A;  4WNF A;  1JUQ A;  3Q5M A;  4GTS A;  4WND A;  4I2W A;  4LEU A;  5BPP A;  1N11 A;  3FTV A;  2WXO A;  2GRR B;  2VSN A;  3HHM A;  1N4S A;  4BTB A;  3Q4A B;  4AVX A;  1JWF A;  4YND A;  3C98 A;  4ACK A;  3KEZ A;  4HOU A;  2I6H A;  4JDS A;  2J09 A;  3F9Y A;  1H0A A;  3LVQ E;  2H6I A;  3TXM A;  5ENQ D;  2HYZ A;  3EHR A;  2WXF A;  4B93 B;  2XZD G;  3MZL B;  4ANU A;  1HG5 A;  4I17 A;  2H6G A;  5BT1 A;  2X6H A;  3LKU A;  2GRN B;  2AXV A;  1TEZ A;  3MEK A;  4YVQ C;  3KMJ A;  4HVB A;  4BSZ B;  3CVQ A;  4FJZ A;  4BWR A;  3RAU A;  3IKO B;  1MVX A;  4U04 A;  3JYS A;  3RRM B;  1SQM A;  3EHQ A;  3KEA A;  2KCK A;  2X6F A;  4ATZ D;  1SZ9 A;  2ZXW E;  3CEQ A;  1P5Q A;  2A4Z A;  2JLB A;  2XCB A;  5AAO A;  2LSU A;  4J8D A;  1E7U A;  3FH5 A;  1HO8 A;  2DBA A;  2VSX E;  3L54 A;  3CK8 A;  4UI9 J;  1S0P A;  4CYM D;  2WB2 A;  3PRZ A;  4AY6 A;  4U07 A;  4Q94 A;  3LJN A;  4OAU C;  2FO1 E;  1HZ4 A;  2P9P G;  2ETB A;  2LXL A;  5T0M A;  4RG9 A;  1E8Y A;  4ILI A;  2PM6 A;  4CGV A;  3UKR G;  4RG6 A;  2DZN A;  1H19 A;  2GRP B;  5M72 A;  3D9P A;  1KPS B;  1NA3 A;  4AP2 A;  4JHJ A;  2IJG X;  2CHZ A;  2AXZ A;  4UQX A;  1D8D A;  4C0E A;  1IQR A;  1TNZ A;  3IHX A;  4LNB A;  4HXI A;  4UUC A;  1KT0 A;  1Y8M A;  3ESL A;  4M7C A;  3R9A B;  4JHR A;  3HXC A;  1O9S A;  3ZN3 A;  4XKB A;  2I1J A;  3EU5 A;  3S7J A;  5JJT A;  4WAF A;  3OXL A;  4DX7 D;  1Z3Y A;  3Q9N C;  1MJ0 A;  1DCQ A;  4FUL A;  4XE0 A;  2BED A;  5E76 A;  2P9S G;  3APD A;  4NJ5 A;  1FPP A;  1X81 A;  2KAT A;  5F6K C;  2WXJ A;  3SO8 A;  1OWN A;  3PNL B;  2ZIS A;  3ML8 A;  3TAX A;  3DSS A;  3FWV A;  3LYA A;  4HNA D;  2Y4T A;  4IUL A;  5FZS A;  3PZ4 A;  1IHB A;  3MO2 A;  4KT6 B;  3V2X A;  3JQ1 A;  3P2B A;  3V79 K;  1E8X A;  2XS8 A;  3V2O A;  1N6A A;  3UI2 A;  3CBP A;  5AQ7 A;  1TJC A;  3CR3 A;  4UQZ A;  2V5Q C;  2ILR A;  3M54 A;  4FC8 A;  1UW4 B;  3KMA A;  1Z3X A;  3ZHE B;  3HIZ A;  5FIO A;  3UM2 A;  2MYO A;  5EIL A;  4Z68 A;  4Y6W A;  2UY1 A;  2BKK B;  3CVV A;  3PZ1 A;  5D0O D;  3MGB A;  2CHW A;  4BFR A;  3FH8 A;  1JCS A;  5EG2 A;  3D9K A;  4UWK A;  3UIO C;  4FP7 A;  2H6F A;  3AG1 E;  3IHY A;  3OAW A;  1YYH A;  1OWO A;  3PS6 A;  1ELK A;  1ELW A;  3ZW3 A;  5AQB A;  4DI4 A;  1INZ A;  3E30 A;  3TJP A;  3RKV A;  1UOH A;  3FP3 A;  4DX1 A;  3ZFW A;  3AG3 E;  4JA9 A;  2XGO A;  3L16 A;  1QBQ A;  3CV0 A;  4K5A B;  2WMN A;  5ENR D;  1HF8 A;  4JLG A;  5TTF A;  5LOZ A;  2NC9 A;  3J5Q B;  2AJA A;  2VYI A;  2J49 A;  4U96 D;  4BT9 A;  5JMN D;  1N9A A;  3ASG A;  3UX4 A;  5AYW D;  2XCC A;  4MRU A;  2KZT A;  4HB5 A;  1K3Z D;  3E33 A;  5ENO D;  3D9I A;  4IRU A;  5CCM A;  1ELR A;  3TWU A;  3VUZ A;  5KJN A;  5T4Y A;  4DUI A;  3U66 A;  2L6B A;  4NUR A;  2YHC A;  3T5X A;  5CPR B;  5DBK A;  3DXM G;  4DK5 A;  3B7B A;  1K8K G;  3LPZ A;  3D9L A;  1H2V C;  1EF1 C;  2VTB B;  4MS6 A;  3UTM A;  1N0Q A;  2WXL A;  5LX8 A;  1IXV A;  1MT6 A;  4NQ0 A;  1QQE A;  1TJF A;  1IQU A;  3L82 A;  4BY6 A;  3JUI A;  2Y4U A;  3TXN A;  3FTU A;  2VJ8 A;  4P29 A;  3TWR A;  2LUH A;  4KMO A;  5G55 A;  4I6G A;  3ASD A;  2VGX B;  2LXM A;  3E32 A;  1D8E A;  1S64 A;  3QKY A;  4GCN A;  1WAO 1;  2GRO B;  3RK6 A;  3AU4 A;  4DPR A;  3S7F A;  2WXH A;  1UJJ A;  5ENP D;  1A5E A;  5HI7 A;  4G1T A;  2XGM A;  5FQ6 A;  1HXI A;  4WNG A;  1JCR A;  4BUP A;  1RZ4 A;  3HXE A;  3SNX A;  4G24 A;  3PEV B;  3UIN C;  1S63 A;  2ZIR A;  4F6R D;  3O48 A;  2R5S A;  1KLX A;  4HRM B;  4EHM A;  3QNK A;  1DCE A;  3HXF A;  4O6F A;  1LD7 A;  3ULQ A;  3B13 A;  2XHE A;  4I1M A;  3T9K A;  1LF8 A;  5JHN A;  4J6I A;  3I4R B;  4WWN A;  1OCZ E;  2JV0 A;  2R02 A;  3MV2 B;  3PEU B;  3UQ3 A;  4J7W A;  4L1B A;  3QC1 A;  4GTV A;  1MX4 A;  2R05 A;  2P9K G;  4PH4 B;  3X2Q E;  2JEK A;  3HVE A;  4TUM A;  4GMJ A;  1OXJ A;  1PY1 A;  3MCX A;  1EPU A;  4N3B A;  1N94 A;  3AG2 E;  4X8Q A;  5A7D B;  4UWG A;  4EBA A;  3HXB A;  1UN8 A;  4GTP A;  4O60 A;  5AN8 A;  3EP0 A;  5HKP A;  3CVY A;  4IJ8 A;  4GYY A;  3FUK A;  3DAL A;  2WXM A;  1LD8 A;  4YDE A;  3O4Z A;  2BTD A;  4TUU A;  3KAE A;  2QFC A;  2YIN A;  4JA7 A;  4GA1 A;  1HS6 A;  1OWM A;  2PZI A;  2R2L A;  4PS7 A;  5AJL A;  4AY5 A;  3DRA A;  3QAR A;  3E37 A;  1AWC B;  3DBS A;  4FHK A;  3IHV A;  2KBX A;  3R9M A;  3DXK G;  3FTY A;  1LTX A;  3M55 A;  3MKQ A;  3KSQ A;  1N0R A;  4K5C A;  2VSY A;  3AS4 A;  4UI9 C;  2RFA A;  4UWF A;  2XEN A;  3IXE A;  4RVB A;  4H12 A;  4J8Y A;  2FUL A;  4BEP A;  1N54 A;  5D0Q D;  4F7A A;  3M57 A;  4AV7 A;  4CDM A;  4XEI G;  3PRE A;  1XGW A;  4H7Y A;  5ARF A;  2GGF A;  3NBN B;  4Z4P A;  4ANW A;  3RU0 A;  2G46 A;  5AJD A;  5CEC B;  4RLY A;  2P9L G;  3HG0 D;  1O1T A;  5ENN A;  3TWT A;  3BUA A;  4J8O A;  2ION A;  5AQ9 A;  3IBE A;  2RKK A;  1MZC A;  3CQC B;  1TN7 A;  5HRY A;  3FUH A;  4B94 A;  5CHE E;  5KWD A;  2L0T B;  1G3N B;  3APF A;  5HQ8 A;  2XPZ A;  3Q73 A;  3U64 A;  4BET A;  2CFZ A;  3MA5 A;  3CIA A;  1BD8 A;  2HO1 A;  3ASO E;  4GMR A;  3BU8 A;  3SD5 A;  3JCK C;  3OPE A;  1NP7 A;  2P9N G;  5JIY A;  2O8J A;  2KZT B;  3BG0 B;  1D9S A;  4CEM A;  2PNN A;  4YVO A;  3SFY A;  4Q69 A;  2F8X K;  1HE8 A;  2V8S E;  3ISM C;  3JXI A;  5F6L A;  4Y6C A;  4IYP A;  5B3S E;  4G23 A;  2B6C A;  5CBN A;  1N6C A;  2MOW A;  5D2M C;  2Q7F A;  2DCP A;  4XKC A;  4GZ6 A;  2KC7 A;  4E6H A;  4J83 A;  1E7V A;  2F37 A;  3ZXP A;  2QYU A;  5EDS A;  2J4D A;  3CHQ A;  3I3N A;  4RQI A;  2X6J A;  3DSU A;  3L6A A;  4XI9 A;  3SBT B;  2J9Q A;  3Q79 A;  5G2N A;  4AXH A;  2JAB A;  2HE0 A;  3JUE A;  3Q75 A;  2DWZ A;  5G05 C;  2W5Y A;  2AW6 A;  3ZVV A;  4YPU A;  2A5E A;  3EUV A;  5DIZ A;  1EYH A;  4HI9 A;  3KMT A;  3LS8 A;  5A6C A;  4TV3 A;  1WY6 A;  1FT2 A;  3DEO A;  4EZL A;  2MHK A;  2WXN A;  4JB8 P;  1HFA A;  4HS2 A;  3K5K A;  2F8Y A;  2C2L A;  4U95 D;  2OVB A;  2BF0 X;  1L5J A;  2QY7 A;  1BLX B;  3LY9 A;  4DX2 A;  1TNY A;  3CST A;  5E75 A;  4HFG A;  4EZJ A;  5LSX A;  4JL0 A;  3RJV A;  3CBM A;  4L2L A;  2KXP C;  3R7Q A;  3OS5 A;  2KCL A;  4CDN A;  4I43 A;  3ZGQ A;  3URZ A;  1SA4 A;  2EIN E;  2H6H A;  4A3V A;  5ITZ F;  4JXT A;  4J8F A;  1E96 B;  3ASH A;  3K9I A;  3UKU G;  3QAQ A;  5IY5 E;  1OWP A;  3FUN A;  3S7D A;  3G2W A;  4WNE A;  4HBD A;  3CK9 A;  5A23 A;  1IHG A;  4GZ5 A;  1IKN D;  3U4T A;  2CFU A;  3PZD A;  3PVL A;  4N2S A;  3MKQ B;  4ZHB A;  4HOT A;  4KYO B;  2IO3 C;  1O5M A;  3ONK A;  2NSZ A;  4MKT A;  4N3A A;  3APC A;  4APO A;  2OEV A;  1TNB A;  1JPL A;  1BI8 B;  4A1G A;  4WUY A;  4TRQ A;  2R3A A;  4A3T A;  4IN3 B;  1HG2 A;  3I5P A;  4CT0 A;  3C3R A;  4CGW A;  3ONL A;  3DSW A;  3RRU A;  3FTZ A;  4TXP A;  4E85 A;  1MVH A;  3CVX A;  2B0O E;  4OVU A;  5JA4 D;  3TWX A;  4GZD A;  4K5B A;  4KZC A;  1H6P A;  3ZYQ A;  3PZ3 A;  1NZN A;  4YDO A;  4JEU A;  3NB2 A;  4GTQ A;  1S70 B;  2XEE A;  5FWQ A;  4BX8 A;  3BG1 B;  4LG6 A;  4PDX A;  3ABM E;  3VTY A;  1JWG A;  2DYR E;  4GU5 A;  4O30 A;  2IFU A;  2BQZ A;  3RJW A;  5JHB A;  3FEX A;  3RIB A;  1TN8 A;  3ULY A;  2IU1 A;  2HM8 A;  3TWW A;  3CKB A;  2UWJ G;  3CK7 A;  4GA0 A;  5G04 C;  3VV0 A;  5C1D A;  5LSZ A;  3B7T A;  3IV0 A;  1FVH A;  4JPS A;  3T8M A;  3MJW A;  2XS1 A;  3OXG A;  2CG2 A;  3L08 A;  1WG0 A;  2LSV A;  3PE3 A;  5FQ4 A;  1GW6 A;  2E2E A;  4FMU A;  4QEN A;  4B0Z A;  1MX6 A;  2WVI A;  5CBO A;  2I1K A;  4HRL A;  3FU3 A;  5B1B E;  3UUX A;  3NZU A;  4GYO A;  3KS2 A;  3M53 A;  1OY3 D;  3QJZ A;  4G8K A;  4CRW A;  5JJ7 A;  3LJ3 A;  1X5B A;  5BNW A;  3S7B A;  4JZY A;  2GRL A;  4M3O A;  4HOR A;  2EQX A;  3UM3 A;  4U0Z A;  3Q15 A;  3JXJ A;  5B1A E;  3SI5 A;  4JC8 A;  2MRI A;  3CVP A;  5F59 A;  4NAC A;  3I4G A;  5JIN A;  2FO7 A;  3F9X A;  3LEW A;  4XI0 A;  2X6K A;  3FUM A;  4JD2 G;  2LNI A;  4GB9 A;  3ABL E;  4UQY A;  4QEP A;  4J7I A;  3KD7 A;  4MI0 A;  3HXD A;  5LFA A;  1ZBP A;  5LCW J;  4A63 B;  1SW6 A;  4HQD A;  4LDG A;  2F0Y A;  3C3O A;  5T8I A;  2DYS E;  2XEV A;  5JHA A;  3CHO A;  3LDZ A;  3EIJ A;  2XRY A;  5LCW C;  4GTR A;  2PQR A;  5KNG A;  2QYJ A;  3Q47 B;  4FAD A;  5KBA A;  5JJ6 A;  4DLQ A;  3N71 A;  2WPV A;  3P1U A;  2QC9 A;  4ILG A;  3WXX A;  4F3V A;  3F6Q A;  4B89 A;  4I6J A;  3S8P A;  2PQN A;  4OVV A;  2GRQ B;  3AS8 A;  2R59 A;  1W3B A;  2YQ8 A;  1Y6I A;  3FPD A;  2F69 A;  4GZC A;  2V4L A;  4D10 C;  4EEC A;  4AM9 A;  5FZR A;  1QNF A;  4GTO A;  1O1S A;  4YPA A;  5KJM A;  3EIQ C;  4N3C A;  4ACL A;  3QWW A;  4EPZ A;  4ANX A;  5BV1 A;  2YHE A;  2IOS A;  3GZS A;  2XPY A;  5CED B;  2LAH A;  1KT1 A;  4E47 A;  3UXG A;  5T0K A;  5H7P A;  4BER A;  4L9P A;  5AQA A;  4K03 A;  3TWS A;  3ZKJ A;  4U8H A;  3ZYK A;  1SZA A;  2PM7 A;  3L22 A;  2QPW A;  3NF1 A;  4YDW A;  4HLL A;  1A17 A;  4QFV A;  1DC2 A;  4CZ2 D;  4YDY A;  5EX0 A;  4L23 A;  1BU9 A;  1OCR E;  2XGS A;  3FUF A;  4HI8 A;  4DI3 A;  3HVE B;  2XPI A;  4HOS A;  2YNQ A;  5HS0 A;  3CVW A;  4XIF A;  4NIK A;  2W5Z A;  3B95 A;  3C72 A;  3PNT B;  4U8V D;  3MKR A;  3ZUV B;  3EHN A;  3KSL A;  4W9R A;  2WXP A;  3F9W A;  3ZXS A;  4AEZ C;  1OWL A;  3ZYM A;  4BTA A;  1TN6 A;  3RSE G;  5AIJ A;  2KCV A;  3SY2 A;  2XQ0 A;  3HYM B;  2ZGG A;  4GA2 A;  4GPK A;  3FU6 A;  3FY4 A;  3Q78 A;  4C0M A;  3ASF A;  1U3C A;  1BPO A;  3G2V A;  3M58 A;  2WMO A;  2I2O A;  3CHP A;  3HRA A;  1N4P A;  2EIK E;  3TGO A;  1MUF A;  1WM5 A;  4G26 A;  2OOE A;  5KJK A;  1ZB1 A;  5F5E A;  3D9J A;  1JCQ A;  2ZU6 B;  3SWC A;  5ENS D;  2P9I G;  4YNM A;  3SW9 A;  1OCC E;  4MBG A;  2XZT G;  4YNP A;  4BX9 A;  2L0I A;  3PZ2 A;  2EIM E;  4KXK B;  3NQP A;  3SFX A;  1H3I A;  2C0L A;  5FQ8 A;  3G2T A;  4HRN A;  5EID A;  4KVO A;  4O1P A;  4G25 A;  5ARG A;  4BT8 A;  5J90 A;  2ZGD A;  4JEH A;  2V5F A;  3ASN E;  1MQS A;  3UPV A;  5FIN A;  5T3R A;  3AS5 A;  1HU3 A;  3SFZ A;  2FEZ A;  4LNU D;  2IQC A;  4N5C A;  1ZU2 A;  3UT7 A;  2Y69 E;  3VLD A;  3BO5 A;  3FEY A;  4H7X A;  4IJD A;  2WXG A;  4PS3 A;  3DPY A;  2UY1 B;  1N52 A;  1Z5S C;  2V0P A;  3M59 A;  3D9H A;  1N95 A;  4CDR A;  4JVS A;  5ENT D;  2IY0 C;  3G2S A;  5BUZ A;  5AEN A;  3AAA C;  3LCA A;  4G11 A;  1K1B A;  3E34 A;  3UT8 A;  3NZS A;  2R17 C;  2DVW A;  2A5U A;  3T5V A;  4O1O A;  4QEO A;  2RFM A;  4ANV A;  3ZRH A;  3CGH A;  4I9E A;  4GTT A;  3Q49 B;  4AOF A;  3OOI A;  5KCM A;  2VGY A;  2J4B A;  4F1S A;  2FI7 A;  3EU9 A;  3M56 A;  4FA6 A;  3AU5 A;  4JW1 A;  1MHQ A;  3Q7F A;  3SF4 A;  2R03 A;  4C1Q A;  3BEE A;  1U3D A;  2WQH A;  3CHM A;  3CHR A;  3GZ1 A;  3TWQ A;  4GAA A;  4TXQ A;  4LRZ A;  2L9B A;  3CQG B; 
#chains in the Genus database with same CATH homology
 4OYS A;  3SHF A;  3VLF A;  5FWQ A;  3F9Z A;  4LCT A;  4BX8 A;  3BG1 B;  4G24 A;  3PEV B;  3FU5 A;  4PDX A;  2RD0 A;  3VTY A;  4RSY A;  5EX3 A;  3G2U A;  5TH7 A;  3R7R A;  3O48 A;  1HX8 A;  2AXU A;  2R5S A;  1KLX A;  2X38 A;  3PUK A;  5G05 J;  1JWG A;  4R7L A;  2NXP A;  5J08 A;  3RAY A;  4GU5 A;  4UWH A;  3QNK A;  1PEG A;  4A55 A;  4UI9 K;  3UT4 A;  4O30 A;  3D3M A;  3FU0 A;  4BSX A;  4O6F A;  4L7T A;  2IFU A;  2C0M A;  4J8E A;  2IF4 A;  2BQZ A;  3QOU A;  3RJW A;  5JHB A;  1DNP A;  3FEX A;  4LUN U;  3ENE A;  4ME2 A;  3RIB A;  1NA0 A;  3ULQ A;  3M5A A;  3B13 A;  4I2Z A;  2XHE A;  4G2V A;  4I1M A;  2P58 C;  1LF8 A;  2IU1 A;  4FJY A;  3RRN B;  2M63 A;  4Q96 A;  1H2U A;  2HM8 A;  4CT4 A;  5JHN A;  3VLE A;  4J6I A;  5CMW A;  2WXK A;  3CKB A;  3I4R B;  4LER A;  4WWN A;  2UWJ G;  2JV0 A;  3CK7 A;  4I6E A;  4GA0 A;  3MV2 B;  3PEU B;  2WQ6 A;  5G04 C;  3UQ3 A;  4WNF A;  3VTX A;  3B7S A;  4L1B A;  2E0I A;  3QC1 A;  3VV0 A;  3MX3 A;  2X3M A;  3TG5 A;  5C1D A;  4APF A;  4PH4 B;  5LSZ A;  1JUQ A;  3Q5M A;  3B7T A;  3GW4 A;  4V3I A;  4WND A;  4I2W A;  3IV0 A;  4LEU A;  5BPP A;  1FVH A;  2JEK A;  3HVE A;  4JPS A;  3FTV A;  3MJW A;  3T8M A;  4MI5 A;  4GMJ A;  2WXO A;  1PY1 A;  5KJL A;  3MCX A;  1EPU A;  2VSN A;  3HHM A;  4N3B A;  4WWO A;  1UJK A;  3ZYL A;  4BTB A;  3Q4A B;  2VGX A;  5A7D B;  4UWG A;  3OXG A;  4EBA A;  4AVX A;  1UN8 A;  2CG2 A;  3L08 A;  1JWF A;  3ZHE A;  3EP0 A;  4YND A;  3C98 A;  4ACK A;  3KEZ A;  4HOU A;  2LSV A;  3CVY A;  4NRH B;  4IJ8 A;  2I6H A;  3PE3 A;  2J08 A;  4GYY A;  4JDS A;  3RO2 A;  3FUK A;  3DB5 A;  2J09 A;  3DAL A;  3GYZ A;  4DJA A;  2WXM A;  2GW1 A;  5FQ4 A;  1H0A A;  3F9Y A;  1GW6 A;  2E2E A;  3LVQ E;  3O4Z A;  5FJY A;  4FMU A;  4B0Z A;  4DLO A;  5BV0 A;  4QEN A;  2WVI A;  2BTD A;  3TXM A;  2I1K A;  4TUU A;  2HYZ A;  2WXF A;  3FU3 A;  3KAE A;  4ABN A;  3MZL B;  4I1A A;  4ANU A;  2QFC A;  2YIN A;  4JA7 A;  3UUX A;  4GYW A;  3NZU A;  4GA1 A;  4GYO A;  4KZ0 A;  1HG5 A;  3KS2 A;  3LY8 A;  4I17 A;  3M53 A;  1HS6 A;  1OWM A;  3SBS A;  2PZI A;  3QJZ A;  4PS7 A;  4CRW A;  5AJL A;  5BT1 A;  5JJ7 A;  3LJ3 A;  2X6H A;  4FHJ A;  1X5B A;  5BNW A;  3S7B A;  4AY5 A;  3LKU A;  2VTB A;  4JZY A;  2AXV A;  1TEZ A;  2VSO E;  3MEK A;  2GRL A;  4M3O A;  4HOR A;  4YVQ C;  3QAR A;  5FTP A;  3FUI A;  4HVB A;  3KMJ A;  1OUV A;  2EQX A;  3QB2 A;  3CVQ A;  4FJZ A;  4BWR A;  3DBS A;  4FHK A;  3IKO B;  1MVX A;  4U04 A;  3IHV A;  4U0Z A;  3JYS A;  3RRM B;  1SQM A;  3LVR E;  2KCK A;  2X6F A;  4AIF A;  3Q15 A;  1SZ9 A;  4J0U A;  3CEQ A;  3CVL A;  1P5Q A;  3FTY A;  3TG4 A;  3M55 A;  3MKQ A;  1UN9 A;  4KBQ A;  2A4Z A;  3SI5 A;  2JLB A;  3FTS A;  4JC8 A;  2XCB A;  2MRI A;  2VSY A;  3CVP A;  2LSU A;  5F59 A;  3AS4 A;  4NAC A;  4UI9 C;  3I4G A;  4NVQ A;  5JIN A;  2FO7 A;  4J8D A;  3F9X A;  3LEW A;  4UWF A;  1E7U A;  4XI0 A;  3FH5 A;  4J8S A;  1HO8 A;  2DBA A;  2X6K A;  3FTW A;  4RVB A;  2VSX E;  3L54 A;  4H12 A;  3CK8 A;  4UI9 J;  1S0P A;  4WWP A;  3EHM A;  3PRZ A;  2WQ7 A;  2WB2 A;  3FUM A;  3OXF A;  2LNI A;  2FUL A;  4AY6 A;  4U07 A;  4Q94 A;  4GB9 A;  3CLJ A;  1N54 A;  3QDN A;  5D0Q D;  4EQF A;  1B89 A;  4F7A A;  4AV7 A;  3M57 A;  4CDM A;  1HZ4 A;  4UQY A;  3PRE A;  1XGW A;  4QEP A;  4F53 A;  4H7Y A;  3ESK A;  4RG9 A;  5ARF A;  5T0M A;  1E8Y A;  4J7I A;  4ILI A;  2GGF A;  1EDU A;  2PM6 A;  3KD7 A;  3MV3 B;  4RG6 A;  4CGV A;  5LFA A;  1ZBP A;  4MI0 A;  3SGH A;  2WXQ A;  5CCL A;  1H19 A;  5LCW J;  3D9P A;  5M72 A;  4Z4P A;  4LDG A;  4ANW A;  3RU0 A;  2G46 A;  5BW8 C;  5T8I A;  5AJD A;  2XEV A;  1NA3 A;  5FZQ A;  4AP2 A;  5JHA A;  3CHO A;  3LDZ A;  3EIJ A;  4JHJ A;  4U0S A;  2IJG X;  2XRY A;  5LCW C;  4GCO A;  2PQR A;  2CHZ A;  2AXZ A;  5ENN A;  3U3W A;  3Q47 B;  4FAD A;  4U63 A;  5JJ6 A;  4DLQ A;  4N39 A;  3N71 A;  4UQX A;  4C0E A;  1IQR A;  2WPV A;  3P1U A;  4ILG A;  3WXX A;  3IHX A;  4HXI A;  1HH8 A;  4F3V A;  4B89 A;  4ATG A;  4I6J A;  4GML A;  4J8O A;  2ION A;  1KT0 A;  4GZ3 A;  3S8P A;  1FCH A;  1Y8M A;  3ESL A;  3IBE A;  3R9A B;  2PQN A;  4OVV A;  3L13 A;  3LY7 A;  3CVU A;  4JHR A;  3AS8 A;  3CHS A;  3ZN3 A;  1O9S A;  4XKB A;  3CQC B;  2I1J A;  2R59 A;  3S7J A;  3RQ4 A;  2RG8 A;  3FTX A;  3FUH A;  4B94 A;  1W3B A;  1DVP A;  5JJT A;  5CHE E;  5G04 J;  2L0T B;  2YQ8 A;  1Y6I A;  4WAF A;  3OXL A;  1Z3Y A;  3APF A;  5HQ8 A;  4FUL A;  2XPZ A;  1PC2 A;  4XX5 A;  4XE0 A;  3U64 A;  1VDY A;  2CFZ A;  3MA5 A;  4GZC A;  3CIA A;  2F69 A;  3FUD A;  3FPD A;  2HO1 A;  5E76 A;  2V4L A;  3APD A;  3OTN A;  3L17 A;  3B7U X;  4D10 C;  1N3J A;  4EEC A;  3SD5 A;  4AM9 A;  3JCK C;  3MO0 A;  3OPE A;  4NJ5 A;  1NP7 A;  2LO6 A;  5FZR A;  1QNF A;  2KAT A;  5F6K C;  5JIY A;  2O8J A;  2WXJ A;  4YPA A;  2KZT B;  3BG0 B;  1OWN A;  4KVM A;  2Y3A A;  4CEM A;  3PNL B;  5KJM A;  3EIQ C;  3ML8 A;  3TAX A;  4J7F A;  3LYA A;  3FWV A;  4N3C A;  3EJN A;  3FFL A;  1E8W A;  2Y4T A;  4IUL A;  4ACL A;  3QWW A;  4YVO A;  5FZS A;  4EPZ A;  4Q69 A;  4ANX A;  3MO2 A;  1HE8 A;  2V8S E;  2GRM A;  2YHE A;  1QZ2 A;  4KT6 B;  4L2Y A;  1XNF A;  4B8A A;  5BV1 A;  2IOS A;  2IGQ A;  3GZS A;  4I1O B;  3JQ1 A;  5F6L A;  3P2B A;  2XPY A;  2LAH A;  1KT1 A;  1E8X A;  4Y6C A;  4E47 A;  4IYP A;  5T0K A;  3D9O A;  3D9M A;  4K03 A;  4G23 A;  1N6A A;  5TEG A;  4U8H A;  3CBP A;  1N6C A;  1TJC A;  2MOW A;  4HOQ A;  2Q7F A;  3ZYK A;  1SZA A;  3CR3 A;  3TL5 A;  4UQZ A;  2PM7 A;  2DCP A;  3L22 A;  4XKC A;  4GZ6 A;  2KC7 A;  2ILR A;  2WM9 A;  4E6H A;  2QPW A;  3M54 A;  3NF1 A;  1UW4 B;  3B7R L;  4FC8 A;  4MLP A;  4J83 A;  1ZKK A;  1E7V A;  3KMA A;  1A17 A;  1Z3X A;  3ZHE B;  4QFV A;  2L6J A;  5EDS A;  5FQ7 A;  2J4D A;  3HIZ A;  2DIW A;  3CHQ A;  5EX0 A;  2KM4 A;  3I3N A;  4L23 A;  3CVN A;  4U0U A;  4JHK A;  3FH7 A;  2XGS A;  3FUF A;  2FF4 A;  2X6J A;  4DI3 A;  3HVE B;  3L6A A;  4XI9 A;  3SBT B;  2XPI A;  3GZ2 A;  4HOS A;  2YNQ A;  3CVW A;  2J9Q A;  4XIF A;  2W5Z A;  4XZ4 A;  5G2N A;  3PNT B;  4AXH A;  3MKR A;  2OVF A;  2WXI A;  4Y6W A;  2UY1 A;  3CBO A;  3CVV A;  5T5G A;  5D0O D;  3EHN A;  3MGB A;  2CHW A;  1E8Z A;  4W9R A;  4BFR A;  3LXU X;  2WXP A;  3FH8 A;  3F9W A;  5G05 C;  3ZXS A;  2W5Y A;  4AEZ C;  1OWL A;  3ZYM A;  2AW6 A;  4BTA A;  4HLE A;  5EG2 A;  2WXR A;  3D9K A;  5AIJ A;  1FVF A;  2KCV A;  4UWK A;  3ZVV A;  4YPU A;  2XQ0 A;  3HYM B;  4AJW A;  4FP7 A;  4GA2 A;  4GPK A;  3IHY A;  5DIZ A;  3OAW A;  1EYH A;  3FU6 A;  3KMT A;  3FY4 A;  1YA0 A;  2FBN A;  4RZ0 A;  1OWO A;  2CHX A;  3LS8 A;  4K0R A;  3PS6 A;  4C0M A;  5A6C A;  1ELK A;  3ASF A;  1U3C A;  1ELW A;  4TV3 A;  1H6K A;  1BPO A;  3G2V A;  1WY6 A;  5ANR A;  3M58 A;  5AYF A;  3ZW3 A;  2WMO A;  2I2O A;  3CHP A;  4EZL A;  2MHK A;  2WXN A;  4FU3 A;  1HFA A;  4HS2 A;  2BUG A;  4DI4 A;  3K5K A;  3TGO A;  5C2Y A;  2XRZ A;  1MUF A;  1INZ A;  3CSF A;  3TJP A;  3RKV A;  2C2L A;  2OVB A;  2BF0 X;  1WM5 A;  1L5J A;  2OOE A;  4G26 A;  2QY7 A;  5KJK A;  5F5E A;  3LY9 A;  3D9J A;  3FP3 A;  2ZU6 B;  3SWC A;  3SZ7 A;  3D9N A;  3ZFW A;  4YNM A;  3SW9 A;  3CST A;  5E75 A;  4JA9 A;  4HFG A;  2PL2 A;  4EZJ A;  2XGO A;  4YNP A;  3MYV A;  3L16 A;  4BX9 A;  3CV0 A;  2L0I A;  5LSX A;  4JL0 A;  2WMN A;  3RJV A;  3PH0 C;  4KXK B;  3NQP A;  4PUC A;  1HF8 A;  4A1S A;  3ZIM A;  5LP0 A;  3CBM A;  1H3I A;  4JLG A;  4L2L A;  5LOZ A;  3R7Q A;  3OS5 A;  5TTF A;  2C0L A;  5FQ8 A;  2KCL A;  2OV8 A;  3G2T A;  4CDN A;  2NC9 A;  4I43 A;  3ZGQ A;  3URZ A;  2VYI A;  3FUE A;  4KVO A;  4UWL A;  4G25 A;  2J49 A;  3PDN A;  1XQH A;  5ARG A;  4A3V A;  4BT8 A;  1H2T C;  4AU7 A;  4JXT A;  4J8F A;  1E96 B;  4BT9 A;  5J90 A;  3ASH A;  3ASG A;  3K9I A;  4JEH A;  3UX4 A;  3FHE A;  5AYW D;  2V5F A;  3UPV A;  1MQS A;  2XCC A;  3QAQ A;  4MRU A;  2KZT A;  2HR2 A;  5T3R A;  3AS5 A;  5JJ0 A;  1OWP A;  3DPD A;  1HU3 A;  3EDT B;  3FUN A;  3S7D A;  3G2W A;  2LAI A;  3SFZ A;  4WNE A;  3CK9 A;  3FUL A;  2FEZ A;  3QWP A;  5A23 A;  3D9I A;  4IRU A;  2IQC A;  4N5C A;  2I9C A;  4YPE A;  5CCM A;  1IHG A;  1ZU2 A;  4GZ5 A;  1ELR A;  4FLH A;  3UT7 A;  3VLD A;  3VUZ A;  3U4T A;  3ZEF A;  2CFU A;  3PZD A;  3PVL A;  5KJN A;  3BO5 A;  5T4Y A;  3ZPJ A;  4N2S A;  3MKQ B;  3FEY A;  3U66 A;  4H7X A;  4HOT A;  4IJD A;  2WXG A;  4KYO B;  4NUR A;  4PS3 A;  5EKQ D;  3RO3 A;  2YHC A;  3ONK A;  4B8C B;  2UY1 B;  3T5X A;  1N52 A;  2NSZ A;  2V0P A;  5DBK A;  5CPR B;  3CKC A;  3M59 A;  4FLB A;  4DK5 A;  1Z6T A;  3FUJ A;  4JVS A;  4MKT A;  4N3A A;  3LPZ A;  4CCA A;  4CDR A;  3APC A;  3D9L A;  1H2V C;  3E4B A;  4APO A;  3G2S A;  5BUZ A;  4C9B B;  5AEN A;  1EF1 C;  3LCA A;  4G11 A;  5FT9 A;  1IYG A;  3UT8 A;  4ILH B;  3S2A A;  2VTB B;  4MS6 A;  3IEG A;  3NZS A;  1JPL A;  1ML9 A;  4A1G A;  2R17 C;  3JQ0 A;  4WUY A;  2A5U A;  2WXL A;  3HNA A;  4TRQ A;  3T5V A;  4URK A;  5LX8 A;  4QEO A;  2R3A A;  3FDH A;  4ANV A;  3ZRH A;  5CMY A;  4NQ0 A;  4PS8 A;  2J07 A;  4A3T A;  4IN3 B;  3CGH A;  1MT6 A;  1HG2 A;  1QQE A;  1TJF A;  4I9E A;  3I5P A;  3QK0 A;  4I51 A;  3Q49 B;  4CT0 A;  3MO5 A;  4AOF A;  1IQU A;  4BY6 A;  3UMV A;  2X6I A;  3OOI A;  4EZK A;  3JUI A;  5KCM A;  4CGW A;  2IOL A;  2Y4U A;  3TXN A;  2VGY A;  3HDX A;  3ONL A;  3FTU A;  2VJ8 A;  3RRU A;  2J4B A;  4P29 A;  1PAQ A;  4KMO A;  5G55 A;  1UG3 A;  4I6G A;  4F1S A;  3ML9 A;  2FI7 A;  3ASD A;  3PUJ A;  2VGX B;  4I9C A;  3FTZ A;  4E85 A;  3M56 A;  2OND A;  4FA6 A;  2AWI A;  1MVH A;  4N2Q A;  3AU5 A;  4JW1 A;  3CVX A;  4OVU A;  3QKY A;  1MHQ A;  4GCN A;  1WAO 1;  2AVP A;  3SF4 A;  3RK6 A;  3AU4 A;  4DPR A;  3S7F A;  2RFI A;  3BEE A;  2WXH A;  4C1Q A;  1UJJ A;  1U3D A;  2WQH A;  3CHM A;  3CHR A;  3GZ1 A;  2CG3 A;  4GZD A;  5HI7 A;  4G1T A;  4KZC A;  2XGM A;  4GAA A;  4EBA G;  3QWV A;  3PE4 A;  3ZYQ A;  1E90 A;  1NZN A;  4LRZ A;  5FQ6 A;  1HXI A;  4JEU A;  3U9W A;  4WNG A;  5ANL A;  2VQ2 A;  4BUP A;  2L9B A;  3SNX A;  3CQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...