2G46A

Structure of vset in complex with mek27 h3 pept. and cofactor product sah
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PBCV-1 histone H3-Lys 27 methyltransferase
publication title Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
total genus 9
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2g46A01
4IJDA 5TTFA 5TH7A 4NJ5A 3RQ4A 3RU0A 4J7IA 3S7FA 3RAYA 4J8OA 3RIBA 4O30A 3OPEA 3MEKA 5JIYA 3OXLA 4E47A 5AYFA 3TG5A 2W5YA 5CCMA 2QPWA 5F59A 4O6FA 3RJWA 4JLGA 3FPDA 5JINA 3MO2A 3F9XA 4NVQA 5F6LA 4QENA 3SW9A 4C1QA 3IHXA 3HNAA 4YPUA 3M58A 3MO5A 4H12A 4YNDA 3S8PA 1MT6A 4QEPA 3OOIA 4J7FA 3K5KA 2F69A 5CCLA 4YNMA 3M55A 1N3JA 2W5ZA 3EP0A 5EG2A 2IGQA 5TEGA 1N6AA 3TG4A 4RZ0A 4YNPA 5EX0A 1MVHA 1H3IA 3VUZA 2G46A 4J83A 4QEOA 4I51A 3S7JA 5LSXA 5EX3A 4JDSA 5HI7A 3N71A 3OXFA 2JV0A 3BO5A 3S7BA 3S7DA 2R3AA 5CPRB 3M5AA 5JJ0A 5ARGA 3F9WA 3M54A 5KJLA 3PDNA 1PEGA 3DALA 3CBMA 4YPAA 5JHNA 3OS5A 1O9SA 2O8JA 4WUYA 5F5EA 4BUPA 1N6CA 4Z4PA 4LDGA 3QWVA 5T0KA 3SWCA 1ZKKA 3QWWA 1MUFA 3KMJA 5HQ8A 5T0MA 3MO0A 3VV0A 5KJKA 4MI0A 1ML9A 3KMAA 5F6KC 3OXGA 4AU7A 2BQZA 4FMUA 3KMTA 4MI5A 5KJNA 3CBOA 3M56A 4YPEA 5ARFA 3F9YA 5T5GA 4IJ8A 3M53A 1XQHA 3F9ZA 5KJMA 3QWPA 1MVXA 3M57A 3CBPA 2RFIA 5LSZA 3M59A 3DB5A
chains in the Genus database with same CATH superfamily
4IJDA 5TTFA 5TH7A 4NJ5A 3RQ4A 3RU0A 4J7IA 3S7FA 3RAYA 4J8OA 3RIBA 4O30A 3OPEA 3MEKA 5JIYA 3OXLA 4E47A 5AYFA 3TG5A 2W5YA 5CCMA 2QPWA 5F59A 4O6FA 3RJWA 4JLGA 3FPDA 5JINA 3MO2A 3F9XA 4NVQA 5F6LA 4QENA 3SW9A 4C1QA 3IHXA 3HNAA 4YPUA 3M58A 3MO5A 4H12A 4YNDA 3S8PA 1MT6A 4QEPA 3OOIA 4J7FA 3K5KA 2F69A 5CCLA 4YNMA 3M55A 1N3JA 2W5ZA 3EP0A 5EG2A 2IGQA 5TEGA 1N6AA 3TG4A 4RZ0A 4YNPA 5EX0A 1MVHA 1H3IA 3VUZA 2G46A 4J83A 4QEOA 4I51A 3S7JA 5LSXA 5EX3A 4JDSA 5HI7A 3N71A 3OXFA 2JV0A 3BO5A 3S7BA 3S7DA 2R3AA 5CPRB 3M5AA 5JJ0A 5ARGA 3F9WA 3M54A 5KJLA 3PDNA 1PEGA 3DALA 3CBMA 4YPAA 5JHNA 3OS5A 1O9SA 2O8JA 4WUYA 5F5EA 4BUPA 1N6CA 4Z4PA 4LDGA 3QWVA 5T0KA 3SWCA 1ZKKA 3QWWA 1MUFA 3KMJA 5HQ8A 5T0MA 3MO0A 3VV0A 5KJKA 4MI0A 1ML9A 3KMAA 5F6KC 3OXGA 4AU7A 2BQZA 4FMUA 3KMTA 4MI5A 5KJNA 3CBOA 3M56A 4YPEA 5ARFA 3F9YA 5T5GA 4IJ8A 3M53A 1XQHA 3F9ZA 5KJMA 3QWPA 1MVXA 3M57A 3CBPA 2RFIA 5LSZA 3M59A 3DB5A
chains in the Genus database with same CATH topology
4IJDA 5TTFA 5TH7A 4NJ5A 3RQ4A 3RU0A 4J7IA 3S7FA 3RAYA 4J8OA 3RIBA 4O30A 3OPEA 3MEKA 5JIYA 3OXLA 4E47A 5AYFA 3TG5A 2W5YA 5CCMA 2QPWA 5F59A 4O6FA 3RJWA 4JLGA 3FPDA 5JINA 3MO2A 3F9XA 4NVQA 5F6LA 4QENA 3SW9A 4C1QA 3IHXA 3HNAA 4YPUA 3M58A 3MO5A 4H12A 4YNDA 3S8PA 1MT6A 4QEPA 3OOIA 4J7FA 3K5KA 2F69A 5CCLA 4YNMA 3M55A 1N3JA 2W5ZA 3EP0A 5EG2A 2IGQA 5TEGA 1N6AA 3TG4A 4RZ0A 4YNPA 5EX0A 1MVHA 1H3IA 3VUZA 2G46A 4J83A 4QEOA 4I51A 3S7JA 5LSXA 5EX3A 4JDSA 5HI7A 3N71A 3OXFA 2JV0A 3BO5A 3S7BA 3S7DA 2R3AA 5CPRB 3M5AA 5JJ0A 5ARGA 3F9WA 3M54A 5KJLA 3PDNA 1PEGA 3DALA 3CBMA 4YPAA 5JHNA 3OS5A 1O9SA 2O8JA 4WUYA 5F5EA 4BUPA 1N6CA 4Z4PA 4LDGA 3QWVA 5T0KA 3SWCA 1ZKKA 3QWWA 1MUFA 3KMJA 5HQ8A 5T0MA 3MO0A 3VV0A 5KJKA 4MI0A 1ML9A 3KMAA 5F6KC 3OXGA 4AU7A 2BQZA 4FMUA 3KMTA 4MI5A 5KJNA 3CBOA 3M56A 4YPEA 5ARFA 3F9YA 5T5GA 4IJ8A 3M53A 1XQHA 3F9ZA 5KJMA 3QWPA 1MVXA 3M57A 3CBPA 2RFIA 5LSZA 3M59A 3DB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  5TTF A;  5TH7 A;  4NJ5 A;  3RQ4 A;  3RU0 A;  4J7I A;  3S7F A;  3RAY A;  4J8O A;  3RIB A;  4O30 A;  3OPE A;  3MEK A;  5JIY A;  3OXL A;  4E47 A;  5AYF A;  3TG5 A;  2W5Y A;  5CCM A;  2QPW A;  5F59 A;  4O6F A;  3RJW A;  4JLG A;  3FPD A;  5JIN A;  3MO2 A;  3F9X A;  4NVQ A;  5F6L A;  4QEN A;  3SW9 A;  4C1Q A;  3IHX A;  3HNA A;  4YPU A;  3M58 A;  3MO5 A;  4H12 A;  4YND A;  3S8P A;  1MT6 A;  4QEP A;  3OOI A;  4J7F A;  3K5K A;  2F69 A;  5CCL A;  4YNM A;  3M55 A;  1N3J A;  2W5Z A;  3EP0 A;  5EG2 A;  2IGQ A;  5TEG A;  1N6A A;  3TG4 A;  4RZ0 A;  4YNP A;  5EX0 A;  1MVH A;  1H3I A;  3VUZ A;  2G46 A;  4J83 A;  4QEO A;  4I51 A;  3S7J A;  5LSX A;  5EX3 A;  4JDS A;  5HI7 A;  3N71 A;  3OXF A;  2JV0 A;  3BO5 A;  3S7B A;  3S7D A;  2R3A A;  5CPR B;  3M5A A;  5JJ0 A;  5ARG A;  3F9W A;  3M54 A;  5KJL A;  3PDN A;  1PEG A;  3DAL A;  3CBM A;  4YPA A;  5JHN A;  3OS5 A;  1O9S A;  2O8J A;  4WUY A;  5F5E A;  4BUP A;  1N6C A;  4Z4P A;  4LDG A;  3QWV A;  5T0K A;  3SWC A;  1ZKK A;  3QWW A;  1MUF A;  3KMJ A;  5HQ8 A;  5T0M A;  3MO0 A;  3VV0 A;  5KJK A;  4MI0 A;  1ML9 A;  3KMA A;  5F6K C;  3OXG A;  4AU7 A;  2BQZ A;  4FMU A;  3KMT A;  4MI5 A;  5KJN A;  3CBO A;  3M56 A;  4YPE A;  5ARF A;  3F9Y A;  5T5G A;  4IJ8 A;  3M53 A;  1XQH A;  3F9Z A;  5KJM A;  3QWP A;  1MVX A;  3M57 A;  3CBP A;  2RFI A;  5LSZ A;  3M59 A;  3DB5 A; 
#chains in the Genus database with same CATH topology
 4IJD A;  5TTF A;  5TH7 A;  4NJ5 A;  3RQ4 A;  3RU0 A;  4J7I A;  3S7F A;  3RAY A;  4J8O A;  3RIB A;  4O30 A;  3OPE A;  3MEK A;  5JIY A;  3OXL A;  4E47 A;  5AYF A;  3TG5 A;  2W5Y A;  5CCM A;  2QPW A;  5F59 A;  4O6F A;  3RJW A;  4JLG A;  3FPD A;  5JIN A;  3MO2 A;  3F9X A;  4NVQ A;  5F6L A;  4QEN A;  3SW9 A;  4C1Q A;  3IHX A;  3HNA A;  4YPU A;  3M58 A;  3MO5 A;  4H12 A;  4YND A;  3S8P A;  1MT6 A;  4QEP A;  3OOI A;  4J7F A;  3K5K A;  2F69 A;  5CCL A;  4YNM A;  3M55 A;  1N3J A;  2W5Z A;  3EP0 A;  5EG2 A;  2IGQ A;  5TEG A;  1N6A A;  3TG4 A;  4RZ0 A;  4YNP A;  5EX0 A;  1MVH A;  1H3I A;  3VUZ A;  2G46 A;  4J83 A;  4QEO A;  4I51 A;  3S7J A;  5LSX A;  5EX3 A;  4JDS A;  5HI7 A;  3N71 A;  3OXF A;  2JV0 A;  3BO5 A;  3S7B A;  3S7D A;  2R3A A;  5CPR B;  3M5A A;  5JJ0 A;  5ARG A;  3F9W A;  3M54 A;  5KJL A;  3PDN A;  1PEG A;  3DAL A;  3CBM A;  4YPA A;  5JHN A;  3OS5 A;  1O9S A;  2O8J A;  4WUY A;  5F5E A;  4BUP A;  1N6C A;  4Z4P A;  4LDG A;  3QWV A;  5T0K A;  3SWC A;  1ZKK A;  3QWW A;  1MUF A;  3KMJ A;  5HQ8 A;  5T0M A;  3MO0 A;  3VV0 A;  5KJK A;  4MI0 A;  1ML9 A;  3KMA A;  5F6K C;  3OXG A;  4AU7 A;  2BQZ A;  4FMU A;  3KMT A;  4MI5 A;  5KJN A;  3CBO A;  3M56 A;  4YPE A;  5ARF A;  3F9Y A;  5T5G A;  4IJ8 A;  3M53 A;  1XQH A;  3F9Z A;  5KJM A;  3QWP A;  1MVX A;  3M57 A;  3CBP A;  2RFI A;  5LSZ A;  3M59 A;  3DB5 A; 
#chains in the Genus database with same CATH homology
 4IJD A;  5TTF A;  5TH7 A;  4NJ5 A;  3RQ4 A;  3RU0 A;  4J7I A;  3S7F A;  3RAY A;  4J8O A;  3RIB A;  4O30 A;  3OPE A;  3MEK A;  5JIY A;  3OXL A;  4E47 A;  5AYF A;  3TG5 A;  2W5Y A;  5CCM A;  2QPW A;  5F59 A;  4O6F A;  3RJW A;  4JLG A;  3FPD A;  5JIN A;  3MO2 A;  3F9X A;  4NVQ A;  5F6L A;  4QEN A;  3SW9 A;  4C1Q A;  3IHX A;  3HNA A;  4YPU A;  3M58 A;  3MO5 A;  4H12 A;  4YND A;  3S8P A;  1MT6 A;  4QEP A;  3OOI A;  4J7F A;  3K5K A;  2F69 A;  5CCL A;  4YNM A;  3M55 A;  1N3J A;  2W5Z A;  3EP0 A;  5EG2 A;  2IGQ A;  5TEG A;  1N6A A;  3TG4 A;  4RZ0 A;  4YNP A;  5EX0 A;  1MVH A;  1H3I A;  3VUZ A;  2G46 A;  4J83 A;  4QEO A;  4I51 A;  3S7J A;  5LSX A;  5EX3 A;  4JDS A;  5HI7 A;  3N71 A;  3OXF A;  2JV0 A;  3BO5 A;  3S7B A;  3S7D A;  2R3A A;  5CPR B;  3M5A A;  5JJ0 A;  5ARG A;  3F9W A;  3M54 A;  5KJL A;  3PDN A;  1PEG A;  3DAL A;  3CBM A;  4YPA A;  5JHN A;  3OS5 A;  1O9S A;  2O8J A;  4WUY A;  5F5E A;  4BUP A;  1N6C A;  4Z4P A;  4LDG A;  3QWV A;  5T0K A;  3SWC A;  1ZKK A;  3QWW A;  1MUF A;  3KMJ A;  5HQ8 A;  5T0M A;  3MO0 A;  3VV0 A;  5KJK A;  4MI0 A;  1ML9 A;  3KMA A;  5F6K C;  3OXG A;  4AU7 A;  2BQZ A;  4FMU A;  3KMT A;  4MI5 A;  5KJN A;  3CBO A;  3M56 A;  4YPE A;  5ARF A;  3F9Y A;  5T5G A;  4IJ8 A;  3M53 A;  1XQH A;  3F9Z A;  5KJM A;  3QWP A;  1MVX A;  3M57 A;  3CBP A;  2RFI A;  5LSZ A;  3M59 A;  3DB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...