5ARGA

Smyd2 in complex with sgc probe bay-598
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
426
structure length
426
Chain Sequence
b'LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 151
structure length 426
sequence length 426
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5argA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5argA01
4AM9A 3S8PA 5KJNA 2KCKA 4LEUA 4CGVA 3IHXA 4GPKA 3ZFWA 3UPVA 5EX3A 4U07A 3HYMB 4J8OA 2VYIA 1NA0A 2DBAA 2QFCA 2HR2A 4MI5A 2IFUA 5JJTA 2XPIA 3URZA 3Q47B 1PEGA 2J9QA 2KCLA 1ELWA 4KBQA 3M53A 3WXXA 2VGXA 4J7IA 5JHNA 4CDRA 4AY6A 4YNMA 1IHGA 4N5CA 5KJMA 5C1DA 5T0MA 4G24A 5EKQD 3M58A 4APOA 3K5KA 3CKCA 3SW9A 1P5QA 2UY1A 4J8DA 4E47A 4HOSA 2PQRA 4I51A 4IN3B 1MVXA 2FI7A 2C0LA 3GZ2A 3ZHEB 1QZ2A 3RJVA 3UUXA 4I17A 4MI0A 2R3AA 3Q15A 4YVQC 1B89A 5CCLA 3F9ZA 2FO7A 5FT9A 1A17A 5F6LA 3F9XA 3F9YA 4ABNA 3TGOA 1E96B 2LSVA 5AYWD 3M56A 4YPUA 5G05J 3FP3A 3QWPA 1NA3A 3QWVA 4QEOA 2RFIA 4BUPA 1ELRA 2P58C 3MO2A 5FTPA 1N6AA 4H12A 1ZU2A 4J83A 3SZ7A 3VV0A 1WAO1 4J7FA 4KXKB 2WQHA 4QENA 1XQHA 2JLBA 5EX0A 3JYSA 2O8JA 5JIYA 5EG2A 3M55A 2LNIA 4GZ5A 4U04A 3KS2A 3CK8A 3MA5A 1W3BA 3TG5A 4BWRA 3LY8A 5FZQA 5D0QD 3K9IA 2IGQA 3KAEA 3KMTA 3CVNA 2C2LA 4G23A 5KJLA 3Q4AB 4NRHB 3N71A 1QQEA 3OXLA 4XIFA 4QEPA 2JV0A 4WNEA 2W5YA 2G46A 3CBMA 3QOUA 4RG9A 4XI0A 5TH7A 5BNWA 5HI7A 5M72A 3LCAA 3CVQA 3LKUA 3M5AA 3S7JA 5LCWC 4BTBA 2KC7A 3SWCA 1TJCA 3MKRA 4ME2A 4I9CA 5CHEE 2MHKA 2UWJG 5FJYA 5T5GA 2LSUA 2NC9A 4NJ5A 2R5SA 4BT8A 3U3WA 3CBPA 1FCHA 3M59A 3R9AB 4YPAA 3S7DA 2HO1A 4BT9A 2XEVA 3TG4A 4GA0A 1MVHA 1MT6A 1XNFA 4FMUA 4UQXA 4KYOB 2YQ8A 4G25A 3OOIA 3DALA 4GYOA 3Q49B 4G26A 4HOQA 4G1TA 4IJDA 3CEQA 4G2VA 1H3IA 3ASHA 3CK7A 2QPWA 2XCCA 3RQ4A 3ZN3A 4N2SA 4Y6CA 3SF4A 3S7BA 1ZKKA 4WUYA 5JJ7A 3QKYA 2XGMA 4I1AA 2E2EA 3MV2B 3LY7A 4H7XA 5DBKA 1HH8A 1O9SA 5KJKA 4JA7A 4F3VA 4O6FA 3CKBA 4WNDA 5TEGA 3VTXA 3FFLA 3MO5A 3MEKA 3QWWA 3E4BA 3NF1A 3DB5A 4HORA 4C1QA 3RJWA 3IEGA 2YHCA 3CV0A 3GYZA 4GCNA 2IF4A 5LCWJ 3EP0A 5TTFA 3M57A 3GW4A 4GZ6A 3ASFA 5A6CA 3ZHEA 3TAXA 1KLXA 2Q7FA 5AYFA 2Y4TA 3FWVA 5DIZA 4NQ0A 3OPEA 2HYZA 3ULQA 3FPDA 2BQZA 1NZNA 4U0ZA 4AU7A 2KCVA 2OOEA 3CK9A 4GA1A 4JA9A 3KMJA 5F59A 3O48A 3M54A 4JDSA 5JINA 4U0SA 4I9EA 4HOUA 4YNDA 4GYWA 3VTYA 2Y4UA 2UY1B 2FEZA 3S7FA 4Z4PA 3U4TA 2AVPA 1MUFA 1IYGA 4YNPA 2ONDA 4N3CA 5JJ6A 4HOTA 4I2ZA 1ML9A 3PDNA 4LDGA 5F5EA 5G04C 4GCOA 4XI9A 4W9RA 3ZPJA 4N2QA 4UI9K 3VUZA 2VGYA 3KMAA 5CPRB 5CCMA 4N39A 4Y6WA 5BT1A 4WNFA 3LY9A 5JJ0A 4J8FA 2XCBA 4BTAA 3PE3A 4JL0A 4H7YA 5FZRA 4I2WA 2VSNA 4EQFA 4AIFA 3MV3B 2VQ2A 2VSYA 2FF4A 4GYYA 4CGWA 3AS8A 5LSZA 3BEEA 3ASDA 4GA2A 2KATA 4J8EA 2FBNA 1WM5A 3OXGA 1HXIA 1ZBPA 5BW8C 3OXFA 4YPEA 4AY5A 1N6CA 3MO0A 5A7DB 1YA0A 5ARFA 4IJ8A 2I6HA 2WPVA 3RO2A 3CBOA 4UI9J 3RAYA 3ZGQA 2PQNA 4GZ3A 1OUVA 4UQZA 3EDTB 1HZ4A 5FZSA 4N3AA 2PZIA 3LYAA 4RZ0A 4RG6A 5D0OD 2W5ZA 4O30A 3Q5MA 2V5FA 5LSXA 2XGOA 4N3BA 2GW1A 4J0UA 3OS5A 4NVQA 2C0MA 3ASGA 5G04J 3AS4A 3GZ1A 5T0KA 4JLGA 3F9WA 5F6KC 3ESKA 2XGSA 4UI9C 3CVLA 2VGXB 3PE4A 2PL2A 3BO5A 3CVPA 2L6JA 1KT0A 3LPZA 5HQ8A 4YVOA 4UQYA 1PC2A 1N3JA 2F69A 5ARGA 3RO3A 3RKVA 3QDNA 4WNGA 4JHRA 2BUGA 1KT1A 5G05C 4U0UA 4A1SA 3HNAA 3AS5A 3KD7A 4B94A 1Y8MA 3RU0A 3RIBA 3UQ3A
chains in the Genus database with same CATH superfamily
3AG2E 4M7CA 2KCKA 4CGVA 4GPKA 3ZFWA 1MZCA 3TXMA 3LJNA 1TYQG 3HYMB 4J8OA 5ENOD 1S0PA 2AXZA 2Y0BG 3C3OA 4B0ZA 3TJPA 4MI5A 2IFUA 5JJTA 4PS8A 1IXVA 1OWPA 4LNGA 2WVIA 4UUCA 4KBQA 3M53A 3SNXA 4ACKA 2H6GA 3MKQA 3T5VA 4J7IA 2OEVA 4AY6A 4YNMA 2F37A 3APDA 2NSZA 3L54A 2IOLA 4L7TA 2NXPA 2MYOA 4APOA 1V54E 3LXUX 1HX8A 1K1AA 2OVFA 3JXIA 2WQ7A 4CZ2D 2PQRA 2R02A 4IN3B 1YYHA 4JPSA 1MVXA 2A5UA 3P2BA 4PDXA 4JVSA 3QNKA 3FU5A 3RAUA 3FUDA 1NP7A 3F9ZA 4V3IA 5AAOA 3G2UA 5EILA 2MOWA 2L0TB 3V79K 3F9XA 2WXIA 2AW6A 1E96B 3AG3E 4G8KA 2HM8A 5G05J 3QWPA 3ZRHA 3NQPA 2RFIA 4AV7A 3LVQE 3MZLB 3LVRE 4F1SA 2YNQA 1UJJA 5FINA 4HRNA 3VV0A 4KXKB 2P9UG 4GTVA 3CSTA 2H6HA 4WWOA 1DC2A 2EIKE 3EHMA 3M55A 5AQ9A 4UWHA 4WWNA 2IEJA 4PH4B 3CK8A 1OWNA 1G3NB 2IO3C 3LY8A 4BWRA 1PAQA 2I1KA 3LS8A 3ZNGA 2OVBA 2J4BA 5HRYA 1JCRA 2C2LA 4KZCA 3HHMA 3UTMA 3VLFA 4HB5A 5BXOA 1QQEA 3OXLA 2B6CA 3JUEA 4QEPA 2JV0A 5JHAA 2G46A 3CBMA 3IBEA 4XI0A 1HO8A 3UIOC 3LCAA 1TJFA 3TWRA 4LNUD 2E0IA 3S7JA 3QAQA 2B0OE 3G2TA 1U3CA 1TJCA 4ME2A 2XZTG 5FJYA 4C9BB 2WXOA 2BTDA 2P9LG 3KSLA 2NC9A 5FQ8A 4F6RD 3U3WA 5KNHD 5T4YA 2YHEA 3NZUA 2WXFA 3S7DA 3TG4A 4FMUA 2EIJE 4EHMA 2YQ8A 1JPLA 4DLOA 4TXPA 4E85A 3OOIA 4DK5A 4NURA 4XZ4A 3JCKC 2BF0X 2IJGX 4FULA 2KZTB 4G2VA 3UT7A 4DI3A 3CHOA 3SF4A 5JJ7A 1WY6A 2XGMA 4KT6B 4JEHA 2IONA 2E2EA 1S63A 1X5BA 3LY7A 1N4QA 4O60A 4IYPA 5G2NA 1MHQA 3UM0A 1EDUA 3Q78A 4JA7A 4DUIA 4BX9A 4U8YD 1MYOA 3LJ3A 2RG8A 3EIQC 4PS7A 3FFLA 5JHBA 4HNAD 2GRMA 4YDWA 4DI4A 3DSWA 3S2AA 3EP0A 3GW4A 3ASFA 1H0AA 3ZHEA 3TAXA 1U2VG 2Q7FA 5AYFA 3R9MA 5ANRA 1O1TA 3JUIA 4LNBA 1TN8A 4I1MA 5CEDB 3QARA 4GB9A 3FULA 1TNOA 3U66A 4GMJA 4AU7A 2XHEA 2OOEA 4X8QA 3FUMA 2GRRB 4AXHA 2P9KG 3FEYA 4OVVA 4AVXA 2FEZA 3B7RL 3S7FA 4Z4PA 1MUFA 1IYGA 2ONDA 4I2ZA 3Q79A 4LDGA 5G04C 4GCOA 4XI9A 4KVMA 3ZPJA 3SGHA 3WG7E 3VUZA 4K03A 2OCCE 5KNGA 1JUQA 5B1AE 3L16A 1Z5SC 4B93B 1E8YA 4HRLA 1KZOA 1EF1C 3LY9A 5JJ0A 3FTWA 2Y3AA 2XCBA 3ML9A 1OWOA 3HVEA 2KM4A 2XS8A 4CT0A 2VSYA 1NFIE 4MS6A 3AS8A 4DX5D 4L9PA 3TWQA 2KATA 3B95A 2XPZA 4I6JA 3CHQA 1HXIA 2NYJA 3MO0A 1YA0A 4IJ8A 4JB8P 1XGWA 5BXUA 1DCEA 3RAYA 2CFUA 4Z68A 4LCTA 1OUVA 3PEUB 4TXQA 4N3AA 4I6EA 3LYAA 3D9LA 3MGBA 4I6GA 4BSZB 2PM6A 4FJYA 2W5ZA 1SW6A 4O30A 3ZVVA 2XGOA 2FO1E 3PRZA 2J8SD 3ASGA 1FVHA 4CCAA 3FTSA 3UKUG 3AS4A 1HS6A 1AP7A 5T0KA 4JLGA 3F9WA 5ENQD 4ZHBA 2VGXB 3PE4A 3CVPA 2LUHA 1EYHA 4GTRA 2ZGGA 4BX8A 5HQ8A 3F6QA 5ARGA 3Q73A 1H2VC 4XKCA 4OYSA 1BU9A 4YDOA 2BKKB 4U0UA 4XE0A 4A1SA 4GTMA 1Y8MA 4LUNU 3OTNA 4UWLA 4AM9A 4DLQA 2QYJA 4YDYA 3S8PA 3NAWA 4F7AA 3SBSA 3L22A 3CR3A 2QFCA 3NB2A 3PNLB 2LO6A 3T5XA 1NL4A 5D66A 4L2YA 3CHRA 1PEGA 2KCLA 1ELWA 3CQCB 3WXXA 3UXGA 4DX6D 3ZYKA 3SO8A 5T0MA 3EHQA 1TNZA 5EKQD 2P9PG 2I9CA 4CT4A 4ILGA 3RRNB 3R7QA 2JEKA 3PVLA 1WG0A 4GMLA 2CHWA 3ENEA 3SI5A 4J8DA 1FPPA 3SFYA 2KXPC 1INZA 1BD8A 1H6OA 4ILHB 3ZHEB 1QZ2A 1IQRA 1E7VA 3FUKA 4I17A 2R3AA 4YVQC 1B89A 2R17C 2WMNA 3D3MA 1A17A 1TN7A 5F6LA 2BKGA 2XZDG 5CEAA 5J08A 3APFA 1NA3A 3QWVA 4RLYA 4BUPA 3ZU7B 4EZKA 4JD2G 3MO2A 5CRVA 3NOCD 4H12A 1N4PA 1VDYA 3DBSA 4FJZA 3ZXPA 2V4HC 2WXRA 5JMND 2AJAA 3TWWA 1XQHA 2JLBA 4GU5A 1MJ0A 5EX0A 2GROB 4FC8A 1MX2A 3OAWA 3APCA 4GZ5A 2P2CP 4HS2A 4U04A 5ANLA 4J7WA 3KS2A 3DPYA 3MA5A 5BPPA 5D0QD 2IGQA 3CVNA 2XS1A 3FH8A 3FUNA 2ETBA 4NRHB 2ETCA 2GGFA 3O4ZA 1TNBA 2X38A 3FU6A 4XIFA 3MX3A 2WXLA 4BESA 5AJDA 2J49A 2LAHA 3B7TA 3I5PA 3ESLA 2F8XK 3CVQA 3LKUA 3M5AA 3EU9A 5LCWC 4BTBA 2KC7A 1H2TC 1BI7B 1NI1A 4J8SA 4HQDA 5T5GA 3RK6A 4ANWA 4FU3A 4BT8A 3CBPA 3TXNA 4BT9A 2WXJA 1MT6A 3T8KA 3EIJA 2ETAA 4B8AA 4GTPA 4ANXA 3TL5A 1DCQA 3BQOA 1DVPA 4K5BA 4G26A 2ZU6B 4G1TA 2DZNA 3CK7A 2QPWA 4FLBA 4Y6CA 3FUJA 3S7BA 1ZKKA 5IY5E 3CQGB 5AENA 4DX7D 2OEWA 5DBKA 4LG6A 1X81A 4O6FA 4GZDA 1IHBA 3RSEG 3MEKA 3D9KA 3NF1A 5T8IA 4KMOA 2PNNA 3RJWA 2YHCA 5KWDA 4GCNA 5A23A 2IF4A 4CYMD 5BUZA 3SFZA 2ZXWE 5EIDA 3L6AA 1MX6A 3ULQA 2WXMA 2BQZA 1NZNA 5D2MC 4ACLA 3QK0A 4FLHA 3C72A 2GRNB 2KCVA 2IQCA 5ITZF 3HXDA 1L5JA 3HXCA 4I9EA 4YNDA 3VTYA 2Y4UA 4NIKA 2CG2A 1N0RA 3V30A 1BI8B 2VSOE 1TN6A 4D10C 2AVPA 1SA4A 2A4ZA 2QC9A 3Q9NC 2LXMA 5JJ6A 3ABKE 5F5EA 4W9RA 3QC1A 1OXJA 4UI9K 2VGYA 5CERB 3KMAA 5CPRB 4WNFA 1N11A 1KPSB 4ILIA 4O1PA 3PREA 4GTSA 4J8FA 3J5PA 3PE3A 4JZYA 2VQ2A 2RKKA 4GYYA 4CGWA 3PZ2A 3G2WA 4J8EA 1QYMA 2FBNA 1WM5A 1ZBPA 1N6CA 5A7DB 5ARFA 2QY7A 3EUVA 4OVUA 3UT8A 4GZ3A 3L9TA 3EDTB 3D9IA 3IHVA 1IQUA 3CVXA 1PY1A 2PZIA 4RZ0A 3DSXA 4CDMA 1N54A 4N3BA 2GW1A 3DEPA 5AQAA 4J0UA 3DRAA 3OS5A 5EIBE 4NVQA 4BSXA 5C2YA 5ENTD 3DXKG 2VGEA 3GZ1A 3B7UX 3ESKA 5JA4D 1H19A 4UI9C 3KSQA 3MKQB 3FTZA 3U9WA 1FT2A 4Q94A 1KT0A 2WXPA 4GTTA 2XEHA 4HXIA 2PM7A 5CMYA 4LERA 1N3JA 3RKVA 4JHJA 3FU0A 3Q75A 1TEZA 1KT1A 5G05C 3FHEA 2WXNA 4JW1A 3PH0C 4OAVB 3RIBA 1LTXA 2IO2C 2P9SG 2J09A 1S70B 4IULA 3X2QE 2X6IA 2DIWA 4LEUA 2CFZA 3D9PA 4TXRA 5EX3A 4U07A 2VYIA 1NA0A 2DBAA 4K0RA 3UM1A 3UT4A 4EBAA 4HFGA 4HI8A 5FIOA 3RRUA 1ELKA 1N9AA 2QZAA 4HLLA 2XPIA 5CMWA 1QNFA 2QYUA 1RW2A 1OCZE 4EECA 3W9GA 5C1DA 1EPUA 4G24A 4DX1A 4UWKA 5CRUA 3DSSA 3SW9A 3KEZA 1P5QA 1Z3XA 3ULYA 3ZXSA 4GAAA 4HOSA 4FADA 3ZKJA 2C0LA 2R03A 5T3RA 3GZ2A 3J5QB 2AWIA 2LAIA 3UUXA 3R7RA 2M63A 3P1UA 5CCLA 3ABME 2J07A 3HG0D 3F9YA 1MX4A 2LSVA 5AYWD 4I1OB 1SZAA 3M56A 4YPUA 2J4DA 3T8MA 2ZIRA 4L2LA 4QEOA 1H2UA 1ELRA 3FDHA 1ZU2A 2XRYA 1MQSA 4J83A 1D8EA 4I43A 3V2OA 3HDXA 1K8KG 3E30A 4J7FA 1UN9A 3DXMG 4QENA 4RQIA 3FUHA 2WXKA 3JYSA 2O8JA 3GZSA 1N95A 1LF8A 2WM9A 3C3RA 3IV0A 1W3BA 3E37A 2EILE 2F8YA 5FZQA 3PZ3A 3KAEA 3KMTA 3V2XA 4OAUC 1E8WA 5KJLA 3TWXA 3C3QA 4KVOA 3N71A 3TWTA 1E8XA 5FQ7A 2WQ6A 4J6IA 2WMOA 4WNEA 3PUJA 2W5YA 3QOUA 4U95D 5KCMA 2F0YA 2V5QC 3SY2A 5M72A 5HI7A 2IY0C 2CG3A 5EYPF 3T9KA 1BPOA 3MKRA 4P29A 1WDYA 5CHEE 2MHKA 2UWJG 4A3VA 3D9HA 4NJ5A 2R5SA 3CIAA 4E6HA 1OCRE 2EIME 2DVWA 3HXFA 1MVHA 1TR4A 2WB2A 1UW4B 4UQXA 3AU4A 4KYOB 3CVVA 1Z6TA 4G25A 2DYRE 2R05A 1SA5A 3DALA 5ENNA 3DSVA 3Q49B 2GRPB 5B1BE 4UWFA 4WWPA 3FH5A 3CEQA 2X6FA 3SD5A 3ASHA 3Q9UC 2EQXA 4FA6A 4WUYA 3QKYA 2XRZA 2MRIA 1IKND 3FTXA 2XQ0A 5ENPD 1O9SA 2HE0A 1H6PA 5KJKA 4YDEA 3CKBA 4WNDA 4DRXE 2ZGDA 4DX2A 4BERA 2I2OA 1ZB1A 2RFMA 3QWWA 3E4BA 3DB5A 3E32A 4GTQA 4LSZE 1O1RA 3E33A 3PNTB 5J90A 5TTFA 2X6KA 4HI9A 2KZTA 5B3SE 4GZ6A 5A6CA 4U8HA 4L1BA 1JWGA 2ILRA 2Y4TA 3FWVA 4NQ0A 3ZW3A 2HYZA 2AXVA 3LDZA 1D9SA 4A1GA 4U0ZA 4N5QA 3CHPA 3EJNA 3HVEB 3DWLG 3CK9A 4GA1A 4JA9A 3KMJA 5ENSD 5LFAA 2L6BA 3UM3A 4JDSA 1TNYA 1SQMA 3UM2A 4FHKA 2GRQB 3JQ0A 4FHJA 2LXLA 3L13A 4YNPA 4N3CA 4HOTA 1ML9A 2Y1LE 1UJKA 3TWSA 4J8YA 1Y6IA 3D9JA 1N94A 5CCMA 4QFVA 3FUFA 4Q96A 4N39A 4Y6WA 4EZLA 4BETA 2DZOA 5HS0A 3VLDA 2H6IA 1FVFA 4C0EA 1QBQA 4EQFA 4AIFA 3MV3B 3NZSA 1UG3A 3ONKA 3BEEA 4GA2A 3RRMB 3PEVB 1LD7A 3W9FA 4YPEA 3OXFA 2R59A 4KZ0A 3PS6A 5H7PA 3RO2A 4EBAG 4UI9J 1SVXA 3ZGQA 3NBNB 2PQNA 4UQZA 1HZ4A 4TRQA 3I3NA 1E7UA 2V0PA 4RG6A 3ZYQA 3PZDA 2WXQA 3BG1B 2CHZA 3Q5MA 2V5FA 5LSXA 1Q2ZA 2KBXA 1O1SA 2C0MA 1GW6A 5G04J 2DWZA 3QB2A 2VTBA 3IHYA 3L17A 1HG5A 3NOGD 3FTVA 5F6KC 3LEWA 4CEMA 3IXEA 2XGSA 3CVLA 4PUCA 3ZEFA 2XENA 1JCQA 3ULEG 3SFXA 3PZ4A 3IKOB 3LPZA 4YVOA 5E76A 4GPMA 3DSTA 2F69A 3FH7A 3RO3A 1E90A 3QDNA 4JHRA 4LRZA 3KEAA 3G2VA 3ASOE 3EU5A 5EDSA 4B94A 5BV0A 3RU0A 3PDNA 3UQ3A 5FQ4A 1AWCB 3CVYA 3ZIMA 5KJNA 4F53A 3CLJA 3IHXA 3HRAA 3UPVA 3ASNE 4U7EB 3PZ1A 2HR2A 3CHSA 2VSXE 3URZA 3Q47B 2J9QA 3ML8A 3UX4A 2VGXA 3UKRG 4MKTA 5JHNA 4CDRA 3I4RB 3TWVA 3TWUA 1YMPA 3Q7AA 1IHGA 3CHMA 2JABA 4N5CA 5KJMA 4A63B 1V55E 3AJIA 3M58A 3K5KA 3CKCA 4HLEA 2XPYA 5FWQA 4XKBA 2YINA 4HRMB 3EHRA 2UY1A 4G8LA 3CVUA 4E47A 4I51A 1LD8A 3E34A 2FI7A 5AQBA 5G55A 5EN5D 4URKA 3FU3A 2V4LA 3RJVA 4MLPA 4MI0A 1N0QA 3Q15A 3QJZA 2FO7A 5FT9A 2L9BA 5AARA 4F1PA 4ABNA 2X6HA 3TGOA 3VLEA 4U8VD 3FP3A 3I4GA 5LOZA 4TV3A 4TUUA 5AQ7A 2H6FA 2GRLA 3D9MA 3CVWA 2P58C 5FTPA 1N6AA 4CRWA 4XEIG 1FT1A 4JEUA 3SZ7A 2L0IA 1WAO1 3JXJA 1TNUA 1OWMA 4AEZC 2WQHA 4K5AB 5JIYA 3FTYA 5EG2A 4WAFA 1K1BA 2LNIA 1OT8A 1KZPA 4NACA 3TG5A 3K9IA 2FULA 3JQ1A 4DJAA 5LX8A 4HBDA 4G23A 3Q4AB 4RVBA 1OCCE 1A5EA 3L82A 3CGHA 4A3TA 1BLXB 4PS3A 3SBTB 3MYVA 4GZCA 1UN8A 2EINE 4RG9A 5TH7A 3HXEA 5BNWA 3AAAC 2RD0A 3SWCA 3FTUA 3ABLE 4I9CA 5KBAA 2LSUA 4B8CB 2J08A 1FCHA 3M59A 3R9AB 4YPAA 2HO1A 2XEVA 4ANVA 4GA0A 3AU5A 1XNFA 4BEPA 4MRUA 1S64A 4R7LA 1U3DA 4EZJA 3B7SA 2Y69E 1SZ9A 4GYOA 4HVBA 4Q69A 4HOQA 3ZUVB 3BU8A 4IJDA 4QQIA 1N4RA 1H3IA 1OWLA 3ZYLA 2XCCA 4JC8A 3RQ4A 5CECB 3ZN3A 4N2SA 2VTBB 1N4SA 1DNPA 4BFRA 4CDNA 4AJWA 4I1AA 2DYSE 2ZISA 3MV2B 3UIPC 4H7XA 1HH8A 3DEOA 3ISMC 4APFA 1HF8A 4F3VA 4U96D 1JCSA 3FUIA 5TEGA 1OCOE 5E75A 3VTXA 4MBGA 3MO5A 3BUAA 4AP2A 1RZ4A 4HORA 4B89A 4C1QA 4AOFA 1HE8A 3V31A 2R2LA 3IEGA 4BY6A 3CV0A 3GYZA 5LCWJ 1E8ZA 3M57A 3SQVA 1D8DA 2WXGA 4DPRA 2V8SE 3EHNA 4ATZD 1KLXA 3CSFA 5DIZA 1JWFA 3OPEA 2RFAA 4G11A 3FPDA 3ONLA 5AJLA 5CBNA 2IU1A 3B13A 5BV1A 4K5CA 4ATGA 4XX5A 4O1OA 5F59A 3O48A 4ANUA 3M54A 5JINA 4U0SA 4HOUA 4GYWA 2P9IG 2UY1B 4JHKA 3U4TA 3DPDA 1HG2A 4A55A 4N2QA 3U64A 2X6JA 4RSYA 2WXHA 5BT1A 3FUEA 2OV8A 3HIZA 4IRUA 3UMVA 4BTAA 5CBOA 4JL0A 4H7YA 5FZRA 4I2WA 3FY4A 2VSNA 3D9NA 5HKPA 1YCSB 2FF4A 3UI2A 5LSZA 4C48B 4TUMA 3ASDA 2XEEA 3SHFA 5LP0A 2DCPA 3OXGA 3UINC 5BW8C 4AY5A 1OY3D 3MJWA 2I6HA 1O5MA 2WPVA 3FEXA 3CBOA 2BEDA 3AG4E 3AG1E 3L08A 3DSUA 4U63A 1UOHA 4FP7A 5FQ6A 4EPZA 5FZSA 4M3OA 3PUKA 2AXUA 5D0OD 4GMRA 4GTOA 3MCXA 3C98A 4ZFHA 4C0MA 2CHXA 5ENRD 3BG0B 3HXBA 3ZYMA 5AN8A 1H6KA 1K3ZD 4JXTA 5AIJA 2A5EA 1Z3YA 2VJ8A 2P9NG 2X3MA 2PL2A 3BO5A 2IOSA 2L6JA 5EYLA 4UQYA 1PC2A 4UWGA 4WNGA 2BUGA 2I1JA 3Q7FA 3B7BA 3C5RA 4L23A 3HNAA 3AS5A 3G2SA 3KD7A 1HU3A 1N52A 3D9OA 1HFAA
chains in the Genus database with same CATH topology
3CVYA 2J09A 4AM9A 4IULA 4DLQA 3ZIMA 5KJNA 2X6IA 3S8PA 4F53A 2DIWA 2KCKA 4LEUA 3CLJA 4CGVA 3IHXA 4F7AA 4GPKA 3ZFWA 2CFZA 3D9PA 3TXMA 5EX3A 3UPVA 4U07A 3HYMB 3L22A 3SBSA 4J8OA 2VYIA 3CR3A 1NA0A 2DBAA 2QFCA 4K0RA 1S0PA 2AXZA 2LO6A 3PNLB 3UT4A 3T5XA 4EBAA 4HFGA 4B0ZA 3TJPA 3RRUA 1ELKA 2HR2A 4MI5A 3CHSA 2IFUA 5CMWA 2XPIA 2VSXE 1QNFA 4L2YA 4PS8A 3URZA 5JJTA 3CHRA 1OWPA 2WVIA 3Q47B 1PEGA 2J9QA 2KCLA 1ELWA 3ML8A 4KBQA 3M53A 3SNXA 3CQCB 3UX4A 4ACKA 3WXXA 3T5VA 3MKQA 2VGXA 4J7IA 3ZYKA 4MKTA 5JHNA 4CDRA 4EECA 4AY6A 4YNMA 3APDA 3I4RB 1IHGA 3CHMA 4N5CA 5KJMA 5C1DA 5T0MA 2NSZA 1EPUA 4G24A 3L54A 4UWKA 2IOLA 5EKQD 4L7TA 2NXPA 2I9CA 3M58A 4APOA 3LXUX 1HX8A 4CT4A 3K5KA 3CKCA 4ILGA 4HLEA 3RRNB 3R7QA 2JEKA 2OVFA 2XPYA 3PVLA 4GMLA 2YINA 2CHWA 4XKBA 5FWQA 2WQ7A 3SW9A 3ENEA 3KEZA 1P5QA 3SI5A 2UY1A 4J8DA 3CVUA 4E47A 1Z3XA 3ZXSA 4GAAA 4HOSA 2PQRA 1INZA 4I51A 4IN3B 4FADA 4JPSA 1MVXA 2A5UA 3P2BA 2FI7A 4PDXA 2C0LA 4JVSA 3QNKA 4ILHB 5G55A 5T3RA 3GZ2A 4URKA 2AWIA 3FU3A 1QZ2A 2V4LA 1IQRA 1E7VA 3FU5A 2LAIA 3FUKA 4MLPA 3RJVA 3UUXA 4I17A 4MI0A 2R3AA 3FUDA 3R7RA 2M63A 1NP7A 3Q15A 3P1UA 4YVQC 1B89A 2R17C 3QJZA 5CCLA 2WMNA 2FO7A 3D3MA 3F9ZA 2J07A 1A17A 4V3IA 5FT9A 3RIBA 2L9BA 3G2UA 2MOWA 2L0TB 5F6LA 3F9XA 3F9YA 2WXIA 2AW6A 4ABNA 2X6HA 3TGOA 1E96B 2LSVA 5AYWD 4I1OB 2HM8A 1SZAA 3M56A 4YPUA 3VLEA 5G05J 5J08A 2J4DA 3FP3A 3T8MA 3APFA 1NA3A 3I4GA 3QWPA 4L2LA 3QWVA 4TV3A 4TUUA 5LOZA 3ZRHA 4QEOA 2GRLA 3NQPA 1H2UA 1ELRA 2RFIA 4AV7A 3D9MA 3CVWA 4BUPA 4EZKA 3LVQE 3MZLB 3LVRE 3FDHA 2P58C 3MO2A 5FTPA 1N6AA 4H12A 4F1SA 1ZU2A 2XRYA 1MQSA 4J83A 4CRWA 1VDYA 2YNQA 4I43A 3HDXA 1UJJA 3DBSA 4FJZA 4JEUA 3SZ7A 2WXRA 2L0IA 3VV0A 1WAO1 4J7FA 4KXKB 1UN9A 1OWMA 4AEZC 2WQHA 4QENA 3CSTA 1XQHA 2JLBA 3FUHA 2WXKA 4GU5A 5EX0A 4WWOA 3JYSA 4FC8A 2O8JA 5JIYA 3GZSA 3FTYA 3EHMA 3OAWA 5EG2A 3APCA 4WAFA 2LNIA 3M55A 4GZ5A 4UWHA 1LF8A 4HS2A 4U04A 4WWNA 2WM9A 3IV0A 5ANLA 4PH4B 3KS2A 4NACA 3CK8A 3MA5A 1W3BA 3TG5A 1OWNA 4BWRA 3LY8A 5BPPA 5FZQA 5D0QD 3K9IA 1PAQA 2FULA 3JQ1A 2I1KA 3LS8A 2IGQA 3KAEA 4DJAA 5LX8A 3KMTA 3CVNA 2OVBA 2J4BA 1E8WA 3FH8A 3FUNA 2C2LA 4G23A 4KZCA 3HHMA 5KJLA 3Q4AB 3VLFA 4NRHB 4KVOA 2GGFA 3N71A 4RVBA 1QQEA 3O4ZA 3OXLA 2X38A 3FU6A 1E8XA 5FQ7A 4XIFA 2WQ6A 3CGHA 4A3TA 3UQ3A 2JV0A 4QEPA 4PS3A 4J6IA 2WMOA 4WNEA 3PUJA 5JHAA 2G46A 2W5YA 3MX3A 2WXLA 3CBMA 3IBEA 3QOUA 5AJDA 5KCMA 3SBTB 2J49A 3MYVA 4GZCA 1UN8A 4RG9A 2LAHA 3B7TA 3I5PA 4XI0A 1HO8A 5TH7A 5BNWA 5HI7A 3ESLA 5M72A 3LCAA 1TJFA 2E0IA 3CVQA 2CG3A 3LKUA 3M5AA 3S7JA 5LCWC 4BTBA 2RD0A 2KC7A 1H2TC 3G2TA 3QAQA 3SWCA 1U3CA 1BPOA 1TJCA 3MKRA 4ME2A 3FTUA 4P29A 4I9CA 4J8SA 5CHEE 2MHKA 2UWJG 5FJYA 4A3VA 4C9BB 2WXOA 5T5GA 2LSUA 3RK6A 2BTDA 4FU3A 4ANWA 4B8CB 2NC9A 5FQ8A 4NJ5A 2R5SA 3CIAA 2J08A 4BT8A 4E6HA 3TXNA 3U3WA 1FCHA 3CBPA 3M59A 3R9AB 5T4YA 2YHEA 3NZUA 2WXFA 4YPAA 3S7DA 2HO1A 4BT9A 2XEVA 3TG4A 4GA0A 4ANVA 2WXJA 1MT6A 1MVHA 3AU5A 1XNFA 4MRUA 4FMUA 2WB2A 1UW4B 4UQXA 3AU4A 3EIJA 4KYOB 4R7LA 1U3DA 2YQ8A 4B8AA 4EZJA 3B7SA 3CVVA 1Z6TA 4G25A 1JPLA 4ANXA 3TL5A 4DLOA 3OOIA 4E85A 1SZ9A 3DALA 4DK5A 4NURA 5ENNA 4GYOA 3Q49B 4HVBA 4XZ4A 4Q69A 3JCKC 1DVPA 4G26A 4UWFA 2BF0X 2IJGX 3FH5A 4HOQA 4WWPA 2ZU6B 4G1TA 4FULA 2KZTB 3CEQA 4G2VA 3UT7A 4DI3A 1OWLA 2X6FA 3SD5A 3ASHA 1H3IA 3ZYLA 3CK7A 2QPWA 2XCCA 4JC8A 3RQ4A 3ZN3A 2EQXA 4N2SA 2VTBB 4FLBA 4Y6CA 3CHOA 3FUJA 3SF4A 1DNPA 4FA6A 4BFRA 4CDNA 3S7BA 1ZKKA 4WUYA 5JJ7A 1WY6A 3QKYA 2XRZA 3CQGB 4AJWA 5AENA 2XGMA 4KT6B 4I1AA 4JEHA 2MRIA 2IONA 2E2EA 3MV2B 1X5BA 3FTXA 3LY7A 4H7XA 5DBKA 2XQ0A 4IYPA 1HH8A 5G2NA 1O9SA 1MHQA 1EDUA 5KJKA 4APFA 1HF8A 4JA7A 4F3VA 4O6FA 3ZHEB 3CKBA 4WNDA 4GZDA 3FUIA 4BX9A 5TEGA 2I2OA 5E75A 3LJ3A 2RG8A 3VTXA 3EIQC 4PS7A 3FFLA 3MO5A 5JHBA 3MEKA 3D9KA 3QWWA 4AP2A 3E4BA 3NF1A 3DB5A 4HORA 4B89A 4C1QA 4AOFA 5T8IA 4KMOA 1HE8A 2GRMA 3RJWA 3IEGA 4DI4A 2YHCA 4BY6A 3CV0A 3GYZA 3S2AA 3PNTB 4GCNA 5A23A 2IF4A 5LCWJ 1E8ZA 5J90A 3EP0A 5TTFA 3M57A 3GW4A 5BUZA 2X6KA 2KZTA 2WXGA 4GZ6A 3ASFA 1H0AA 4DPRA 5A6CA 2V8SE 3EHNA 4U8HA 3SFZA 3ZHEA 4L1BA 3TAXA 1KLXA 1JWGA 2ILRA 2Q7FA 5AYFA 2Y4TA 3FWVA 3CSFA 5DIZA 1JWFA 5ANRA 3L6AA 4NQ0A 3ZW3A 3OPEA 3JUIA 2HYZA 3ULQA 4G11A 2AXVA 2WXMA 3FPDA 2BQZA 3ONLA 1NZNA 3LDZA 4I1MA 5AJLA 4ACLA 4A1GA 3QARA 3QK0A 4GB9A 4U0ZA 2IU1A 3B13A 3FULA 4FLHA 5BV1A 3CHPA 3EJNA 4ATGA 4XX5A 3HVEB 3U66A 4GMJA 4AU7A 2KCVA 2IQCA 2XHEA 2OOEA 1L5JA 3CK9A 4GA1A 4JA9A 3KMJA 3FUMA 5F59A 3O48A 4ANUA 5LFAA 4AXHA 3M54A 4JDSA 5JINA 4U0SA 4I9EA 4HOUA 4YNDA 3FEYA 1SQMA 4GYWA 4OVVA 4FHKA 4AVXA 3VTYA 2Y4UA 2CG2A 2UY1B 2FEZA 3B7RL 4JHKA 3JQ0A 2VSOE 3S7FA 4D10C 4Z4PA 4FHJA 2AVPA 3U4TA 3DPDA 1MUFA 1IYGA 1HG2A 3L13A 2A4ZA 4YNPA 2ONDA 4N3CA 5JJ6A 4HOTA 4I2ZA 1ML9A 3PDNA 4LDGA 1UJKA 5F5EA 5G04C 4GCOA 4XI9A 4KVMA 4W9RA 3QC1A 4A55A 3ZPJA 3SGHA 4N2QA 3U64A 1Y6IA 2X6JA 4UI9K 3D9JA 3VUZA 4K03A 2VGYA 3KMAA 5CPRB 4RSYA 5CCMA 4QFVA 3FUFA 2WXHA 4N39A 4Q96A 1JUQA 4Y6WA 5BT1A 4WNFA 3L16A 4EZLA 3FUEA 1E8YA 3VLDA 4IJDA 2OV8A 3HIZA 4ILIA 4IRUA 1EF1C 3LY9A 5JJ0A 3FTWA 2Y3AA 3PREA 4J8FA 1FVFA 2XCBA 3UMVA 3ML9A 1OWOA 4BTAA 3PE3A 3HVEA 2KM4A 4JL0A 4C0EA 4H7YA 5FZRA 4I2WA 3FY4A 2VSNA 4JZYA 3D9NA 4CT0A 4EQFA 4AIFA 3MV3B 2VQ2A 2VSYA 3NZSA 4MS6A 2FF4A 4GYYA 1UG3A 3AS8A 3ONKA 4CGWA 5LSZA 3BEEA 3ASDA 3G2WA 4GA2A 3RRMB 2KATA 4J8EA 3PEVB 3SHFA 2XPZA 2FBNA 1WM5A 4I6JA 5LP0A 3CHQA 2DCPA 3OXGA 1HXIA 1ZBPA 5BW8C 3OXFA 4YPEA 4AY5A 1N6CA 3MO0A 5A7DB 2R59A 1YA0A 5ARFA 4IJ8A 1XGWA 3MJWA 4KZ0A 2I6HA 3PS6A 2WPVA 3RO2A 3FEXA 4EBAG 3CBOA 4UI9J 2QY7A 3RAYA 2CFUA 3L08A 3ZGQA 4OVUA 3UT8A 4LCTA 4U63A 2PQNA 4GZ3A 1OUVA 4FP7A 4UQZA 3EDTB 1HZ4A 3D9IA 3PEUB 4TRQA 5FQ6A 4EPZA 5FZSA 3IHVA 3I3NA 1IQUA 3CVXA 1PY1A 2PZIA 4N3AA 4I6EA 1E7UA 4M3OA 3LYAA 3D9LA 3MGBA 4I6GA 3PUKA 4RZ0A 2V0PA 2PM6A 4CDMA 4FJYA 4RG6A 2AXUA 5D0OD 3ZYQA 2W5ZA 3PZDA 2WXQA 3BG1B 2CHZA 3MCXA 3C98A 3Q5MA 2V5FA 3ZVVA 4O30A 5LSXA 4C0MA 2CHXA 2XGOA 1N54A 3BG0B 3PRZA 4N3BA 2GW1A 4J0UA 3ZYMA 3OS5A 4NVQA 4BSXA 1H6KA 2C0MA 3ASGA 1FVHA 4CCAA 1GW6A 5C2YA 5G04J 3QB2A 3FTSA 4JXTA 3IHYA 2VTBA 5AIJA 3AS4A 1Z3YA 3L17A 2VJ8A 1HG5A 3FTVA 1HS6A 3GZ1A 5T0KA 4JLGA 3B7UX 3F9WA 5F6KC 3LEWA 3ESKA 4CEMA 2XGSA 1H19A 4UI9C 3CVLA 2VGXB 3FTZA 2X3MA 3MKQB 3PE4A 4PUCA 2PL2A 3U9WA 3ZEFA 3CVPA 4Q94A 3BO5A 2IOSA 2L6JA 1KT0A 2WXPA 1EYHA 3IKOB 4HXIA 2PM7A 3LPZA 5CMYA 4BX8A 5HQ8A 4YVOA 4UQYA 4LERA 5E76A 1PC2A 4UWGA 1N3JA 2F69A 5ARGA 3FH7A 1H2VC 3RKVA 1E90A 4JHJA 3RO3A 3QDNA 4WNGA 4JHRA 3FU0A 2BUGA 2I1JA 4LRZA 1TEZA 3G2VA 4XKCA 1KT1A 4OYSA 5G05C 4U0UA 4XE0A 4L23A 3FHEA 4A1SA 3HNAA 3AS5A 2WXNA 3G2SA 3KD7A 5EDSA 4B94A 1Y8MA 1HU3A 4JW1A 5BV0A 4LUNU 3RU0A 3PH0C 1N52A 3OTNA 5FQ4A 3D9OA 1HFAA 4UWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AM9 A;  3S8P A;  5KJN A;  2KCK A;  4LEU A;  4CGV A;  3IHX A;  4GPK A;  3ZFW A;  3UPV A;  5EX3 A;  4U07 A;  3HYM B;  4J8O A;  2VYI A;  1NA0 A;  2DBA A;  2QFC A;  2HR2 A;  4MI5 A;  2IFU A;  5JJT A;  2XPI A;  3URZ A;  3Q47 B;  1PEG A;  2J9Q A;  2KCL A;  1ELW A;  4KBQ A;  3M53 A;  3WXX A;  2VGX A;  4J7I A;  5JHN A;  4CDR A;  4AY6 A;  4YNM A;  1IHG A;  4N5C A;  5KJM A;  5C1D A;  5T0M A;  4G24 A;  5EKQ D;  3M58 A;  4APO A;  3K5K A;  3CKC A;  3SW9 A;  1P5Q A;  2UY1 A;  4J8D A;  4E47 A;  4HOS A;  2PQR A;  4I51 A;  4IN3 B;  1MVX A;  2FI7 A;  2C0L A;  3GZ2 A;  3ZHE B;  1QZ2 A;  3RJV A;  3UUX A;  4I17 A;  4MI0 A;  2R3A A;  3Q15 A;  4YVQ C;  1B89 A;  5CCL A;  3F9Z A;  2FO7 A;  5FT9 A;  1A17 A;  5F6L A;  3F9X A;  3F9Y A;  4ABN A;  3TGO A;  1E96 B;  2LSV A;  5AYW D;  3M56 A;  4YPU A;  5G05 J;  3FP3 A;  3QWP A;  1NA3 A;  3QWV A;  4QEO A;  2RFI A;  4BUP A;  1ELR A;  2P58 C;  3MO2 A;  5FTP A;  1N6A A;  4H12 A;  1ZU2 A;  4J83 A;  3SZ7 A;  3VV0 A;  1WAO 1;  4J7F A;  4KXK B;  2WQH A;  4QEN A;  1XQH A;  2JLB A;  5EX0 A;  3JYS A;  2O8J A;  5JIY A;  5EG2 A;  3M55 A;  2LNI A;  4GZ5 A;  4U04 A;  3KS2 A;  3CK8 A;  3MA5 A;  1W3B A;  3TG5 A;  4BWR A;  3LY8 A;  5FZQ A;  5D0Q D;  3K9I A;  2IGQ A;  3KAE A;  3KMT A;  3CVN A;  2C2L A;  4G23 A;  5KJL A;  3Q4A B;  4NRH B;  3N71 A;  1QQE A;  3OXL A;  4XIF A;  4QEP A;  2JV0 A;  4WNE A;  2W5Y A;  2G46 A;  3CBM A;  3QOU A;  4RG9 A;  4XI0 A;  5TH7 A;  5BNW A;  5HI7 A;  5M72 A;  3LCA A;  3CVQ A;  3LKU A;  3M5A A;  3S7J A;  5LCW C;  4BTB A;  2KC7 A;  3SWC A;  1TJC A;  3MKR A;  4ME2 A;  4I9C A;  5CHE E;  2MHK A;  2UWJ G;  5FJY A;  5T5G A;  2LSU A;  2NC9 A;  4NJ5 A;  2R5S A;  4BT8 A;  3U3W A;  3CBP A;  1FCH A;  3M59 A;  3R9A B;  4YPA A;  3S7D A;  2HO1 A;  4BT9 A;  2XEV A;  3TG4 A;  4GA0 A;  1MVH A;  1MT6 A;  1XNF A;  4FMU A;  4UQX A;  4KYO B;  2YQ8 A;  4G25 A;  3OOI A;  3DAL A;  4GYO A;  3Q49 B;  4G26 A;  4HOQ A;  4G1T A;  4IJD A;  3CEQ A;  4G2V A;  1H3I A;  3ASH A;  3CK7 A;  2QPW A;  2XCC A;  3RQ4 A;  3ZN3 A;  4N2S A;  4Y6C A;  3SF4 A;  3S7B A;  1ZKK A;  4WUY A;  5JJ7 A;  3QKY A;  2XGM A;  4I1A A;  2E2E A;  3MV2 B;  3LY7 A;  4H7X A;  5DBK A;  1HH8 A;  1O9S A;  5KJK A;  4JA7 A;  4F3V A;  4O6F A;  3CKB A;  4WND A;  5TEG A;  3VTX A;  3FFL A;  3MO5 A;  3MEK A;  3QWW A;  3E4B A;  3NF1 A;  3DB5 A;  4HOR A;  4C1Q A;  3RJW A;  3IEG A;  2YHC A;  3CV0 A;  3GYZ A;  4GCN A;  2IF4 A;  5LCW J;  3EP0 A;  5TTF A;  3M57 A;  3GW4 A;  4GZ6 A;  3ASF A;  5A6C A;  3ZHE A;  3TAX A;  1KLX A;  2Q7F A;  5AYF A;  2Y4T A;  3FWV A;  5DIZ A;  4NQ0 A;  3OPE A;  2HYZ A;  3ULQ A;  3FPD A;  2BQZ A;  1NZN A;  4U0Z A;  4AU7 A;  2KCV A;  2OOE A;  3CK9 A;  4GA1 A;  4JA9 A;  3KMJ A;  5F59 A;  3O48 A;  3M54 A;  4JDS A;  5JIN A;  4U0S A;  4I9E A;  4HOU A;  4YND A;  4GYW A;  3VTY A;  2Y4U A;  2UY1 B;  2FEZ A;  3S7F A;  4Z4P A;  3U4T A;  2AVP A;  1MUF A;  1IYG A;  4YNP A;  2OND A;  4N3C A;  5JJ6 A;  4HOT A;  4I2Z A;  1ML9 A;  3PDN A;  4LDG A;  5F5E A;  5G04 C;  4GCO A;  4XI9 A;  4W9R A;  3ZPJ A;  4N2Q A;  4UI9 K;  3VUZ A;  2VGY A;  3KMA A;  5CPR B;  5CCM A;  4N39 A;  4Y6W A;  5BT1 A;  4WNF A;  3LY9 A;  5JJ0 A;  4J8F A;  2XCB A;  4BTA A;  3PE3 A;  4JL0 A;  4H7Y A;  5FZR A;  4I2W A;  2VSN A;  4EQF A;  4AIF A;  3MV3 B;  2VQ2 A;  2VSY A;  2FF4 A;  4GYY A;  4CGW A;  3AS8 A;  5LSZ A;  3BEE A;  3ASD A;  4GA2 A;  2KAT A;  4J8E A;  2FBN A;  1WM5 A;  3OXG A;  1HXI A;  1ZBP A;  5BW8 C;  3OXF A;  4YPE A;  4AY5 A;  1N6C A;  3MO0 A;  5A7D B;  1YA0 A;  5ARF A;  4IJ8 A;  2I6H A;  2WPV A;  3RO2 A;  3CBO A;  4UI9 J;  3RAY A;  3ZGQ A;  2PQN A;  4GZ3 A;  1OUV A;  4UQZ A;  3EDT B;  1HZ4 A;  5FZS A;  4N3A A;  2PZI A;  3LYA A;  4RZ0 A;  4RG6 A;  5D0O D;  2W5Z A;  4O30 A;  3Q5M A;  2V5F A;  5LSX A;  2XGO A;  4N3B A;  2GW1 A;  4J0U A;  3OS5 A;  4NVQ A;  2C0M A;  3ASG A;  5G04 J;  3AS4 A;  3GZ1 A;  5T0K A;  4JLG A;  3F9W A;  5F6K C;  3ESK A;  2XGS A;  4UI9 C;  3CVL A;  2VGX B;  3PE4 A;  2PL2 A;  3BO5 A;  3CVP A;  2L6J A;  1KT0 A;  3LPZ A;  5HQ8 A;  4YVO A;  4UQY A;  1PC2 A;  1N3J A;  2F69 A;  5ARG A;  3RO3 A;  3RKV A;  3QDN A;  4WNG A;  4JHR A;  2BUG A;  1KT1 A;  5G05 C;  4U0U A;  4A1S A;  3HNA A;  3AS5 A;  3KD7 A;  4B94 A;  1Y8M A;  3RU0 A;  3RIB A;  3UQ3 A; 
#chains in the Genus database with same CATH topology
 3AG2 E;  4M7C A;  2KCK A;  4CGV A;  4GPK A;  3ZFW A;  1MZC A;  3TXM A;  3LJN A;  1TYQ G;  3HYM B;  4J8O A;  5ENO D;  1S0P A;  2AXZ A;  2Y0B G;  3C3O A;  4B0Z A;  3TJP A;  4MI5 A;  2IFU A;  5JJT A;  4PS8 A;  1IXV A;  1OWP A;  4LNG A;  2WVI A;  4UUC A;  4KBQ A;  3M53 A;  3SNX A;  4ACK A;  2H6G A;  3MKQ A;  3T5V A;  4J7I A;  2OEV A;  4AY6 A;  4YNM A;  2F37 A;  3APD A;  2NSZ A;  3L54 A;  2IOL A;  4L7T A;  2NXP A;  2MYO A;  4APO A;  1V54 E;  3LXU X;  1HX8 A;  1K1A A;  2OVF A;  3JXI A;  2WQ7 A;  4CZ2 D;  2PQR A;  2R02 A;  4IN3 B;  1YYH A;  4JPS A;  1MVX A;  2A5U A;  3P2B A;  4PDX A;  4JVS A;  3QNK A;  3FU5 A;  3RAU A;  3FUD A;  1NP7 A;  3F9Z A;  4V3I A;  5AAO A;  3G2U A;  5EIL A;  2MOW A;  2L0T B;  3V79 K;  3F9X A;  2WXI A;  2AW6 A;  1E96 B;  3AG3 E;  4G8K A;  2HM8 A;  5G05 J;  3QWP A;  3ZRH A;  3NQP A;  2RFI A;  4AV7 A;  3LVQ E;  3MZL B;  3LVR E;  4F1S A;  2YNQ A;  1UJJ A;  5FIN A;  4HRN A;  3VV0 A;  4KXK B;  2P9U G;  4GTV A;  3CST A;  2H6H A;  4WWO A;  1DC2 A;  2EIK E;  3EHM A;  3M55 A;  5AQ9 A;  4UWH A;  4WWN A;  2IEJ A;  4PH4 B;  3CK8 A;  1OWN A;  1G3N B;  2IO3 C;  3LY8 A;  4BWR A;  1PAQ A;  2I1K A;  3LS8 A;  3ZNG A;  2OVB A;  2J4B A;  5HRY A;  1JCR A;  2C2L A;  4KZC A;  3HHM A;  3UTM A;  3VLF A;  4HB5 A;  5BXO A;  1QQE A;  3OXL A;  2B6C A;  3JUE A;  4QEP A;  2JV0 A;  5JHA A;  2G46 A;  3CBM A;  3IBE A;  4XI0 A;  1HO8 A;  3UIO C;  3LCA A;  1TJF A;  3TWR A;  4LNU D;  2E0I A;  3S7J A;  3QAQ A;  2B0O E;  3G2T A;  1U3C A;  1TJC A;  4ME2 A;  2XZT G;  5FJY A;  4C9B B;  2WXO A;  2BTD A;  2P9L G;  3KSL A;  2NC9 A;  5FQ8 A;  4F6R D;  3U3W A;  5KNH D;  5T4Y A;  2YHE A;  3NZU A;  2WXF A;  3S7D A;  3TG4 A;  4FMU A;  2EIJ E;  4EHM A;  2YQ8 A;  1JPL A;  4DLO A;  4TXP A;  4E85 A;  3OOI A;  4DK5 A;  4NUR A;  4XZ4 A;  3JCK C;  2BF0 X;  2IJG X;  4FUL A;  2KZT B;  4G2V A;  3UT7 A;  4DI3 A;  3CHO A;  3SF4 A;  5JJ7 A;  1WY6 A;  2XGM A;  4KT6 B;  4JEH A;  2ION A;  2E2E A;  1S63 A;  1X5B A;  3LY7 A;  1N4Q A;  4O60 A;  4IYP A;  5G2N A;  1MHQ A;  3UM0 A;  1EDU A;  3Q78 A;  4JA7 A;  4DUI A;  4BX9 A;  4U8Y D;  1MYO A;  3LJ3 A;  2RG8 A;  3EIQ C;  4PS7 A;  3FFL A;  5JHB A;  4HNA D;  2GRM A;  4YDW A;  4DI4 A;  3DSW A;  3S2A A;  3EP0 A;  3GW4 A;  3ASF A;  1H0A A;  3ZHE A;  3TAX A;  1U2V G;  2Q7F A;  5AYF A;  3R9M A;  5ANR A;  1O1T A;  3JUI A;  4LNB A;  1TN8 A;  4I1M A;  5CED B;  3QAR A;  4GB9 A;  3FUL A;  1TNO A;  3U66 A;  4GMJ A;  4AU7 A;  2XHE A;  2OOE A;  4X8Q A;  3FUM A;  2GRR B;  4AXH A;  2P9K G;  3FEY A;  4OVV A;  4AVX A;  2FEZ A;  3B7R L;  3S7F A;  4Z4P A;  1MUF A;  1IYG A;  2OND A;  4I2Z A;  3Q79 A;  4LDG A;  5G04 C;  4GCO A;  4XI9 A;  4KVM A;  3ZPJ A;  3SGH A;  3WG7 E;  3VUZ A;  4K03 A;  2OCC E;  5KNG A;  1JUQ A;  5B1A E;  3L16 A;  1Z5S C;  4B93 B;  1E8Y A;  4HRL A;  1KZO A;  1EF1 C;  3LY9 A;  5JJ0 A;  3FTW A;  2Y3A A;  2XCB A;  3ML9 A;  1OWO A;  3HVE A;  2KM4 A;  2XS8 A;  4CT0 A;  2VSY A;  1NFI E;  4MS6 A;  3AS8 A;  4DX5 D;  4L9P A;  3TWQ A;  2KAT A;  3B95 A;  2XPZ A;  4I6J A;  3CHQ A;  1HXI A;  2NYJ A;  3MO0 A;  1YA0 A;  4IJ8 A;  4JB8 P;  1XGW A;  5BXU A;  1DCE A;  3RAY A;  2CFU A;  4Z68 A;  4LCT A;  1OUV A;  3PEU B;  4TXQ A;  4N3A A;  4I6E A;  3LYA A;  3D9L A;  3MGB A;  4I6G A;  4BSZ B;  2PM6 A;  4FJY A;  2W5Z A;  1SW6 A;  4O30 A;  3ZVV A;  2XGO A;  2FO1 E;  3PRZ A;  2J8S D;  3ASG A;  1FVH A;  4CCA A;  3FTS A;  3UKU G;  3AS4 A;  1HS6 A;  1AP7 A;  5T0K A;  4JLG A;  3F9W A;  5ENQ D;  4ZHB A;  2VGX B;  3PE4 A;  3CVP A;  2LUH A;  1EYH A;  4GTR A;  2ZGG A;  4BX8 A;  5HQ8 A;  3F6Q A;  5ARG A;  3Q73 A;  1H2V C;  4XKC A;  4OYS A;  1BU9 A;  4YDO A;  2BKK B;  4U0U A;  4XE0 A;  4A1S A;  4GTM A;  1Y8M A;  4LUN U;  3OTN A;  4UWL A;  4AM9 A;  4DLQ A;  2QYJ A;  4YDY A;  3S8P A;  3NAW A;  4F7A A;  3SBS A;  3L22 A;  3CR3 A;  2QFC A;  3NB2 A;  3PNL B;  2LO6 A;  3T5X A;  1NL4 A;  5D66 A;  4L2Y A;  3CHR A;  1PEG A;  2KCL A;  1ELW A;  3CQC B;  3WXX A;  3UXG A;  4DX6 D;  3ZYK A;  3SO8 A;  5T0M A;  3EHQ A;  1TNZ A;  5EKQ D;  2P9P G;  2I9C A;  4CT4 A;  4ILG A;  3RRN B;  3R7Q A;  2JEK A;  3PVL A;  1WG0 A;  4GML A;  2CHW A;  3ENE A;  3SI5 A;  4J8D A;  1FPP A;  3SFY A;  2KXP C;  1INZ A;  1BD8 A;  1H6O A;  4ILH B;  3ZHE B;  1QZ2 A;  1IQR A;  1E7V A;  3FUK A;  4I17 A;  2R3A A;  4YVQ C;  1B89 A;  2R17 C;  2WMN A;  3D3M A;  1A17 A;  1TN7 A;  5F6L A;  2BKG A;  2XZD G;  5CEA A;  5J08 A;  3APF A;  1NA3 A;  3QWV A;  4RLY A;  4BUP A;  3ZU7 B;  4EZK A;  4JD2 G;  3MO2 A;  5CRV A;  3NOC D;  4H12 A;  1N4P A;  1VDY A;  3DBS A;  4FJZ A;  3ZXP A;  2V4H C;  2WXR A;  5JMN D;  2AJA A;  3TWW A;  1XQH A;  2JLB A;  4GU5 A;  1MJ0 A;  5EX0 A;  2GRO B;  4FC8 A;  1MX2 A;  3OAW A;  3APC A;  4GZ5 A;  2P2C P;  4HS2 A;  4U04 A;  5ANL A;  4J7W A;  3KS2 A;  3DPY A;  3MA5 A;  5BPP A;  5D0Q D;  2IGQ A;  3CVN A;  2XS1 A;  3FH8 A;  3FUN A;  2ETB A;  4NRH B;  2ETC A;  2GGF A;  3O4Z A;  1TNB A;  2X38 A;  3FU6 A;  4XIF A;  3MX3 A;  2WXL A;  4BES A;  5AJD A;  2J49 A;  2LAH A;  3B7T A;  3I5P A;  3ESL A;  2F8X K;  3CVQ A;  3LKU A;  3M5A A;  3EU9 A;  5LCW C;  4BTB A;  2KC7 A;  1H2T C;  1BI7 B;  1NI1 A;  4J8S A;  4HQD A;  5T5G A;  3RK6 A;  4ANW A;  4FU3 A;  4BT8 A;  3CBP A;  3TXN A;  4BT9 A;  2WXJ A;  1MT6 A;  3T8K A;  3EIJ A;  2ETA A;  4B8A A;  4GTP A;  4ANX A;  3TL5 A;  1DCQ A;  3BQO A;  1DVP A;  4K5B A;  4G26 A;  2ZU6 B;  4G1T A;  2DZN A;  3CK7 A;  2QPW A;  4FLB A;  4Y6C A;  3FUJ A;  3S7B A;  1ZKK A;  5IY5 E;  3CQG B;  5AEN A;  4DX7 D;  2OEW A;  5DBK A;  4LG6 A;  1X81 A;  4O6F A;  4GZD A;  1IHB A;  3RSE G;  3MEK A;  3D9K A;  3NF1 A;  5T8I A;  4KMO A;  2PNN A;  3RJW A;  2YHC A;  5KWD A;  4GCN A;  5A23 A;  2IF4 A;  4CYM D;  5BUZ A;  3SFZ A;  2ZXW E;  5EID A;  3L6A A;  1MX6 A;  3ULQ A;  2WXM A;  2BQZ A;  1NZN A;  5D2M C;  4ACL A;  3QK0 A;  4FLH A;  3C72 A;  2GRN B;  2KCV A;  2IQC A;  5ITZ F;  3HXD A;  1L5J A;  3HXC A;  4I9E A;  4YND A;  3VTY A;  2Y4U A;  4NIK A;  2CG2 A;  1N0R A;  3V30 A;  1BI8 B;  2VSO E;  1TN6 A;  4D10 C;  2AVP A;  1SA4 A;  2A4Z A;  2QC9 A;  3Q9N C;  2LXM A;  5JJ6 A;  3ABK E;  5F5E A;  4W9R A;  3QC1 A;  1OXJ A;  4UI9 K;  2VGY A;  5CER B;  3KMA A;  5CPR B;  4WNF A;  1N11 A;  1KPS B;  4ILI A;  4O1P A;  3PRE A;  4GTS A;  4J8F A;  3J5P A;  3PE3 A;  4JZY A;  2VQ2 A;  2RKK A;  4GYY A;  4CGW A;  3PZ2 A;  3G2W A;  4J8E A;  1QYM A;  2FBN A;  1WM5 A;  1ZBP A;  1N6C A;  5A7D B;  5ARF A;  2QY7 A;  3EUV A;  4OVU A;  3UT8 A;  4GZ3 A;  3L9T A;  3EDT B;  3D9I A;  3IHV A;  1IQU A;  3CVX A;  1PY1 A;  2PZI A;  4RZ0 A;  3DSX A;  4CDM A;  1N54 A;  4N3B A;  2GW1 A;  3DEP A;  5AQA A;  4J0U A;  3DRA A;  3OS5 A;  5EIB E;  4NVQ A;  4BSX A;  5C2Y A;  5ENT D;  3DXK G;  2VGE A;  3GZ1 A;  3B7U X;  3ESK A;  5JA4 D;  1H19 A;  4UI9 C;  3KSQ A;  3MKQ B;  3FTZ A;  3U9W A;  1FT2 A;  4Q94 A;  1KT0 A;  2WXP A;  4GTT A;  2XEH A;  4HXI A;  2PM7 A;  5CMY A;  4LER A;  1N3J A;  3RKV A;  4JHJ A;  3FU0 A;  3Q75 A;  1TEZ A;  1KT1 A;  5G05 C;  3FHE A;  2WXN A;  4JW1 A;  3PH0 C;  4OAV B;  3RIB A;  1LTX A;  2IO2 C;  2P9S G;  2J09 A;  1S70 B;  4IUL A;  3X2Q E;  2X6I A;  2DIW A;  4LEU A;  2CFZ A;  3D9P A;  4TXR A;  5EX3 A;  4U07 A;  2VYI A;  1NA0 A;  2DBA A;  4K0R A;  3UM1 A;  3UT4 A;  4EBA A;  4HFG A;  4HI8 A;  5FIO A;  3RRU A;  1ELK A;  1N9A A;  2QZA A;  4HLL A;  2XPI A;  5CMW A;  1QNF A;  2QYU A;  1RW2 A;  1OCZ E;  4EEC A;  3W9G A;  5C1D A;  1EPU A;  4G24 A;  4DX1 A;  4UWK A;  5CRU A;  3DSS A;  3SW9 A;  3KEZ A;  1P5Q A;  1Z3X A;  3ULY A;  3ZXS A;  4GAA A;  4HOS A;  4FAD A;  3ZKJ A;  2C0L A;  2R03 A;  5T3R A;  3GZ2 A;  3J5Q B;  2AWI A;  2LAI A;  3UUX A;  3R7R A;  2M63 A;  3P1U A;  5CCL A;  3ABM E;  2J07 A;  3HG0 D;  3F9Y A;  1MX4 A;  2LSV A;  5AYW D;  4I1O B;  1SZA A;  3M56 A;  4YPU A;  2J4D A;  3T8M A;  2ZIR A;  4L2L A;  4QEO A;  1H2U A;  1ELR A;  3FDH A;  1ZU2 A;  2XRY A;  1MQS A;  4J83 A;  1D8E A;  4I43 A;  3V2O A;  3HDX A;  1K8K G;  3E30 A;  4J7F A;  1UN9 A;  3DXM G;  4QEN A;  4RQI A;  3FUH A;  2WXK A;  3JYS A;  2O8J A;  3GZS A;  1N95 A;  1LF8 A;  2WM9 A;  3C3R A;  3IV0 A;  1W3B A;  3E37 A;  2EIL E;  2F8Y A;  5FZQ A;  3PZ3 A;  3KAE A;  3KMT A;  3V2X A;  4OAU C;  1E8W A;  5KJL A;  3TWX A;  3C3Q A;  4KVO A;  3N71 A;  3TWT A;  1E8X A;  5FQ7 A;  2WQ6 A;  4J6I A;  2WMO A;  4WNE A;  3PUJ A;  2W5Y A;  3QOU A;  4U95 D;  5KCM A;  2F0Y A;  2V5Q C;  3SY2 A;  5M72 A;  5HI7 A;  2IY0 C;  2CG3 A;  5EYP F;  3T9K A;  1BPO A;  3MKR A;  4P29 A;  1WDY A;  5CHE E;  2MHK A;  2UWJ G;  4A3V A;  3D9H A;  4NJ5 A;  2R5S A;  3CIA A;  4E6H A;  1OCR E;  2EIM E;  2DVW A;  3HXF A;  1MVH A;  1TR4 A;  2WB2 A;  1UW4 B;  4UQX A;  3AU4 A;  4KYO B;  3CVV A;  1Z6T A;  4G25 A;  2DYR E;  2R05 A;  1SA5 A;  3DAL A;  5ENN A;  3DSV A;  3Q49 B;  2GRP B;  5B1B E;  4UWF A;  4WWP A;  3FH5 A;  3CEQ A;  2X6F A;  3SD5 A;  3ASH A;  3Q9U C;  2EQX A;  4FA6 A;  4WUY A;  3QKY A;  2XRZ A;  2MRI A;  1IKN D;  3FTX A;  2XQ0 A;  5ENP D;  1O9S A;  2HE0 A;  1H6P A;  5KJK A;  4YDE A;  3CKB A;  4WND A;  4DRX E;  2ZGD A;  4DX2 A;  4BER A;  2I2O A;  1ZB1 A;  2RFM A;  3QWW A;  3E4B A;  3DB5 A;  3E32 A;  4GTQ A;  4LSZ E;  1O1R A;  3E33 A;  3PNT B;  5J90 A;  5TTF A;  2X6K A;  4HI9 A;  2KZT A;  5B3S E;  4GZ6 A;  5A6C A;  4U8H A;  4L1B A;  1JWG A;  2ILR A;  2Y4T A;  3FWV A;  4NQ0 A;  3ZW3 A;  2HYZ A;  2AXV A;  3LDZ A;  1D9S A;  4A1G A;  4U0Z A;  4N5Q A;  3CHP A;  3EJN A;  3HVE B;  3DWL G;  3CK9 A;  4GA1 A;  4JA9 A;  3KMJ A;  5ENS D;  5LFA A;  2L6B A;  3UM3 A;  4JDS A;  1TNY A;  1SQM A;  3UM2 A;  4FHK A;  2GRQ B;  3JQ0 A;  4FHJ A;  2LXL A;  3L13 A;  4YNP A;  4N3C A;  4HOT A;  1ML9 A;  2Y1L E;  1UJK A;  3TWS A;  4J8Y A;  1Y6I A;  3D9J A;  1N94 A;  5CCM A;  4QFV A;  3FUF A;  4Q96 A;  4N39 A;  4Y6W A;  4EZL A;  4BET A;  2DZO A;  5HS0 A;  3VLD A;  2H6I A;  1FVF A;  4C0E A;  1QBQ A;  4EQF A;  4AIF A;  3MV3 B;  3NZS A;  1UG3 A;  3ONK A;  3BEE A;  4GA2 A;  3RRM B;  3PEV B;  1LD7 A;  3W9F A;  4YPE A;  3OXF A;  2R59 A;  4KZ0 A;  3PS6 A;  5H7P A;  3RO2 A;  4EBA G;  4UI9 J;  1SVX A;  3ZGQ A;  3NBN B;  2PQN A;  4UQZ A;  1HZ4 A;  4TRQ A;  3I3N A;  1E7U A;  2V0P A;  4RG6 A;  3ZYQ A;  3PZD A;  2WXQ A;  3BG1 B;  2CHZ A;  3Q5M A;  2V5F A;  5LSX A;  1Q2Z A;  2KBX A;  1O1S A;  2C0M A;  1GW6 A;  5G04 J;  2DWZ A;  3QB2 A;  2VTB A;  3IHY A;  3L17 A;  1HG5 A;  3NOG D;  3FTV A;  5F6K C;  3LEW A;  4CEM A;  3IXE A;  2XGS A;  3CVL A;  4PUC A;  3ZEF A;  2XEN A;  1JCQ A;  3ULE G;  3SFX A;  3PZ4 A;  3IKO B;  3LPZ A;  4YVO A;  5E76 A;  4GPM A;  3DST A;  2F69 A;  3FH7 A;  3RO3 A;  1E90 A;  3QDN A;  4JHR A;  4LRZ A;  3KEA A;  3G2V A;  3ASO E;  3EU5 A;  5EDS A;  4B94 A;  5BV0 A;  3RU0 A;  3PDN A;  3UQ3 A;  5FQ4 A;  1AWC B;  3CVY A;  3ZIM A;  5KJN A;  4F53 A;  3CLJ A;  3IHX A;  3HRA A;  3UPV A;  3ASN E;  4U7E B;  3PZ1 A;  2HR2 A;  3CHS A;  2VSX E;  3URZ A;  3Q47 B;  2J9Q A;  3ML8 A;  3UX4 A;  2VGX A;  3UKR G;  4MKT A;  5JHN A;  4CDR A;  3I4R B;  3TWV A;  3TWU A;  1YMP A;  3Q7A A;  1IHG A;  3CHM A;  2JAB A;  4N5C A;  5KJM A;  4A63 B;  1V55 E;  3AJI A;  3M58 A;  3K5K A;  3CKC A;  4HLE A;  2XPY A;  5FWQ A;  4XKB A;  2YIN A;  4HRM B;  3EHR A;  2UY1 A;  4G8L A;  3CVU A;  4E47 A;  4I51 A;  1LD8 A;  3E34 A;  2FI7 A;  5AQB A;  5G55 A;  5EN5 D;  4URK A;  3FU3 A;  2V4L A;  3RJV A;  4MLP A;  4MI0 A;  1N0Q A;  3Q15 A;  3QJZ A;  2FO7 A;  5FT9 A;  2L9B A;  5AAR A;  4F1P A;  4ABN A;  2X6H A;  3TGO A;  3VLE A;  4U8V D;  3FP3 A;  3I4G A;  5LOZ A;  4TV3 A;  4TUU A;  5AQ7 A;  2H6F A;  2GRL A;  3D9M A;  3CVW A;  2P58 C;  5FTP A;  1N6A A;  4CRW A;  4XEI G;  1FT1 A;  4JEU A;  3SZ7 A;  2L0I A;  1WAO 1;  3JXJ A;  1TNU A;  1OWM A;  4AEZ C;  2WQH A;  4K5A B;  5JIY A;  3FTY A;  5EG2 A;  4WAF A;  1K1B A;  2LNI A;  1OT8 A;  1KZP A;  4NAC A;  3TG5 A;  3K9I A;  2FUL A;  3JQ1 A;  4DJA A;  5LX8 A;  4HBD A;  4G23 A;  3Q4A B;  4RVB A;  1OCC E;  1A5E A;  3L82 A;  3CGH A;  4A3T A;  1BLX B;  4PS3 A;  3SBT B;  3MYV A;  4GZC A;  1UN8 A;  2EIN E;  4RG9 A;  5TH7 A;  3HXE A;  5BNW A;  3AAA C;  2RD0 A;  3SWC A;  3FTU A;  3ABL E;  4I9C A;  5KBA A;  2LSU A;  4B8C B;  2J08 A;  1FCH A;  3M59 A;  3R9A B;  4YPA A;  2HO1 A;  2XEV A;  4ANV A;  4GA0 A;  3AU5 A;  1XNF A;  4BEP A;  4MRU A;  1S64 A;  4R7L A;  1U3D A;  4EZJ A;  3B7S A;  2Y69 E;  1SZ9 A;  4GYO A;  4HVB A;  4Q69 A;  4HOQ A;  3ZUV B;  3BU8 A;  4IJD A;  4QQI A;  1N4R A;  1H3I A;  1OWL A;  3ZYL A;  2XCC A;  4JC8 A;  3RQ4 A;  5CEC B;  3ZN3 A;  4N2S A;  2VTB B;  1N4S A;  1DNP A;  4BFR A;  4CDN A;  4AJW A;  4I1A A;  2DYS E;  2ZIS A;  3MV2 B;  3UIP C;  4H7X A;  1HH8 A;  3DEO A;  3ISM C;  4APF A;  1HF8 A;  4F3V A;  4U96 D;  1JCS A;  3FUI A;  5TEG A;  1OCO E;  5E75 A;  3VTX A;  4MBG A;  3MO5 A;  3BUA A;  4AP2 A;  1RZ4 A;  4HOR A;  4B89 A;  4C1Q A;  4AOF A;  1HE8 A;  3V31 A;  2R2L A;  3IEG A;  4BY6 A;  3CV0 A;  3GYZ A;  5LCW J;  1E8Z A;  3M57 A;  3SQV A;  1D8D A;  2WXG A;  4DPR A;  2V8S E;  3EHN A;  4ATZ D;  1KLX A;  3CSF A;  5DIZ A;  1JWF A;  3OPE A;  2RFA A;  4G11 A;  3FPD A;  3ONL A;  5AJL A;  5CBN A;  2IU1 A;  3B13 A;  5BV1 A;  4K5C A;  4ATG A;  4XX5 A;  4O1O A;  5F59 A;  3O48 A;  4ANU A;  3M54 A;  5JIN A;  4U0S A;  4HOU A;  4GYW A;  2P9I G;  2UY1 B;  4JHK A;  3U4T A;  3DPD A;  1HG2 A;  4A55 A;  4N2Q A;  3U64 A;  2X6J A;  4RSY A;  2WXH A;  5BT1 A;  3FUE A;  2OV8 A;  3HIZ A;  4IRU A;  3UMV A;  4BTA A;  5CBO A;  4JL0 A;  4H7Y A;  5FZR A;  4I2W A;  3FY4 A;  2VSN A;  3D9N A;  5HKP A;  1YCS B;  2FF4 A;  3UI2 A;  5LSZ A;  4C48 B;  4TUM A;  3ASD A;  2XEE A;  3SHF A;  5LP0 A;  2DCP A;  3OXG A;  3UIN C;  5BW8 C;  4AY5 A;  1OY3 D;  3MJW A;  2I6H A;  1O5M A;  2WPV A;  3FEX A;  3CBO A;  2BED A;  3AG4 E;  3AG1 E;  3L08 A;  3DSU A;  4U63 A;  1UOH A;  4FP7 A;  5FQ6 A;  4EPZ A;  5FZS A;  4M3O A;  3PUK A;  2AXU A;  5D0O D;  4GMR A;  4GTO A;  3MCX A;  3C98 A;  4ZFH A;  4C0M A;  2CHX A;  5ENR D;  3BG0 B;  3HXB A;  3ZYM A;  5AN8 A;  1H6K A;  1K3Z D;  4JXT A;  5AIJ A;  2A5E A;  1Z3Y A;  2VJ8 A;  2P9N G;  2X3M A;  2PL2 A;  3BO5 A;  2IOS A;  2L6J A;  5EYL A;  4UQY A;  1PC2 A;  4UWG A;  4WNG A;  2BUG A;  2I1J A;  3Q7F A;  3B7B A;  3C5R A;  4L23 A;  3HNA A;  3AS5 A;  3G2S A;  3KD7 A;  1HU3 A;  1N52 A;  3D9O A;  1HFA A; 
#chains in the Genus database with same CATH homology
 3CVY A;  2J09 A;  4AM9 A;  4IUL A;  4DLQ A;  3ZIM A;  5KJN A;  2X6I A;  3S8P A;  4F53 A;  2DIW A;  2KCK A;  4LEU A;  3CLJ A;  4CGV A;  3IHX A;  4F7A A;  4GPK A;  3ZFW A;  2CFZ A;  3D9P A;  3TXM A;  5EX3 A;  3UPV A;  4U07 A;  3HYM B;  3L22 A;  3SBS A;  4J8O A;  2VYI A;  3CR3 A;  1NA0 A;  2DBA A;  2QFC A;  4K0R A;  1S0P A;  2AXZ A;  2LO6 A;  3PNL B;  3UT4 A;  3T5X A;  4EBA A;  4HFG A;  4B0Z A;  3TJP A;  3RRU A;  1ELK A;  2HR2 A;  4MI5 A;  3CHS A;  2IFU A;  5CMW A;  2XPI A;  2VSX E;  1QNF A;  4L2Y A;  4PS8 A;  3URZ A;  5JJT A;  3CHR A;  1OWP A;  2WVI A;  3Q47 B;  1PEG A;  2J9Q A;  2KCL A;  1ELW A;  3ML8 A;  4KBQ A;  3M53 A;  3SNX A;  3CQC B;  3UX4 A;  4ACK A;  3WXX A;  3T5V A;  3MKQ A;  2VGX A;  4J7I A;  3ZYK A;  4MKT A;  5JHN A;  4CDR A;  4EEC A;  4AY6 A;  4YNM A;  3APD A;  3I4R B;  1IHG A;  3CHM A;  4N5C A;  5KJM A;  5C1D A;  5T0M A;  2NSZ A;  1EPU A;  4G24 A;  3L54 A;  4UWK A;  2IOL A;  5EKQ D;  4L7T A;  2NXP A;  2I9C A;  3M58 A;  4APO A;  3LXU X;  1HX8 A;  4CT4 A;  3K5K A;  3CKC A;  4ILG A;  4HLE A;  3RRN B;  3R7Q A;  2JEK A;  2OVF A;  2XPY A;  3PVL A;  4GML A;  2YIN A;  2CHW A;  4XKB A;  5FWQ A;  2WQ7 A;  3SW9 A;  3ENE A;  3KEZ A;  1P5Q A;  3SI5 A;  2UY1 A;  4J8D A;  3CVU A;  4E47 A;  1Z3X A;  3ZXS A;  4GAA A;  4HOS A;  2PQR A;  1INZ A;  4I51 A;  4IN3 B;  4FAD A;  4JPS A;  1MVX A;  2A5U A;  3P2B A;  2FI7 A;  4PDX A;  2C0L A;  4JVS A;  3QNK A;  4ILH B;  5G55 A;  5T3R A;  3GZ2 A;  4URK A;  2AWI A;  3FU3 A;  1QZ2 A;  2V4L A;  1IQR A;  1E7V A;  3FU5 A;  2LAI A;  3FUK A;  4MLP A;  3RJV A;  3UUX A;  4I17 A;  4MI0 A;  2R3A A;  3FUD A;  3R7R A;  2M63 A;  1NP7 A;  3Q15 A;  3P1U A;  4YVQ C;  1B89 A;  2R17 C;  3QJZ A;  5CCL A;  2WMN A;  2FO7 A;  3D3M A;  3F9Z A;  2J07 A;  1A17 A;  4V3I A;  5FT9 A;  3RIB A;  2L9B A;  3G2U A;  2MOW A;  2L0T B;  5F6L A;  3F9X A;  3F9Y A;  2WXI A;  2AW6 A;  4ABN A;  2X6H A;  3TGO A;  1E96 B;  2LSV A;  5AYW D;  4I1O B;  2HM8 A;  1SZA A;  3M56 A;  4YPU A;  3VLE A;  5G05 J;  5J08 A;  2J4D A;  3FP3 A;  3T8M A;  3APF A;  1NA3 A;  3I4G A;  3QWP A;  4L2L A;  3QWV A;  4TV3 A;  4TUU A;  5LOZ A;  3ZRH A;  4QEO A;  2GRL A;  3NQP A;  1H2U A;  1ELR A;  2RFI A;  4AV7 A;  3D9M A;  3CVW A;  4BUP A;  4EZK A;  3LVQ E;  3MZL B;  3LVR E;  3FDH A;  2P58 C;  3MO2 A;  5FTP A;  1N6A A;  4H12 A;  4F1S A;  1ZU2 A;  2XRY A;  1MQS A;  4J83 A;  4CRW A;  1VDY A;  2YNQ A;  4I43 A;  3HDX A;  1UJJ A;  3DBS A;  4FJZ A;  4JEU A;  3SZ7 A;  2WXR A;  2L0I A;  3VV0 A;  1WAO 1;  4J7F A;  4KXK B;  1UN9 A;  1OWM A;  4AEZ C;  2WQH A;  4QEN A;  3CST A;  1XQH A;  2JLB A;  3FUH A;  2WXK A;  4GU5 A;  5EX0 A;  4WWO A;  3JYS A;  4FC8 A;  2O8J A;  5JIY A;  3GZS A;  3FTY A;  3EHM A;  3OAW A;  5EG2 A;  3APC A;  4WAF A;  2LNI A;  3M55 A;  4GZ5 A;  4UWH A;  1LF8 A;  4HS2 A;  4U04 A;  4WWN A;  2WM9 A;  3IV0 A;  5ANL A;  4PH4 B;  3KS2 A;  4NAC A;  3CK8 A;  3MA5 A;  1W3B A;  3TG5 A;  1OWN A;  4BWR A;  3LY8 A;  5BPP A;  5FZQ A;  5D0Q D;  3K9I A;  1PAQ A;  2FUL A;  3JQ1 A;  2I1K A;  3LS8 A;  2IGQ A;  3KAE A;  4DJA A;  5LX8 A;  3KMT A;  3CVN A;  2OVB A;  2J4B A;  1E8W A;  3FH8 A;  3FUN A;  2C2L A;  4G23 A;  4KZC A;  3HHM A;  5KJL A;  3Q4A B;  3VLF A;  4NRH B;  4KVO A;  2GGF A;  3N71 A;  4RVB A;  1QQE A;  3O4Z A;  3OXL A;  2X38 A;  3FU6 A;  1E8X A;  5FQ7 A;  4XIF A;  2WQ6 A;  3CGH A;  4A3T A;  3UQ3 A;  2JV0 A;  4QEP A;  4PS3 A;  4J6I A;  2WMO A;  4WNE A;  3PUJ A;  5JHA A;  2G46 A;  2W5Y A;  3MX3 A;  2WXL A;  3CBM A;  3IBE A;  3QOU A;  5AJD A;  5KCM A;  3SBT B;  2J49 A;  3MYV A;  4GZC A;  1UN8 A;  4RG9 A;  2LAH A;  3B7T A;  3I5P A;  4XI0 A;  1HO8 A;  5TH7 A;  5BNW A;  5HI7 A;  3ESL A;  5M72 A;  3LCA A;  1TJF A;  2E0I A;  3CVQ A;  2CG3 A;  3LKU A;  3M5A A;  3S7J A;  5LCW C;  4BTB A;  2RD0 A;  2KC7 A;  1H2T C;  3G2T A;  3QAQ A;  3SWC A;  1U3C A;  1BPO A;  1TJC A;  3MKR A;  4ME2 A;  3FTU A;  4P29 A;  4I9C A;  4J8S A;  5CHE E;  2MHK A;  2UWJ G;  5FJY A;  4A3V A;  4C9B B;  2WXO A;  5T5G A;  2LSU A;  3RK6 A;  2BTD A;  4FU3 A;  4ANW A;  4B8C B;  2NC9 A;  5FQ8 A;  4NJ5 A;  2R5S A;  3CIA A;  2J08 A;  4BT8 A;  4E6H A;  3TXN A;  3U3W A;  1FCH A;  3CBP A;  3M59 A;  3R9A B;  5T4Y A;  2YHE A;  3NZU A;  2WXF A;  4YPA A;  3S7D A;  2HO1 A;  4BT9 A;  2XEV A;  3TG4 A;  4GA0 A;  4ANV A;  2WXJ A;  1MT6 A;  1MVH A;  3AU5 A;  1XNF A;  4MRU A;  4FMU A;  2WB2 A;  1UW4 B;  4UQX A;  3AU4 A;  3EIJ A;  4KYO B;  4R7L A;  1U3D A;  2YQ8 A;  4B8A A;  4EZJ A;  3B7S A;  3CVV A;  1Z6T A;  4G25 A;  1JPL A;  4ANX A;  3TL5 A;  4DLO A;  3OOI A;  4E85 A;  1SZ9 A;  3DAL A;  4DK5 A;  4NUR A;  5ENN A;  4GYO A;  3Q49 B;  4HVB A;  4XZ4 A;  4Q69 A;  3JCK C;  1DVP A;  4G26 A;  4UWF A;  2BF0 X;  2IJG X;  3FH5 A;  4HOQ A;  4WWP A;  2ZU6 B;  4G1T A;  4FUL A;  2KZT B;  3CEQ A;  4G2V A;  3UT7 A;  4DI3 A;  1OWL A;  2X6F A;  3SD5 A;  3ASH A;  1H3I A;  3ZYL A;  3CK7 A;  2QPW A;  2XCC A;  4JC8 A;  3RQ4 A;  3ZN3 A;  2EQX A;  4N2S A;  2VTB B;  4FLB A;  4Y6C A;  3CHO A;  3FUJ A;  3SF4 A;  1DNP A;  4FA6 A;  4BFR A;  4CDN A;  3S7B A;  1ZKK A;  4WUY A;  5JJ7 A;  1WY6 A;  3QKY A;  2XRZ A;  3CQG B;  4AJW A;  5AEN A;  2XGM A;  4KT6 B;  4I1A A;  4JEH A;  2MRI A;  2ION A;  2E2E A;  3MV2 B;  1X5B A;  3FTX A;  3LY7 A;  4H7X A;  5DBK A;  2XQ0 A;  4IYP A;  1HH8 A;  5G2N A;  1O9S A;  1MHQ A;  1EDU A;  5KJK A;  4APF A;  1HF8 A;  4JA7 A;  4F3V A;  4O6F A;  3ZHE B;  3CKB A;  4WND A;  4GZD A;  3FUI A;  4BX9 A;  5TEG A;  2I2O A;  5E75 A;  3LJ3 A;  2RG8 A;  3VTX A;  3EIQ C;  4PS7 A;  3FFL A;  3MO5 A;  5JHB A;  3MEK A;  3D9K A;  3QWW A;  4AP2 A;  3E4B A;  3NF1 A;  3DB5 A;  4HOR A;  4B89 A;  4C1Q A;  4AOF A;  5T8I A;  4KMO A;  1HE8 A;  2GRM A;  3RJW A;  3IEG A;  4DI4 A;  2YHC A;  4BY6 A;  3CV0 A;  3GYZ A;  3S2A A;  3PNT B;  4GCN A;  5A23 A;  2IF4 A;  5LCW J;  1E8Z A;  5J90 A;  3EP0 A;  5TTF A;  3M57 A;  3GW4 A;  5BUZ A;  2X6K A;  2KZT A;  2WXG A;  4GZ6 A;  3ASF A;  1H0A A;  4DPR A;  5A6C A;  2V8S E;  3EHN A;  4U8H A;  3SFZ A;  3ZHE A;  4L1B A;  3TAX A;  1KLX A;  1JWG A;  2ILR A;  2Q7F A;  5AYF A;  2Y4T A;  3FWV A;  3CSF A;  5DIZ A;  1JWF A;  5ANR A;  3L6A A;  4NQ0 A;  3ZW3 A;  3OPE A;  3JUI A;  2HYZ A;  3ULQ A;  4G11 A;  2AXV A;  2WXM A;  3FPD A;  2BQZ A;  3ONL A;  1NZN A;  3LDZ A;  4I1M A;  5AJL A;  4ACL A;  4A1G A;  3QAR A;  3QK0 A;  4GB9 A;  4U0Z A;  2IU1 A;  3B13 A;  3FUL A;  4FLH A;  5BV1 A;  3CHP A;  3EJN A;  4ATG A;  4XX5 A;  3HVE B;  3U66 A;  4GMJ A;  4AU7 A;  2KCV A;  2IQC A;  2XHE A;  2OOE A;  1L5J A;  3CK9 A;  4GA1 A;  4JA9 A;  3KMJ A;  3FUM A;  5F59 A;  3O48 A;  4ANU A;  5LFA A;  4AXH A;  3M54 A;  4JDS A;  5JIN A;  4U0S A;  4I9E A;  4HOU A;  4YND A;  3FEY A;  1SQM A;  4GYW A;  4OVV A;  4FHK A;  4AVX A;  3VTY A;  2Y4U A;  2CG2 A;  2UY1 B;  2FEZ A;  3B7R L;  4JHK A;  3JQ0 A;  2VSO E;  3S7F A;  4D10 C;  4Z4P A;  4FHJ A;  2AVP A;  3U4T A;  3DPD A;  1MUF A;  1IYG A;  1HG2 A;  3L13 A;  2A4Z A;  4YNP A;  2OND A;  4N3C A;  5JJ6 A;  4HOT A;  4I2Z A;  1ML9 A;  3PDN A;  4LDG A;  1UJK A;  5F5E A;  5G04 C;  4GCO A;  4XI9 A;  4KVM A;  4W9R A;  3QC1 A;  4A55 A;  3ZPJ A;  3SGH A;  4N2Q A;  3U64 A;  1Y6I A;  2X6J A;  4UI9 K;  3D9J A;  3VUZ A;  4K03 A;  2VGY A;  3KMA A;  5CPR B;  4RSY A;  5CCM A;  4QFV A;  3FUF A;  2WXH A;  4N39 A;  4Q96 A;  1JUQ A;  4Y6W A;  5BT1 A;  4WNF A;  3L16 A;  4EZL A;  3FUE A;  1E8Y A;  3VLD A;  4IJD A;  2OV8 A;  3HIZ A;  4ILI A;  4IRU A;  1EF1 C;  3LY9 A;  5JJ0 A;  3FTW A;  2Y3A A;  3PRE A;  4J8F A;  1FVF A;  2XCB A;  3UMV A;  3ML9 A;  1OWO A;  4BTA A;  3PE3 A;  3HVE A;  2KM4 A;  4JL0 A;  4C0E A;  4H7Y A;  5FZR A;  4I2W A;  3FY4 A;  2VSN A;  4JZY A;  3D9N A;  4CT0 A;  4EQF A;  4AIF A;  3MV3 B;  2VQ2 A;  2VSY A;  3NZS A;  4MS6 A;  2FF4 A;  4GYY A;  1UG3 A;  3AS8 A;  3ONK A;  4CGW A;  5LSZ A;  3BEE A;  3ASD A;  3G2W A;  4GA2 A;  3RRM B;  2KAT A;  4J8E A;  3PEV B;  3SHF A;  2XPZ A;  2FBN A;  1WM5 A;  4I6J A;  5LP0 A;  3CHQ A;  2DCP A;  3OXG A;  1HXI A;  1ZBP A;  5BW8 C;  3OXF A;  4YPE A;  4AY5 A;  1N6C A;  3MO0 A;  5A7D B;  2R59 A;  1YA0 A;  5ARF A;  4IJ8 A;  1XGW A;  3MJW A;  4KZ0 A;  2I6H A;  3PS6 A;  2WPV A;  3RO2 A;  3FEX A;  4EBA G;  3CBO A;  4UI9 J;  2QY7 A;  3RAY A;  2CFU A;  3L08 A;  3ZGQ A;  4OVU A;  3UT8 A;  4LCT A;  4U63 A;  2PQN A;  4GZ3 A;  1OUV A;  4FP7 A;  4UQZ A;  3EDT B;  1HZ4 A;  3D9I A;  3PEU B;  4TRQ A;  5FQ6 A;  4EPZ A;  5FZS A;  3IHV A;  3I3N A;  1IQU A;  3CVX A;  1PY1 A;  2PZI A;  4N3A A;  4I6E A;  1E7U A;  4M3O A;  3LYA A;  3D9L A;  3MGB A;  4I6G A;  3PUK A;  4RZ0 A;  2V0P A;  2PM6 A;  4CDM A;  4FJY A;  4RG6 A;  2AXU A;  5D0O D;  3ZYQ A;  2W5Z A;  3PZD A;  2WXQ A;  3BG1 B;  2CHZ A;  3MCX A;  3C98 A;  3Q5M A;  2V5F A;  3ZVV A;  4O30 A;  5LSX A;  4C0M A;  2CHX A;  2XGO A;  1N54 A;  3BG0 B;  3PRZ A;  4N3B A;  2GW1 A;  4J0U A;  3ZYM A;  3OS5 A;  4NVQ A;  4BSX A;  1H6K A;  2C0M A;  3ASG A;  1FVH A;  4CCA A;  1GW6 A;  5C2Y A;  5G04 J;  3QB2 A;  3FTS A;  4JXT A;  3IHY A;  2VTB A;  5AIJ A;  3AS4 A;  1Z3Y A;  3L17 A;  2VJ8 A;  1HG5 A;  3FTV A;  1HS6 A;  3GZ1 A;  5T0K A;  4JLG A;  3B7U X;  3F9W A;  5F6K C;  3LEW A;  3ESK A;  4CEM A;  2XGS A;  1H19 A;  4UI9 C;  3CVL A;  2VGX B;  3FTZ A;  2X3M A;  3MKQ B;  3PE4 A;  4PUC A;  2PL2 A;  3U9W A;  3ZEF A;  3CVP A;  4Q94 A;  3BO5 A;  2IOS A;  2L6J A;  1KT0 A;  2WXP A;  1EYH A;  3IKO B;  4HXI A;  2PM7 A;  3LPZ A;  5CMY A;  4BX8 A;  5HQ8 A;  4YVO A;  4UQY A;  4LER A;  5E76 A;  1PC2 A;  4UWG A;  1N3J A;  2F69 A;  5ARG A;  3FH7 A;  1H2V C;  3RKV A;  1E90 A;  4JHJ A;  3RO3 A;  3QDN A;  4WNG A;  4JHR A;  3FU0 A;  2BUG A;  2I1J A;  4LRZ A;  1TEZ A;  3G2V A;  4XKC A;  1KT1 A;  4OYS A;  5G05 C;  4U0U A;  4XE0 A;  4L23 A;  3FHE A;  4A1S A;  3HNA A;  3AS5 A;  2WXN A;  3G2S A;  3KD7 A;  5EDS A;  4B94 A;  1Y8M A;  1HU3 A;  4JW1 A;  5BV0 A;  4LUN U;  3RU0 A;  3PH0 C;  1N52 A;  3OTN A;  5FQ4 A;  3D9O A;  1HFA A;  4UWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...