2G46A

Structure of vset in complex with mek27 h3 pept. and cofactor product sah
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
molecule keywords PBCV-1 histone H3-Lys 27 methyltransferase
total genus 9
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2g46A01
5JHNA 3RIBA 2RFIA 5CCLA 5CPRB 4JDSA 3M54A 4QENA 5KJNA 3CBOA 5F5EA 3F9WA 1MUFA 5T0KA 3S7DA 3KMTA 5EX3A 1XQHA 1ZKKA 2IGQA 4E47A 5HQ8A 3F9ZA 3S7JA 3OXFA 3QWVA 3VUZA 4QEOA 4YNMA 3OXGA 3M56A 3M59A 3CBPA 1O9SA 3M5AA 4LDGA 5F6LA 3DB5A 3SWCA 2W5ZA 3PDNA 4J83A 3RJWA 3OS5A 5T5GA 4I51A 3OPEA 5JINA 4IJ8A 2BQZA 4IJDA 4NJ5A 5LSZA 3IHXA 5CCMA 2F69A 4H12A 2W5YA 4MI5A 3DALA 4MI0A 5HI7A 3OOIA 3EP0A 5AYFA 3F9XA 4O6FA 1N6CA 4YPEA 5JJ0A 4JLGA 3MO5A 4YNPA 4YPAA 5ARGA 5KJMA 1MVXA 3N71A 4NVQA 3VV0A 4O30A 3MEKA 4C1QA 4WUYA 1PEGA 4Z4PA 3MO2A 3F9YA 4J7IA 5EG2A 5JIYA 5F59A 3SW9A 2O8JA 4J8OA 4AU7A 3HNAA 5F6KC 3S7BA 4YNDA 3RQ4A 2JV0A 1H3IA 4QEPA 1MVHA 3BO5A 5EX0A 1N6AA 3M58A 5KJLA 5ARFA 1ML9A 3S7FA 2QPWA 5TEGA 3QWPA 5KJKA 3KMAA 3RAYA 4RZ0A 3TG4A 3KMJA 4FMUA 5T0MA 5TTFA 3K5KA 2G46A 4J7FA 3RU0A 3TG5A 3M53A 3CBMA 1MT6A 4YPUA 5LSXA 4BUPA 5TH7A 1N3JA 3M55A 3S8PA 3MO0A 2R3AA 3QWWA 3M57A 3FPDA 3OXLA
chains in the Genus database with same CATH superfamily
5JHNA 3RIBA 2RFIA 5CCLA 5CPRB 4JDSA 3M54A 4QENA 5KJNA 3CBOA 5F5EA 3F9WA 1MUFA 5T0KA 3S7DA 3KMTA 5EX3A 1XQHA 1ZKKA 2IGQA 4E47A 5HQ8A 3F9ZA 3S7JA 3OXFA 3QWVA 3VUZA 4QEOA 4YNMA 3OXGA 3M56A 3M59A 3CBPA 1O9SA 3M5AA 4LDGA 5F6LA 3DB5A 3SWCA 2W5ZA 3PDNA 4J83A 3RJWA 3OS5A 5T5GA 4I51A 3OPEA 5JINA 4IJ8A 2BQZA 4IJDA 4NJ5A 5LSZA 3IHXA 5CCMA 2F69A 4H12A 2W5YA 4MI5A 3DALA 4MI0A 5HI7A 3OOIA 3EP0A 5AYFA 3F9XA 4O6FA 1N6CA 4YPEA 5JJ0A 4JLGA 3MO5A 4YNPA 4YPAA 5ARGA 5KJMA 1MVXA 3N71A 4NVQA 3VV0A 4O30A 3MEKA 4C1QA 4WUYA 1PEGA 4Z4PA 3MO2A 3F9YA 4J7IA 5EG2A 5JIYA 5F59A 3SW9A 2O8JA 4J8OA 4AU7A 3HNAA 5F6KC 3S7BA 4YNDA 3RQ4A 2JV0A 1H3IA 4QEPA 1MVHA 3BO5A 5EX0A 1N6AA 3M58A 5KJLA 5ARFA 1ML9A 3S7FA 2QPWA 5TEGA 3QWPA 5KJKA 3KMAA 3RAYA 4RZ0A 3TG4A 3KMJA 4FMUA 5T0MA 5TTFA 3K5KA 2G46A 4J7FA 3RU0A 3TG5A 3M53A 3CBMA 1MT6A 4YPUA 5LSXA 4BUPA 5TH7A 1N3JA 3M55A 3S8PA 3MO0A 2R3AA 3QWWA 3M57A 3FPDA 3OXLA
chains in the Genus database with same CATH topology
5JHNA 3RIBA 2RFIA 5CCLA 5CPRB 4JDSA 3M54A 4QENA 5KJNA 3CBOA 5F5EA 3F9WA 1MUFA 5T0KA 3S7DA 3KMTA 5EX3A 1XQHA 1ZKKA 2IGQA 4E47A 5HQ8A 3F9ZA 3S7JA 3OXFA 3QWVA 3VUZA 4QEOA 4YNMA 3OXGA 3M56A 3M59A 3CBPA 1O9SA 3M5AA 4LDGA 5F6LA 3DB5A 3SWCA 2W5ZA 3PDNA 4J83A 3RJWA 3OS5A 5T5GA 4I51A 3OPEA 5JINA 4IJ8A 2BQZA 4IJDA 4NJ5A 5LSZA 3IHXA 5CCMA 2F69A 4H12A 2W5YA 4MI5A 3DALA 4MI0A 5HI7A 3OOIA 3EP0A 5AYFA 3F9XA 4O6FA 1N6CA 4YPEA 5JJ0A 4JLGA 3MO5A 4YNPA 4YPAA 5ARGA 5KJMA 1MVXA 3N71A 4NVQA 3VV0A 4O30A 3MEKA 4C1QA 4WUYA 1PEGA 4Z4PA 3MO2A 3F9YA 4J7IA 5EG2A 5JIYA 5F59A 3SW9A 2O8JA 4J8OA 4AU7A 3HNAA 5F6KC 3S7BA 4YNDA 3RQ4A 2JV0A 1H3IA 4QEPA 1MVHA 3BO5A 5EX0A 1N6AA 3M58A 5KJLA 5ARFA 1ML9A 3S7FA 2QPWA 5TEGA 3QWPA 5KJKA 3KMAA 3RAYA 4RZ0A 3TG4A 3KMJA 4FMUA 5T0MA 5TTFA 3K5KA 2G46A 4J7FA 3RU0A 3TG5A 3M53A 3CBMA 1MT6A 4YPUA 5LSXA 4BUPA 5TH7A 1N3JA 3M55A 3S8PA 3MO0A 2R3AA 3QWWA 3M57A 3FPDA 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHN A;  3RIB A;  2RFI A;  5CCL A;  5CPR B;  4JDS A;  3M54 A;  4QEN A;  5KJN A;  3CBO A;  5F5E A;  3F9W A;  1MUF A;  5T0K A;  3S7D A;  3KMT A;  5EX3 A;  1XQH A;  1ZKK A;  2IGQ A;  4E47 A;  5HQ8 A;  3F9Z A;  3S7J A;  3OXF A;  3QWV A;  3VUZ A;  4QEO A;  4YNM A;  3OXG A;  3M56 A;  3M59 A;  3CBP A;  1O9S A;  3M5A A;  4LDG A;  5F6L A;  3DB5 A;  3SWC A;  2W5Z A;  3PDN A;  4J83 A;  3RJW A;  3OS5 A;  5T5G A;  4I51 A;  3OPE A;  5JIN A;  4IJ8 A;  2BQZ A;  4IJD A;  4NJ5 A;  5LSZ A;  3IHX A;  5CCM A;  2F69 A;  4H12 A;  2W5Y A;  4MI5 A;  3DAL A;  4MI0 A;  5HI7 A;  3OOI A;  3EP0 A;  5AYF A;  3F9X A;  4O6F A;  1N6C A;  4YPE A;  5JJ0 A;  4JLG A;  3MO5 A;  4YNP A;  4YPA A;  5ARG A;  5KJM A;  1MVX A;  3N71 A;  4NVQ A;  3VV0 A;  4O30 A;  3MEK A;  4C1Q A;  4WUY A;  1PEG A;  4Z4P A;  3MO2 A;  3F9Y A;  4J7I A;  5EG2 A;  5JIY A;  5F59 A;  3SW9 A;  2O8J A;  4J8O A;  4AU7 A;  3HNA A;  5F6K C;  3S7B A;  4YND A;  3RQ4 A;  2JV0 A;  1H3I A;  4QEP A;  1MVH A;  3BO5 A;  5EX0 A;  1N6A A;  3M58 A;  5KJL A;  5ARF A;  1ML9 A;  3S7F A;  2QPW A;  5TEG A;  3QWP A;  5KJK A;  3KMA A;  3RAY A;  4RZ0 A;  3TG4 A;  3KMJ A;  4FMU A;  5T0M A;  5TTF A;  3K5K A;  2G46 A;  4J7F A;  3RU0 A;  3TG5 A;  3M53 A;  3CBM A;  1MT6 A;  4YPU A;  5LSX A;  4BUP A;  5TH7 A;  1N3J A;  3M55 A;  3S8P A;  3MO0 A;  2R3A A;  3QWW A;  3M57 A;  3FPD A;  3OXL A; 
#chains in the Genus database with same CATH topology
 5JHN A;  3RIB A;  2RFI A;  5CCL A;  5CPR B;  4JDS A;  3M54 A;  4QEN A;  5KJN A;  3CBO A;  5F5E A;  3F9W A;  1MUF A;  5T0K A;  3S7D A;  3KMT A;  5EX3 A;  1XQH A;  1ZKK A;  2IGQ A;  4E47 A;  5HQ8 A;  3F9Z A;  3S7J A;  3OXF A;  3QWV A;  3VUZ A;  4QEO A;  4YNM A;  3OXG A;  3M56 A;  3M59 A;  3CBP A;  1O9S A;  3M5A A;  4LDG A;  5F6L A;  3DB5 A;  3SWC A;  2W5Z A;  3PDN A;  4J83 A;  3RJW A;  3OS5 A;  5T5G A;  4I51 A;  3OPE A;  5JIN A;  4IJ8 A;  2BQZ A;  4IJD A;  4NJ5 A;  5LSZ A;  3IHX A;  5CCM A;  2F69 A;  4H12 A;  2W5Y A;  4MI5 A;  3DAL A;  4MI0 A;  5HI7 A;  3OOI A;  3EP0 A;  5AYF A;  3F9X A;  4O6F A;  1N6C A;  4YPE A;  5JJ0 A;  4JLG A;  3MO5 A;  4YNP A;  4YPA A;  5ARG A;  5KJM A;  1MVX A;  3N71 A;  4NVQ A;  3VV0 A;  4O30 A;  3MEK A;  4C1Q A;  4WUY A;  1PEG A;  4Z4P A;  3MO2 A;  3F9Y A;  4J7I A;  5EG2 A;  5JIY A;  5F59 A;  3SW9 A;  2O8J A;  4J8O A;  4AU7 A;  3HNA A;  5F6K C;  3S7B A;  4YND A;  3RQ4 A;  2JV0 A;  1H3I A;  4QEP A;  1MVH A;  3BO5 A;  5EX0 A;  1N6A A;  3M58 A;  5KJL A;  5ARF A;  1ML9 A;  3S7F A;  2QPW A;  5TEG A;  3QWP A;  5KJK A;  3KMA A;  3RAY A;  4RZ0 A;  3TG4 A;  3KMJ A;  4FMU A;  5T0M A;  5TTF A;  3K5K A;  2G46 A;  4J7F A;  3RU0 A;  3TG5 A;  3M53 A;  3CBM A;  1MT6 A;  4YPU A;  5LSX A;  4BUP A;  5TH7 A;  1N3J A;  3M55 A;  3S8P A;  3MO0 A;  2R3A A;  3QWW A;  3M57 A;  3FPD A;  3OXL A; 
#chains in the Genus database with same CATH homology
 5JHN A;  3RIB A;  2RFI A;  5CCL A;  5CPR B;  4JDS A;  3M54 A;  4QEN A;  5KJN A;  3CBO A;  5F5E A;  3F9W A;  1MUF A;  5T0K A;  3S7D A;  3KMT A;  5EX3 A;  1XQH A;  1ZKK A;  2IGQ A;  4E47 A;  5HQ8 A;  3F9Z A;  3S7J A;  3OXF A;  3QWV A;  3VUZ A;  4QEO A;  4YNM A;  3OXG A;  3M56 A;  3M59 A;  3CBP A;  1O9S A;  3M5A A;  4LDG A;  5F6L A;  3DB5 A;  3SWC A;  2W5Z A;  3PDN A;  4J83 A;  3RJW A;  3OS5 A;  5T5G A;  4I51 A;  3OPE A;  5JIN A;  4IJ8 A;  2BQZ A;  4IJD A;  4NJ5 A;  5LSZ A;  3IHX A;  5CCM A;  2F69 A;  4H12 A;  2W5Y A;  4MI5 A;  3DAL A;  4MI0 A;  5HI7 A;  3OOI A;  3EP0 A;  5AYF A;  3F9X A;  4O6F A;  1N6C A;  4YPE A;  5JJ0 A;  4JLG A;  3MO5 A;  4YNP A;  4YPA A;  5ARG A;  5KJM A;  1MVX A;  3N71 A;  4NVQ A;  3VV0 A;  4O30 A;  3MEK A;  4C1Q A;  4WUY A;  1PEG A;  4Z4P A;  3MO2 A;  3F9Y A;  4J7I A;  5EG2 A;  5JIY A;  5F59 A;  3SW9 A;  2O8J A;  4J8O A;  4AU7 A;  3HNA A;  5F6K C;  3S7B A;  4YND A;  3RQ4 A;  2JV0 A;  1H3I A;  4QEP A;  1MVH A;  3BO5 A;  5EX0 A;  1N6A A;  3M58 A;  5KJL A;  5ARF A;  1ML9 A;  3S7F A;  2QPW A;  5TEG A;  3QWP A;  5KJK A;  3KMA A;  3RAY A;  4RZ0 A;  3TG4 A;  3KMJ A;  4FMU A;  5T0M A;  5TTF A;  3K5K A;  2G46 A;  4J7F A;  3RU0 A;  3TG5 A;  3M53 A;  3CBM A;  1MT6 A;  4YPU A;  5LSX A;  4BUP A;  5TH7 A;  1N3J A;  3M55 A;  3S8P A;  3MO0 A;  2R3A A;  3QWW A;  3M57 A;  3FPD A;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...