2G46A

Structure of vset in complex with mek27 h3 pept. and cofactor product sah
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PBCV-1 histone H3-Lys 27 methyltransferase
publication title Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 9
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2g46A01
3M5AA 3MEKA 3QWWA 5HQ8A 3S8PA 5TH7A 3MO2A 1XQHA 5F6LA 4LDGA 5ARFA 4RZ0A 1MVXA 5KJMA 3M57A 3M54A 1ML9A 4BUPA 5T5GA 5F5EA 5T0KA 4IJDA 3RU0A 3EP0A 3MO5A 3KMTA 3TG5A 4IJ8A 3CBPA 4NJ5A 5KJKA 2IGQA 3OPEA 5AYFA 2W5ZA 5JHNA 4JLGA 3OS5A 3RAYA 3DALA 5F6KC 3FPDA 4YPEA 3CBMA 3QWPA 5EG2A 2G46A 2QPWA 4J7FA 3F9WA 3S7JA 4YNMA 4AU7A 3SW9A 1H3IA 2W5YA 4H12A 2F69A 2R3AA 3RIBA 4JDSA 4YPUA 3F9ZA 4YNDA 2O8JA 5JIYA 4J8OA 3RJWA 3PDNA 4WUYA 5LSXA 4QENA 3OXFA 5CCMA 5TTFA 1MT6A 1PEGA 1N3JA 3OOIA 5F59A 4NVQA 3VV0A 4QEPA 3VUZA 4YPAA 3F9YA 4O30A 3M56A 1MUFA 1ZKKA 3KMAA 2BQZA 3S7FA 1MVHA 3OXLA 5T0MA 5HI7A 5JJ0A 3IHXA 3SWCA 4O6FA 5KJNA 3HNAA 2JV0A 3BO5A 1N6AA 5CCLA 1N6CA 3OXGA 4J7IA 3M59A 5TEGA 4C1QA 4MI0A 3M58A 3S7DA 4E47A 5ARGA 4YNPA 3S7BA 3K5KA 2RFIA 5JINA 3DB5A 3N71A 4QEOA 3M53A 3KMJA 4J83A 4FMUA 5EX0A 1O9SA 4I51A 3MO0A 3TG4A 5LSZA 3M55A 4MI5A 3F9XA 5CPRB 4Z4PA 3RQ4A 5EX3A 5KJLA 3QWVA 3CBOA
chains in the Genus database with same CATH superfamily
3M5AA 3MEKA 3QWWA 5HQ8A 3S8PA 5TH7A 3MO2A 1XQHA 5F6LA 4LDGA 5ARFA 4RZ0A 1MVXA 5KJMA 3M57A 3M54A 1ML9A 4BUPA 5T5GA 5F5EA 5T0KA 4IJDA 3RU0A 3EP0A 3MO5A 3KMTA 3TG5A 4IJ8A 3CBPA 4NJ5A 5KJKA 2IGQA 3OPEA 5AYFA 2W5ZA 5JHNA 4JLGA 3OS5A 3RAYA 3DALA 5F6KC 3FPDA 4YPEA 3CBMA 3QWPA 5EG2A 2G46A 2QPWA 4J7FA 3F9WA 3S7JA 4YNMA 4AU7A 3SW9A 1H3IA 2W5YA 4H12A 2F69A 2R3AA 3RIBA 4JDSA 4YPUA 3F9ZA 4YNDA 2O8JA 5JIYA 4J8OA 3RJWA 3PDNA 4WUYA 5LSXA 4QENA 3OXFA 5CCMA 5TTFA 1MT6A 1PEGA 1N3JA 3OOIA 5F59A 4NVQA 3VV0A 4QEPA 3VUZA 4YPAA 3F9YA 4O30A 3M56A 1MUFA 1ZKKA 3KMAA 2BQZA 3S7FA 1MVHA 3OXLA 5T0MA 5HI7A 5JJ0A 3IHXA 3SWCA 4O6FA 5KJNA 3HNAA 2JV0A 3BO5A 1N6AA 5CCLA 1N6CA 3OXGA 4J7IA 3M59A 5TEGA 4C1QA 4MI0A 3M58A 3S7DA 4E47A 5ARGA 4YNPA 3S7BA 3K5KA 2RFIA 5JINA 3DB5A 3N71A 4QEOA 3M53A 3KMJA 4J83A 4FMUA 5EX0A 1O9SA 4I51A 3MO0A 3TG4A 5LSZA 3M55A 4MI5A 3F9XA 5CPRB 4Z4PA 3RQ4A 5EX3A 5KJLA 3QWVA 3CBOA
chains in the Genus database with same CATH topology
3M5AA 3MEKA 3QWWA 5HQ8A 3S8PA 5TH7A 3MO2A 1XQHA 5F6LA 4LDGA 5ARFA 4RZ0A 1MVXA 5KJMA 3M57A 3M54A 1ML9A 4BUPA 5T5GA 5F5EA 5T0KA 4IJDA 3RU0A 3EP0A 3MO5A 3KMTA 3TG5A 4IJ8A 3CBPA 4NJ5A 5KJKA 2IGQA 3OPEA 5AYFA 2W5ZA 5JHNA 4JLGA 3OS5A 3RAYA 3DALA 5F6KC 3FPDA 4YPEA 3CBMA 3QWPA 5EG2A 2G46A 2QPWA 4J7FA 3F9WA 3S7JA 4YNMA 4AU7A 3SW9A 1H3IA 2W5YA 4H12A 2F69A 2R3AA 3RIBA 4JDSA 4YPUA 3F9ZA 4YNDA 2O8JA 5JIYA 4J8OA 3RJWA 3PDNA 4WUYA 5LSXA 4QENA 3OXFA 5CCMA 5TTFA 1MT6A 1PEGA 1N3JA 3OOIA 5F59A 4NVQA 3VV0A 4QEPA 3VUZA 4YPAA 3F9YA 4O30A 3M56A 1MUFA 1ZKKA 3KMAA 2BQZA 3S7FA 1MVHA 3OXLA 5T0MA 5HI7A 5JJ0A 3IHXA 3SWCA 4O6FA 5KJNA 3HNAA 2JV0A 3BO5A 1N6AA 5CCLA 1N6CA 3OXGA 4J7IA 3M59A 5TEGA 4C1QA 4MI0A 3M58A 3S7DA 4E47A 5ARGA 4YNPA 3S7BA 3K5KA 2RFIA 5JINA 3DB5A 3N71A 4QEOA 3M53A 3KMJA 4J83A 4FMUA 5EX0A 1O9SA 4I51A 3MO0A 3TG4A 5LSZA 3M55A 4MI5A 3F9XA 5CPRB 4Z4PA 3RQ4A 5EX3A 5KJLA 3QWVA 3CBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M5A A;  3MEK A;  3QWW A;  5HQ8 A;  3S8P A;  5TH7 A;  3MO2 A;  1XQH A;  5F6L A;  4LDG A;  5ARF A;  4RZ0 A;  1MVX A;  5KJM A;  3M57 A;  3M54 A;  1ML9 A;  4BUP A;  5T5G A;  5F5E A;  5T0K A;  4IJD A;  3RU0 A;  3EP0 A;  3MO5 A;  3KMT A;  3TG5 A;  4IJ8 A;  3CBP A;  4NJ5 A;  5KJK A;  2IGQ A;  3OPE A;  5AYF A;  2W5Z A;  5JHN A;  4JLG A;  3OS5 A;  3RAY A;  3DAL A;  5F6K C;  3FPD A;  4YPE A;  3CBM A;  3QWP A;  5EG2 A;  2G46 A;  2QPW A;  4J7F A;  3F9W A;  3S7J A;  4YNM A;  4AU7 A;  3SW9 A;  1H3I A;  2W5Y A;  4H12 A;  2F69 A;  2R3A A;  3RIB A;  4JDS A;  4YPU A;  3F9Z A;  4YND A;  2O8J A;  5JIY A;  4J8O A;  3RJW A;  3PDN A;  4WUY A;  5LSX A;  4QEN A;  3OXF A;  5CCM A;  5TTF A;  1MT6 A;  1PEG A;  1N3J A;  3OOI A;  5F59 A;  4NVQ A;  3VV0 A;  4QEP A;  3VUZ A;  4YPA A;  3F9Y A;  4O30 A;  3M56 A;  1MUF A;  1ZKK A;  3KMA A;  2BQZ A;  3S7F A;  1MVH A;  3OXL A;  5T0M A;  5HI7 A;  5JJ0 A;  3IHX A;  3SWC A;  4O6F A;  5KJN A;  3HNA A;  2JV0 A;  3BO5 A;  1N6A A;  5CCL A;  1N6C A;  3OXG A;  4J7I A;  3M59 A;  5TEG A;  4C1Q A;  4MI0 A;  3M58 A;  3S7D A;  4E47 A;  5ARG A;  4YNP A;  3S7B A;  3K5K A;  2RFI A;  5JIN A;  3DB5 A;  3N71 A;  4QEO A;  3M53 A;  3KMJ A;  4J83 A;  4FMU A;  5EX0 A;  1O9S A;  4I51 A;  3MO0 A;  3TG4 A;  5LSZ A;  3M55 A;  4MI5 A;  3F9X A;  5CPR B;  4Z4P A;  3RQ4 A;  5EX3 A;  5KJL A;  3QWV A;  3CBO A; 
#chains in the Genus database with same CATH topology
 3M5A A;  3MEK A;  3QWW A;  5HQ8 A;  3S8P A;  5TH7 A;  3MO2 A;  1XQH A;  5F6L A;  4LDG A;  5ARF A;  4RZ0 A;  1MVX A;  5KJM A;  3M57 A;  3M54 A;  1ML9 A;  4BUP A;  5T5G A;  5F5E A;  5T0K A;  4IJD A;  3RU0 A;  3EP0 A;  3MO5 A;  3KMT A;  3TG5 A;  4IJ8 A;  3CBP A;  4NJ5 A;  5KJK A;  2IGQ A;  3OPE A;  5AYF A;  2W5Z A;  5JHN A;  4JLG A;  3OS5 A;  3RAY A;  3DAL A;  5F6K C;  3FPD A;  4YPE A;  3CBM A;  3QWP A;  5EG2 A;  2G46 A;  2QPW A;  4J7F A;  3F9W A;  3S7J A;  4YNM A;  4AU7 A;  3SW9 A;  1H3I A;  2W5Y A;  4H12 A;  2F69 A;  2R3A A;  3RIB A;  4JDS A;  4YPU A;  3F9Z A;  4YND A;  2O8J A;  5JIY A;  4J8O A;  3RJW A;  3PDN A;  4WUY A;  5LSX A;  4QEN A;  3OXF A;  5CCM A;  5TTF A;  1MT6 A;  1PEG A;  1N3J A;  3OOI A;  5F59 A;  4NVQ A;  3VV0 A;  4QEP A;  3VUZ A;  4YPA A;  3F9Y A;  4O30 A;  3M56 A;  1MUF A;  1ZKK A;  3KMA A;  2BQZ A;  3S7F A;  1MVH A;  3OXL A;  5T0M A;  5HI7 A;  5JJ0 A;  3IHX A;  3SWC A;  4O6F A;  5KJN A;  3HNA A;  2JV0 A;  3BO5 A;  1N6A A;  5CCL A;  1N6C A;  3OXG A;  4J7I A;  3M59 A;  5TEG A;  4C1Q A;  4MI0 A;  3M58 A;  3S7D A;  4E47 A;  5ARG A;  4YNP A;  3S7B A;  3K5K A;  2RFI A;  5JIN A;  3DB5 A;  3N71 A;  4QEO A;  3M53 A;  3KMJ A;  4J83 A;  4FMU A;  5EX0 A;  1O9S A;  4I51 A;  3MO0 A;  3TG4 A;  5LSZ A;  3M55 A;  4MI5 A;  3F9X A;  5CPR B;  4Z4P A;  3RQ4 A;  5EX3 A;  5KJL A;  3QWV A;  3CBO A; 
#chains in the Genus database with same CATH homology
 3M5A A;  3MEK A;  3QWW A;  5HQ8 A;  3S8P A;  5TH7 A;  3MO2 A;  1XQH A;  5F6L A;  4LDG A;  5ARF A;  4RZ0 A;  1MVX A;  5KJM A;  3M57 A;  3M54 A;  1ML9 A;  4BUP A;  5T5G A;  5F5E A;  5T0K A;  4IJD A;  3RU0 A;  3EP0 A;  3MO5 A;  3KMT A;  3TG5 A;  4IJ8 A;  3CBP A;  4NJ5 A;  5KJK A;  2IGQ A;  3OPE A;  5AYF A;  2W5Z A;  5JHN A;  4JLG A;  3OS5 A;  3RAY A;  3DAL A;  5F6K C;  3FPD A;  4YPE A;  3CBM A;  3QWP A;  5EG2 A;  2G46 A;  2QPW A;  4J7F A;  3F9W A;  3S7J A;  4YNM A;  4AU7 A;  3SW9 A;  1H3I A;  2W5Y A;  4H12 A;  2F69 A;  2R3A A;  3RIB A;  4JDS A;  4YPU A;  3F9Z A;  4YND A;  2O8J A;  5JIY A;  4J8O A;  3RJW A;  3PDN A;  4WUY A;  5LSX A;  4QEN A;  3OXF A;  5CCM A;  5TTF A;  1MT6 A;  1PEG A;  1N3J A;  3OOI A;  5F59 A;  4NVQ A;  3VV0 A;  4QEP A;  3VUZ A;  4YPA A;  3F9Y A;  4O30 A;  3M56 A;  1MUF A;  1ZKK A;  3KMA A;  2BQZ A;  3S7F A;  1MVH A;  3OXL A;  5T0M A;  5HI7 A;  5JJ0 A;  3IHX A;  3SWC A;  4O6F A;  5KJN A;  3HNA A;  2JV0 A;  3BO5 A;  1N6A A;  5CCL A;  1N6C A;  3OXG A;  4J7I A;  3M59 A;  5TEG A;  4C1Q A;  4MI0 A;  3M58 A;  3S7D A;  4E47 A;  5ARG A;  4YNP A;  3S7B A;  3K5K A;  2RFI A;  5JIN A;  3DB5 A;  3N71 A;  4QEO A;  3M53 A;  3KMJ A;  4J83 A;  4FMU A;  5EX0 A;  1O9S A;  4I51 A;  3MO0 A;  3TG4 A;  5LSZ A;  3M55 A;  4MI5 A;  3F9X A;  5CPR B;  4Z4P A;  3RQ4 A;  5EX3 A;  5KJL A;  3QWV A;  3CBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...