5ARGA

Smyd2 in complex with sgc probe bay-598
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
426
structure length
426
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 151
structure length 426
sequence length 426
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5argA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5argA01
3GYZA 4FMUA 4CDRA 4U04A 3LPZA 3R9AB 3F9YA 3TAXA 5TTFA 3Q49B 2HO1A 2Q7FA 1KT0A 4G23A 5FJYA 3N71A 3ASGA 1HH8A 3OXLA 1QZ2A 2XGMA 1W3BA 5FTPA 4U0ZA 5G04J 4I9CA 3GZ2A 4CGVA 4RZ0A 2OOEA 1MUFA 5DIZA 4GZ6A 1O9SA 4WNGA 4YPUA 3TGOA 4H7XA 3DALA 3Q15A 3NF1A 5BNWA 1WM5A 3OS5A 2WQHA 4N3BA 2MHKA 1QQEA 2RFIA 4YNDA 3CVQA 4UQYA 4ABNA 2VQ2A 2BQZA 5TH7A 1WAO1 1Y8MA 2UWJG 3RJWA 3UQ3A 4YNMA 4Y6WA 2C0MA 2FEZA 3M59A 5LCWC 3CVLA 4BT8A 1B89A 4NVQA 2Y4UA 2IGQA 5CCLA 3QWPA 2JV0A 3HNAA 3PE4A 5AYFA 3RO3A 2BUGA 5ARGA 3MV2B 4A1SA 3BO5A 3PE3A 2QFCA 3WXXA 5BT1A 2W5YA 4GA1A 2LSUA 3O48A 4GZ3A 4J7FA 2AVPA 3CV0A 5CHEE 5C1DA 5FT9A 2XCCA 2UY1A 4J8OA 3FWVA 3SWCA 5HQ8A 1ELWA 3CKCA 4AIFA 3CKBA 4BTAA 3K9IA 1HZ4A 1PEGA 2UY1B 4UI9J 2IFUA 4GYWA 4U0SA 2P58C 3VUZA 4JL0A 2J9QA 1N6CA 4N3AA 2JLBA 4JLGA 4GZ5A 3E4BA 4J8FA 4UI9K 4WUYA 2PQNA 3HYMB 3VTXA 5T0MA 2VSNA 4BT9A 4BWRA 4GCNA 5BW8C 5FZRA 4HORA 1N3JA 3FP3A 2WPVA 3QOUA 5G05J 5A6CA 4MI0A 4HOSA 4LDGA 3M54A 4RG6A 4RG9A 3CBOA 3GW4A 3U3WA 4GPKA 3K5KA 1MVXA 5D0QD 5JHNA 4O30A 4I2ZA 4Y6CA 3ZFWA 5D0OD 5F5EA 1NA3A 3AS4A 2NC9A 4IJDA 2KCVA 3DB5A 1XQHA 3LYAA 2KCLA 2ONDA 3TG5A 5F59A 2HYZA 4W9RA 2GW1A 2Y4TA 3JYSA 3MA5A 5JJ7A 3MV3B 1A17A 3QDNA 4UQZA 2XPIA 3MEKA 4GA2A 5T0KA 4APOA 3QKYA 4IJ8A 1P5QA 4MI5A 3SZ7A 4YPAA 3EP0A 4U07A 4YPEA 4LEUA 4I9EA 3ZGQA 4WNFA 3CBPA 3SW9A 4N2SA 2KC7A 2R5SA 2YHCA 2VGYA 5KJKA 3S8PA 4U0UA 4ME2A 4JHRA 4UQXA 4J83A 1HXIA 4UI9C 3F9ZA 5F6LA 2R3AA 4QEOA 4F3VA 3AS5A 1TJCA 4G25A 4KBQA 4I1AA 4I2WA 3VTYA 1IHGA 3KAEA 2L6JA 3F9WA 4WNDA 4GYYA 4H7YA 5JIYA 5EX3A 3SF4A 5FZSA 4YNPA 4GCOA 4H12A 3KS2A 3UPVA 2FI7A 2KCKA 3AS8A 5JJTA 3RQ4A 1KT1A 5LCWJ 2C2LA 4AU7A 2PQRA 3ZHEA 3Q5MA 5EX0A 4HOQA 4EQFA 3CVPA 4I51A 3Q47B 3M56A 2XCBA 4JDSA 4KXKB 3ZHEB 5EG2A 1H3IA 2XEVA 2O8JA 2XGOA 5G04C 3MO5A 4AM9A 2PL2A 5FZQA 3CVNA 3IEGA 4GA0A 5CPRB 2G46A 4J8EA 3LY8A 1ZKKA 4N39A 2YQ8A 3ULQA 5DBKA 1ML9A 5HI7A 5M72A 2XGSA 3M53A 3OXFA 5LSXA 3OXGA 2C0LA 3FFLA 5JJ6A 3RIBA 4CGWA 5AYWD 3CBMA 4WNEA 1PC2A 1MT6A 2V5FA 4C1QA 3RO2A 1ELRA 4NRHB 5F6KC 2LSVA 3KMTA 3KMAA 4G2VA 3S7DA 4N5CA 3M5AA 1KLXA 3EDTB 1FCHA 1E96B 1MVHA 4B94A 2E2EA 4HOUA 3S7FA 2QPWA 3ASFA 1N6AA 3M55A 3VV0A 4I17A 3LKUA 3ASDA 3ASHA 4G24A 3UUXA 2FO7A 3KD7A 4Z4PA 4GYOA 4J8DA 2VGXA 4YVQC 5CCMA 1ZBPA 1YA0A 2VSYA 3CK8A 5KJMA 3CK7A 2VGXB 4NJ5A 3ESKA 3RU0A 1OUVA 2I6HA 4E47A 5T5GA 5JJ0A 2DBAA 4KYOB 3PDNA 1NZNA 3TG4A 1ZU2A 4NQ0A 3U4TA 1IYGA 3CEQA 4IN3B 2PZIA 4XI9A 1NA0A 4AY5A 3OOIA 4N3CA 3Q4AB 5G05C 3CK9A 3MO0A 2HR2A 3URZA 3F9XA 3S7BA 4J0UA 5TEGA 3OPEA 5LSZA 2VYIA 5ARFA 4XIFA 2IF4A 3M58A 3FPDA 4JA7A 1XNFA 3S7JA 5KJNA 2LNIA 4JA9A 4G26A 4QENA 3IHXA 4BTBA 3RKVA 3ZPJA 3BEEA 2F69A 5A7DB 3MKRA 4G1TA 3GZ1A 4N2QA 3RAYA 3LCAA 3MO2A 4J7IA 2W5ZA 3LY9A 2FBNA 3M57A 3RJVA 5KJLA 5JINA 4BUPA 3QWWA 3ZN3A 2FF4A 4O6FA 4HOTA 4AY6A 3KMJA 3QWVA 4XI0A 5EKQD 2KATA 4YVOA 4QEPA 3LY7A
chains in the Genus database with same CATH superfamily
3GYZA 4FMUA 1UG3A 3MZLB 3TAXA 4C0EA 1S63A 4I6JA 3TWXA 2X6IA 1O1SA 4YDYA 2HM8A 4G23A 2IO3C 3B7RL 4B93B 1QZ2A 1SQMA 1W3BA 1D8DA 5G04J 3DPDA 2FULA 3GZ2A 4CYMD 4K5BA 1OWMA 1HU3A 4YPUA 4I1OB 3IBEA 2H6HA 5AQ9A 4J7WA 2BEDA 4ATZD 3TWSA 4LNUD 1JPLA 2GRRB 5LP0A 4MRUA 3J5PA 4UQYA 4ABNA 1KZOA 2I2OA 1V54E 3RJWA 4JPSA 3FTWA 5ITZF 3CGHA 3JXJA 4Q96A 3DSXA 3CVLA 5C2YA 2WXLA 5CCLA 1G3NB 2WMOA 3RO3A 3CHPA 3MV2B 3TWTA 3EHMA 4LCTA 2QZAA 5J90A 3O48A 2AXZA 4GZ3A 5JA4D 5C1DA 5FT9A 2XCCA 2UY1A 4CZ2D 4J8OA 3FWVA 3SWCA 3S2AA 4JZYA 3CKCA 2R17C 3D9PA 4AIFA 3CKBA 3K9IA 4UI9J 4MS6A 3PNTB 1D9SA 4UWLA 3HHMA 4JL0A 4N3AA 2JLBA 4GZ5A 3SBTB 1DCQA 2WXHA 3F6QA 3PNLB 4J8FA 3FDHA 4UI9K 4WUYA 5D66A 4HBDA 1JUQA 3WG7E 1UW4B 4F1SA 2WQ7A 4BT9A 4E85A 1E8XA 2EIJE 3FP3A 3FH8A 5ENTD 5G05J 3PS6A 4LDGA 3I5PA 3D9HA 3U3WA 4GPKA 3PZ1A 1MVXA 2J4DA 2MYOA 1N4QA 3UM2A 4GZCA 1JWFA 4I2ZA 4Y6CA 5D0OD 5F5EA 1NA3A 3CVYA 1DC2A 2KCVA 1TNUA 2GRNB 4ANUA 3V2OA 2GW1A 1RW2A 5HKPA 1IQRA 3E37A 4GTPA 3ZVVA 4C48B 2XPIA 4TXPA 5ENRD 4APOA 2LO6A 1P5QA 1OWLA 4U07A 4YPEA 3AU5A 1TNYA 1U3DA 2IQCA 3ZGQA 3SW9A 3QARA 4UUCA 4N2SA 1BI7B 1UOHA 4FU3A 4JHJA 3S8PA 4ILIA 4ME2A 4JHRA 4UQXA 1HXIA 4UI9C 4KMOA 1SZAA 4QEOA 2QY7A 3NQPA 1TJCA 2R02A 1IXVA 4G25A 4KBQA 4EZLA 3JXIA 4I43A 5ENSD 2IY0C 4XX5A 2XEEA 3SFZA 1YCSB 3UPVA 4FP7A 1MX2A 3EIJA 4R7LA 4DPRA 2IEJA 1KT1A 4KZ0A 4AU7A 3LJNA 4MKTA 4PH4B 4HOQA 4EQFA 5FINA 3NZUA 2XCBA 4BETA 4KXKB 3DSSA 4WWPA 2XEVA 4DX2A 5BUZA 2O8JA 2XGOA 4XE0A 3SNXA 4ZHBA 3MO5A 3CVNA 4GA0A 1E8YA 2G46A 4DUIA 4J8EA 4HQDA 1ML9A 5HI7A 5M72A 3C3RA 2LXMA 4GMLA 3OXFA 4XKBA 3L6AA 1SA4A 3AG3E 3OXGA 3FTUA 2R03A 4FA6A 4CGWA 3T5XA 2V5FA 5CRUA 3CSFA 2WXQA 4NRHB 4B8CB 4KZCA 3KMAA 2F37A 3S7DA 3M5AA 3EDTB 1FCHA 1E96B 4B94A 3L82A 2J49A 2MRIA 3PZ2A 4GPMA 1H19A 4G11A 2OV8A 3SO8A 4LG6A 1BLXB 1EDUA 1DVPA 4I17A 2XS1A 3BUAA 1Z5SC 5ENNA 4J8DA 3AU4A 1YA0A 5EIBE 3CK7A 2WXKA 3TWQA 3FTVA 2I6HA 5JJ0A 2DBAA 4HRLA 4LRZA 1H2TC 2QC9A 3G2UA 2WM9A 3TG4A 1UJKA 4J6IA 3SBSA 1ZU2A 4OAUC 1IYGA 4A55A 1UN9A 3SFXA 2CG3A 1A5EA 4AY5A 3Q4AB 4BESA 4Q94A 2HR2A 2F8YA 3URZA 1QBQA 1TN7A 3Q7AA 2VSOE 1SA5A 2VYIA 4XIFA 3QAQA 2CHXA 3ML8A 1XNFA 4EPZA 5H7PA 4QENA 3FUJA 4K0RA 3ZPJA 3EHRA 3SQVA 5A7DB 4FHKA 4Q69A 1N0RA 1INZA 4BUPA 2AJAA 4HRMB 3AAAC 4KVOA 4HOTA 2OEVA 1FVFA 3Q7FA 4ACLA 3JUIA 2VGEA 4XI0A 5BXUA 2Y3AA 2DVWA 4OVUA 1QNFA 5T8IA 4CDRA 3LPZA 3B7UX 5TTFA 3Q49B 1NFIE 2LAIA 4NIKA 4UWHA 2ZGGA 3ISMC 2KZTA 3APCA 5T3RA 2VTBB 3N71A 3ASGA 1HH8A 4P29A 3UIOC 2P9PG 2AW6A 4BSZB 4DJAA 1N9AA 4U0ZA 3AG4E 3DRAA 5DIZA 2WB2A 2IOSA 4H7XA 3DALA 5BNWA 3OS5A 3W9GA 2WQHA 4N3BA 5AQBA 3Q73A 2MHKA 2IOLA 4YNDA 3PH0C 4FULA 4FJZA 1Y8MA 4APFA 4GTOA 1Y6IA 2J09A 1K1BA 4B0ZA 2C0MA 3M59A 5LCWC 4BT8A 3SGHA 1H6OA 2WXOA 3CHMA 2XEHA 3QWPA 2JV0A 3UKUG 5ARGA 2NYJA 4L9PA 4L2YA 3WXXA 1HO8A 1OY3D 1AWCB 2V5QC 4OYSA 3UINC 2W5YA 3Q75A 4GA1A 2XZDG 3ASNE 3FTZA 3CHQA 3CV0A 5CHEE 5D2MC 2MOWA 4BX8A 2J08A 2VJ8A 4JD2G 3FUNA 3ULEG 1TYQG 4BTAA 1H2UA 1HZ4A 2UY1B 3CQGB 4GYWA 5HRYA 3ASOE 3BQOA 3J5QB 3FUEA 1MX6A 3L9TA 5B3SE 4JC8A 5CMYA 3FULA 4AXHA 4BY6A 3HYMB 3EHNA 4AEZC 4GCNA 5FZRA 4HORA 2ZIRA 1N3JA 1WY6A 4MI0A 3ZXPA 3CVXA 3M54A 2VTBA 4LNBA 2KBXA 1K8KG 3K5KA 5CEDB 5EYLA 5JHNA 4UWFA 4LUNU 3T8MA 4TXRA 3AS4A 2PM6A 3C3QA 3DB5A 1N95A 2HE0A 5FQ6A 3MA5A 5JJ7A 2XPZA 3MV3B 3V31A 5ENPD 3QDNA 4UQZA 4MI5A 3D9KA 3ESLA 4YPAA 1N4SA 3IKOB 1WDYA 4LEUA 4YDWA 3T9KA 4QFVA 2WQ6A 4L2LA 4F53A 4FC8A 5EILA 5B1AE 1N4RA 2YHCA 3FUHA 2WXGA 5KJKA 4U0UA 3UMVA 4N5QA 5F6LA 2R3AA 5LFAA 4YDEA 1TR4A 4I1AA 4I2WA 1LD7A 4WNDA 2L0TB 2Y69E 4FHJA 5EX3A 5FZSA 4RVBA 4YNPA 5AENA 2OVBA 2BTDA 5BV1A 2AXVA 2A5UA 3KS2A 3D9JA 5LX8A 3DXMG 3UM3A 3AS8A 3FH7A 5JJTA 4LERA 4GMRA 4PS7A 4M7CA 2Y1LE 3Q47B 3M56A 4JDSA 1YMPA 3L17A 3JQ0A 2XQ0A 4LNGA 5G04C 4AM9A 1JWGA 3DEPA 3KSLA 2V4HC 3QK0A 3FEYA 4N39A 4JEHA 3OTNA 5AIJA 2J8SD 5LSXA 4ATGA 3FFLA 2FO1E 1KPSB 3VLFA 3CBMA 4HI9A 1PC2A 3UM0A 3HG0D 3RO2A 3AG1E 3FY4A 1LF8A 1E8ZA 3KMTA 1KLXA 5ENQD 4HFGA 4DLQA 3AJIA 1SZ9A 1OXJA 3P1UA 4PS3A 2CHWA 3JQ1A 1DCEA 3ASHA 3LKUA 4G24A 3Q9UC 4TV3A 3DBSA 3B13A 2AXUA 5JHBA 4GYOA 5ANLA 2VGXA 3PREA 2GGFA 1ZBPA 2RFAA 3FTYA 4E6HA 1Z6TA 5FQ8A 3AG2E 5KNHD 1OUVA 5T5GA 4KYOB 5E75A 4NURA 5BXOA 3MCXA 4XI9A 1NA0A 3OOIA 1FPPA 2EILE 5G05C 3CK9A 1H0AA 3MO0A 2YHEA 3ONKA 2ZXWE 3IHVA 3UXGA 2B6CA 3CHOA 3RRMB 5CMWA 5TEGA 5LSZA 2P9KG 3D9OA 2GRPB 3FPDA 4JA7A 1TEZA 1MZCA 1BPOA 3S7JA 5KJNA 4FLBA 4G26A 3IHXA 3LDZA 3V2XA 5CERB 3BEEA 4N2QA 3GZ1A 3RAYA 3KSQA 4K5AB 3OAWA 3UI2A 5AQ7A 2FBNA 5KJLA 3HXDA 3QWWA 2FF4A 4O6FA 1OWNA 3PZDA 2NXPA 4AY6A 2H6GA 3LEWA 3SI5A 4TUMA 3KMJA 4F6RD 4RSYA 4WAFA 1Z3XA 4U8VD 2CG2A 3FU5A 3EU5A 1H2VC 2KATA 5ENOD 3MJWA 2XHEA 4QEPA 1HF8A 3RAUA 4GTRA 4D10C 2OEWA 1PAQA 4HXIA 3R9AB 3F9YA 2HO1A 2I9CA 2Q7FA 3GZSA 4JVSA 3R7QA 3I4RB 4IRUA 1N4PA 5FJYA 3G2SA 3RRNB 1N54A 2KZTB 2A4ZA 3TXNA 3L16A 3SFYA 2IJGX 1S0PA 2XGMA 3IV0A 3QB2A 3RK6A 1MQSA 2ETCA 3LXUX 3C72A 4CGVA 4BEPA 3L22A 2OOEA 4ZFHA 2AWIA 4TUUA 3ZYKA 3Q15A 1FT2A 3G2TA 4DX6D 4HRNA 4EBAA 2DIWA 4EZKA 1QQEA 3UTMA 3CVQA 2VQ2A 1WAO1 3UQ3A 4YDOA 4DI4A 4YNMA 4GU5A 2NSZA 2WXMA 4Y6WA 2FEZA 4B89A 1B89A 4NVQA 4TXQA 2IGQA 1JCQA 3ULYA 1TN8A 1MYOA 3EU9A 3D3MA 4UWGA 2Y0BG 2WXJA 4A1SA 3BO5A 3C3OA 4GTMA 4CDNA 4J8YA 2XRYA 2V0PA 3KEAA 1EF1C 1K1AA 4J7FA 4EZJA 2AVPA 3PZ3A 4HS2A 1OCRE 2X6KA 4HNAD 3KEZA 5HQ8A 1ELWA 3FU3A 4I6EA 5AQAA 3RRUA 4BX9A 4L1BA 2IONA 4QQIA 2WXIA 2IFUA 4U0SA 3VUZA 2ZU6B 4G8LA 2J9QA 1N6CA 2ZGDA 2DWZA 3QC1A 1HX8A 3E4BA 4F7AA 2PQNA 2ETBA 3TWVA 5T0MA 2VSNA 4XEIG 4CT0A 4BWRA 5BW8C 4U63A 2KXPC 4U8YD 3DWLG 3QOUA 4HOSA 2WXPA 1H6KA 3CBOA 3GW4A 3VLEA 3ENEA 1JCRA 1IQUA 4BFRA 1TNBA 3TWUA 2BF0X 3ZFWA 3HXCA 3Q78A 2NC9A 2RKKA 1EPUA 2WXNA 4K5CA 3LYAA 2KCLA 2ONDA 1X81A 5BPPA 4HB5A 2HYZA 4FLHA 4W9RA 4AVXA 3MKQB 3I4GA 2EQXA 2Y4TA 3JYSA 3DSWA 2P9NG 3IXEA 1IKND 3MEKA 5T0KA 3QKYA 3ZNGA 3EP0A 4OAVB 4I9EA 2DZOA 3CBPA 4I6GA 3UIPC 3JUEA 1O1RA 2VGYA 2GRMA 2P9IG 2XZTG 4A3VA 3DPYA 3O4ZA 5KNGA 4GTVA 2DYRE 2B0OE 1N94A 5HS0A 3VTYA 2VSXE 3KAEA 2L6JA 3F9WA 4GYYA 5KWDA 1BI8B 3SF4A 3I3NA 3ZKJA 5CBOA 3D9NA 5IY5E 4ACKA 3LVRE 2KCKA 2OVFA 1FVHA 2M63A 4ANWA 2QYJA 1YYHA 2C2LA 2PQRA 3ZHEA 3IHYA 4TRQA 3FUMA 3CVPA 4EHMA 4BERA 5EG2A 4L23A 3HXBA 1H3IA 1V55E 2ZISA 3ZW3A 5JHAA 1BD8A 3ONLA 2PL2A 5FZQA 3ZUVB 2YINA 3JCKC 3UT4A 5AAOA 2CFUA 5LOZA 3SY2A 4U7EB 3LY8A 3ZIMA 3APDA 3D9MA 1N0QA 1UJJA 3PRZA 2C0LA 3EIQC 3RIBA 3MKQA 3B7TA 3ZYMA 3APFA 5KBAA 2BKKB 4WNEA 2J4BA 3TWRA 2JEKA 3LS8A 1ELRA 3U66A 2DZNA 5G2NA 3T8KA 5E76A 3NOCD 1LD8A 2E2EA 3S7FA 4CRWA 2I1KA 4HLLA 2V8SE 4B8AA 4U8HA 1N6AA 3M55A 2A5EA 4M3OA 3VV0A 2IU1A 3FEXA 3UUXA 2FO7A 1ELKA 4Z4PA 4FADA 3B7SA 4GB9A 2VSYA 5KJMA 3U64A 1O1TA 2VGXB 4NJ5A 3FUIA 3ESKA 3RU0A 3B7BA 3Q79A 4E47A 5G55A 3UT8A 3HDXA 4OVVA 1TJFA 2WMNA 3HXEA 1IHBA 3CHSA 1OCOE 3NB2A 4NQ0A 1RZ4A 3CEQA 4GMJA 4MBGA 2X6JA 4DX7D 3G2VA 2WXRA 1O5MA 3ABLE 4IYPA 3EUVA 1HE8A 4V3IA 2R59A 3S7BA 3NZSA 3Q9NC 3OPEA 2WVIA 2P2CP 3FTSA 4GTSA 3PZ4A 2IF4A 3M58A 3PVLA 5BV0A 1HS6A 2LNIA 5AN8A 3DSTA 4DRXE 3RKVA 2EIKE 4JW1A 4J7IA 2W5ZA 3M57A 3RJVA 2PM7A 2X6HA 3CLJA 3ZN3A 3FUKA 2BKGA 4CCAA 2EIME 2P9UG 3ABKE 2XS8A 4I1MA 1MJ0A 5CBNA 1SW6A 4U04A 4Z68A 3HVEB 2XRZA 4ANXA 3CQCB 1KT0A 5J08A 5EDSA 1NL4A 3OXLA 3UKRG 2X38A 5FTPA 1OCCE 4I9CA 1OT8A 1NI1A 3NBNB 1MX4A 4RZ0A 1FT1A 1MUFA 5EIDA 4GZ6A 1O9SA 2F8XK 4WNGA 3QNKA 3TGOA 2ILRA 4WWOA 1BU9A 3NF1A 1WM5A 3UM1A 4DK5A 2OCCE 1N11A 3U9WA 4J8SA 1MHQA 5ANRA 2RFIA 1X5BA 5TH7A 2BQZA 3CIAA 1TN6A 2UWJG 3L54A 3DSVA 5KCMA 1OCZE 2DCPA 3PUKA 4JB8P 3CVWA 3SHFA 2Y4UA 4DX1A 3HNAA 3PE4A 5AYFA 3CHRA 4JXTA 2BUGA 2DYSE 4JHKA 4URKA 3TWWA 4EBAG 2LXLA 3PE3A 2QFCA 3ABME 3LVQE 5BT1A 3ZEFA 3LJ3A 2LSUA 1U2VG 3FUFA 1OWPA 2QYUA 4A1GA 2CHZA 1PY1A 1PEGA 1S70B 3L13A 2P58C 5AJLA 3CSTA 4GZDA 4DLOA 4JLGA 3NAWA 3DSUA 4PS8A 2P9SG 3UX4A 2JABA 3VTXA 3FUDA 2R05A 1TNOA 2P9LG 4L7TA 3PEVB 2WPVA 1EYHA 5JMND 4U96D 3HVEA 5A6CA 2L0IA 3MGBA 3E34A 4RG6A 3C5RA 2L9BA 4ANVA 4RG9A 4DX5D 2GRQB 3TL5A 3R9MA 3CVVA 4KT6B 3HIZA 4XZ4A 4GAAA 2X3MA 3DXKG 3FU0A 2XENA 5D0QD 4O30A 4XKCA 5AJDA 3ZXSA 4IJDA 4CT4A 1XQHA 3TG5A 4O60A 5F59A 4JEUA 2F0YA 1A17A 1JCSA 4O1PA 1GW6A 2E0IA 4X8QA 1HG5A 1HG2A 4GA2A 5A23A 4IJ8A 3V30A 3E30A 2RD0A 4ILGA 3SZ7A 1E8WA 1Q2ZA 4RQIA 3ZRHA 2XPYA 2L6BA 1Z3YA 4WNFA 3B95A 4O1OA 4GTTA 3CR3A 2KC7A 4C0MA 1U3CA 2R5SA 4MLPA 3HXFA 3DEOA 3VLDA 4J83A 3F9ZA 5CECB 3RSEG 4F3VA 3TXMA 3AS5A 3EJNA 3HRAA 3PUJA 1AP7A 1IHGA 4DI3A 5FQ7A 2X6FA 4A3TA 1E7UA 4H7YA 3P2BA 1DNPA 1HFAA 5JIYA 2LAHA 4C9BB 2H6FA 4GCOA 1H6PA 4H12A 2FI7A 1NP7A 3RQ4A 1LTXA 1L5JA 1D8EA 3ZYLA 5LCWJ 1N52A 3Q5MA 5EX0A 2CFZA 3G2WA 4I51A 3ZHEB 1SVXA 3ZYQA 2LUHA 4PDXA 3IEGA 3FU6A 5CPRB 3MX3A 3CVUA 4UWKA 5T4YA 1ZKKA 2YQ8A 3ULQA 5DBKA 2XGSA 3TJPA 3M53A 3BG1B 2YNQA 3E33A 4GTQA 3D9IA 5JJ6A 3MYVA 4WWNA 5AYWD 4EECA 4ILHB 1MT6A 3FHEA 4C1QA 5CEAA 4AJWA 5F6KC 4G8KA 4IULA 2LSVA 4G2VA 4N5CA 3X2QE 2KM4A 5FIOA 2PNNA 2EINE 1MVHA 3SD5A 4HOUA 2QPWA 4HLEA 5B1BE 3ASFA 1E90A 3C98A 3UT7A 3ZU7B 3ASDA 2RFMA 4FJYA 3KD7A 4NACA 1WG0A 3R7RA 3BG0B 5CRVA 4U95D 5CCMA 4YVQC 1E7VA 5EYPF 3CK8A 1OWOA 4AP2A 3BU8A 5AARA 1UN8A 2GRLA 3ML9A 4HI8A 1K3ZD 3FTXA 1VDYA 2J07A 3PEUB 3PDNA 1NZNA 2GROB 4A63B 3U4TA 4HVBA 4CDMA 4IN3B 2WXFA 2PZIA 4N3CA 2IO2C 3L08A 4BSXA 1XGWA 3F9XA 3QJZA 4J0UA 5FQ4A 3FH5A 1S64A 5ARFA 1QYMA 1TNZA 4AV7A 2R2LA 5FWQA 3T5VA 3NOGD 4AOFA 1KZPA 4JA9A 2ETAA 4PUCA 4BTBA 3D9LA 5EN5D 4F1PA 1ZB1A 2F69A 3MKRA 4G1TA 3LCAA 3MO2A 3EHQA 4LSZE 3LY9A 3E32A 5JINA 3V79K 2I1JA 4KVMA 2H6IA 4RLYA 2RG8A 3QWVA 4CEMA 5EKQD 4YVOA 4K03A 2V4LA 3LY7A 3W9FA
chains in the Genus database with same CATH topology
3GYZA 4FMUA 4CDRA 1PAQA 4HXIA 4U04A 1UG3A 2XRZA 3HVEB 3LPZA 3R9AB 3MZLB 3F9YA 3TAXA 4ANXA 3CQCB 3B7UX 4C0EA 5TTFA 3Q49B 2HO1A 2LAIA 4I6JA 4UWHA 2I9CA 2X6IA 2Q7FA 2KZTA 3GZSA 4JVSA 3APCA 3R7QA 1KT0A 2HM8A 3I4RB 4G23A 4IRUA 5T3RA 2VTBB 5J08A 5FJYA 3N71A 5EDSA 3ASGA 1HH8A 3B7RL 4P29A 3G2SA 3RRNB 3OXLA 1N54A 2KZTB 2A4ZA 2AW6A 3TXNA 3L16A 4DJAA 2X38A 1QZ2A 2IJGX 1S0PA 2XGMA 3IV0A 3QB2A 1SQMA 1MQSA 3RK6A 1W3BA 5FTPA 4U0ZA 5G04J 3LXUX 3DPDA 2FULA 3GZ2A 4I9CA 4CGVA 1OWMA 1HU3A 4RZ0A 3L22A 2OOEA 1MUFA 2AWIA 4GZ6A 5DIZA 4TUUA 1O9SA 4WNGA 3ZYKA 4YPUA 2WB2A 3QNKA 2IOSA 2ILRA 4H7XA 4I1OB 3TGOA 3IBEA 4WWOA 3Q15A 3DALA 3NF1A 5BNWA 1WM5A 3OS5A 4DK5A 2WQHA 3G2TA 4N3BA 3U9WA 4J8SA 4EBAA 1MHQA 2DIWA 5ANRA 4EZKA 2MHKA 1JPLA 5LP0A 2IOLA 1QQEA 4MRUA 2RFIA 1X5BA 4YNDA 3CVQA 4UQYA 4ABNA 2VQ2A 3PH0C 2BQZA 5TH7A 1WAO1 4FULA 4FJZA 2I2OA 1Y8MA 3CIAA 4APFA 2UWJG 1Y6IA 3L54A 4JPSA 2J09A 5KCMA 3RJWA 3FTWA 3CGHA 3UQ3A 4YNMA 4DI4A 4Q96A 4GU5A 2NSZA 2WXMA 4B0ZA 2DCPA 2C0MA 2FEZA 3PUKA 4Y6WA 4B89A 5LCWC 3M59A 3CVLA 4BT8A 1B89A 3CVWA 5C2YA 3SGHA 3SHFA 2Y4UA 4NVQA 2WXOA 3CHMA 2IGQA 2WXLA 5CCLA 3QWPA 2JV0A 3HNAA 3PE4A 5AYFA 2WMOA 3CHRA 3RO3A 3D3MA 4JXTA 2BUGA 4URKA 4JHKA 3CHPA 5ARGA 4UWGA 3MV2B 2WXJA 4A1SA 4EBAG 3BO5A 3PE3A 2QFCA 4L2YA 3WXXA 3UT7A 4CDNA 1HO8A 3LVQE 3EHMA 4LCTA 5BT1A 2XRYA 2V0PA 4OYSA 3ZEFA 2W5YA 5J90A 1EF1C 4GA1A 3LJ3A 2LSUA 3O48A 2AXZA 4GZ3A 4J7FA 4EZJA 3FTZA 3FUFA 2AVPA 1OWPA 3CHQA 3CV0A 4HS2A 5CHEE 5C1DA 5FT9A 2XCCA 4A1GA 2UY1A 2X6KA 3FWVA 4J8OA 2CHZA 3KEZA 2MOWA 3S2AA 4BX8A 1ELWA 3FU3A 2J08A 4I6EA 3CKCA 4JZYA 2VJ8A 3RRUA 2R17C 4BX9A 1PY1A 3D9PA 3FUNA 4AIFA 3CKBA 4L1BA 2IONA 1H2UA 1HZ4A 3K9IA 4BTAA 1PEGA 2WXIA 2UY1B 4UI9J 3CQGB 4MS6A 2IFUA 3L13A 3PNTB 4GYWA 4U0SA 2P58C 5AJLA 3VUZA 3FUEA 3CSTA 4GZDA 4UWLA 4DLOA 2ZU6B 3HHMA 4JL0A 2J9QA 1N6CA 4N3AA 2JLBA 4JLGA 4GZ5A 3SBTB 4JC8A 4PS8A 2WXHA 3QC1A 1HX8A 3E4BA 3PNLB 4J8FA 3FDHA 4UI9K 5CMYA 4WUYA 3FULA 2PQNA 4AXHA 4BY6A 4F7AA 3HYMB 1JUQA 3EHNA 4AEZC 3UX4A 1UW4B 4F1SA 3VTXA 2WQ7A 5T0MA 3FUDA 2VSNA 4BT9A 4CT0A 4BWRA 4GCNA 4U63A 5FZRA 1E8XA 5BW8C 4E85A 4HORA 1N3JA 4L7TA 3PEVB 3FP3A 1WY6A 2WPVA 1EYHA 3FH8A 3QOUA 3HVEA 5G05J 5A6CA 4MI0A 3PS6A 4HOSA 2L0IA 3I5PA 3MGBA 2WXPA 4LDGA 3CVXA 3M54A 4RG6A 4ANVA 2L9BA 1H6KA 4RG9A 3CBOA 3TL5A 3GW4A 3CVVA 4KT6B 3VLEA 2VTBA 3U3WA 3ENEA 3HIZA 4XZ4A 4GAAA 4GPKA 2X3MA 3K5KA 1IQUA 3FU0A 1MVXA 2J4DA 5D0QD 4UWFA 5JHNA 4O30A 4GZCA 1JWFA 4I2ZA 4LUNU 4BFRA 4Y6CA 2BF0X 5D0OD 3T8MA 3ZFWA 4XKCA 5F5EA 1NA3A 5AJDA 3AS4A 3CVYA 2PM6A 2NC9A 3ZXSA 4IJDA 4CT4A 2KCVA 1EPUA 3DB5A 2WXNA 1XQHA 3LYAA 2KCLA 4ANUA 2ONDA 5BPPA 3TG5A 5F59A 2HYZA 4FLHA 4JEUA 4W9RA 4AVXA 3MKQB 3I4GA 2EQXA 2GW1A 2Y4TA 1IQRA 3ZVVA 3JYSA 5FQ6A 3MA5A 5JJ7A 2XPZA 3MV3B 1A17A 1GW6A 2E0IA 3QDNA 4UQZA 1HG5A 2XPIA 1HG2A 3MEKA 4GA2A 5T0KA 4APOA 3QKYA 5A23A 4IJ8A 2LO6A 1P5QA 4MI5A 4ILGA 2RD0A 3D9KA 3SZ7A 1E8WA 3ESLA 4YPAA 3IKOB 3EP0A 1OWLA 4U07A 4YPEA 3AU5A 3ZRHA 1U3DA 4LEUA 4I9EA 2XPYA 2IQCA 1Z3YA 3ZGQA 4WNFA 3CBPA 3SW9A 3QARA 4I6GA 4N2SA 3CR3A 2KC7A 4C0MA 1U3CA 4QFVA 2WQ6A 2R5SA 4L2LA 4F53A 4FC8A 4FU3A 4MLPA 2YHCA 3FUHA 2VGYA 2WXGA 4JHJA 5KJKA 2GRMA 3S8PA 4U0UA 4ILIA 4ME2A 4JHRA 4UQXA 3VLDA 4A3VA 4J83A 1HXIA 3UMVA 4UI9C 3F9ZA 5F6LA 4KMOA 2R3AA 1SZAA 5LFAA 4QEOA 3O4ZA 2QY7A 3NQPA 4F3VA 3TXMA 3AS5A 3EJNA 1TJCA 4G25A 4KBQA 4I1AA 4I2WA 3PUJA 4EZLA 3VTYA 1IHGA 2VSXE 3KAEA 2L6JA 3F9WA 4DI3A 5FQ7A 2X6FA 2L0TB 4WNDA 4A3TA 1E7UA 5HQ8A 4GYYA 4H7YA 3P2BA 1DNPA 4I43A 5JINA 1HFAA 5JIYA 4FHJA 2LAHA 5EX3A 3SF4A 3I3NA 4C9BB 5FZSA 4RVBA 4YNPA 5AENA 3D9NA 2OVBA 4GCOA 4XX5A 3SFZA 2BTDA 5BV1A 4ACKA 2AXVA 4H12A 2A5UA 3KS2A 3LVRE 3UPVA 3D9JA 4FP7A 5LX8A 2FI7A 2KCKA 2OVFA 1FVHA 1NP7A 3AS8A 3FH7A 5JJTA 4LERA 3EIJA 3RQ4A 1L5JA 4R7LA 2M63A 4DPRA 1KT1A 3ZYLA 4ANWA 4KZ0A 4PS7A 5LCWJ 2C2LA 4AU7A 2PQRA 3ZHEA 1N52A 3IHYA 3Q5MA 4TRQA 5EX0A 4MKTA 4PH4B 3FUMA 4HOQA 2CFZA 3G2WA 4EQFA 3CVPA 4I51A 3Q47B 3NZUA 2XCBA 3M56A 4JDSA 4KXKB 3ZHEB 5EG2A 4L23A 3L17A 1H3IA 4WWPA 2XEVA 3JQ0A 2XQ0A 5BUZA 2O8JA 2XGOA 3ZYQA 3ZW3A 5G04C 5JHAA 4XE0A 3ONLA 3SNXA 3MO5A 4AM9A 2PL2A 5FZQA 3CVNA 4PDXA 3IEGA 3FU6A 1JWGA 4GA0A 5CPRB 2YINA 1E8YA 2G46A 3JCKC 3UT4A 3MX3A 3QK0A 2CFUA 3CVUA 5LOZA 4UWKA 3FEYA 4J8EA 5T4YA 3LY8A 1ZKKA 4N39A 3ZIMA 2YQ8A 3OTNA 4JEHA 5DBKA 3ULQA 1ML9A 3APDA 5HI7A 3D9MA 5M72A 2XGSA 4GMLA 3TJPA 3BG1B 2YNQA 3OXFA 3M53A 5AIJA 4XKBA 1UJJA 3L6AA 3PRZA 5LSXA 3OXGA 2C0LA 4ATGA 3FTUA 3EIQC 3D9IA 3FFLA 5JJ6A 3MYVA 3RIBA 3MKQA 4WWNA 4FA6A 4CGWA 3B7TA 5AYWD 3ZYMA 3APFA 4EECA 4ILHB 3VLFA 3CBMA 3T5XA 4WNEA 1PC2A 1MT6A 3FHEA 2V5FA 2J4BA 4C1QA 4AJWA 2JEKA 3RO2A 3CSFA 1ELRA 2WXQA 3LS8A 4NRHB 5F6KC 3FY4A 1LF8A 4IULA 1E8ZA 4B8CB 2LSVA 3U66A 4KZCA 3KMTA 3KMAA 5G2NA 4G2VA 3S7DA 4N5CA 3M5AA 1KLXA 2KM4A 3EDTB 1FCHA 1E96B 4HFGA 5E76A 1MVHA 4B94A 4DLQA 2J49A 2E2EA 3SD5A 2MRIA 4HOUA 3S7FA 2QPWA 4CRWA 1SZ9A 2I1KA 4HLEA 1H19A 4G11A 2V8SE 3P1UA 4B8AA 4PS3A 2OV8A 4U8HA 3ASFA 2CHWA 1N6AA 1E90A 3M55A 3C98A 4M3OA 3VV0A 1EDUA 1DVPA 2IU1A 3JQ1A 3ASDA 3ASHA 3FEXA 3LKUA 4I17A 4G24A 3UUXA 4FJYA 3DBSA 4TV3A 2FO7A 1ELKA 3KD7A 3B13A 2AXUA 4NACA 3R7RA 5JHBA 3BG0B 4FADA 4Z4PA 5ENNA 4GYOA 4J8DA 5ANLA 2VGXA 3PREA 2GGFA 4YVQC 5CCMA 3AU4A 1E7VA 1ZBPA 3B7SA 1YA0A 2VSYA 4GB9A 3CK8A 1OWOA 5KJMA 3U64A 3CK7A 3FTYA 4AP2A 2WXKA 2VGXB 4NJ5A 3FUIA 4E6HA 3ESKA 1Z6TA 1UN8A 5FQ8A 3RU0A 2GRLA 3ML9A 3FTVA 1OUVA 2I6HA 4E47A 5G55A 3UT8A 3FTXA 2DBAA 5T5GA 4LRZA 5JJ0A 1VDYA 4KYOB 2J07A 3HDXA 4NURA 1H2TC 3PEUB 4OVVA 1TJFA 3PDNA 3G2UA 5E75A 2WMNA 1NZNA 2WM9A 3CHSA 3TG4A 1UJKA 4J6IA 3SBSA 1ZU2A 4NQ0A 3U4TA 1IYGA 4HVBA 4A55A 3CEQA 4CDMA 1UN9A 4GMJA 3MCXA 4IN3B 2CG3A 2X6JA 2PZIA 2WXFA 4XI9A 1NA0A 4AY5A 3OOIA 4N3CA 3G2VA 3Q4AB 2WXRA 5G05C 3CK9A 1H0AA 4IYPA 4Q94A 3MO0A 2YHEA 2HR2A 3ONKA 1HE8A 3L08A 4BSXA 4V3IA 3IHVA 2R59A 1XGWA 3URZA 3F9XA 3S7BA 3CHOA 3RRMB 5CMWA 2VSOE 3NZSA 3QJZA 4J0UA 5TEGA 5FQ4A 3FH5A 3OPEA 2WVIA 3FTSA 5LSZA 2VYIA 5ARFA 3D9OA 4XIFA 2IF4A 3QAQA 3M58A 3PVLA 4AV7A 3FPDA 2CHXA 3ML8A 4JA7A 1XNFA 4EPZA 1TEZA 1BPOA 5FWQA 3T5VA 5BV0A 3S7JA 5KJNA 4AOFA 1HS6A 2LNIA 4FLBA 4JA9A 4G26A 3FUJA 4QENA 4PUCA 3IHXA 4K0RA 4BTBA 3D9LA 3LDZA 3RKVA 3ZPJA 3BEEA 4D10C 2F69A 5A7DB 3MKRA 4FHKA 4G1TA 3GZ1A 4N2QA 3RAYA 3LCAA 3MO2A 3OAWA 4JW1A 4Q69A 4J7IA 2W5ZA 3SWCA 3LY9A 2FBNA 3M57A 3RJVA 2PM7A 5KJLA 1INZA 2X6HA 4BUPA 3CLJA 3QWWA 3ZN3A 2I1JA 2FF4A 3FUKA 4O6FA 1OWNA 3PZDA 2NXPA 4KVOA 4KVMA 4AY6A 4HOTA 3LEWA 1FVFA 3SI5A 4CCAA 3KMJA 2RG8A 4RSYA 3JUIA 3QWVA 4WAFA 4ACLA 1Z3XA 4XI0A 2CG2A 3FU5A 5EKQD 4CEMA 1H2VC 2KATA 4YVOA 2Y3AA 4K03A 3MJWA 4OVUA 2XHEA 4I1MA 1QNFA 5T8IA 2V4LA 4QEPA 1HF8A 3LY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYZ A;  4FMU A;  4CDR A;  4U04 A;  3LPZ A;  3R9A B;  3F9Y A;  3TAX A;  5TTF A;  3Q49 B;  2HO1 A;  2Q7F A;  1KT0 A;  4G23 A;  5FJY A;  3N71 A;  3ASG A;  1HH8 A;  3OXL A;  1QZ2 A;  2XGM A;  1W3B A;  5FTP A;  4U0Z A;  5G04 J;  4I9C A;  3GZ2 A;  4CGV A;  4RZ0 A;  2OOE A;  1MUF A;  5DIZ A;  4GZ6 A;  1O9S A;  4WNG A;  4YPU A;  3TGO A;  4H7X A;  3DAL A;  3Q15 A;  3NF1 A;  5BNW A;  1WM5 A;  3OS5 A;  2WQH A;  4N3B A;  2MHK A;  1QQE A;  2RFI A;  4YND A;  3CVQ A;  4UQY A;  4ABN A;  2VQ2 A;  2BQZ A;  5TH7 A;  1WAO 1;  1Y8M A;  2UWJ G;  3RJW A;  3UQ3 A;  4YNM A;  4Y6W A;  2C0M A;  2FEZ A;  3M59 A;  5LCW C;  3CVL A;  4BT8 A;  1B89 A;  4NVQ A;  2Y4U A;  2IGQ A;  5CCL A;  3QWP A;  2JV0 A;  3HNA A;  3PE4 A;  5AYF A;  3RO3 A;  2BUG A;  5ARG A;  3MV2 B;  4A1S A;  3BO5 A;  3PE3 A;  2QFC A;  3WXX A;  5BT1 A;  2W5Y A;  4GA1 A;  2LSU A;  3O48 A;  4GZ3 A;  4J7F A;  2AVP A;  3CV0 A;  5CHE E;  5C1D A;  5FT9 A;  2XCC A;  2UY1 A;  4J8O A;  3FWV A;  3SWC A;  5HQ8 A;  1ELW A;  3CKC A;  4AIF A;  3CKB A;  4BTA A;  3K9I A;  1HZ4 A;  1PEG A;  2UY1 B;  4UI9 J;  2IFU A;  4GYW A;  4U0S A;  2P58 C;  3VUZ A;  4JL0 A;  2J9Q A;  1N6C A;  4N3A A;  2JLB A;  4JLG A;  4GZ5 A;  3E4B A;  4J8F A;  4UI9 K;  4WUY A;  2PQN A;  3HYM B;  3VTX A;  5T0M A;  2VSN A;  4BT9 A;  4BWR A;  4GCN A;  5BW8 C;  5FZR A;  4HOR A;  1N3J A;  3FP3 A;  2WPV A;  3QOU A;  5G05 J;  5A6C A;  4MI0 A;  4HOS A;  4LDG A;  3M54 A;  4RG6 A;  4RG9 A;  3CBO A;  3GW4 A;  3U3W A;  4GPK A;  3K5K A;  1MVX A;  5D0Q D;  5JHN A;  4O30 A;  4I2Z A;  4Y6C A;  3ZFW A;  5D0O D;  5F5E A;  1NA3 A;  3AS4 A;  2NC9 A;  4IJD A;  2KCV A;  3DB5 A;  1XQH A;  3LYA A;  2KCL A;  2OND A;  3TG5 A;  5F59 A;  2HYZ A;  4W9R A;  2GW1 A;  2Y4T A;  3JYS A;  3MA5 A;  5JJ7 A;  3MV3 B;  1A17 A;  3QDN A;  4UQZ A;  2XPI A;  3MEK A;  4GA2 A;  5T0K A;  4APO A;  3QKY A;  4IJ8 A;  1P5Q A;  4MI5 A;  3SZ7 A;  4YPA A;  3EP0 A;  4U07 A;  4YPE A;  4LEU A;  4I9E A;  3ZGQ A;  4WNF A;  3CBP A;  3SW9 A;  4N2S A;  2KC7 A;  2R5S A;  2YHC A;  2VGY A;  5KJK A;  3S8P A;  4U0U A;  4ME2 A;  4JHR A;  4UQX A;  4J83 A;  1HXI A;  4UI9 C;  3F9Z A;  5F6L A;  2R3A A;  4QEO A;  4F3V A;  3AS5 A;  1TJC A;  4G25 A;  4KBQ A;  4I1A A;  4I2W A;  3VTY A;  1IHG A;  3KAE A;  2L6J A;  3F9W A;  4WND A;  4GYY A;  4H7Y A;  5JIY A;  5EX3 A;  3SF4 A;  5FZS A;  4YNP A;  4GCO A;  4H12 A;  3KS2 A;  3UPV A;  2FI7 A;  2KCK A;  3AS8 A;  5JJT A;  3RQ4 A;  1KT1 A;  5LCW J;  2C2L A;  4AU7 A;  2PQR A;  3ZHE A;  3Q5M A;  5EX0 A;  4HOQ A;  4EQF A;  3CVP A;  4I51 A;  3Q47 B;  3M56 A;  2XCB A;  4JDS A;  4KXK B;  3ZHE B;  5EG2 A;  1H3I A;  2XEV A;  2O8J A;  2XGO A;  5G04 C;  3MO5 A;  4AM9 A;  2PL2 A;  5FZQ A;  3CVN A;  3IEG A;  4GA0 A;  5CPR B;  2G46 A;  4J8E A;  3LY8 A;  1ZKK A;  4N39 A;  2YQ8 A;  3ULQ A;  5DBK A;  1ML9 A;  5HI7 A;  5M72 A;  2XGS A;  3M53 A;  3OXF A;  5LSX A;  3OXG A;  2C0L A;  3FFL A;  5JJ6 A;  3RIB A;  4CGW A;  5AYW D;  3CBM A;  4WNE A;  1PC2 A;  1MT6 A;  2V5F A;  4C1Q A;  3RO2 A;  1ELR A;  4NRH B;  5F6K C;  2LSV A;  3KMT A;  3KMA A;  4G2V A;  3S7D A;  4N5C A;  3M5A A;  1KLX A;  3EDT B;  1FCH A;  1E96 B;  1MVH A;  4B94 A;  2E2E A;  4HOU A;  3S7F A;  2QPW A;  3ASF A;  1N6A A;  3M55 A;  3VV0 A;  4I17 A;  3LKU A;  3ASD A;  3ASH A;  4G24 A;  3UUX A;  2FO7 A;  3KD7 A;  4Z4P A;  4GYO A;  4J8D A;  2VGX A;  4YVQ C;  5CCM A;  1ZBP A;  1YA0 A;  2VSY A;  3CK8 A;  5KJM A;  3CK7 A;  2VGX B;  4NJ5 A;  3ESK A;  3RU0 A;  1OUV A;  2I6H A;  4E47 A;  5T5G A;  5JJ0 A;  2DBA A;  4KYO B;  3PDN A;  1NZN A;  3TG4 A;  1ZU2 A;  4NQ0 A;  3U4T A;  1IYG A;  3CEQ A;  4IN3 B;  2PZI A;  4XI9 A;  1NA0 A;  4AY5 A;  3OOI A;  4N3C A;  3Q4A B;  5G05 C;  3CK9 A;  3MO0 A;  2HR2 A;  3URZ A;  3F9X A;  3S7B A;  4J0U A;  5TEG A;  3OPE A;  5LSZ A;  2VYI A;  5ARF A;  4XIF A;  2IF4 A;  3M58 A;  3FPD A;  4JA7 A;  1XNF A;  3S7J A;  5KJN A;  2LNI A;  4JA9 A;  4G26 A;  4QEN A;  3IHX A;  4BTB A;  3RKV A;  3ZPJ A;  3BEE A;  2F69 A;  5A7D B;  3MKR A;  4G1T A;  3GZ1 A;  4N2Q A;  3RAY A;  3LCA A;  3MO2 A;  4J7I A;  2W5Z A;  3LY9 A;  2FBN A;  3M57 A;  3RJV A;  5KJL A;  5JIN A;  4BUP A;  3QWW A;  3ZN3 A;  2FF4 A;  4O6F A;  4HOT A;  4AY6 A;  3KMJ A;  3QWV A;  4XI0 A;  5EKQ D;  2KAT A;  4YVO A;  4QEP A;  3LY7 A; 
#chains in the Genus database with same CATH topology
 3GYZ A;  4FMU A;  1UG3 A;  3MZL B;  3TAX A;  4C0E A;  1S63 A;  4I6J A;  3TWX A;  2X6I A;  1O1S A;  4YDY A;  2HM8 A;  4G23 A;  2IO3 C;  3B7R L;  4B93 B;  1QZ2 A;  1SQM A;  1W3B A;  1D8D A;  5G04 J;  3DPD A;  2FUL A;  3GZ2 A;  4CYM D;  4K5B A;  1OWM A;  1HU3 A;  4YPU A;  4I1O B;  3IBE A;  2H6H A;  5AQ9 A;  4J7W A;  2BED A;  4ATZ D;  3TWS A;  4LNU D;  1JPL A;  2GRR B;  5LP0 A;  4MRU A;  3J5P A;  4UQY A;  4ABN A;  1KZO A;  2I2O A;  1V54 E;  3RJW A;  4JPS A;  3FTW A;  5ITZ F;  3CGH A;  3JXJ A;  4Q96 A;  3DSX A;  3CVL A;  5C2Y A;  2WXL A;  5CCL A;  1G3N B;  2WMO A;  3RO3 A;  3CHP A;  3MV2 B;  3TWT A;  3EHM A;  4LCT A;  2QZA A;  5J90 A;  3O48 A;  2AXZ A;  4GZ3 A;  5JA4 D;  5C1D A;  5FT9 A;  2XCC A;  2UY1 A;  4CZ2 D;  4J8O A;  3FWV A;  3SWC A;  3S2A A;  4JZY A;  3CKC A;  2R17 C;  3D9P A;  4AIF A;  3CKB A;  3K9I A;  4UI9 J;  4MS6 A;  3PNT B;  1D9S A;  4UWL A;  3HHM A;  4JL0 A;  4N3A A;  2JLB A;  4GZ5 A;  3SBT B;  1DCQ A;  2WXH A;  3F6Q A;  3PNL B;  4J8F A;  3FDH A;  4UI9 K;  4WUY A;  5D66 A;  4HBD A;  1JUQ A;  3WG7 E;  1UW4 B;  4F1S A;  2WQ7 A;  4BT9 A;  4E85 A;  1E8X A;  2EIJ E;  3FP3 A;  3FH8 A;  5ENT D;  5G05 J;  3PS6 A;  4LDG A;  3I5P A;  3D9H A;  3U3W A;  4GPK A;  3PZ1 A;  1MVX A;  2J4D A;  2MYO A;  1N4Q A;  3UM2 A;  4GZC A;  1JWF A;  4I2Z A;  4Y6C A;  5D0O D;  5F5E A;  1NA3 A;  3CVY A;  1DC2 A;  2KCV A;  1TNU A;  2GRN B;  4ANU A;  3V2O A;  2GW1 A;  1RW2 A;  5HKP A;  1IQR A;  3E37 A;  4GTP A;  3ZVV A;  4C48 B;  2XPI A;  4TXP A;  5ENR D;  4APO A;  2LO6 A;  1P5Q A;  1OWL A;  4U07 A;  4YPE A;  3AU5 A;  1TNY A;  1U3D A;  2IQC A;  3ZGQ A;  3SW9 A;  3QAR A;  4UUC A;  4N2S A;  1BI7 B;  1UOH A;  4FU3 A;  4JHJ A;  3S8P A;  4ILI A;  4ME2 A;  4JHR A;  4UQX A;  1HXI A;  4UI9 C;  4KMO A;  1SZA A;  4QEO A;  2QY7 A;  3NQP A;  1TJC A;  2R02 A;  1IXV A;  4G25 A;  4KBQ A;  4EZL A;  3JXI A;  4I43 A;  5ENS D;  2IY0 C;  4XX5 A;  2XEE A;  3SFZ A;  1YCS B;  3UPV A;  4FP7 A;  1MX2 A;  3EIJ A;  4R7L A;  4DPR A;  2IEJ A;  1KT1 A;  4KZ0 A;  4AU7 A;  3LJN A;  4MKT A;  4PH4 B;  4HOQ A;  4EQF A;  5FIN A;  3NZU A;  2XCB A;  4BET A;  4KXK B;  3DSS A;  4WWP A;  2XEV A;  4DX2 A;  5BUZ A;  2O8J A;  2XGO A;  4XE0 A;  3SNX A;  4ZHB A;  3MO5 A;  3CVN A;  4GA0 A;  1E8Y A;  2G46 A;  4DUI A;  4J8E A;  4HQD A;  1ML9 A;  5HI7 A;  5M72 A;  3C3R A;  2LXM A;  4GML A;  3OXF A;  4XKB A;  3L6A A;  1SA4 A;  3AG3 E;  3OXG A;  3FTU A;  2R03 A;  4FA6 A;  4CGW A;  3T5X A;  2V5F A;  5CRU A;  3CSF A;  2WXQ A;  4NRH B;  4B8C B;  4KZC A;  3KMA A;  2F37 A;  3S7D A;  3M5A A;  3EDT B;  1FCH A;  1E96 B;  4B94 A;  3L82 A;  2J49 A;  2MRI A;  3PZ2 A;  4GPM A;  1H19 A;  4G11 A;  2OV8 A;  3SO8 A;  4LG6 A;  1BLX B;  1EDU A;  1DVP A;  4I17 A;  2XS1 A;  3BUA A;  1Z5S C;  5ENN A;  4J8D A;  3AU4 A;  1YA0 A;  5EIB E;  3CK7 A;  2WXK A;  3TWQ A;  3FTV A;  2I6H A;  5JJ0 A;  2DBA A;  4HRL A;  4LRZ A;  1H2T C;  2QC9 A;  3G2U A;  2WM9 A;  3TG4 A;  1UJK A;  4J6I A;  3SBS A;  1ZU2 A;  4OAU C;  1IYG A;  4A55 A;  1UN9 A;  3SFX A;  2CG3 A;  1A5E A;  4AY5 A;  3Q4A B;  4BES A;  4Q94 A;  2HR2 A;  2F8Y A;  3URZ A;  1QBQ A;  1TN7 A;  3Q7A A;  2VSO E;  1SA5 A;  2VYI A;  4XIF A;  3QAQ A;  2CHX A;  3ML8 A;  1XNF A;  4EPZ A;  5H7P A;  4QEN A;  3FUJ A;  4K0R A;  3ZPJ A;  3EHR A;  3SQV A;  5A7D B;  4FHK A;  4Q69 A;  1N0R A;  1INZ A;  4BUP A;  2AJA A;  4HRM B;  3AAA C;  4KVO A;  4HOT A;  2OEV A;  1FVF A;  3Q7F A;  4ACL A;  3JUI A;  2VGE A;  4XI0 A;  5BXU A;  2Y3A A;  2DVW A;  4OVU A;  1QNF A;  5T8I A;  4CDR A;  3LPZ A;  3B7U X;  5TTF A;  3Q49 B;  1NFI E;  2LAI A;  4NIK A;  4UWH A;  2ZGG A;  3ISM C;  2KZT A;  3APC A;  5T3R A;  2VTB B;  3N71 A;  3ASG A;  1HH8 A;  4P29 A;  3UIO C;  2P9P G;  2AW6 A;  4BSZ B;  4DJA A;  1N9A A;  4U0Z A;  3AG4 E;  3DRA A;  5DIZ A;  2WB2 A;  2IOS A;  4H7X A;  3DAL A;  5BNW A;  3OS5 A;  3W9G A;  2WQH A;  4N3B A;  5AQB A;  3Q73 A;  2MHK A;  2IOL A;  4YND A;  3PH0 C;  4FUL A;  4FJZ A;  1Y8M A;  4APF A;  4GTO A;  1Y6I A;  2J09 A;  1K1B A;  4B0Z A;  2C0M A;  3M59 A;  5LCW C;  4BT8 A;  3SGH A;  1H6O A;  2WXO A;  3CHM A;  2XEH A;  3QWP A;  2JV0 A;  3UKU G;  5ARG A;  2NYJ A;  4L9P A;  4L2Y A;  3WXX A;  1HO8 A;  1OY3 D;  1AWC B;  2V5Q C;  4OYS A;  3UIN C;  2W5Y A;  3Q75 A;  4GA1 A;  2XZD G;  3ASN E;  3FTZ A;  3CHQ A;  3CV0 A;  5CHE E;  5D2M C;  2MOW A;  4BX8 A;  2J08 A;  2VJ8 A;  4JD2 G;  3FUN A;  3ULE G;  1TYQ G;  4BTA A;  1H2U A;  1HZ4 A;  2UY1 B;  3CQG B;  4GYW A;  5HRY A;  3ASO E;  3BQO A;  3J5Q B;  3FUE A;  1MX6 A;  3L9T A;  5B3S E;  4JC8 A;  5CMY A;  3FUL A;  4AXH A;  4BY6 A;  3HYM B;  3EHN A;  4AEZ C;  4GCN A;  5FZR A;  4HOR A;  2ZIR A;  1N3J A;  1WY6 A;  4MI0 A;  3ZXP A;  3CVX A;  3M54 A;  2VTB A;  4LNB A;  2KBX A;  1K8K G;  3K5K A;  5CED B;  5EYL A;  5JHN A;  4UWF A;  4LUN U;  3T8M A;  4TXR A;  3AS4 A;  2PM6 A;  3C3Q A;  3DB5 A;  1N95 A;  2HE0 A;  5FQ6 A;  3MA5 A;  5JJ7 A;  2XPZ A;  3MV3 B;  3V31 A;  5ENP D;  3QDN A;  4UQZ A;  4MI5 A;  3D9K A;  3ESL A;  4YPA A;  1N4S A;  3IKO B;  1WDY A;  4LEU A;  4YDW A;  3T9K A;  4QFV A;  2WQ6 A;  4L2L A;  4F53 A;  4FC8 A;  5EIL A;  5B1A E;  1N4R A;  2YHC A;  3FUH A;  2WXG A;  5KJK A;  4U0U A;  3UMV A;  4N5Q A;  5F6L A;  2R3A A;  5LFA A;  4YDE A;  1TR4 A;  4I1A A;  4I2W A;  1LD7 A;  4WND A;  2L0T B;  2Y69 E;  4FHJ A;  5EX3 A;  5FZS A;  4RVB A;  4YNP A;  5AEN A;  2OVB A;  2BTD A;  5BV1 A;  2AXV A;  2A5U A;  3KS2 A;  3D9J A;  5LX8 A;  3DXM G;  3UM3 A;  3AS8 A;  3FH7 A;  5JJT A;  4LER A;  4GMR A;  4PS7 A;  4M7C A;  2Y1L E;  3Q47 B;  3M56 A;  4JDS A;  1YMP A;  3L17 A;  3JQ0 A;  2XQ0 A;  4LNG A;  5G04 C;  4AM9 A;  1JWG A;  3DEP A;  3KSL A;  2V4H C;  3QK0 A;  3FEY A;  4N39 A;  4JEH A;  3OTN A;  5AIJ A;  2J8S D;  5LSX A;  4ATG A;  3FFL A;  2FO1 E;  1KPS B;  3VLF A;  3CBM A;  4HI9 A;  1PC2 A;  3UM0 A;  3HG0 D;  3RO2 A;  3AG1 E;  3FY4 A;  1LF8 A;  1E8Z A;  3KMT A;  1KLX A;  5ENQ D;  4HFG A;  4DLQ A;  3AJI A;  1SZ9 A;  1OXJ A;  3P1U A;  4PS3 A;  2CHW A;  3JQ1 A;  1DCE A;  3ASH A;  3LKU A;  4G24 A;  3Q9U C;  4TV3 A;  3DBS A;  3B13 A;  2AXU A;  5JHB A;  4GYO A;  5ANL A;  2VGX A;  3PRE A;  2GGF A;  1ZBP A;  2RFA A;  3FTY A;  4E6H A;  1Z6T A;  5FQ8 A;  3AG2 E;  5KNH D;  1OUV A;  5T5G A;  4KYO B;  5E75 A;  4NUR A;  5BXO A;  3MCX A;  4XI9 A;  1NA0 A;  3OOI A;  1FPP A;  2EIL E;  5G05 C;  3CK9 A;  1H0A A;  3MO0 A;  2YHE A;  3ONK A;  2ZXW E;  3IHV A;  3UXG A;  2B6C A;  3CHO A;  3RRM B;  5CMW A;  5TEG A;  5LSZ A;  2P9K G;  3D9O A;  2GRP B;  3FPD A;  4JA7 A;  1TEZ A;  1MZC A;  1BPO A;  3S7J A;  5KJN A;  4FLB A;  4G26 A;  3IHX A;  3LDZ A;  3V2X A;  5CER B;  3BEE A;  4N2Q A;  3GZ1 A;  3RAY A;  3KSQ A;  4K5A B;  3OAW A;  3UI2 A;  5AQ7 A;  2FBN A;  5KJL A;  3HXD A;  3QWW A;  2FF4 A;  4O6F A;  1OWN A;  3PZD A;  2NXP A;  4AY6 A;  2H6G A;  3LEW A;  3SI5 A;  4TUM A;  3KMJ A;  4F6R D;  4RSY A;  4WAF A;  1Z3X A;  4U8V D;  2CG2 A;  3FU5 A;  3EU5 A;  1H2V C;  2KAT A;  5ENO D;  3MJW A;  2XHE A;  4QEP A;  1HF8 A;  3RAU A;  4GTR A;  4D10 C;  2OEW A;  1PAQ A;  4HXI A;  3R9A B;  3F9Y A;  2HO1 A;  2I9C A;  2Q7F A;  3GZS A;  4JVS A;  3R7Q A;  3I4R B;  4IRU A;  1N4P A;  5FJY A;  3G2S A;  3RRN B;  1N54 A;  2KZT B;  2A4Z A;  3TXN A;  3L16 A;  3SFY A;  2IJG X;  1S0P A;  2XGM A;  3IV0 A;  3QB2 A;  3RK6 A;  1MQS A;  2ETC A;  3LXU X;  3C72 A;  4CGV A;  4BEP A;  3L22 A;  2OOE A;  4ZFH A;  2AWI A;  4TUU A;  3ZYK A;  3Q15 A;  1FT2 A;  3G2T A;  4DX6 D;  4HRN A;  4EBA A;  2DIW A;  4EZK A;  1QQE A;  3UTM A;  3CVQ A;  2VQ2 A;  1WAO 1;  3UQ3 A;  4YDO A;  4DI4 A;  4YNM A;  4GU5 A;  2NSZ A;  2WXM A;  4Y6W A;  2FEZ A;  4B89 A;  1B89 A;  4NVQ A;  4TXQ A;  2IGQ A;  1JCQ A;  3ULY A;  1TN8 A;  1MYO A;  3EU9 A;  3D3M A;  4UWG A;  2Y0B G;  2WXJ A;  4A1S A;  3BO5 A;  3C3O A;  4GTM A;  4CDN A;  4J8Y A;  2XRY A;  2V0P A;  3KEA A;  1EF1 C;  1K1A A;  4J7F A;  4EZJ A;  2AVP A;  3PZ3 A;  4HS2 A;  1OCR E;  2X6K A;  4HNA D;  3KEZ A;  5HQ8 A;  1ELW A;  3FU3 A;  4I6E A;  5AQA A;  3RRU A;  4BX9 A;  4L1B A;  2ION A;  4QQI A;  2WXI A;  2IFU A;  4U0S A;  3VUZ A;  2ZU6 B;  4G8L A;  2J9Q A;  1N6C A;  2ZGD A;  2DWZ A;  3QC1 A;  1HX8 A;  3E4B A;  4F7A A;  2PQN A;  2ETB A;  3TWV A;  5T0M A;  2VSN A;  4XEI G;  4CT0 A;  4BWR A;  5BW8 C;  4U63 A;  2KXP C;  4U8Y D;  3DWL G;  3QOU A;  4HOS A;  2WXP A;  1H6K A;  3CBO A;  3GW4 A;  3VLE A;  3ENE A;  1JCR A;  1IQU A;  4BFR A;  1TNB A;  3TWU A;  2BF0 X;  3ZFW A;  3HXC A;  3Q78 A;  2NC9 A;  2RKK A;  1EPU A;  2WXN A;  4K5C A;  3LYA A;  2KCL A;  2OND A;  1X81 A;  5BPP A;  4HB5 A;  2HYZ A;  4FLH A;  4W9R A;  4AVX A;  3MKQ B;  3I4G A;  2EQX A;  2Y4T A;  3JYS A;  3DSW A;  2P9N G;  3IXE A;  1IKN D;  3MEK A;  5T0K A;  3QKY A;  3ZNG A;  3EP0 A;  4OAV B;  4I9E A;  2DZO A;  3CBP A;  4I6G A;  3UIP C;  3JUE A;  1O1R A;  2VGY A;  2GRM A;  2P9I G;  2XZT G;  4A3V A;  3DPY A;  3O4Z A;  5KNG A;  4GTV A;  2DYR E;  2B0O E;  1N94 A;  5HS0 A;  3VTY A;  2VSX E;  3KAE A;  2L6J A;  3F9W A;  4GYY A;  5KWD A;  1BI8 B;  3SF4 A;  3I3N A;  3ZKJ A;  5CBO A;  3D9N A;  5IY5 E;  4ACK A;  3LVR E;  2KCK A;  2OVF A;  1FVH A;  2M63 A;  4ANW A;  2QYJ A;  1YYH A;  2C2L A;  2PQR A;  3ZHE A;  3IHY A;  4TRQ A;  3FUM A;  3CVP A;  4EHM A;  4BER A;  5EG2 A;  4L23 A;  3HXB A;  1H3I A;  1V55 E;  2ZIS A;  3ZW3 A;  5JHA A;  1BD8 A;  3ONL A;  2PL2 A;  5FZQ A;  3ZUV B;  2YIN A;  3JCK C;  3UT4 A;  5AAO A;  2CFU A;  5LOZ A;  3SY2 A;  4U7E B;  3LY8 A;  3ZIM A;  3APD A;  3D9M A;  1N0Q A;  1UJJ A;  3PRZ A;  2C0L A;  3EIQ C;  3RIB A;  3MKQ A;  3B7T A;  3ZYM A;  3APF A;  5KBA A;  2BKK B;  4WNE A;  2J4B A;  3TWR A;  2JEK A;  3LS8 A;  1ELR A;  3U66 A;  2DZN A;  5G2N A;  3T8K A;  5E76 A;  3NOC D;  1LD8 A;  2E2E A;  3S7F A;  4CRW A;  2I1K A;  4HLL A;  2V8S E;  4B8A A;  4U8H A;  1N6A A;  3M55 A;  2A5E A;  4M3O A;  3VV0 A;  2IU1 A;  3FEX A;  3UUX A;  2FO7 A;  1ELK A;  4Z4P A;  4FAD A;  3B7S A;  4GB9 A;  2VSY A;  5KJM A;  3U64 A;  1O1T A;  2VGX B;  4NJ5 A;  3FUI A;  3ESK A;  3RU0 A;  3B7B A;  3Q79 A;  4E47 A;  5G55 A;  3UT8 A;  3HDX A;  4OVV A;  1TJF A;  2WMN A;  3HXE A;  1IHB A;  3CHS A;  1OCO E;  3NB2 A;  4NQ0 A;  1RZ4 A;  3CEQ A;  4GMJ A;  4MBG A;  2X6J A;  4DX7 D;  3G2V A;  2WXR A;  1O5M A;  3ABL E;  4IYP A;  3EUV A;  1HE8 A;  4V3I A;  2R59 A;  3S7B A;  3NZS A;  3Q9N C;  3OPE A;  2WVI A;  2P2C P;  3FTS A;  4GTS A;  3PZ4 A;  2IF4 A;  3M58 A;  3PVL A;  5BV0 A;  1HS6 A;  2LNI A;  5AN8 A;  3DST A;  4DRX E;  3RKV A;  2EIK E;  4JW1 A;  4J7I A;  2W5Z A;  3M57 A;  3RJV A;  2PM7 A;  2X6H A;  3CLJ A;  3ZN3 A;  3FUK A;  2BKG A;  4CCA A;  2EIM E;  2P9U G;  3ABK E;  2XS8 A;  4I1M A;  1MJ0 A;  5CBN A;  1SW6 A;  4U04 A;  4Z68 A;  3HVE B;  2XRZ A;  4ANX A;  3CQC B;  1KT0 A;  5J08 A;  5EDS A;  1NL4 A;  3OXL A;  3UKR G;  2X38 A;  5FTP A;  1OCC E;  4I9C A;  1OT8 A;  1NI1 A;  3NBN B;  1MX4 A;  4RZ0 A;  1FT1 A;  1MUF A;  5EID A;  4GZ6 A;  1O9S A;  2F8X K;  4WNG A;  3QNK A;  3TGO A;  2ILR A;  4WWO A;  1BU9 A;  3NF1 A;  1WM5 A;  3UM1 A;  4DK5 A;  2OCC E;  1N11 A;  3U9W A;  4J8S A;  1MHQ A;  5ANR A;  2RFI A;  1X5B A;  5TH7 A;  2BQZ A;  3CIA A;  1TN6 A;  2UWJ G;  3L54 A;  3DSV A;  5KCM A;  1OCZ E;  2DCP A;  3PUK A;  4JB8 P;  3CVW A;  3SHF A;  2Y4U A;  4DX1 A;  3HNA A;  3PE4 A;  5AYF A;  3CHR A;  4JXT A;  2BUG A;  2DYS E;  4JHK A;  4URK A;  3TWW A;  4EBA G;  2LXL A;  3PE3 A;  2QFC A;  3ABM E;  3LVQ E;  5BT1 A;  3ZEF A;  3LJ3 A;  2LSU A;  1U2V G;  3FUF A;  1OWP A;  2QYU A;  4A1G A;  2CHZ A;  1PY1 A;  1PEG A;  1S70 B;  3L13 A;  2P58 C;  5AJL A;  3CST A;  4GZD A;  4DLO A;  4JLG A;  3NAW A;  3DSU A;  4PS8 A;  2P9S G;  3UX4 A;  2JAB A;  3VTX A;  3FUD A;  2R05 A;  1TNO A;  2P9L G;  4L7T A;  3PEV B;  2WPV A;  1EYH A;  5JMN D;  4U96 D;  3HVE A;  5A6C A;  2L0I A;  3MGB A;  3E34 A;  4RG6 A;  3C5R A;  2L9B A;  4ANV A;  4RG9 A;  4DX5 D;  2GRQ B;  3TL5 A;  3R9M A;  3CVV A;  4KT6 B;  3HIZ A;  4XZ4 A;  4GAA A;  2X3M A;  3DXK G;  3FU0 A;  2XEN A;  5D0Q D;  4O30 A;  4XKC A;  5AJD A;  3ZXS A;  4IJD A;  4CT4 A;  1XQH A;  3TG5 A;  4O60 A;  5F59 A;  4JEU A;  2F0Y A;  1A17 A;  1JCS A;  4O1P A;  1GW6 A;  2E0I A;  4X8Q A;  1HG5 A;  1HG2 A;  4GA2 A;  5A23 A;  4IJ8 A;  3V30 A;  3E30 A;  2RD0 A;  4ILG A;  3SZ7 A;  1E8W A;  1Q2Z A;  4RQI A;  3ZRH A;  2XPY A;  2L6B A;  1Z3Y A;  4WNF A;  3B95 A;  4O1O A;  4GTT A;  3CR3 A;  2KC7 A;  4C0M A;  1U3C A;  2R5S A;  4MLP A;  3HXF A;  3DEO A;  3VLD A;  4J83 A;  3F9Z A;  5CEC B;  3RSE G;  4F3V A;  3TXM A;  3AS5 A;  3EJN A;  3HRA A;  3PUJ A;  1AP7 A;  1IHG A;  4DI3 A;  5FQ7 A;  2X6F A;  4A3T A;  1E7U A;  4H7Y A;  3P2B A;  1DNP A;  1HFA A;  5JIY A;  2LAH A;  4C9B B;  2H6F A;  4GCO A;  1H6P A;  4H12 A;  2FI7 A;  1NP7 A;  3RQ4 A;  1LTX A;  1L5J A;  1D8E A;  3ZYL A;  5LCW J;  1N52 A;  3Q5M A;  5EX0 A;  2CFZ A;  3G2W A;  4I51 A;  3ZHE B;  1SVX A;  3ZYQ A;  2LUH A;  4PDX A;  3IEG A;  3FU6 A;  5CPR B;  3MX3 A;  3CVU A;  4UWK A;  5T4Y A;  1ZKK A;  2YQ8 A;  3ULQ A;  5DBK A;  2XGS A;  3TJP A;  3M53 A;  3BG1 B;  2YNQ A;  3E33 A;  4GTQ A;  3D9I A;  5JJ6 A;  3MYV A;  4WWN A;  5AYW D;  4EEC A;  4ILH B;  1MT6 A;  3FHE A;  4C1Q A;  5CEA A;  4AJW A;  5F6K C;  4G8K A;  4IUL A;  2LSV A;  4G2V A;  4N5C A;  3X2Q E;  2KM4 A;  5FIO A;  2PNN A;  2EIN E;  1MVH A;  3SD5 A;  4HOU A;  2QPW A;  4HLE A;  5B1B E;  3ASF A;  1E90 A;  3C98 A;  3UT7 A;  3ZU7 B;  3ASD A;  2RFM A;  4FJY A;  3KD7 A;  4NAC A;  1WG0 A;  3R7R A;  3BG0 B;  5CRV A;  4U95 D;  5CCM A;  4YVQ C;  1E7V A;  5EYP F;  3CK8 A;  1OWO A;  4AP2 A;  3BU8 A;  5AAR A;  1UN8 A;  2GRL A;  3ML9 A;  4HI8 A;  1K3Z D;  3FTX A;  1VDY A;  2J07 A;  3PEU B;  3PDN A;  1NZN A;  2GRO B;  4A63 B;  3U4T A;  4HVB A;  4CDM A;  4IN3 B;  2WXF A;  2PZI A;  4N3C A;  2IO2 C;  3L08 A;  4BSX A;  1XGW A;  3F9X A;  3QJZ A;  4J0U A;  5FQ4 A;  3FH5 A;  1S64 A;  5ARF A;  1QYM A;  1TNZ A;  4AV7 A;  2R2L A;  5FWQ A;  3T5V A;  3NOG D;  4AOF A;  1KZP A;  4JA9 A;  2ETA A;  4PUC A;  4BTB A;  3D9L A;  5EN5 D;  4F1P A;  1ZB1 A;  2F69 A;  3MKR A;  4G1T A;  3LCA A;  3MO2 A;  3EHQ A;  4LSZ E;  3LY9 A;  3E32 A;  5JIN A;  3V79 K;  2I1J A;  4KVM A;  2H6I A;  4RLY A;  2RG8 A;  3QWV A;  4CEM A;  5EKQ D;  4YVO A;  4K03 A;  2V4L A;  3LY7 A;  3W9F A; 
#chains in the Genus database with same CATH homology
 3GYZ A;  4FMU A;  4CDR A;  1PAQ A;  4HXI A;  4U04 A;  1UG3 A;  2XRZ A;  3HVE B;  3LPZ A;  3R9A B;  3MZL B;  3F9Y A;  3TAX A;  4ANX A;  3CQC B;  3B7U X;  4C0E A;  5TTF A;  3Q49 B;  2HO1 A;  2LAI A;  4I6J A;  4UWH A;  2I9C A;  2X6I A;  2Q7F A;  2KZT A;  3GZS A;  4JVS A;  3APC A;  3R7Q A;  1KT0 A;  2HM8 A;  3I4R B;  4G23 A;  4IRU A;  5T3R A;  2VTB B;  5J08 A;  5FJY A;  3N71 A;  5EDS A;  3ASG A;  1HH8 A;  3B7R L;  4P29 A;  3G2S A;  3RRN B;  3OXL A;  1N54 A;  2KZT B;  2A4Z A;  2AW6 A;  3TXN A;  3L16 A;  4DJA A;  2X38 A;  1QZ2 A;  2IJG X;  1S0P A;  2XGM A;  3IV0 A;  3QB2 A;  1SQM A;  1MQS A;  3RK6 A;  1W3B A;  5FTP A;  4U0Z A;  5G04 J;  3LXU X;  3DPD A;  2FUL A;  3GZ2 A;  4I9C A;  4CGV A;  1OWM A;  1HU3 A;  4RZ0 A;  3L22 A;  2OOE A;  1MUF A;  2AWI A;  4GZ6 A;  5DIZ A;  4TUU A;  1O9S A;  4WNG A;  3ZYK A;  4YPU A;  2WB2 A;  3QNK A;  2IOS A;  2ILR A;  4H7X A;  4I1O B;  3TGO A;  3IBE A;  4WWO A;  3Q15 A;  3DAL A;  3NF1 A;  5BNW A;  1WM5 A;  3OS5 A;  4DK5 A;  2WQH A;  3G2T A;  4N3B A;  3U9W A;  4J8S A;  4EBA A;  1MHQ A;  2DIW A;  5ANR A;  4EZK A;  2MHK A;  1JPL A;  5LP0 A;  2IOL A;  1QQE A;  4MRU A;  2RFI A;  1X5B A;  4YND A;  3CVQ A;  4UQY A;  4ABN A;  2VQ2 A;  3PH0 C;  2BQZ A;  5TH7 A;  1WAO 1;  4FUL A;  4FJZ A;  2I2O A;  1Y8M A;  3CIA A;  4APF A;  2UWJ G;  1Y6I A;  3L54 A;  4JPS A;  2J09 A;  5KCM A;  3RJW A;  3FTW A;  3CGH A;  3UQ3 A;  4YNM A;  4DI4 A;  4Q96 A;  4GU5 A;  2NSZ A;  2WXM A;  4B0Z A;  2DCP A;  2C0M A;  2FEZ A;  3PUK A;  4Y6W A;  4B89 A;  5LCW C;  3M59 A;  3CVL A;  4BT8 A;  1B89 A;  3CVW A;  5C2Y A;  3SGH A;  3SHF A;  2Y4U A;  4NVQ A;  2WXO A;  3CHM A;  2IGQ A;  2WXL A;  5CCL A;  3QWP A;  2JV0 A;  3HNA A;  3PE4 A;  5AYF A;  2WMO A;  3CHR A;  3RO3 A;  3D3M A;  4JXT A;  2BUG A;  4URK A;  4JHK A;  3CHP A;  5ARG A;  4UWG A;  3MV2 B;  2WXJ A;  4A1S A;  4EBA G;  3BO5 A;  3PE3 A;  2QFC A;  4L2Y A;  3WXX A;  3UT7 A;  4CDN A;  1HO8 A;  3LVQ E;  3EHM A;  4LCT A;  5BT1 A;  2XRY A;  2V0P A;  4OYS A;  3ZEF A;  2W5Y A;  5J90 A;  1EF1 C;  4GA1 A;  3LJ3 A;  2LSU A;  3O48 A;  2AXZ A;  4GZ3 A;  4J7F A;  4EZJ A;  3FTZ A;  3FUF A;  2AVP A;  1OWP A;  3CHQ A;  3CV0 A;  4HS2 A;  5CHE E;  5C1D A;  5FT9 A;  2XCC A;  4A1G A;  2UY1 A;  2X6K A;  3FWV A;  4J8O A;  2CHZ A;  3KEZ A;  2MOW A;  3S2A A;  4BX8 A;  1ELW A;  3FU3 A;  2J08 A;  4I6E A;  3CKC A;  4JZY A;  2VJ8 A;  3RRU A;  2R17 C;  4BX9 A;  1PY1 A;  3D9P A;  3FUN A;  4AIF A;  3CKB A;  4L1B A;  2ION A;  1H2U A;  1HZ4 A;  3K9I A;  4BTA A;  1PEG A;  2WXI A;  2UY1 B;  4UI9 J;  3CQG B;  4MS6 A;  2IFU A;  3L13 A;  3PNT B;  4GYW A;  4U0S A;  2P58 C;  5AJL A;  3VUZ A;  3FUE A;  3CST A;  4GZD A;  4UWL A;  4DLO A;  2ZU6 B;  3HHM A;  4JL0 A;  2J9Q A;  1N6C A;  4N3A A;  2JLB A;  4JLG A;  4GZ5 A;  3SBT B;  4JC8 A;  4PS8 A;  2WXH A;  3QC1 A;  1HX8 A;  3E4B A;  3PNL B;  4J8F A;  3FDH A;  4UI9 K;  5CMY A;  4WUY A;  3FUL A;  2PQN A;  4AXH A;  4BY6 A;  4F7A A;  3HYM B;  1JUQ A;  3EHN A;  4AEZ C;  3UX4 A;  1UW4 B;  4F1S A;  3VTX A;  2WQ7 A;  5T0M A;  3FUD A;  2VSN A;  4BT9 A;  4CT0 A;  4BWR A;  4GCN A;  4U63 A;  5FZR A;  1E8X A;  5BW8 C;  4E85 A;  4HOR A;  1N3J A;  4L7T A;  3PEV B;  3FP3 A;  1WY6 A;  2WPV A;  1EYH A;  3FH8 A;  3QOU A;  3HVE A;  5G05 J;  5A6C A;  4MI0 A;  3PS6 A;  4HOS A;  2L0I A;  3I5P A;  3MGB A;  2WXP A;  4LDG A;  3CVX A;  3M54 A;  4RG6 A;  4ANV A;  2L9B A;  1H6K A;  4RG9 A;  3CBO A;  3TL5 A;  3GW4 A;  3CVV A;  4KT6 B;  3VLE A;  2VTB A;  3U3W A;  3ENE A;  3HIZ A;  4XZ4 A;  4GAA A;  4GPK A;  2X3M A;  3K5K A;  1IQU A;  3FU0 A;  1MVX A;  2J4D A;  5D0Q D;  4UWF A;  5JHN A;  4O30 A;  4GZC A;  1JWF A;  4I2Z A;  4LUN U;  4BFR A;  4Y6C A;  2BF0 X;  5D0O D;  3T8M A;  3ZFW A;  4XKC A;  5F5E A;  1NA3 A;  5AJD A;  3AS4 A;  3CVY A;  2PM6 A;  2NC9 A;  3ZXS A;  4IJD A;  4CT4 A;  2KCV A;  1EPU A;  3DB5 A;  2WXN A;  1XQH A;  3LYA A;  2KCL A;  4ANU A;  2OND A;  5BPP A;  3TG5 A;  5F59 A;  2HYZ A;  4FLH A;  4JEU A;  4W9R A;  4AVX A;  3MKQ B;  3I4G A;  2EQX A;  2GW1 A;  2Y4T A;  1IQR A;  3ZVV A;  3JYS A;  5FQ6 A;  3MA5 A;  5JJ7 A;  2XPZ A;  3MV3 B;  1A17 A;  1GW6 A;  2E0I A;  3QDN A;  4UQZ A;  1HG5 A;  2XPI A;  1HG2 A;  3MEK A;  4GA2 A;  5T0K A;  4APO A;  3QKY A;  5A23 A;  4IJ8 A;  2LO6 A;  1P5Q A;  4MI5 A;  4ILG A;  2RD0 A;  3D9K A;  3SZ7 A;  1E8W A;  3ESL A;  4YPA A;  3IKO B;  3EP0 A;  1OWL A;  4U07 A;  4YPE A;  3AU5 A;  3ZRH A;  1U3D A;  4LEU A;  4I9E A;  2XPY A;  2IQC A;  1Z3Y A;  3ZGQ A;  4WNF A;  3CBP A;  3SW9 A;  3QAR A;  4I6G A;  4N2S A;  3CR3 A;  2KC7 A;  4C0M A;  1U3C A;  4QFV A;  2WQ6 A;  2R5S A;  4L2L A;  4F53 A;  4FC8 A;  4FU3 A;  4MLP A;  2YHC A;  3FUH A;  2VGY A;  2WXG A;  4JHJ A;  5KJK A;  2GRM A;  3S8P A;  4U0U A;  4ILI A;  4ME2 A;  4JHR A;  4UQX A;  3VLD A;  4A3V A;  4J83 A;  1HXI A;  3UMV A;  4UI9 C;  3F9Z A;  5F6L A;  4KMO A;  2R3A A;  1SZA A;  5LFA A;  4QEO A;  3O4Z A;  2QY7 A;  3NQP A;  4F3V A;  3TXM A;  3AS5 A;  3EJN A;  1TJC A;  4G25 A;  4KBQ A;  4I1A A;  4I2W A;  3PUJ A;  4EZL A;  3VTY A;  1IHG A;  2VSX E;  3KAE A;  2L6J A;  3F9W A;  4DI3 A;  5FQ7 A;  2X6F A;  2L0T B;  4WND A;  4A3T A;  1E7U A;  5HQ8 A;  4GYY A;  4H7Y A;  3P2B A;  1DNP A;  4I43 A;  5JIN A;  1HFA A;  5JIY A;  4FHJ A;  2LAH A;  5EX3 A;  3SF4 A;  3I3N A;  4C9B B;  5FZS A;  4RVB A;  4YNP A;  5AEN A;  3D9N A;  2OVB A;  4GCO A;  4XX5 A;  3SFZ A;  2BTD A;  5BV1 A;  4ACK A;  2AXV A;  4H12 A;  2A5U A;  3KS2 A;  3LVR E;  3UPV A;  3D9J A;  4FP7 A;  5LX8 A;  2FI7 A;  2KCK A;  2OVF A;  1FVH A;  1NP7 A;  3AS8 A;  3FH7 A;  5JJT A;  4LER A;  3EIJ A;  3RQ4 A;  1L5J A;  4R7L A;  2M63 A;  4DPR A;  1KT1 A;  3ZYL A;  4ANW A;  4KZ0 A;  4PS7 A;  5LCW J;  2C2L A;  4AU7 A;  2PQR A;  3ZHE A;  1N52 A;  3IHY A;  3Q5M A;  4TRQ A;  5EX0 A;  4MKT A;  4PH4 B;  3FUM A;  4HOQ A;  2CFZ A;  3G2W A;  4EQF A;  3CVP A;  4I51 A;  3Q47 B;  3NZU A;  2XCB A;  3M56 A;  4JDS A;  4KXK B;  3ZHE B;  5EG2 A;  4L23 A;  3L17 A;  1H3I A;  4WWP A;  2XEV A;  3JQ0 A;  2XQ0 A;  5BUZ A;  2O8J A;  2XGO A;  3ZYQ A;  3ZW3 A;  5G04 C;  5JHA A;  4XE0 A;  3ONL A;  3SNX A;  3MO5 A;  4AM9 A;  2PL2 A;  5FZQ A;  3CVN A;  4PDX A;  3IEG A;  3FU6 A;  1JWG A;  4GA0 A;  5CPR B;  2YIN A;  1E8Y A;  2G46 A;  3JCK C;  3UT4 A;  3MX3 A;  3QK0 A;  2CFU A;  3CVU A;  5LOZ A;  4UWK A;  3FEY A;  4J8E A;  5T4Y A;  3LY8 A;  1ZKK A;  4N39 A;  3ZIM A;  2YQ8 A;  3OTN A;  4JEH A;  5DBK A;  3ULQ A;  1ML9 A;  3APD A;  5HI7 A;  3D9M A;  5M72 A;  2XGS A;  4GML A;  3TJP A;  3BG1 B;  2YNQ A;  3OXF A;  3M53 A;  5AIJ A;  4XKB A;  1UJJ A;  3L6A A;  3PRZ A;  5LSX A;  3OXG A;  2C0L A;  4ATG A;  3FTU A;  3EIQ C;  3D9I A;  3FFL A;  5JJ6 A;  3MYV A;  3RIB A;  3MKQ A;  4WWN A;  4FA6 A;  4CGW A;  3B7T A;  5AYW D;  3ZYM A;  3APF A;  4EEC A;  4ILH B;  3VLF A;  3CBM A;  3T5X A;  4WNE A;  1PC2 A;  1MT6 A;  3FHE A;  2V5F A;  2J4B A;  4C1Q A;  4AJW A;  2JEK A;  3RO2 A;  3CSF A;  1ELR A;  2WXQ A;  3LS8 A;  4NRH B;  5F6K C;  3FY4 A;  1LF8 A;  4IUL A;  1E8Z A;  4B8C B;  2LSV A;  3U66 A;  4KZC A;  3KMT A;  3KMA A;  5G2N A;  4G2V A;  3S7D A;  4N5C A;  3M5A A;  1KLX A;  2KM4 A;  3EDT B;  1FCH A;  1E96 B;  4HFG A;  5E76 A;  1MVH A;  4B94 A;  4DLQ A;  2J49 A;  2E2E A;  3SD5 A;  2MRI A;  4HOU A;  3S7F A;  2QPW A;  4CRW A;  1SZ9 A;  2I1K A;  4HLE A;  1H19 A;  4G11 A;  2V8S E;  3P1U A;  4B8A A;  4PS3 A;  2OV8 A;  4U8H A;  3ASF A;  2CHW A;  1N6A A;  1E90 A;  3M55 A;  3C98 A;  4M3O A;  3VV0 A;  1EDU A;  1DVP A;  2IU1 A;  3JQ1 A;  3ASD A;  3ASH A;  3FEX A;  3LKU A;  4I17 A;  4G24 A;  3UUX A;  4FJY A;  3DBS A;  4TV3 A;  2FO7 A;  1ELK A;  3KD7 A;  3B13 A;  2AXU A;  4NAC A;  3R7R A;  5JHB A;  3BG0 B;  4FAD A;  4Z4P A;  5ENN A;  4GYO A;  4J8D A;  5ANL A;  2VGX A;  3PRE A;  2GGF A;  4YVQ C;  5CCM A;  3AU4 A;  1E7V A;  1ZBP A;  3B7S A;  1YA0 A;  2VSY A;  4GB9 A;  3CK8 A;  1OWO A;  5KJM A;  3U64 A;  3CK7 A;  3FTY A;  4AP2 A;  2WXK A;  2VGX B;  4NJ5 A;  3FUI A;  4E6H A;  3ESK A;  1Z6T A;  1UN8 A;  5FQ8 A;  3RU0 A;  2GRL A;  3ML9 A;  3FTV A;  1OUV A;  2I6H A;  4E47 A;  5G55 A;  3UT8 A;  3FTX A;  2DBA A;  5T5G A;  4LRZ A;  5JJ0 A;  1VDY A;  4KYO B;  2J07 A;  3HDX A;  4NUR A;  1H2T C;  3PEU B;  4OVV A;  1TJF A;  3PDN A;  3G2U A;  5E75 A;  2WMN A;  1NZN A;  2WM9 A;  3CHS A;  3TG4 A;  1UJK A;  4J6I A;  3SBS A;  1ZU2 A;  4NQ0 A;  3U4T A;  1IYG A;  4HVB A;  4A55 A;  3CEQ A;  4CDM A;  1UN9 A;  4GMJ A;  3MCX A;  4IN3 B;  2CG3 A;  2X6J A;  2PZI A;  2WXF A;  4XI9 A;  1NA0 A;  4AY5 A;  3OOI A;  4N3C A;  3G2V A;  3Q4A B;  2WXR A;  5G05 C;  3CK9 A;  1H0A A;  4IYP A;  4Q94 A;  3MO0 A;  2YHE A;  2HR2 A;  3ONK A;  1HE8 A;  3L08 A;  4BSX A;  4V3I A;  3IHV A;  2R59 A;  1XGW A;  3URZ A;  3F9X A;  3S7B A;  3CHO A;  3RRM B;  5CMW A;  2VSO E;  3NZS A;  3QJZ A;  4J0U A;  5TEG A;  5FQ4 A;  3FH5 A;  3OPE A;  2WVI A;  3FTS A;  5LSZ A;  2VYI A;  5ARF A;  3D9O A;  4XIF A;  2IF4 A;  3QAQ A;  3M58 A;  3PVL A;  4AV7 A;  3FPD A;  2CHX A;  3ML8 A;  4JA7 A;  1XNF A;  4EPZ A;  1TEZ A;  1BPO A;  5FWQ A;  3T5V A;  5BV0 A;  3S7J A;  5KJN A;  4AOF A;  1HS6 A;  2LNI A;  4FLB A;  4JA9 A;  4G26 A;  3FUJ A;  4QEN A;  4PUC A;  3IHX A;  4K0R A;  4BTB A;  3D9L A;  3LDZ A;  3RKV A;  3ZPJ A;  3BEE A;  4D10 C;  2F69 A;  5A7D B;  3MKR A;  4FHK A;  4G1T A;  3GZ1 A;  4N2Q A;  3RAY A;  3LCA A;  3MO2 A;  3OAW A;  4JW1 A;  4Q69 A;  4J7I A;  2W5Z A;  3SWC A;  3LY9 A;  2FBN A;  3M57 A;  3RJV A;  2PM7 A;  5KJL A;  1INZ A;  2X6H A;  4BUP A;  3CLJ A;  3QWW A;  3ZN3 A;  2I1J A;  2FF4 A;  3FUK A;  4O6F A;  1OWN A;  3PZD A;  2NXP A;  4KVO A;  4KVM A;  4AY6 A;  4HOT A;  3LEW A;  1FVF A;  3SI5 A;  4CCA A;  3KMJ A;  2RG8 A;  4RSY A;  3JUI A;  3QWV A;  4WAF A;  4ACL A;  1Z3X A;  4XI0 A;  2CG2 A;  3FU5 A;  5EKQ D;  4CEM A;  1H2V C;  2KAT A;  4YVO A;  2Y3A A;  4K03 A;  3MJW A;  4OVU A;  2XHE A;  4I1M A;  1QNF A;  5T8I A;  2V4L A;  4QEP A;  1HF8 A;  3LY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...