2G46A

Structure of vset in complex with mek27 h3 pept. and cofactor product sah
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PBCV-1 histone H3-Lys 27 methyltransferase
publication title Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 9
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2g46A01
1N6CA 5CCMA 3MO2A 1MVHA 1O9SA 2IGQA 3F9XA 4FMUA 3RAYA 3RU0A 5CPRB 3RIBA 5F6KC 4AU7A 4QEOA 3SWCA 4NJ5A 3QWWA 3OXFA 3VUZA 1N3JA 3CBPA 5JHNA 4J7FA 3KMJA 5TEGA 2F69A 5T0MA 5KJNA 4RZ0A 3OXLA 4J7IA 5HQ8A 4MI0A 3S7JA 4YPAA 3CBMA 3M53A 4NVQA 3IHXA 5F5EA 4BUPA 4QENA 5T0KA 4O6FA 5KJMA 3K5KA 3F9YA 3TG4A 1PEGA 3M5AA 5EX3A 2QPWA 4IJ8A 5LSZA 4E47A 4MI5A 3EP0A 3QWVA 4JDSA 3TG5A 3MO0A 3RQ4A 3PDNA 3S8PA 4J8OA 5JJ0A 2JV0A 3M57A 4H12A 4J83A 2W5ZA 4YNMA 1XQHA 3MO5A 1ML9A 2W5YA 3VV0A 1MT6A 3F9WA 3DALA 3HNAA 3QWPA 1N6AA 2O8JA 3MEKA 3OS5A 1MUFA 5AYFA 5F6LA 3M54A 4QEPA 4IJDA 3FPDA 1MVXA 5ARGA 3SW9A 5KJKA 5EX0A 5TH7A 4YNDA 5EG2A 3OXGA 4I51A 4O30A 3OOIA 4YPEA 3CBOA 3M55A 3KMTA 3S7FA 4WUYA 4YNPA 1H3IA 2RFIA 5LSXA 2R3AA 4C1QA 5JIYA 3KMAA 5T5GA 3F9ZA 3M56A 1ZKKA 3M59A 3S7BA 4JLGA 3BO5A 3N71A 4YPUA 4Z4PA 3S7DA 5ARFA 5TTFA 2G46A 5F59A 3M58A 3DB5A 3OPEA 2BQZA 3RJWA 5KJLA 4LDGA 5HI7A 5CCLA 5JINA
chains in the Genus database with same CATH superfamily
1N6CA 5CCMA 3MO2A 1MVHA 1O9SA 2IGQA 3F9XA 4FMUA 3RAYA 3RU0A 5CPRB 3RIBA 5F6KC 4AU7A 4QEOA 3SWCA 4NJ5A 3QWWA 3OXFA 3VUZA 1N3JA 3CBPA 5JHNA 4J7FA 3KMJA 5TEGA 2F69A 5T0MA 5KJNA 4RZ0A 3OXLA 4J7IA 5HQ8A 4MI0A 3S7JA 4YPAA 3CBMA 3M53A 4NVQA 3IHXA 5F5EA 4BUPA 4QENA 5T0KA 4O6FA 5KJMA 3K5KA 3F9YA 3TG4A 1PEGA 3M5AA 5EX3A 2QPWA 4IJ8A 5LSZA 4E47A 4MI5A 3EP0A 3QWVA 4JDSA 3TG5A 3MO0A 3RQ4A 3PDNA 3S8PA 4J8OA 5JJ0A 2JV0A 3M57A 4H12A 4J83A 2W5ZA 4YNMA 1XQHA 3MO5A 1ML9A 2W5YA 3VV0A 1MT6A 3F9WA 3DALA 3HNAA 3QWPA 1N6AA 2O8JA 3MEKA 3OS5A 1MUFA 5AYFA 5F6LA 3M54A 4QEPA 4IJDA 3FPDA 1MVXA 5ARGA 3SW9A 5KJKA 5EX0A 5TH7A 4YNDA 5EG2A 3OXGA 4I51A 4O30A 3OOIA 4YPEA 3CBOA 3M55A 3KMTA 3S7FA 4WUYA 4YNPA 1H3IA 2RFIA 5LSXA 2R3AA 4C1QA 5JIYA 3KMAA 5T5GA 3F9ZA 3M56A 1ZKKA 3M59A 3S7BA 4JLGA 3BO5A 3N71A 4YPUA 4Z4PA 3S7DA 5ARFA 5TTFA 2G46A 5F59A 3M58A 3DB5A 3OPEA 2BQZA 3RJWA 5KJLA 4LDGA 5HI7A 5CCLA 5JINA
chains in the Genus database with same CATH topology
1N6CA 5CCMA 3MO2A 1MVHA 1O9SA 2IGQA 3F9XA 4FMUA 3RAYA 3RU0A 5CPRB 3RIBA 5F6KC 4AU7A 4QEOA 3SWCA 4NJ5A 3QWWA 3OXFA 3VUZA 1N3JA 3CBPA 5JHNA 4J7FA 3KMJA 5TEGA 2F69A 5T0MA 5KJNA 4RZ0A 3OXLA 4J7IA 5HQ8A 4MI0A 3S7JA 4YPAA 3CBMA 3M53A 4NVQA 3IHXA 5F5EA 4BUPA 4QENA 5T0KA 4O6FA 5KJMA 3K5KA 3F9YA 3TG4A 1PEGA 3M5AA 5EX3A 2QPWA 4IJ8A 5LSZA 4E47A 4MI5A 3EP0A 3QWVA 4JDSA 3TG5A 3MO0A 3RQ4A 3PDNA 3S8PA 4J8OA 5JJ0A 2JV0A 3M57A 4H12A 4J83A 2W5ZA 4YNMA 1XQHA 3MO5A 1ML9A 2W5YA 3VV0A 1MT6A 3F9WA 3DALA 3HNAA 3QWPA 1N6AA 2O8JA 3MEKA 3OS5A 1MUFA 5AYFA 5F6LA 3M54A 4QEPA 4IJDA 3FPDA 1MVXA 5ARGA 3SW9A 5KJKA 5EX0A 5TH7A 4YNDA 5EG2A 3OXGA 4I51A 4O30A 3OOIA 4YPEA 3CBOA 3M55A 3KMTA 3S7FA 4WUYA 4YNPA 1H3IA 2RFIA 5LSXA 2R3AA 4C1QA 5JIYA 3KMAA 5T5GA 3F9ZA 3M56A 1ZKKA 3M59A 3S7BA 4JLGA 3BO5A 3N71A 4YPUA 4Z4PA 3S7DA 5ARFA 5TTFA 2G46A 5F59A 3M58A 3DB5A 3OPEA 2BQZA 3RJWA 5KJLA 4LDGA 5HI7A 5CCLA 5JINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6C A;  5CCM A;  3MO2 A;  1MVH A;  1O9S A;  2IGQ A;  3F9X A;  4FMU A;  3RAY A;  3RU0 A;  5CPR B;  3RIB A;  5F6K C;  4AU7 A;  4QEO A;  3SWC A;  4NJ5 A;  3QWW A;  3OXF A;  3VUZ A;  1N3J A;  3CBP A;  5JHN A;  4J7F A;  3KMJ A;  5TEG A;  2F69 A;  5T0M A;  5KJN A;  4RZ0 A;  3OXL A;  4J7I A;  5HQ8 A;  4MI0 A;  3S7J A;  4YPA A;  3CBM A;  3M53 A;  4NVQ A;  3IHX A;  5F5E A;  4BUP A;  4QEN A;  5T0K A;  4O6F A;  5KJM A;  3K5K A;  3F9Y A;  3TG4 A;  1PEG A;  3M5A A;  5EX3 A;  2QPW A;  4IJ8 A;  5LSZ A;  4E47 A;  4MI5 A;  3EP0 A;  3QWV A;  4JDS A;  3TG5 A;  3MO0 A;  3RQ4 A;  3PDN A;  3S8P A;  4J8O A;  5JJ0 A;  2JV0 A;  3M57 A;  4H12 A;  4J83 A;  2W5Z A;  4YNM A;  1XQH A;  3MO5 A;  1ML9 A;  2W5Y A;  3VV0 A;  1MT6 A;  3F9W A;  3DAL A;  3HNA A;  3QWP A;  1N6A A;  2O8J A;  3MEK A;  3OS5 A;  1MUF A;  5AYF A;  5F6L A;  3M54 A;  4QEP A;  4IJD A;  3FPD A;  1MVX A;  5ARG A;  3SW9 A;  5KJK A;  5EX0 A;  5TH7 A;  4YND A;  5EG2 A;  3OXG A;  4I51 A;  4O30 A;  3OOI A;  4YPE A;  3CBO A;  3M55 A;  3KMT A;  3S7F A;  4WUY A;  4YNP A;  1H3I A;  2RFI A;  5LSX A;  2R3A A;  4C1Q A;  5JIY A;  3KMA A;  5T5G A;  3F9Z A;  3M56 A;  1ZKK A;  3M59 A;  3S7B A;  4JLG A;  3BO5 A;  3N71 A;  4YPU A;  4Z4P A;  3S7D A;  5ARF A;  5TTF A;  2G46 A;  5F59 A;  3M58 A;  3DB5 A;  3OPE A;  2BQZ A;  3RJW A;  5KJL A;  4LDG A;  5HI7 A;  5CCL A;  5JIN A; 
#chains in the Genus database with same CATH topology
 1N6C A;  5CCM A;  3MO2 A;  1MVH A;  1O9S A;  2IGQ A;  3F9X A;  4FMU A;  3RAY A;  3RU0 A;  5CPR B;  3RIB A;  5F6K C;  4AU7 A;  4QEO A;  3SWC A;  4NJ5 A;  3QWW A;  3OXF A;  3VUZ A;  1N3J A;  3CBP A;  5JHN A;  4J7F A;  3KMJ A;  5TEG A;  2F69 A;  5T0M A;  5KJN A;  4RZ0 A;  3OXL A;  4J7I A;  5HQ8 A;  4MI0 A;  3S7J A;  4YPA A;  3CBM A;  3M53 A;  4NVQ A;  3IHX A;  5F5E A;  4BUP A;  4QEN A;  5T0K A;  4O6F A;  5KJM A;  3K5K A;  3F9Y A;  3TG4 A;  1PEG A;  3M5A A;  5EX3 A;  2QPW A;  4IJ8 A;  5LSZ A;  4E47 A;  4MI5 A;  3EP0 A;  3QWV A;  4JDS A;  3TG5 A;  3MO0 A;  3RQ4 A;  3PDN A;  3S8P A;  4J8O A;  5JJ0 A;  2JV0 A;  3M57 A;  4H12 A;  4J83 A;  2W5Z A;  4YNM A;  1XQH A;  3MO5 A;  1ML9 A;  2W5Y A;  3VV0 A;  1MT6 A;  3F9W A;  3DAL A;  3HNA A;  3QWP A;  1N6A A;  2O8J A;  3MEK A;  3OS5 A;  1MUF A;  5AYF A;  5F6L A;  3M54 A;  4QEP A;  4IJD A;  3FPD A;  1MVX A;  5ARG A;  3SW9 A;  5KJK A;  5EX0 A;  5TH7 A;  4YND A;  5EG2 A;  3OXG A;  4I51 A;  4O30 A;  3OOI A;  4YPE A;  3CBO A;  3M55 A;  3KMT A;  3S7F A;  4WUY A;  4YNP A;  1H3I A;  2RFI A;  5LSX A;  2R3A A;  4C1Q A;  5JIY A;  3KMA A;  5T5G A;  3F9Z A;  3M56 A;  1ZKK A;  3M59 A;  3S7B A;  4JLG A;  3BO5 A;  3N71 A;  4YPU A;  4Z4P A;  3S7D A;  5ARF A;  5TTF A;  2G46 A;  5F59 A;  3M58 A;  3DB5 A;  3OPE A;  2BQZ A;  3RJW A;  5KJL A;  4LDG A;  5HI7 A;  5CCL A;  5JIN A; 
#chains in the Genus database with same CATH homology
 1N6C A;  5CCM A;  3MO2 A;  1MVH A;  1O9S A;  2IGQ A;  3F9X A;  4FMU A;  3RAY A;  3RU0 A;  5CPR B;  3RIB A;  5F6K C;  4AU7 A;  4QEO A;  3SWC A;  4NJ5 A;  3QWW A;  3OXF A;  3VUZ A;  1N3J A;  3CBP A;  5JHN A;  4J7F A;  3KMJ A;  5TEG A;  2F69 A;  5T0M A;  5KJN A;  4RZ0 A;  3OXL A;  4J7I A;  5HQ8 A;  4MI0 A;  3S7J A;  4YPA A;  3CBM A;  3M53 A;  4NVQ A;  3IHX A;  5F5E A;  4BUP A;  4QEN A;  5T0K A;  4O6F A;  5KJM A;  3K5K A;  3F9Y A;  3TG4 A;  1PEG A;  3M5A A;  5EX3 A;  2QPW A;  4IJ8 A;  5LSZ A;  4E47 A;  4MI5 A;  3EP0 A;  3QWV A;  4JDS A;  3TG5 A;  3MO0 A;  3RQ4 A;  3PDN A;  3S8P A;  4J8O A;  5JJ0 A;  2JV0 A;  3M57 A;  4H12 A;  4J83 A;  2W5Z A;  4YNM A;  1XQH A;  3MO5 A;  1ML9 A;  2W5Y A;  3VV0 A;  1MT6 A;  3F9W A;  3DAL A;  3HNA A;  3QWP A;  1N6A A;  2O8J A;  3MEK A;  3OS5 A;  1MUF A;  5AYF A;  5F6L A;  3M54 A;  4QEP A;  4IJD A;  3FPD A;  1MVX A;  5ARG A;  3SW9 A;  5KJK A;  5EX0 A;  5TH7 A;  4YND A;  5EG2 A;  3OXG A;  4I51 A;  4O30 A;  3OOI A;  4YPE A;  3CBO A;  3M55 A;  3KMT A;  3S7F A;  4WUY A;  4YNP A;  1H3I A;  2RFI A;  5LSX A;  2R3A A;  4C1Q A;  5JIY A;  3KMA A;  5T5G A;  3F9Z A;  3M56 A;  1ZKK A;  3M59 A;  3S7B A;  4JLG A;  3BO5 A;  3N71 A;  4YPU A;  4Z4P A;  3S7D A;  5ARF A;  5TTF A;  2G46 A;  5F59 A;  3M58 A;  3DB5 A;  3OPE A;  2BQZ A;  3RJW A;  5KJL A;  4LDG A;  5HI7 A;  5CCL A;  5JIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...