5ARGA

Smyd2 in complex with sgc probe bay-598
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
426
structure length
426
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
total genus 151
structure length 426
sequence length 426
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5argA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5argA01
5EX3A 5KJMA 5AYWD 4YNMA 5F6LA 3ZN3A 3FWVA 2KCKA 3F9ZA 5FTPA 3F9XA 4YNPA 3GZ1A 4HOTA 4G24A 2PQNA 1N6CA 5ARGA 5CHEE 3CK9A 3LY9A 5HQ8A 5TH7A 2XCBA 3QDNA 5HI7A 3ZGQA 4GZ6A 4U07A 4LEUA 5DIZA 2KC7A 3RKVA 3MO0A 2KCLA 1MVHA 4N3BA 5F5EA 5JJ6A 4AY5A 2FI7A 3U4TA 1ELRA 5DBKA 2VQ2A 4J8EA 4GA2A 4QEPA 4U0ZA 4J7IA 5BNWA 2HYZA 5CCLA 4WNGA 2HO1A 5FZSA 3RU0A 4G2VA 5CPRB 5JINA 3LY7A 4G1TA 4MI0A 4LDGA 5KJNA 3KMJA 4G25A 5FZQA 3KD7A 3RO2A 4I9EA 4I2ZA 3NF1A 1ZU2A 2WQHA 3SZ7A 2O8JA 1ZKKA 4J83A 1QQEA 5G05J 3S7DA 3VTXA 3MV2B 4KBQA 2FEZA 3LKUA 2VYIA 4RZ0A 5KJLA 3ASGA 4MI5A 4UI9K 4HOQA 4CDRA 4CGWA 2P58C 2LNIA 1W3BA 4BTAA 3Q4AB 3IEGA 4JL0A 3CK7A 3VUZA 4E47A 2FBNA 4ME2A 4I1AA 2ONDA 4GYWA 3PDNA 2W5ZA 2VGXB 3LYAA 4I2WA 5FZRA 3URZA 1B89A 1WAO1 3TGOA 3EP0A 3CBMA 4GYOA 5LCWJ 4FMUA 3MA5A 1OUVA 1Y8MA 3VV0A 3RIBA 4XIFA 3ASFA 4N3AA 3GZ2A 2UY1B 4NQ0A 3ZPJA 3QWVA 3M55A 4BT9A 2LSVA 4I51A 4G26A 3CEQA 3BO5A 3MEKA 1ELWA 1N3JA 1HZ4A 3Q15A 2PQRA 2DBAA 3UPVA 1KLXA 1N6AA 2L6JA 2OOEA 3OS5A 1MUFA 2J9QA 4AIFA 4U04A 2KATA 3SWCA 4GCNA 3AS8A 2V5FA 3Q47B 5JHNA 4APOA 3U3WA 3M53A 3OXGA 3M58A 2JV0A 3MV3B 4O6FA 4B94A 2FF4A 3FFLA 4G23A 4WNEA 1YA0A 3Q49B 1H3IA 3CBOA 4GPKA 4AM9A 3UQ3A 2R5SA 3MO2A 2GW1A 3GW4A 3R9AB 1NZNA 4JDSA 4UI9C 3PE3A 3SF4A 3LY8A 3CK8A 1HH8A 3IHXA 4N5CA 3M57A 2KCVA 4ABNA 4BWRA 1IHGA 3EDTB 4NVQA 2QFCA 5T0KA 3FP3A 3CKCA 1A17A 4W9RA 2C2LA 3HYMB 5M72A 5EX0A 2XGOA 3K9IA 3OXFA 3ZHEB 4HOSA 1O9SA 3ASHA 3BEEA 2UY1A 1XQHA 4U0UA 2XPIA 3M54A 3UUXA 2C0MA 3MKRA 4WNFA 4I17A 4KXKB 4N2QA 3O48A 2Q7FA 3RO3A 5EKQD 3S7BA 2W5YA 4JLGA 2I6HA 2LSUA 5T0MA 1TJCA 3RJVA 3F9WA 3OPEA 5ARFA 1NA3A 2WPVA 4Z4PA 5KJKA 5JJ7A 3E4BA 5JJTA 3CV0A 3WXXA 3PE4A 5D0QD 3K5KA 4NRHB 2XCCA 4UQZA 2JLBA 4AY6A 2C0LA 3KAEA 2YHCA 4H7YA 5BW8C 4RG9A 2XEVA 4UQXA 1NA0A 3GYZA 3ZFWA 3LPZA 5D0OD 3QOUA 1XNFA 4Y6WA 2MHKA 5JIYA 3F9YA 4J8FA 3DALA 4YPEA 5LCWC 3M56A 2HR2A 2YQ8A 2UWJG 4IJDA 2XGMA 1P5QA 4WNDA 2VGYA 5FJYA 4KYOB 3CVQA 1PEGA 3AS4A 4U0SA 1KT1A 3Q5MA 3S7JA 5TTFA 4GYYA 4GZ5A 3HNAA 5EG2A 2E2EA 3FPDA 3SW9A 4QEOA 3DB5A 4I9CA 4HOUA 1PC2A 4H12A 5C1DA 2NC9A 3ASDA 5T5GA 2G46A 3VTYA 2VSNA 3OXLA 4IN3B 5G04C 5CCMA 2FO7A 3RJWA 3S7FA 4GA0A 2BUGA 4YPUA 3S8PA 5LSZA 2PL2A 2RFIA 4BTBA 4F3VA 4XI0A 3QWPA 3TAXA 3M59A 5BT1A 2BQZA 1MVXA 4O30A 4CGVA 4BUPA 3AS5A 4BT8A 1WM5A 4J0UA 4N39A 3JYSA 4H7XA 1HXIA 2IFUA 4J8OA 4JA7A 1ZBPA 4C1QA 4WUYA 5F59A 5A7DB 3TG5A 4YPAA 3RQ4A 4UI9J 3TG4A 3CVPA 3MO5A 1FCHA 4GA1A 4YVQC 4N2SA 4J8DA 5G05C 1ML9A 5F6KC 4QENA 4YVOA 1IYGA 4JHRA 4YNDA 4N3CA 4NJ5A 3CKBA 3KS2A 5A6CA 2QPWA 3KMAA 3M5AA 3KMTA 4Y6CA 1KT0A 2IGQA 3QKYA 4GCOA 2PZIA 5JJ0A 2IF4A 4IJ8A 3CBPA 4RG6A 2Y4TA 5FT9A 5TEGA 3LCAA 3QWWA 4AU7A 4J7FA 3ESKA 2XGSA 4A1SA 3CVNA 1MT6A 4HORA 3N71A 2Y4UA 3ZHEA 4GZ3A 4EQFA 3RAYA 5AYFA 3OOIA 2VGXA 4XI9A 2R3AA 1QZ2A 1E96B 4UQYA 3CVLA 2F69A 2AVPA 5G04J 2VSYA 4JA9A 3ULQA 5LSXA
chains in the Genus database with same CATH superfamily
5EX3A 1JCQA 3AJIA 5B1BE 3AU5A 3HDXA 4F1PA 2WXOA 5CHEE 3CK9A 3LY9A 5HQ8A 3CSTA 4U07A 3D9KA 3NAWA 4HI9A 4JHKA 1TNOA 1MVHA 2R05A 1K1BA 1QNFA 4TXQA 2FI7A 3FTWA 3FUFA 5DBKA 4FU3A 4QEPA 2LAHA 4GA2A 4GMRA 2MOWA 1N9AA 4CZ2D 2ZGDA 3E37A 4HS2A 2DZOA 2X6HA 3LY7A 3UM0A 2ETCA 3X2QE 2QYJA 4MI0A 4LDGA 5KJNA 4G25A 3T5VA 4OAUC 2WQHA 1AP7A 2CFUA 4BEPA 3UKRG 2O8JA 5G2NA 4LCTA 4ZHBA 1OCCE 2DWZA 3VTXA 4HVBA 4KBQA 2FEZA 4RQIA 2VYIA 2XS8A 4F1SA 3NQPA 1E8XA 4MI5A 1TJFA 3Q73A 3FH8A 4HOQA 4CDRA 2GRMA 1W3BA 3LEWA 3BG1B 4LUNU 2F37A 4E47A 2FBNA 1Z3YA 1H6PA 2VGXB 4XKCA 4DRXE 1V55E 4FC8A 4TV3A 4GYOA 3KEZA 2WXIA 3EU9A 5LCWJ 2AXVA 3ISMC 3VV0A 3RIBA 2EQXA 3ML8A 1K8KG 2UY1B 4DI3A 3ZPJA 4BT9A 2LSVA 4G26A 3Q79A 5ANRA 5KWDA 1IQUA 4JVSA 3UPVA 2L6JA 4CDNA 3J5QB 3OS5A 1MUFA 2F8YA 4U04A 3FUKA 5EYPF 3SWCA 2F0YA 4EZJA 3LS8A 2KBXA 2XEHA 2V5FA 3Q47B 5JHNA 4DUIA 3EIJA 5AENA 2EILE 4UWKA 2OVFA 3M53A 4DX6D 3OXGA 1Y6IA 5ITZF 1WDYA 3MV3B 4O6FA 5FIOA 3MKQB 3FFLA 4G23A 1WY6A 4PUCA 3PZ1A 2I2OA 3RRMB 1G3NB 2GW1A 3L16A 1X81A 1NZNA 3SF4A 4FADA 3UT8A 4Q94A 1TNZA 2JEKA 2OVBA 3ZW3A 4HI8A 4ANUA 4ABNA 1JPLA 2QFCA 4NVQA 5T0KA 2C2LA 2OCCE 2XZDG 1BI8B 4CRWA 4U7EB 4D10C 2DYSE 5BXOA 2GROB 2B6CA 3UXGA 5KBAA 3M54A 1SZ9A 3AG2E 2DCPA 2EIKE 3SY2A 3MKRA 4U8VD 3HXDA 4N2QA 4FLBA 3FH5A 2X3MA 2VGEA 4JLGA 1H19A 2X6FA 1U3DA 1TJCA 3D9LA 3OPEA 4KMOA 4G8KA 4Z4PA 3J5PA 3Q9NC 5KJKA 5JJ7A 2WB2A 3K5KA 2R02A 2XCCA 4UQZA 3TWXA 3L22A 2JLBA 2C0LA 4H7YA 1UJJA 2P9UG 3QJZA 2DZNA 3NOGD 1TEZA 2MHKA 5JIYA 1HFAA 3SGHA 4L23A 3WG7E 5EDSA 3FUHA 2OV8A 1HO8A 3BQOA 2HR2A 1SVXA 4ATGA 2AXUA 4EECA 3ASNE 3ONKA 2R59A 4JPSA 4A3VA 2ZIRA 3ZUVB 2L0TB 1N95A 4JEHA 1IXVA 5FQ8A 3C3RA 5TTFA 4GYYA 5KNGA 4DLQA 1UN9A 3Q78A 2GRNB 4QEOA 4KZCA 2V4HC 1FVHA 1N94A 5C1DA 4JC8A 3FUDA 4BETA 3ASDA 3D9HA 3FU5A 4PS8A 3DSXA 2VSNA 5CCMA 3RJWA 3DSVA 4YPUA 1UN8A 3L13A 3EHRA 1FT1A 1HE8A 3TXNA 4GTQA 4K5AB 4BUPA 3W9FA 4GMJA 3AS5A 1WM5A 3UM3A 4J0UA 4N39A 2HE0A 4GTOA 3JYSA 2IEJA 4MLPA 4LNUD 3VLDA 4WUYA 1TNBA 2V0PA 4YPAA 3RQ4A 5FQ7A 4GA1A 2CFZA 3I4GA 4N3CA 4EPZA 3KS2A 3ZVVA 3KMTA 5LOZA 4GTVA 2GRPB 4GZCA 1PY1A 3ABKE 3LCAA 3UTMA 3TWTA 5JHAA 2HM8A 1MT6A 2EINE 2JABA 3N71A 2Y4UA 4E6HA 1DNPA 4EQFA 3RAYA 4L9PA 3SBTB 3Q9UC 4UQYA 3CVLA 4ILIA 2CHXA 1E7VA 3PVLA 2NYJA 5KJMA 3FY4A 3ZN3A 5AQAA 2IOLA 2GRLA 3UINC 3B7BA 4BERA 4YNPA 5D66A 1OCRE 2PQNA 1N6CA 5J90A 1DCEA 5HI7A 3ZGQA 3SFXA 5DIZA 2KC7A 4N3BA 4HFGA 4P29A 1EF1C 5JJ6A 3SD5A 4AY5A 1TN6A 2FULA 1TYQG 3U4TA 4BFRA 2VQ2A 3L54A 4J8EA 4U0ZA 3SHFA 3MGBA 3RU0A 4G2VA 2IQCA 5CBOA 1N54A 3LJNA 2V4LA 3CSFA 1QYMA 3QARA 3NF1A 5EYLA 3E32A 4YDYA 1QQEA 5T8IA 5G05J 3S7DA 3LKUA 5CERB 4RZ0A 3ASGA 2XHEA 2IJGX 4CGWA 2P58C 2LNIA 4DLOA 3IEGA 1EPUA 4XE0A 3VUZA 4U63A 4IULA 3RSEG 3ZIMA 3FUJA 1NL4A 5CBNA 1B89A 1WAO1 3TGOA 3GZSA 2Y0BG 3AG4E 1Y8MA 3PH0C 3V79K 4XIFA 3D9JA 3ASFA 4XX5A 4NQ0A 3QWVA 3M55A 4HRNA 3C3QA 5HRYA 3BO5A 2F8XK 3MEKA 2J4DA 3JUIA 1HZ4A 3Q15A 4UWGA 3T9KA 4I1OB 4AIFA 3ENEA 4GCNA 3R9MA 3G2TA 3NOCD 2WXNA 3U3WA 1MX2A 3EUVA 1Z6TA 3OAWA 4E85A 2JV0A 5C2YA 4WNEA 4GTMA 4UWFA 1SA5A 2ETAA 4ILHB 1H2VC 4GPKA 4AM9A 3DXMG 2R5SA 4DX7D 3GW4A 3FEYA 4UI9C 3PE3A 3FUEA 5LP0A 4DK5A 3UMVA 4AEZC 2VJ8A 4N5CA 3M57A 2B0OE 3NZSA 3FP3A 3T5XA 3CKCA 4BSZB 3MCXA 5JMND 4W9RA 5M72A 1O1TA 4U95D 4FULA 4XEIG 4JD2G 3ZHEB 3U66A 3B7TA 3TWRA 1O9SA 3BEEA 2WQ6A 3DSSA 2Y69E 5EIDA 3DRAA 3D9OA 5ENTD 2J49A 2LUHA 3O48A 1N11A 3RO3A 3DSWA 3S7BA 4C9BB 2LSUA 2QY7A 3G2VA 3EJNA 1MHQA 1KZPA 1NFIE 4Q96A 5JJTA 5ENSD 3CV0A 1OXJA 3WXXA 1H2UA 4J6IA 4BESA 3PE4A 2LXLA 3PS6A 3TXMA 2CHWA 5BW8C 1O5MA 4U8HA 3GYZA 3LPZA 3QOUA 3F9YA 4J8YA 4K5BA 1EDUA 2R03A 4DX1A 3W9GA 1SZAA 3ZU7B 4R7LA 2KZTB 4X8QA 2UWJG 2H6FA 2WXJA 3FEXA 3PEVB 1N4QA 2MRIA 3TL5A 3KEAA 4HXIA 4AVXA 4LERA 5FJYA 3U64A 3DEOA 3UIPC 3UKUG 3AS4A 3V30A 5CRUA 4GTSA 3P2BA 4KVMA 3UM1A 3HNAA 5EG2A 1LD8A 5H7PA 5BV0A 3SW9A 4HOUA 4H12A 2E0IA 3ZNGA 2P9NG 3SNXA 3VTYA 4IN3B 3OXLA 1S64A 3DPDA 3UT4A 2FO7A 2J8SD 4CYMD 4GA0A 4IYPA 1OWMA 3LDZA 5HKPA 3S8PA 5LSZA 1O1SA 3CVUA 2A4ZA 4UWLA 4CT0A 3QWPA 4FJYA 4C0EA 3TAXA 3M59A 3SFYA 1TN8A 3FHEA 3DBSA 4ANXA 4BX9A 5AQBA 3L08A 5T4YA 4WWOA 3SBSA 3HHMA 4PS7A 1TN7A 4RSYA 4JA7A 2YINA 1IQRA 1ZBPA 4N5QA 5F59A 4TRQA 1D8DA 1HG5A 3TG4A 3CVPA 3MO5A 1FCHA 2X6JA 4YVQC 4EZLA 4HQDA 3UT7A 3HG0D 1OY3D 5A6CA 2QPWA 3B95A 3M5AA 3C3OA 1DCQA 3ZKJA 2MYOA 1UOHA 1LF8A 5JJ0A 3DSUA 1HF8A 4CT4A 1E8WA 2Y4TA 2I1JA 1IHBA 3FTZA 4J7FA 2XGSA 4DI4A 5ENRD 2X6IA 3AG3E 3PZDA 3FTVA 1E8ZA 3SQVA 2FO1E 2AXZA 2P9PG 2J4BA 5D2MC 5AYFA 2VGXA 4GMLA 1E96B 3MZLB 4K5CA 3HXBA 2VSYA 5CEDB 2Y1LE 1JWGA 1BI7B 5AYWD 4YNMA 3ZXPA 3FU3A 2QZAA 3F9ZA 3F9XA 2XS1A 4B93B 3GZ1A 1D8EA 2VTBA 4CEMA 3QDNA 3BUAA 4GZ6A 1H6KA 4LEUA 1OT8A 4JB8P 3RKVA 1XGWA 2KCLA 2V5QC 3MO0A 4JZYA 4AXHA 2QC9A 5F5EA 2ZGGA 3MKQA 1ELRA 4L1BA 3EIQC 4J7IA 2HYZA 5CCLA 4WNGA 5FZSA 4O1OA 2WQ7A 4G1TA 4F53A 3FDHA 3KSLA 3V31A 2IU1A 3DSTA 1D9SA 2DIWA 4MS6A 4I9EA 3FU6A 4I2ZA 2KZTA 1MX4A 3D9NA 3SZ7A 4J83A 3LVRE 2XRYA 4ZFHA 3U9WA 5JHBA 2WMNA 2OEWA 1FT2A 1OWPA 2L9BA 3Q4AB 3E30A 3CK7A 4I1AA 4GYWA 5CEAA 1OWLA 2W5ZA 5LX8A 4PDXA 4K0RA 5FZRA 3URZA 2R17C 4A63B 1X5BA 3EP0A 3CBMA 4A1GA 1JCRA 4FMUA 3MA5A 3C72A 1U3CA 2Y3AA 4B89A 1U2VG 5T3RA 1ZB1A 2LO6A 2BF0X 3GZ2A 4GZDA 5ENPD 3ULEG 3ABME 1E90A 1YMPA 1N3JA 4EHMA 4J8SA 1GW6A 2LXMA 3CIAA 2DBAA 2ZISA 1N6AA 5ANLA 2J9QA 1EYHA 3QC1A 3SO8A 2KATA 5AJDA 4LNGA 4I1MA 4HLLA 4B8CB 3ZYKA 4APOA 3MJWA 2AWIA 5BUZA 3D9MA 3UX4A 2GRRB 1ELKA 4B94A 2FF4A 4QQIA 3RAUA 3B7SA 1HU3A 3Q49B 2P2CP 2P9KG 2YNQA 3CVWA 2J08A 3C98A 1BD8A 3R9AB 4JDSA 4ATZD 3CK8A 3TWWA 3IHXA 2R2LA 3I3NA 3TWSA 2KCVA 3MYVA 4BWRA 1IHGA 3EDTB 4TUUA 3I5PA 1S0PA 1E7UA 1N0RA 1N52A 3IHVA 4RLYA 3HYMB 2WXGA 2P9IG 4TXRA 3VLEA 5BV1A 5EX0A 4MBGA 2XGOA 3K9IA 3OXFA 4C0MA 4A55A 2WXQA 3ASHA 1XQHA 3MX3A 4U0UA 2XPIA 4CDMA 3UUXA 2RG8A 4KVOA 2ZU6B 1N0QA 1UJKA 2A5EA 3NBNB 1Q2ZA 2A5UA 1YCSB 2AJAA 5EKQD 5EILA 3TWVA 2W5YA 3PUKA 1N4SA 2J07A 3RJVA 1OWOA 3B13A 3F9WA 1MX6A 5ARFA 3IXEA 2WPVA 4C48B 5ENQD 3E4BA 3CHOA 3HIZA 3PNLB 4PH4B 3CQGB 3FH7A 4AY6A 3BU8A 3KAEA 2YHCA 1BPOA 2XEVA 4UQXA 1YYHA 4GAAA 3ZFWA 1BLXB 1JUQA 1H2TC 3VLFA 5BPPA 2XENA 4J8FA 3ML9A 1A5EA 2GGFA 4YPEA 4HBDA 5LCWC 4G8LA 3D9IA 4KZ0A 1SQMA 1H6OA 2IO2C 2YQ8A 4WAFA 5CECB 1OCOE 4IJDA 1NP7A 4WNDA 4BSXA 3Q75A 3CVQA 3P1UA 2OEVA 3Q7AA 4NIKA 3ZYQA 4HB5A 2X38A 4U0SA 3APDA 4XKBA 3S7JA 3QB2A 3CHSA 2ILRA 4GZ5A 3ESLA 2E2EA 3RRNB 2NSZA 5FINA 3DB5A 4I9CA 2QYUA 2RD0A 4APFA 1PC2A 3CVVA 3LVQE 1FVFA 3OTNA 5T5GA 3PRZA 2G46A 5AQ7A 3CLJA 3PUJA 2XPZA 5ENNA 3S7FA 1S70B 3BG0B 3FULA 1HG2A 2PL2A 2RFIA 2BKKB 3FUIA 4BTBA 4F3VA 3ZEFA 4XI0A 1BU9A 2WXLA 2AW6A 4ANWA 3FTSA 4GTRA 1MVXA 4O30A 2WXPA 4CGVA 3FTYA 4FHKA 3IV0A 4J7WA 4BT8A 4QFVA 3IHYA 3DEPA 4ACLA 3E33A 2CG2A 2IFUA 4Z68A 3JUEA 5FQ6A 4EZKA 3CHPA 5LFAA 3QK0A 4IRUA 2WMOA 2NXPA 2L0IA 3EHNA 3TG5A 4NACA 4UI9J 3NB2A 5E75A 2PNNA 4OVUA 5G05C 1ML9A 5F6KC 4YVOA 1IYGA 4I6EA 4YNDA 1NI1A 4MKTA 4NJ5A 2V8SE 3CKBA 3KMAA 1N4RA 4Y6CA 2IONA 3EU5A 5KCMA 1KT0A 3UM2A 3QKYA 3JQ1A 4YDEA 2IF4A 4IJ8A 1S63A 1QBQA 3PREA 2X6KA 3QWWA 5TEGA 4AU7A 3ESKA 4WWNA 2XRZA 4A1SA 3DWLG 3L82A 3D9PA 2CG3A 4HORA 1LTXA 1KPSB 4XZ4A 3ZHEA 4EBAG 4JHJA 5B3SE 4KT6B 1DC2A 2PM6A 4HRLA 4XI9A 5CRVA 2R3AA 4GTPA 4I6JA 3R7RA 5AQ9A 2F69A 3FU0A 3L9TA 3S2AA 5G04J 5LSXA 3UIOC 4FHJA 3D3MA 2PM7A 5F6LA 2WXHA 1WG0A 3FWVA 1UW4B 3PZ3A 2KCKA 5FTPA 5EN5D 3L6AA 4HOTA 4UWHA 2XQ0A 4G24A 3T8MA 2DVWA 3B7UX 4F7AA 5ARGA 4URKA 3TWUA 1E8YA 5TH7A 2LAIA 2XCBA 1HS6A 3PZ4A 5BNWA 2HO1A 1DVPA 5CPRB 2KM4A 2WXRA 4B8AA 5JINA 1UG3A 4U8YD 5BXUA 3G2SA 2IOSA 3KMJA 3RO2A 4LNBA 3KD7A 5FZQA 1N4PA 5AN8A 3ZXSA 4YDWA 1ZU2A 2CHZA 3ZYMA 1ZKKA 1MJ0A 3HRAA 3MV2B 4M7CA 3SI5A 5KJLA 3Q7FA 3HVEB 4AOFA 4UI9K 4BX8A 4O60A 5ENOD 4BTAA 4JL0A 5AJLA 3ONLA 4ME2A 3FUNA 3JCKC 2ONDA 4GU5A 3PDNA 3LYAA 4I2WA 4OVVA 3SFZA 4HLEA 4BY6A 3RRUA 3C5RA 4DPRA 4FP7A 1OUVA 2I1KA 3O4ZA 3PZ2A 1OCZE 4ACKA 4N3AA 4CCAA 1JCSA 1LD7A 5A23A 4I51A 2IO3C 3CEQA 1ELWA 2PQRA 3CHMA 4OAVB 1KLXA 2OOEA 3RK6A 2DYRE 4OYSA 1MYOA 1MQSA 2J09A 5CMYA 3AS8A 4GPMA 2GRQB 2WXFA 3CGHA 3M58A 5FQ4A 3APCA 1YA0A 4I6GA 1H3IA 3CBOA 4MRUA 3UQ3A 3MO2A 4F6RD 5JA4D 1INZA 3LY8A 1IKND 2RKKA 1FPPA 1HH8A 1SA4A 4U96D 4FLHA 4UUCA 3HVEA 4DJAA 3CHQA 2P9LG 3R7QA 1A17A 5G55A 3CR3A 1L5JA 3HXCA 3V2XA 5IY5E 2WVIA 1RZ4A 2XZTG 4HOSA 4NURA 2EIME 4JW1A 1RW2A 2BKGA 5EIBE 3ZRHA 2UY1A 5B1AE 4LG6A 2ETBA 3FTUA 2C0MA 3HXEA 1TNYA 4WNFA 5AAOA 4I17A 4KXKB 5AARA 2Q7FA 2H6GA 3EHQA 4JEUA 2I6HA 2H6IA 1SW6A 1AWCB 5T0MA 3UI2A 1TR4A 1NA3A 3FUMA 4FJZA 4K03A 5D0QD 4DX5D 4NRHB 3G2UA 3NZUA 3FTXA 4A3TA 2WXMA 1JWFA 4EBAA 2L6BA 3CQCB 3QNKA 4RG9A 1NA0A 4AV7A 3IBEA 2I9CA 4G11A 4HNAD 5D0OD 1XNFA 4Y6WA 2H6HA 3KSQA 2BTDA 2P9SG 3DALA 3T8KA 3M56A 2RFAA 5KNHD 1Z5SC 5E76A 4L2LA 3APFA 2XGMA 5CMWA 4GTTA 3ULYA 1P5QA 4LSZE 2VGYA 3TJPA 2VSXE 3AAAC 4KYOB 1PEGA 1TNUA 2IY0C 1VDYA 3CVXA 2ZXWE 4FA6A 1KT1A 3Q5MA 4JXTA 3FPDA 4TXPA 2M63A 4RVBA 4AP2A 3E34A 2NC9A 2RFMA 4AJWA 1H0AA 4L2YA 5AIJA 4GB9A 5G04C 3AU4A 2XEEA 4B0ZA 2YHEA 3AG1E 2BUGA 4LRZA 3PEUB 3G2WA 1HX8A 3HXFA 5BT1A 2BQZA 4V3IA 4Q69A 4PS3A 3DXKG 3LXUX 1PAQA 2VSOE 3IKOB 4HRMB 3I4RB 1K1AA 4H7XA 1HXIA 2KXPC 4J8OA 3CHRA 3TWQA 4C1QA 5A7DB 1KZOA 2EIJE 3V2OA 4N2SA 4J8DA 4QENA 5FWQA 4JHRA 1Z3XA 3PNTB 3DPYA 4WWPA 2WM9A 1O1RA 3L17A 2BEDA 3JXIA 4YDOA 3ZYLA 2IGQA 4GCOA 2PZIA 1V54E 2VTBB 3CBPA 4RG6A 5FT9A 4L7TA 4TUMA 4DX2A 5J08A 3ABLE 4ILGA 3B7RL 3CVNA 1K3ZD 4M3OA 2WXKA 4O1PA 4GZ3A 3ASOE 3F6QA 3JXJA 1MZCA 3QAQA 4I43A 3OOIA 2XPYA 5HS0A 4ANVA 1QZ2A 3EHMA 1OWNA 2AVPA 3CVYA 3JQ0A 3LJ3A 4JA9A 3ULQA
chains in the Genus database with same CATH topology
5EX3A 1JWGA 3D3MA 5KJMA 3FY4A 2PM7A 5AYWD 4YNMA 5F6LA 2WXHA 3ZN3A 3FWVA 1UW4B 3FU3A 2KCKA 2IOLA 3AU5A 3F9ZA 2GRLA 5FTPA 3F9XA 3HDXA 4YNPA 3L6AA 3GZ1A 4HOTA 4UWHA 2XQ0A 4G24A 2PQNA 1N6CA 2WXOA 3T8MA 5J90A 3B7UX 4F7AA 5ARGA 5CHEE 4URKA 2VTBA 1E8YA 3CK9A 3LY9A 5HQ8A 4CEMA 5TH7A 2LAIA 2XCBA 3QDNA 5HI7A 3CSTA 4GZ6A 3ZGQA 1H6KA 4LEUA 4U07A 3D9KA 5DIZA 2KC7A 1HS6A 3RKVA 1XGWA 2KCLA 4JHKA 3MO0A 4JZYA 4AXHA 1MVHA 4N3BA 4HFGA 4P29A 1EF1C 5JJ6A 1QNFA 3SD5A 5F5EA 4AY5A 2FULA 2FI7A 3MKQA 3U4TA 4BFRA 1ELRA 4L1BA 3FTWA 3FUFA 5DBKA 2VQ2A 4FU3A 3L54A 4J8EA 2LAHA 3EIQC 4GA2A 2MOWA 4U0ZA 3CVYA 4QEPA 4J7IA 5BNWA 2HYZA 3SHFA 3MGBA 5CCLA 4WNGA 2HO1A 5FZSA 3RU0A 4G2VA 1DVPA 5CPRB 2KM4A 4HS2A 2WXRA 4B8AA 2X6HA 5JINA 3LY7A 2IQCA 1UG3A 4G1TA 2WQ7A 4F53A 1N54A 3FDHA 3G2SA 4MI0A 4LDGA 2IOSA 2IU1A 2V4LA 5KJNA 3KMJA 2DIWA 4G25A 5FZQA 3KD7A 4MS6A 3RO2A 3T5VA 4I9EA 3ZXSA 3CSFA 3QARA 3FU6A 4I2ZA 3NF1A 2KZTA 1ZU2A 2WQHA 2CFUA 3D9NA 3SZ7A 2O8JA 2CHZA 3ZYMA 1ZKKA 4J83A 5G2NA 4LCTA 1QQEA 5T8IA 5G05J 3S7DA 3VTXA 3MV2B 4HVBA 3LVRE 4KBQA 2FEZA 2XRYA 3LKUA 2VYIA 3SI5A 4F1SA 4RZ0A 5KJLA 3ASGA 3NQPA 1E8XA 4MI5A 1TJFA 3U9WA 3HVEB 2XHEA 4AOFA 4UI9K 4BX8A 3FH8A 5JHBA 4HOQA 2IJGX 4CDRA 4CGWA 2GRMA 2P58C 2WMNA 2LNIA 1W3BA 4DLOA 3LEWA 4BTAA 1OWPA 3BG1B 4LUNU 2L9BA 3IEGA 3Q4AB 1EPUA 4JL0A 3CK7A 5AJLA 4XE0A 3VUZA 4E47A 4U63A 2FBNA 3ONLA 4IULA 4ME2A 4I1AA 3FUNA 3JCKC 2ONDA 4GYWA 1Z3YA 4GU5A 3PDNA 1OWLA 2W5ZA 5LX8A 2VGXB 3LYAA 4PDXA 3FUJA 4K0RA 4I2WA 4OVVA 2R17C 4XKCA 4FC8A 5FZRA 4TV3A 3SFZA 3URZA 1B89A 1WAO1 1X5BA 3TGOA 3EP0A 3CBMA 4A1GA 4BY6A 4GYOA 4HLEA 3RRUA 3GZSA 4DPRA 3KEZA 4FP7A 2WXIA 5LCWJ 4FMUA 2AXVA 3MA5A 1OUVA 1Y8MA 3PH0C 3VV0A 2I1KA 1U3CA 3O4ZA 2Y3AA 3D9JA 2EQXA 3ASFA 3ML8A 4XIFA 3RIBA 4ACKA 4B89A 4N3AA 4CCAA 5T3RA 2LO6A 2BF0X 2UY1B 3GZ2A 4GZDA 4XX5A 4DI3A 4NQ0A 3ZPJA 5A23A 3QWVA 3M55A 4BT9A 2LSVA 4I51A 4G26A 3CEQA 3BO5A 3MEKA 1E90A 1ELWA 5ANRA 2J4DA 1N3JA 3JUIA 1HZ4A 4J8SA 3Q15A 1GW6A 2PQRA 3CHMA 1IQUA 3CIAA 4JVSA 2DBAA 3UPVA 1KLXA 4UWGA 1N6AA 2L6JA 4CDNA 2OOEA 3OS5A 3RK6A 1MUFA 5ANLA 2J9QA 4I1OB 1EYHA 3QC1A 4OYSA 4AIFA 4U04A 2KATA 3FUKA 3SWCA 1MQSA 4EZJA 2J09A 5AJDA 3ENEA 4I1MA 4GCNA 5CMYA 3LS8A 4B8CB 3AS8A 2V5FA 3Q47B 3G2TA 3ZYKA 5JHNA 3EIJA 4APOA 2WXNA 3MJWA 3U3WA 2AWIA 5AENA 5BUZA 4UWKA 2OVFA 1Z6TA 3M53A 3D9MA 2WXFA 3UX4A 3CGHA 3OXGA 1Y6IA 1ELKA 3OAWA 3M58A 4E85A 3MV3B 5FQ4A 4O6FA 4B94A 2JV0A 5C2YA 2FF4A 3MKQB 3APCA 3B7SA 3FFLA 4G23A 1WY6A 4PUCA 1HU3A 4WNEA 1YA0A 3Q49B 4I6GA 4UWFA 1H3IA 4ILHB 2YNQA 2I2OA 4MRUA 3RRMB 3CVWA 1H2VC 4GPKA 4AM9A 3CBOA 3UQ3A 2J08A 2R5SA 3C98A 3MO2A 2GW1A 3L16A 3GW4A 3R9AB 1NZNA 3FEYA 4JDSA 4UI9C 3PE3A 3FUEA 3SF4A 5LP0A 1INZA 3LY8A 4FADA 4DK5A 3UT8A 3UMVA 3CK8A 4Q94A 1HH8A 2JEKA 2OVBA 3ZW3A 4FLHA 4AEZC 4ANUA 2VJ8A 3IHXA 3I3NA 4N5CA 3M57A 2KCVA 3HVEA 3MYVA 4ABNA 4BWRA 1IHGA 3NZSA 3EDTB 1JPLA 2QFCA 3CHQA 4TUUA 4DJAA 4NVQA 5T0KA 3FP3A 3I5PA 3T5XA 1S0PA 3CKCA 1A17A 3R7QA 1E7UA 1N52A 3IHVA 3CR3A 3MCXA 4W9RA 1L5JA 2C2LA 2WXGA 3HYMB 5G55A 5M72A 2WVIA 3VLEA 4FULA 5BV1A 5EX0A 2XGOA 3K9IA 3OXFA 4C0MA 3ZHEB 3U66A 3B7TA 4HOSA 4NURA 4CRWA 4JW1A 4A55A 4D10C 2WXQA 1O9SA 3ASHA 3BEEA 3ZRHA 2UY1A 1XQHA 2WQ6A 3MX3A 4FHJA 4U0UA 2XPIA 3M54A 4CDMA 1SZ9A 3UUXA 3FTUA 2C0MA 2DCPA 3D9OA 2J49A 3MKRA 2RG8A 4KVOA 2ZU6B 4WNFA 4I17A 4KXKB 1UJKA 4N2QA 3O48A 2A5UA 2Q7FA 4FLBA 3FH5A 2X3MA 3RO3A 5EKQD 3S7BA 2W5YA 4JLGA 3PUKA 4JEUA 4C9BB 2I6HA 1H19A 2J07A 2LSUA 2X6FA 1U3DA 5T0MA 1TJCA 2QY7A 3G2VA 1OWOA 3D9LA 3B13A 3RJVA 3F9WA 3OPEA 3EJNA 5ARFA 4KMOA 1MHQA 1NA3A 2WPVA 4Q96A 3FUMA 4Z4PA 5KJKA 5JJ7A 3E4BA 2WB2A 5JJTA 3CHOA 3CV0A 3WXXA 1H2UA 4FJZA 4K03A 4J6IA 3PE4A 3ZIMA 3HIZA 5D0QD 3K5KA 3PNLB 4NRHB 4PH4B 2XCCA 3G2UA 3CQGB 3NZUA 4UQZA 3TXMA 3PS6A 2CHWA 3FTXA 3FH7A 3L22A 2JLBA 1JWFA 2WXMA 4A3TA 4EBAA 4AY6A 2C0LA 3KAEA 2YHCA 4H7YA 5BW8C 3CQCB 3QNKA 1BPOA 1UJJA 2XEVA 4RG9A 4UQXA 1NA0A 4AV7A 4U8HA 3QJZA 3GYZA 3IBEA 4GAAA 2I9CA 3ZFWA 3LPZA 1TEZA 4G11A 3QOUA 5D0OD 1JUQA 1XNFA 4Y6WA 2MHKA 1H2TC 3VLFA 5BPPA 5JIYA 3F9YA 4J8FA 3ML9A 2BTDA 1HFAA 3SGHA 2GGFA 1EDUA 3DALA 4YPEA 4L23A 5LCWC 5EDSA 3FUHA 3M56A 2OV8A 1HO8A 1SZAA 2HR2A 3D9IA 4R7LA 4KZ0A 1SQMA 2KZTB 5E76A 4ATGA 2YQ8A 4L2LA 2AXUA 3APFA 2UWJG 2WXJA 4EECA 3FEXA 3PEVB 3ONKA 2R59A 4WAFA 4JPSA 2XGMA 5CMWA 4IJDA 2MRIA 1NP7A 3TL5A 1P5QA 4HXIA 4WNDA 4LERA 2VGYA 3TJPA 4AVXA 4BSXA 2VSXE 5FJYA 3U64A 4A3VA 4KYOB 3CVQA 2L0TB 3P1UA 1PEGA 4JEHA 3AS4A 3ZYQA 5FQ8A 2X38A 1VDYA 4U0SA 3APDA 3CVXA 3P2BA 4FA6A 1KT1A 4KVMA 3Q5MA 4XKBA 3S7JA 3QB2A 3CHSA 5TTFA 4JXTA 2ILRA 4GYYA 4GZ5A 3HNAA 3ESLA 5EG2A 2E2EA 3FPDA 2M63A 4DLQA 1UN9A 5BV0A 3RRNB 2NSZA 3SW9A 4QEOA 3DB5A 4I9CA 4HOUA 2RD0A 4KZCA 4RVBA 4APFA 1PC2A 4AP2A 3CVVA 3LVQE 1FVFA 4H12A 1FVHA 2E0IA 5C1DA 4JC8A 3FUDA 2NC9A 3OTNA 3ASDA 3SNXA 4AJWA 3PRZA 2G46A 3FU5A 5T5GA 4PS8A 3VTYA 2VSNA 1H0AA 3OXLA 3CLJA 3PUJA 2XPZA 4IN3B 4L2YA 5AIJA 4GB9A 5G04C 3DPDA 5ENNA 3AU4A 3UT4A 5CCMA 2FO7A 4B0ZA 3RJWA 3S7FA 2YHEA 4GA0A 4IYPA 1OWMA 2BUGA 3BG0B 1HG2A 3FULA 3LDZA 4YPUA 3S8PA 5LSZA 3CVUA 2PL2A 4LRZA 2RFIA 1UN8A 2A4ZA 3PEUB 3FUIA 4UWLA 4BTBA 4CT0A 3G2WA 3ZEFA 4XI0A 4F3VA 3L13A 3QWPA 2WXLA 4FJYA 1HX8A 2AW6A 3TAXA 4C0EA 3M59A 4ANWA 5BT1A 1HE8A 3FTSA 1MVXA 2BQZA 4V3IA 3TXNA 4Q69A 4O30A 2WXPA 3FHEA 3DBSA 4PS3A 4ANXA 4CGVA 4BX9A 3FTYA 4FHKA 3IV0A 3LXUX 4BUPA 1PAQA 2VSOE 4GMJA 3AS5A 4BT8A 1WM5A 3IKOB 4QFVA 4J0UA 3L08A 3IHYA 4N39A 5T4YA 4WWOA 4ACLA 3SBSA 3HHMA 3I4RB 4PS7A 3JYSA 4MLPA 4H7XA 1HXIA 2CG2A 2IFUA 3VLDA 4RSYA 5FQ6A 4J8OA 3CHRA 3CHPA 4JA7A 4EZKA 2YINA 1IQRA 1ZBPA 5LFAA 4WUYA 4C1QA 3QK0A 4IRUA 4TRQA 5A7DB 5F59A 2V0PA 2L0IA 2NXPA 2WMOA 3EHNA 3TG5A 4YPAA 3RQ4A 4NACA 1HG5A 4UI9J 3TG4A 3CVPA 5FQ7A 3MO5A 1FCHA 2X6JA 5E75A 4GA1A 4YVQC 2CFZA 4OVUA 4N2SA 4J8DA 5G05C 1ML9A 5F6KC 4EZLA 4QENA 4YVOA 5FWQA 1IYGA 4JHRA 4I6EA 4YNDA 1Z3XA 3I4GA 3PNTB 4MKTA 4N3CA 3UT7A 4NJ5A 2V8SE 4WWPA 4EPZA 3CKBA 3KS2A 3ZVVA 5A6CA 2QPWA 3KMAA 3M5AA 3KMTA 4Y6CA 2IONA 5KCMA 5LOZA 2WM9A 3L17A 1KT0A 3ZYLA 2IGQA 3QKYA 1LF8A 3JQ1A 4GCOA 2PZIA 5JJ0A 1HF8A 2IF4A 2VTBB 4IJ8A 3CBPA 4GZCA 3PREA 1PY1A 4CT4A 1E8WA 4RG6A 2Y4TA 2I1JA 5FT9A 3FTZA 2X6KA 3LCAA 3QWWA 4L7TA 4J7FA 3ESKA 4WWNA 5TEGA 4AU7A 2XGSA 4DI4A 5J08A 2X6IA 2XRZA 3PZDA 4ILGA 3B7RL 4A1SA 5JHAA 3CVNA 3FTVA 3D9PA 2HM8A 2CG3A 1MT6A 4HORA 1E8ZA 4M3OA 3N71A 2Y4UA 2WXKA 4XZ4A 3ZHEA 4E6HA 1DNPA 4GZ3A 2AXZA 4EQFA 3RAYA 4EBAG 2J4BA 4JHJA 3QAQA 4I43A 3SBTB 5AYFA 4KT6B 3OOIA 2PM6A 2XPYA 2VGXA 4GMLA 4XI9A 2R3AA 4ANVA 1QZ2A 1E96B 4I6JA 4UQYA 3R7RA 3CVLA 3EHMA 3MZLB 4ILIA 2F69A 1OWNA 2AVPA 3FU0A 3S2AA 5G04J 2CHXA 2VSYA 3JQ0A 1E7VA 3LJ3A 4JA9A 3ULQA 5LSXA 3PVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EX3 A;  5KJM A;  5AYW D;  4YNM A;  5F6L A;  3ZN3 A;  3FWV A;  2KCK A;  3F9Z A;  5FTP A;  3F9X A;  4YNP A;  3GZ1 A;  4HOT A;  4G24 A;  2PQN A;  1N6C A;  5ARG A;  5CHE E;  3CK9 A;  3LY9 A;  5HQ8 A;  5TH7 A;  2XCB A;  3QDN A;  5HI7 A;  3ZGQ A;  4GZ6 A;  4U07 A;  4LEU A;  5DIZ A;  2KC7 A;  3RKV A;  3MO0 A;  2KCL A;  1MVH A;  4N3B A;  5F5E A;  5JJ6 A;  4AY5 A;  2FI7 A;  3U4T A;  1ELR A;  5DBK A;  2VQ2 A;  4J8E A;  4GA2 A;  4QEP A;  4U0Z A;  4J7I A;  5BNW A;  2HYZ A;  5CCL A;  4WNG A;  2HO1 A;  5FZS A;  3RU0 A;  4G2V A;  5CPR B;  5JIN A;  3LY7 A;  4G1T A;  4MI0 A;  4LDG A;  5KJN A;  3KMJ A;  4G25 A;  5FZQ A;  3KD7 A;  3RO2 A;  4I9E A;  4I2Z A;  3NF1 A;  1ZU2 A;  2WQH A;  3SZ7 A;  2O8J A;  1ZKK A;  4J83 A;  1QQE A;  5G05 J;  3S7D A;  3VTX A;  3MV2 B;  4KBQ A;  2FEZ A;  3LKU A;  2VYI A;  4RZ0 A;  5KJL A;  3ASG A;  4MI5 A;  4UI9 K;  4HOQ A;  4CDR A;  4CGW A;  2P58 C;  2LNI A;  1W3B A;  4BTA A;  3Q4A B;  3IEG A;  4JL0 A;  3CK7 A;  3VUZ A;  4E47 A;  2FBN A;  4ME2 A;  4I1A A;  2OND A;  4GYW A;  3PDN A;  2W5Z A;  2VGX B;  3LYA A;  4I2W A;  5FZR A;  3URZ A;  1B89 A;  1WAO 1;  3TGO A;  3EP0 A;  3CBM A;  4GYO A;  5LCW J;  4FMU A;  3MA5 A;  1OUV A;  1Y8M A;  3VV0 A;  3RIB A;  4XIF A;  3ASF A;  4N3A A;  3GZ2 A;  2UY1 B;  4NQ0 A;  3ZPJ A;  3QWV A;  3M55 A;  4BT9 A;  2LSV A;  4I51 A;  4G26 A;  3CEQ A;  3BO5 A;  3MEK A;  1ELW A;  1N3J A;  1HZ4 A;  3Q15 A;  2PQR A;  2DBA A;  3UPV A;  1KLX A;  1N6A A;  2L6J A;  2OOE A;  3OS5 A;  1MUF A;  2J9Q A;  4AIF A;  4U04 A;  2KAT A;  3SWC A;  4GCN A;  3AS8 A;  2V5F A;  3Q47 B;  5JHN A;  4APO A;  3U3W A;  3M53 A;  3OXG A;  3M58 A;  2JV0 A;  3MV3 B;  4O6F A;  4B94 A;  2FF4 A;  3FFL A;  4G23 A;  4WNE A;  1YA0 A;  3Q49 B;  1H3I A;  3CBO A;  4GPK A;  4AM9 A;  3UQ3 A;  2R5S A;  3MO2 A;  2GW1 A;  3GW4 A;  3R9A B;  1NZN A;  4JDS A;  4UI9 C;  3PE3 A;  3SF4 A;  3LY8 A;  3CK8 A;  1HH8 A;  3IHX A;  4N5C A;  3M57 A;  2KCV A;  4ABN A;  4BWR A;  1IHG A;  3EDT B;  4NVQ A;  2QFC A;  5T0K A;  3FP3 A;  3CKC A;  1A17 A;  4W9R A;  2C2L A;  3HYM B;  5M72 A;  5EX0 A;  2XGO A;  3K9I A;  3OXF A;  3ZHE B;  4HOS A;  1O9S A;  3ASH A;  3BEE A;  2UY1 A;  1XQH A;  4U0U A;  2XPI A;  3M54 A;  3UUX A;  2C0M A;  3MKR A;  4WNF A;  4I17 A;  4KXK B;  4N2Q A;  3O48 A;  2Q7F A;  3RO3 A;  5EKQ D;  3S7B A;  2W5Y A;  4JLG A;  2I6H A;  2LSU A;  5T0M A;  1TJC A;  3RJV A;  3F9W A;  3OPE A;  5ARF A;  1NA3 A;  2WPV A;  4Z4P A;  5KJK A;  5JJ7 A;  3E4B A;  5JJT A;  3CV0 A;  3WXX A;  3PE4 A;  5D0Q D;  3K5K A;  4NRH B;  2XCC A;  4UQZ A;  2JLB A;  4AY6 A;  2C0L A;  3KAE A;  2YHC A;  4H7Y A;  5BW8 C;  4RG9 A;  2XEV A;  4UQX A;  1NA0 A;  3GYZ A;  3ZFW A;  3LPZ A;  5D0O D;  3QOU A;  1XNF A;  4Y6W A;  2MHK A;  5JIY A;  3F9Y A;  4J8F A;  3DAL A;  4YPE A;  5LCW C;  3M56 A;  2HR2 A;  2YQ8 A;  2UWJ G;  4IJD A;  2XGM A;  1P5Q A;  4WND A;  2VGY A;  5FJY A;  4KYO B;  3CVQ A;  1PEG A;  3AS4 A;  4U0S A;  1KT1 A;  3Q5M A;  3S7J A;  5TTF A;  4GYY A;  4GZ5 A;  3HNA A;  5EG2 A;  2E2E A;  3FPD A;  3SW9 A;  4QEO A;  3DB5 A;  4I9C A;  4HOU A;  1PC2 A;  4H12 A;  5C1D A;  2NC9 A;  3ASD A;  5T5G A;  2G46 A;  3VTY A;  2VSN A;  3OXL A;  4IN3 B;  5G04 C;  5CCM A;  2FO7 A;  3RJW A;  3S7F A;  4GA0 A;  2BUG A;  4YPU A;  3S8P A;  5LSZ A;  2PL2 A;  2RFI A;  4BTB A;  4F3V A;  4XI0 A;  3QWP A;  3TAX A;  3M59 A;  5BT1 A;  2BQZ A;  1MVX A;  4O30 A;  4CGV A;  4BUP A;  3AS5 A;  4BT8 A;  1WM5 A;  4J0U A;  4N39 A;  3JYS A;  4H7X A;  1HXI A;  2IFU A;  4J8O A;  4JA7 A;  1ZBP A;  4C1Q A;  4WUY A;  5F59 A;  5A7D B;  3TG5 A;  4YPA A;  3RQ4 A;  4UI9 J;  3TG4 A;  3CVP A;  3MO5 A;  1FCH A;  4GA1 A;  4YVQ C;  4N2S A;  4J8D A;  5G05 C;  1ML9 A;  5F6K C;  4QEN A;  4YVO A;  1IYG A;  4JHR A;  4YND A;  4N3C A;  4NJ5 A;  3CKB A;  3KS2 A;  5A6C A;  2QPW A;  3KMA A;  3M5A A;  3KMT A;  4Y6C A;  1KT0 A;  2IGQ A;  3QKY A;  4GCO A;  2PZI A;  5JJ0 A;  2IF4 A;  4IJ8 A;  3CBP A;  4RG6 A;  2Y4T A;  5FT9 A;  5TEG A;  3LCA A;  3QWW A;  4AU7 A;  4J7F A;  3ESK A;  2XGS A;  4A1S A;  3CVN A;  1MT6 A;  4HOR A;  3N71 A;  2Y4U A;  3ZHE A;  4GZ3 A;  4EQF A;  3RAY A;  5AYF A;  3OOI A;  2VGX A;  4XI9 A;  2R3A A;  1QZ2 A;  1E96 B;  4UQY A;  3CVL A;  2F69 A;  2AVP A;  5G04 J;  2VSY A;  4JA9 A;  3ULQ A;  5LSX A; 
#chains in the Genus database with same CATH topology
 5EX3 A;  1JCQ A;  3AJI A;  5B1B E;  3AU5 A;  3HDX A;  4F1P A;  2WXO A;  5CHE E;  3CK9 A;  3LY9 A;  5HQ8 A;  3CST A;  4U07 A;  3D9K A;  3NAW A;  4HI9 A;  4JHK A;  1TNO A;  1MVH A;  2R05 A;  1K1B A;  1QNF A;  4TXQ A;  2FI7 A;  3FTW A;  3FUF A;  5DBK A;  4FU3 A;  4QEP A;  2LAH A;  4GA2 A;  4GMR A;  2MOW A;  1N9A A;  4CZ2 D;  2ZGD A;  3E37 A;  4HS2 A;  2DZO A;  2X6H A;  3LY7 A;  3UM0 A;  2ETC A;  3X2Q E;  2QYJ A;  4MI0 A;  4LDG A;  5KJN A;  4G25 A;  3T5V A;  4OAU C;  2WQH A;  1AP7 A;  2CFU A;  4BEP A;  3UKR G;  2O8J A;  5G2N A;  4LCT A;  4ZHB A;  1OCC E;  2DWZ A;  3VTX A;  4HVB A;  4KBQ A;  2FEZ A;  4RQI A;  2VYI A;  2XS8 A;  4F1S A;  3NQP A;  1E8X A;  4MI5 A;  1TJF A;  3Q73 A;  3FH8 A;  4HOQ A;  4CDR A;  2GRM A;  1W3B A;  3LEW A;  3BG1 B;  4LUN U;  2F37 A;  4E47 A;  2FBN A;  1Z3Y A;  1H6P A;  2VGX B;  4XKC A;  4DRX E;  1V55 E;  4FC8 A;  4TV3 A;  4GYO A;  3KEZ A;  2WXI A;  3EU9 A;  5LCW J;  2AXV A;  3ISM C;  3VV0 A;  3RIB A;  2EQX A;  3ML8 A;  1K8K G;  2UY1 B;  4DI3 A;  3ZPJ A;  4BT9 A;  2LSV A;  4G26 A;  3Q79 A;  5ANR A;  5KWD A;  1IQU A;  4JVS A;  3UPV A;  2L6J A;  4CDN A;  3J5Q B;  3OS5 A;  1MUF A;  2F8Y A;  4U04 A;  3FUK A;  5EYP F;  3SWC A;  2F0Y A;  4EZJ A;  3LS8 A;  2KBX A;  2XEH A;  2V5F A;  3Q47 B;  5JHN A;  4DUI A;  3EIJ A;  5AEN A;  2EIL E;  4UWK A;  2OVF A;  3M53 A;  4DX6 D;  3OXG A;  1Y6I A;  5ITZ F;  1WDY A;  3MV3 B;  4O6F A;  5FIO A;  3MKQ B;  3FFL A;  4G23 A;  1WY6 A;  4PUC A;  3PZ1 A;  2I2O A;  3RRM B;  1G3N B;  2GW1 A;  3L16 A;  1X81 A;  1NZN A;  3SF4 A;  4FAD A;  3UT8 A;  4Q94 A;  1TNZ A;  2JEK A;  2OVB A;  3ZW3 A;  4HI8 A;  4ANU A;  4ABN A;  1JPL A;  2QFC A;  4NVQ A;  5T0K A;  2C2L A;  2OCC E;  2XZD G;  1BI8 B;  4CRW A;  4U7E B;  4D10 C;  2DYS E;  5BXO A;  2GRO B;  2B6C A;  3UXG A;  5KBA A;  3M54 A;  1SZ9 A;  3AG2 E;  2DCP A;  2EIK E;  3SY2 A;  3MKR A;  4U8V D;  3HXD A;  4N2Q A;  4FLB A;  3FH5 A;  2X3M A;  2VGE A;  4JLG A;  1H19 A;  2X6F A;  1U3D A;  1TJC A;  3D9L A;  3OPE A;  4KMO A;  4G8K A;  4Z4P A;  3J5P A;  3Q9N C;  5KJK A;  5JJ7 A;  2WB2 A;  3K5K A;  2R02 A;  2XCC A;  4UQZ A;  3TWX A;  3L22 A;  2JLB A;  2C0L A;  4H7Y A;  1UJJ A;  2P9U G;  3QJZ A;  2DZN A;  3NOG D;  1TEZ A;  2MHK A;  5JIY A;  1HFA A;  3SGH A;  4L23 A;  3WG7 E;  5EDS A;  3FUH A;  2OV8 A;  1HO8 A;  3BQO A;  2HR2 A;  1SVX A;  4ATG A;  2AXU A;  4EEC A;  3ASN E;  3ONK A;  2R59 A;  4JPS A;  4A3V A;  2ZIR A;  3ZUV B;  2L0T B;  1N95 A;  4JEH A;  1IXV A;  5FQ8 A;  3C3R A;  5TTF A;  4GYY A;  5KNG A;  4DLQ A;  1UN9 A;  3Q78 A;  2GRN B;  4QEO A;  4KZC A;  2V4H C;  1FVH A;  1N94 A;  5C1D A;  4JC8 A;  3FUD A;  4BET A;  3ASD A;  3D9H A;  3FU5 A;  4PS8 A;  3DSX A;  2VSN A;  5CCM A;  3RJW A;  3DSV A;  4YPU A;  1UN8 A;  3L13 A;  3EHR A;  1FT1 A;  1HE8 A;  3TXN A;  4GTQ A;  4K5A B;  4BUP A;  3W9F A;  4GMJ A;  3AS5 A;  1WM5 A;  3UM3 A;  4J0U A;  4N39 A;  2HE0 A;  4GTO A;  3JYS A;  2IEJ A;  4MLP A;  4LNU D;  3VLD A;  4WUY A;  1TNB A;  2V0P A;  4YPA A;  3RQ4 A;  5FQ7 A;  4GA1 A;  2CFZ A;  3I4G A;  4N3C A;  4EPZ A;  3KS2 A;  3ZVV A;  3KMT A;  5LOZ A;  4GTV A;  2GRP B;  4GZC A;  1PY1 A;  3ABK E;  3LCA A;  3UTM A;  3TWT A;  5JHA A;  2HM8 A;  1MT6 A;  2EIN E;  2JAB A;  3N71 A;  2Y4U A;  4E6H A;  1DNP A;  4EQF A;  3RAY A;  4L9P A;  3SBT B;  3Q9U C;  4UQY A;  3CVL A;  4ILI A;  2CHX A;  1E7V A;  3PVL A;  2NYJ A;  5KJM A;  3FY4 A;  3ZN3 A;  5AQA A;  2IOL A;  2GRL A;  3UIN C;  3B7B A;  4BER A;  4YNP A;  5D66 A;  1OCR E;  2PQN A;  1N6C A;  5J90 A;  1DCE A;  5HI7 A;  3ZGQ A;  3SFX A;  5DIZ A;  2KC7 A;  4N3B A;  4HFG A;  4P29 A;  1EF1 C;  5JJ6 A;  3SD5 A;  4AY5 A;  1TN6 A;  2FUL A;  1TYQ G;  3U4T A;  4BFR A;  2VQ2 A;  3L54 A;  4J8E A;  4U0Z A;  3SHF A;  3MGB A;  3RU0 A;  4G2V A;  2IQC A;  5CBO A;  1N54 A;  3LJN A;  2V4L A;  3CSF A;  1QYM A;  3QAR A;  3NF1 A;  5EYL A;  3E32 A;  4YDY A;  1QQE A;  5T8I A;  5G05 J;  3S7D A;  3LKU A;  5CER B;  4RZ0 A;  3ASG A;  2XHE A;  2IJG X;  4CGW A;  2P58 C;  2LNI A;  4DLO A;  3IEG A;  1EPU A;  4XE0 A;  3VUZ A;  4U63 A;  4IUL A;  3RSE G;  3ZIM A;  3FUJ A;  1NL4 A;  5CBN A;  1B89 A;  1WAO 1;  3TGO A;  3GZS A;  2Y0B G;  3AG4 E;  1Y8M A;  3PH0 C;  3V79 K;  4XIF A;  3D9J A;  3ASF A;  4XX5 A;  4NQ0 A;  3QWV A;  3M55 A;  4HRN A;  3C3Q A;  5HRY A;  3BO5 A;  2F8X K;  3MEK A;  2J4D A;  3JUI A;  1HZ4 A;  3Q15 A;  4UWG A;  3T9K A;  4I1O B;  4AIF A;  3ENE A;  4GCN A;  3R9M A;  3G2T A;  3NOC D;  2WXN A;  3U3W A;  1MX2 A;  3EUV A;  1Z6T A;  3OAW A;  4E85 A;  2JV0 A;  5C2Y A;  4WNE A;  4GTM A;  4UWF A;  1SA5 A;  2ETA A;  4ILH B;  1H2V C;  4GPK A;  4AM9 A;  3DXM G;  2R5S A;  4DX7 D;  3GW4 A;  3FEY A;  4UI9 C;  3PE3 A;  3FUE A;  5LP0 A;  4DK5 A;  3UMV A;  4AEZ C;  2VJ8 A;  4N5C A;  3M57 A;  2B0O E;  3NZS A;  3FP3 A;  3T5X A;  3CKC A;  4BSZ B;  3MCX A;  5JMN D;  4W9R A;  5M72 A;  1O1T A;  4U95 D;  4FUL A;  4XEI G;  4JD2 G;  3ZHE B;  3U66 A;  3B7T A;  3TWR A;  1O9S A;  3BEE A;  2WQ6 A;  3DSS A;  2Y69 E;  5EID A;  3DRA A;  3D9O A;  5ENT D;  2J49 A;  2LUH A;  3O48 A;  1N11 A;  3RO3 A;  3DSW A;  3S7B A;  4C9B B;  2LSU A;  2QY7 A;  3G2V A;  3EJN A;  1MHQ A;  1KZP A;  1NFI E;  4Q96 A;  5JJT A;  5ENS D;  3CV0 A;  1OXJ A;  3WXX A;  1H2U A;  4J6I A;  4BES A;  3PE4 A;  2LXL A;  3PS6 A;  3TXM A;  2CHW A;  5BW8 C;  1O5M A;  4U8H A;  3GYZ A;  3LPZ A;  3QOU A;  3F9Y A;  4J8Y A;  4K5B A;  1EDU A;  2R03 A;  4DX1 A;  3W9G A;  1SZA A;  3ZU7 B;  4R7L A;  2KZT B;  4X8Q A;  2UWJ G;  2H6F A;  2WXJ A;  3FEX A;  3PEV B;  1N4Q A;  2MRI A;  3TL5 A;  3KEA A;  4HXI A;  4AVX A;  4LER A;  5FJY A;  3U64 A;  3DEO A;  3UIP C;  3UKU G;  3AS4 A;  3V30 A;  5CRU A;  4GTS A;  3P2B A;  4KVM A;  3UM1 A;  3HNA A;  5EG2 A;  1LD8 A;  5H7P A;  5BV0 A;  3SW9 A;  4HOU A;  4H12 A;  2E0I A;  3ZNG A;  2P9N G;  3SNX A;  3VTY A;  4IN3 B;  3OXL A;  1S64 A;  3DPD A;  3UT4 A;  2FO7 A;  2J8S D;  4CYM D;  4GA0 A;  4IYP A;  1OWM A;  3LDZ A;  5HKP A;  3S8P A;  5LSZ A;  1O1S A;  3CVU A;  2A4Z A;  4UWL A;  4CT0 A;  3QWP A;  4FJY A;  4C0E A;  3TAX A;  3M59 A;  3SFY A;  1TN8 A;  3FHE A;  3DBS A;  4ANX A;  4BX9 A;  5AQB A;  3L08 A;  5T4Y A;  4WWO A;  3SBS A;  3HHM A;  4PS7 A;  1TN7 A;  4RSY A;  4JA7 A;  2YIN A;  1IQR A;  1ZBP A;  4N5Q A;  5F59 A;  4TRQ A;  1D8D A;  1HG5 A;  3TG4 A;  3CVP A;  3MO5 A;  1FCH A;  2X6J A;  4YVQ C;  4EZL A;  4HQD A;  3UT7 A;  3HG0 D;  1OY3 D;  5A6C A;  2QPW A;  3B95 A;  3M5A A;  3C3O A;  1DCQ A;  3ZKJ A;  2MYO A;  1UOH A;  1LF8 A;  5JJ0 A;  3DSU A;  1HF8 A;  4CT4 A;  1E8W A;  2Y4T A;  2I1J A;  1IHB A;  3FTZ A;  4J7F A;  2XGS A;  4DI4 A;  5ENR D;  2X6I A;  3AG3 E;  3PZD A;  3FTV A;  1E8Z A;  3SQV A;  2FO1 E;  2AXZ A;  2P9P G;  2J4B A;  5D2M C;  5AYF A;  2VGX A;  4GML A;  1E96 B;  3MZL B;  4K5C A;  3HXB A;  2VSY A;  5CED B;  2Y1L E;  1JWG A;  1BI7 B;  5AYW D;  4YNM A;  3ZXP A;  3FU3 A;  2QZA A;  3F9Z A;  3F9X A;  2XS1 A;  4B93 B;  3GZ1 A;  1D8E A;  2VTB A;  4CEM A;  3QDN A;  3BUA A;  4GZ6 A;  1H6K A;  4LEU A;  1OT8 A;  4JB8 P;  3RKV A;  1XGW A;  2KCL A;  2V5Q C;  3MO0 A;  4JZY A;  4AXH A;  2QC9 A;  5F5E A;  2ZGG A;  3MKQ A;  1ELR A;  4L1B A;  3EIQ C;  4J7I A;  2HYZ A;  5CCL A;  4WNG A;  5FZS A;  4O1O A;  2WQ7 A;  4G1T A;  4F53 A;  3FDH A;  3KSL A;  3V31 A;  2IU1 A;  3DST A;  1D9S A;  2DIW A;  4MS6 A;  4I9E A;  3FU6 A;  4I2Z A;  2KZT A;  1MX4 A;  3D9N A;  3SZ7 A;  4J83 A;  3LVR E;  2XRY A;  4ZFH A;  3U9W A;  5JHB A;  2WMN A;  2OEW A;  1FT2 A;  1OWP A;  2L9B A;  3Q4A B;  3E30 A;  3CK7 A;  4I1A A;  4GYW A;  5CEA A;  1OWL A;  2W5Z A;  5LX8 A;  4PDX A;  4K0R A;  5FZR A;  3URZ A;  2R17 C;  4A63 B;  1X5B A;  3EP0 A;  3CBM A;  4A1G A;  1JCR A;  4FMU A;  3MA5 A;  3C72 A;  1U3C A;  2Y3A A;  4B89 A;  1U2V G;  5T3R A;  1ZB1 A;  2LO6 A;  2BF0 X;  3GZ2 A;  4GZD A;  5ENP D;  3ULE G;  3ABM E;  1E90 A;  1YMP A;  1N3J A;  4EHM A;  4J8S A;  1GW6 A;  2LXM A;  3CIA A;  2DBA A;  2ZIS A;  1N6A A;  5ANL A;  2J9Q A;  1EYH A;  3QC1 A;  3SO8 A;  2KAT A;  5AJD A;  4LNG A;  4I1M A;  4HLL A;  4B8C B;  3ZYK A;  4APO A;  3MJW A;  2AWI A;  5BUZ A;  3D9M A;  3UX4 A;  2GRR B;  1ELK A;  4B94 A;  2FF4 A;  4QQI A;  3RAU A;  3B7S A;  1HU3 A;  3Q49 B;  2P2C P;  2P9K G;  2YNQ A;  3CVW A;  2J08 A;  3C98 A;  1BD8 A;  3R9A B;  4JDS A;  4ATZ D;  3CK8 A;  3TWW A;  3IHX A;  2R2L A;  3I3N A;  3TWS A;  2KCV A;  3MYV A;  4BWR A;  1IHG A;  3EDT B;  4TUU A;  3I5P A;  1S0P A;  1E7U A;  1N0R A;  1N52 A;  3IHV A;  4RLY A;  3HYM B;  2WXG A;  2P9I G;  4TXR A;  3VLE A;  5BV1 A;  5EX0 A;  4MBG A;  2XGO A;  3K9I A;  3OXF A;  4C0M A;  4A55 A;  2WXQ A;  3ASH A;  1XQH A;  3MX3 A;  4U0U A;  2XPI A;  4CDM A;  3UUX A;  2RG8 A;  4KVO A;  2ZU6 B;  1N0Q A;  1UJK A;  2A5E A;  3NBN B;  1Q2Z A;  2A5U A;  1YCS B;  2AJA A;  5EKQ D;  5EIL A;  3TWV A;  2W5Y A;  3PUK A;  1N4S A;  2J07 A;  3RJV A;  1OWO A;  3B13 A;  3F9W A;  1MX6 A;  5ARF A;  3IXE A;  2WPV A;  4C48 B;  5ENQ D;  3E4B A;  3CHO A;  3HIZ A;  3PNL B;  4PH4 B;  3CQG B;  3FH7 A;  4AY6 A;  3BU8 A;  3KAE A;  2YHC A;  1BPO A;  2XEV A;  4UQX A;  1YYH A;  4GAA A;  3ZFW A;  1BLX B;  1JUQ A;  1H2T C;  3VLF A;  5BPP A;  2XEN A;  4J8F A;  3ML9 A;  1A5E A;  2GGF A;  4YPE A;  4HBD A;  5LCW C;  4G8L A;  3D9I A;  4KZ0 A;  1SQM A;  1H6O A;  2IO2 C;  2YQ8 A;  4WAF A;  5CEC B;  1OCO E;  4IJD A;  1NP7 A;  4WND A;  4BSX A;  3Q75 A;  3CVQ A;  3P1U A;  2OEV A;  3Q7A A;  4NIK A;  3ZYQ A;  4HB5 A;  2X38 A;  4U0S A;  3APD A;  4XKB A;  3S7J A;  3QB2 A;  3CHS A;  2ILR A;  4GZ5 A;  3ESL A;  2E2E A;  3RRN B;  2NSZ A;  5FIN A;  3DB5 A;  4I9C A;  2QYU A;  2RD0 A;  4APF A;  1PC2 A;  3CVV A;  3LVQ E;  1FVF A;  3OTN A;  5T5G A;  3PRZ A;  2G46 A;  5AQ7 A;  3CLJ A;  3PUJ A;  2XPZ A;  5ENN A;  3S7F A;  1S70 B;  3BG0 B;  3FUL A;  1HG2 A;  2PL2 A;  2RFI A;  2BKK B;  3FUI A;  4BTB A;  4F3V A;  3ZEF A;  4XI0 A;  1BU9 A;  2WXL A;  2AW6 A;  4ANW A;  3FTS A;  4GTR A;  1MVX A;  4O30 A;  2WXP A;  4CGV A;  3FTY A;  4FHK A;  3IV0 A;  4J7W A;  4BT8 A;  4QFV A;  3IHY A;  3DEP A;  4ACL A;  3E33 A;  2CG2 A;  2IFU A;  4Z68 A;  3JUE A;  5FQ6 A;  4EZK A;  3CHP A;  5LFA A;  3QK0 A;  4IRU A;  2WMO A;  2NXP A;  2L0I A;  3EHN A;  3TG5 A;  4NAC A;  4UI9 J;  3NB2 A;  5E75 A;  2PNN A;  4OVU A;  5G05 C;  1ML9 A;  5F6K C;  4YVO A;  1IYG A;  4I6E A;  4YND A;  1NI1 A;  4MKT A;  4NJ5 A;  2V8S E;  3CKB A;  3KMA A;  1N4R A;  4Y6C A;  2ION A;  3EU5 A;  5KCM A;  1KT0 A;  3UM2 A;  3QKY A;  3JQ1 A;  4YDE A;  2IF4 A;  4IJ8 A;  1S63 A;  1QBQ A;  3PRE A;  2X6K A;  3QWW A;  5TEG A;  4AU7 A;  3ESK A;  4WWN A;  2XRZ A;  4A1S A;  3DWL G;  3L82 A;  3D9P A;  2CG3 A;  4HOR A;  1LTX A;  1KPS B;  4XZ4 A;  3ZHE A;  4EBA G;  4JHJ A;  5B3S E;  4KT6 B;  1DC2 A;  2PM6 A;  4HRL A;  4XI9 A;  5CRV A;  2R3A A;  4GTP A;  4I6J A;  3R7R A;  5AQ9 A;  2F69 A;  3FU0 A;  3L9T A;  3S2A A;  5G04 J;  5LSX A;  3UIO C;  4FHJ A;  3D3M A;  2PM7 A;  5F6L A;  2WXH A;  1WG0 A;  3FWV A;  1UW4 B;  3PZ3 A;  2KCK A;  5FTP A;  5EN5 D;  3L6A A;  4HOT A;  4UWH A;  2XQ0 A;  4G24 A;  3T8M A;  2DVW A;  3B7U X;  4F7A A;  5ARG A;  4URK A;  3TWU A;  1E8Y A;  5TH7 A;  2LAI A;  2XCB A;  1HS6 A;  3PZ4 A;  5BNW A;  2HO1 A;  1DVP A;  5CPR B;  2KM4 A;  2WXR A;  4B8A A;  5JIN A;  1UG3 A;  4U8Y D;  5BXU A;  3G2S A;  2IOS A;  3KMJ A;  3RO2 A;  4LNB A;  3KD7 A;  5FZQ A;  1N4P A;  5AN8 A;  3ZXS A;  4YDW A;  1ZU2 A;  2CHZ A;  3ZYM A;  1ZKK A;  1MJ0 A;  3HRA A;  3MV2 B;  4M7C A;  3SI5 A;  5KJL A;  3Q7F A;  3HVE B;  4AOF A;  4UI9 K;  4BX8 A;  4O60 A;  5ENO D;  4BTA A;  4JL0 A;  5AJL A;  3ONL A;  4ME2 A;  3FUN A;  3JCK C;  2OND A;  4GU5 A;  3PDN A;  3LYA A;  4I2W A;  4OVV A;  3SFZ A;  4HLE A;  4BY6 A;  3RRU A;  3C5R A;  4DPR A;  4FP7 A;  1OUV A;  2I1K A;  3O4Z A;  3PZ2 A;  1OCZ E;  4ACK A;  4N3A A;  4CCA A;  1JCS A;  1LD7 A;  5A23 A;  4I51 A;  2IO3 C;  3CEQ A;  1ELW A;  2PQR A;  3CHM A;  4OAV B;  1KLX A;  2OOE A;  3RK6 A;  2DYR E;  4OYS A;  1MYO A;  1MQS A;  2J09 A;  5CMY A;  3AS8 A;  4GPM A;  2GRQ B;  2WXF A;  3CGH A;  3M58 A;  5FQ4 A;  3APC A;  1YA0 A;  4I6G A;  1H3I A;  3CBO A;  4MRU A;  3UQ3 A;  3MO2 A;  4F6R D;  5JA4 D;  1INZ A;  3LY8 A;  1IKN D;  2RKK A;  1FPP A;  1HH8 A;  1SA4 A;  4U96 D;  4FLH A;  4UUC A;  3HVE A;  4DJA A;  3CHQ A;  2P9L G;  3R7Q A;  1A17 A;  5G55 A;  3CR3 A;  1L5J A;  3HXC A;  3V2X A;  5IY5 E;  2WVI A;  1RZ4 A;  2XZT G;  4HOS A;  4NUR A;  2EIM E;  4JW1 A;  1RW2 A;  2BKG A;  5EIB E;  3ZRH A;  2UY1 A;  5B1A E;  4LG6 A;  2ETB A;  3FTU A;  2C0M A;  3HXE A;  1TNY A;  4WNF A;  5AAO A;  4I17 A;  4KXK B;  5AAR A;  2Q7F A;  2H6G A;  3EHQ A;  4JEU A;  2I6H A;  2H6I A;  1SW6 A;  1AWC B;  5T0M A;  3UI2 A;  1TR4 A;  1NA3 A;  3FUM A;  4FJZ A;  4K03 A;  5D0Q D;  4DX5 D;  4NRH B;  3G2U A;  3NZU A;  3FTX A;  4A3T A;  2WXM A;  1JWF A;  4EBA A;  2L6B A;  3CQC B;  3QNK A;  4RG9 A;  1NA0 A;  4AV7 A;  3IBE A;  2I9C A;  4G11 A;  4HNA D;  5D0O D;  1XNF A;  4Y6W A;  2H6H A;  3KSQ A;  2BTD A;  2P9S G;  3DAL A;  3T8K A;  3M56 A;  2RFA A;  5KNH D;  1Z5S C;  5E76 A;  4L2L A;  3APF A;  2XGM A;  5CMW A;  4GTT A;  3ULY A;  1P5Q A;  4LSZ E;  2VGY A;  3TJP A;  2VSX E;  3AAA C;  4KYO B;  1PEG A;  1TNU A;  2IY0 C;  1VDY A;  3CVX A;  2ZXW E;  4FA6 A;  1KT1 A;  3Q5M A;  4JXT A;  3FPD A;  4TXP A;  2M63 A;  4RVB A;  4AP2 A;  3E34 A;  2NC9 A;  2RFM A;  4AJW A;  1H0A A;  4L2Y A;  5AIJ A;  4GB9 A;  5G04 C;  3AU4 A;  2XEE A;  4B0Z A;  2YHE A;  3AG1 E;  2BUG A;  4LRZ A;  3PEU B;  3G2W A;  1HX8 A;  3HXF A;  5BT1 A;  2BQZ A;  4V3I A;  4Q69 A;  4PS3 A;  3DXK G;  3LXU X;  1PAQ A;  2VSO E;  3IKO B;  4HRM B;  3I4R B;  1K1A A;  4H7X A;  1HXI A;  2KXP C;  4J8O A;  3CHR A;  3TWQ A;  4C1Q A;  5A7D B;  1KZO A;  2EIJ E;  3V2O A;  4N2S A;  4J8D A;  4QEN A;  5FWQ A;  4JHR A;  1Z3X A;  3PNT B;  3DPY A;  4WWP A;  2WM9 A;  1O1R A;  3L17 A;  2BED A;  3JXI A;  4YDO A;  3ZYL A;  2IGQ A;  4GCO A;  2PZI A;  1V54 E;  2VTB B;  3CBP A;  4RG6 A;  5FT9 A;  4L7T A;  4TUM A;  4DX2 A;  5J08 A;  3ABL E;  4ILG A;  3B7R L;  3CVN A;  1K3Z D;  4M3O A;  2WXK A;  4O1P A;  4GZ3 A;  3ASO E;  3F6Q A;  3JXJ A;  1MZC A;  3QAQ A;  4I43 A;  3OOI A;  2XPY A;  5HS0 A;  4ANV A;  1QZ2 A;  3EHM A;  1OWN A;  2AVP A;  3CVY A;  3JQ0 A;  3LJ3 A;  4JA9 A;  3ULQ A; 
#chains in the Genus database with same CATH homology
 5EX3 A;  1JWG A;  3D3M A;  5KJM A;  3FY4 A;  2PM7 A;  5AYW D;  4YNM A;  5F6L A;  2WXH A;  3ZN3 A;  3FWV A;  1UW4 B;  3FU3 A;  2KCK A;  2IOL A;  3AU5 A;  3F9Z A;  2GRL A;  5FTP A;  3F9X A;  3HDX A;  4YNP A;  3L6A A;  3GZ1 A;  4HOT A;  4UWH A;  2XQ0 A;  4G24 A;  2PQN A;  1N6C A;  2WXO A;  3T8M A;  5J90 A;  3B7U X;  4F7A A;  5ARG A;  5CHE E;  4URK A;  2VTB A;  1E8Y A;  3CK9 A;  3LY9 A;  5HQ8 A;  4CEM A;  5TH7 A;  2LAI A;  2XCB A;  3QDN A;  5HI7 A;  3CST A;  4GZ6 A;  3ZGQ A;  1H6K A;  4LEU A;  4U07 A;  3D9K A;  5DIZ A;  2KC7 A;  1HS6 A;  3RKV A;  1XGW A;  2KCL A;  4JHK A;  3MO0 A;  4JZY A;  4AXH A;  1MVH A;  4N3B A;  4HFG A;  4P29 A;  1EF1 C;  5JJ6 A;  1QNF A;  3SD5 A;  5F5E A;  4AY5 A;  2FUL A;  2FI7 A;  3MKQ A;  3U4T A;  4BFR A;  1ELR A;  4L1B A;  3FTW A;  3FUF A;  5DBK A;  2VQ2 A;  4FU3 A;  3L54 A;  4J8E A;  2LAH A;  3EIQ C;  4GA2 A;  2MOW A;  4U0Z A;  3CVY A;  4QEP A;  4J7I A;  5BNW A;  2HYZ A;  3SHF A;  3MGB A;  5CCL A;  4WNG A;  2HO1 A;  5FZS A;  3RU0 A;  4G2V A;  1DVP A;  5CPR B;  2KM4 A;  4HS2 A;  2WXR A;  4B8A A;  2X6H A;  5JIN A;  3LY7 A;  2IQC A;  1UG3 A;  4G1T A;  2WQ7 A;  4F53 A;  1N54 A;  3FDH A;  3G2S A;  4MI0 A;  4LDG A;  2IOS A;  2IU1 A;  2V4L A;  5KJN A;  3KMJ A;  2DIW A;  4G25 A;  5FZQ A;  3KD7 A;  4MS6 A;  3RO2 A;  3T5V A;  4I9E A;  3ZXS A;  3CSF A;  3QAR A;  3FU6 A;  4I2Z A;  3NF1 A;  2KZT A;  1ZU2 A;  2WQH A;  2CFU A;  3D9N A;  3SZ7 A;  2O8J A;  2CHZ A;  3ZYM A;  1ZKK A;  4J83 A;  5G2N A;  4LCT A;  1QQE A;  5T8I A;  5G05 J;  3S7D A;  3VTX A;  3MV2 B;  4HVB A;  3LVR E;  4KBQ A;  2FEZ A;  2XRY A;  3LKU A;  2VYI A;  3SI5 A;  4F1S A;  4RZ0 A;  5KJL A;  3ASG A;  3NQP A;  1E8X A;  4MI5 A;  1TJF A;  3U9W A;  3HVE B;  2XHE A;  4AOF A;  4UI9 K;  4BX8 A;  3FH8 A;  5JHB A;  4HOQ A;  2IJG X;  4CDR A;  4CGW A;  2GRM A;  2P58 C;  2WMN A;  2LNI A;  1W3B A;  4DLO A;  3LEW A;  4BTA A;  1OWP A;  3BG1 B;  4LUN U;  2L9B A;  3IEG A;  3Q4A B;  1EPU A;  4JL0 A;  3CK7 A;  5AJL A;  4XE0 A;  3VUZ A;  4E47 A;  4U63 A;  2FBN A;  3ONL A;  4IUL A;  4ME2 A;  4I1A A;  3FUN A;  3JCK C;  2OND A;  4GYW A;  1Z3Y A;  4GU5 A;  3PDN A;  1OWL A;  2W5Z A;  5LX8 A;  2VGX B;  3LYA A;  4PDX A;  3FUJ A;  4K0R A;  4I2W A;  4OVV A;  2R17 C;  4XKC A;  4FC8 A;  5FZR A;  4TV3 A;  3SFZ A;  3URZ A;  1B89 A;  1WAO 1;  1X5B A;  3TGO A;  3EP0 A;  3CBM A;  4A1G A;  4BY6 A;  4GYO A;  4HLE A;  3RRU A;  3GZS A;  4DPR A;  3KEZ A;  4FP7 A;  2WXI A;  5LCW J;  4FMU A;  2AXV A;  3MA5 A;  1OUV A;  1Y8M A;  3PH0 C;  3VV0 A;  2I1K A;  1U3C A;  3O4Z A;  2Y3A A;  3D9J A;  2EQX A;  3ASF A;  3ML8 A;  4XIF A;  3RIB A;  4ACK A;  4B89 A;  4N3A A;  4CCA A;  5T3R A;  2LO6 A;  2BF0 X;  2UY1 B;  3GZ2 A;  4GZD A;  4XX5 A;  4DI3 A;  4NQ0 A;  3ZPJ A;  5A23 A;  3QWV A;  3M55 A;  4BT9 A;  2LSV A;  4I51 A;  4G26 A;  3CEQ A;  3BO5 A;  3MEK A;  1E90 A;  1ELW A;  5ANR A;  2J4D A;  1N3J A;  3JUI A;  1HZ4 A;  4J8S A;  3Q15 A;  1GW6 A;  2PQR A;  3CHM A;  1IQU A;  3CIA A;  4JVS A;  2DBA A;  3UPV A;  1KLX A;  4UWG A;  1N6A A;  2L6J A;  4CDN A;  2OOE A;  3OS5 A;  3RK6 A;  1MUF A;  5ANL A;  2J9Q A;  4I1O B;  1EYH A;  3QC1 A;  4OYS A;  4AIF A;  4U04 A;  2KAT A;  3FUK A;  3SWC A;  1MQS A;  4EZJ A;  2J09 A;  5AJD A;  3ENE A;  4I1M A;  4GCN A;  5CMY A;  3LS8 A;  4B8C B;  3AS8 A;  2V5F A;  3Q47 B;  3G2T A;  3ZYK A;  5JHN A;  3EIJ A;  4APO A;  2WXN A;  3MJW A;  3U3W A;  2AWI A;  5AEN A;  5BUZ A;  4UWK A;  2OVF A;  1Z6T A;  3M53 A;  3D9M A;  2WXF A;  3UX4 A;  3CGH A;  3OXG A;  1Y6I A;  1ELK A;  3OAW A;  3M58 A;  4E85 A;  3MV3 B;  5FQ4 A;  4O6F A;  4B94 A;  2JV0 A;  5C2Y A;  2FF4 A;  3MKQ B;  3APC A;  3B7S A;  3FFL A;  4G23 A;  1WY6 A;  4PUC A;  1HU3 A;  4WNE A;  1YA0 A;  3Q49 B;  4I6G A;  4UWF A;  1H3I A;  4ILH B;  2YNQ A;  2I2O A;  4MRU A;  3RRM B;  3CVW A;  1H2V C;  4GPK A;  4AM9 A;  3CBO A;  3UQ3 A;  2J08 A;  2R5S A;  3C98 A;  3MO2 A;  2GW1 A;  3L16 A;  3GW4 A;  3R9A B;  1NZN A;  3FEY A;  4JDS A;  4UI9 C;  3PE3 A;  3FUE A;  3SF4 A;  5LP0 A;  1INZ A;  3LY8 A;  4FAD A;  4DK5 A;  3UT8 A;  3UMV A;  3CK8 A;  4Q94 A;  1HH8 A;  2JEK A;  2OVB A;  3ZW3 A;  4FLH A;  4AEZ C;  4ANU A;  2VJ8 A;  3IHX A;  3I3N A;  4N5C A;  3M57 A;  2KCV A;  3HVE A;  3MYV A;  4ABN A;  4BWR A;  1IHG A;  3NZS A;  3EDT B;  1JPL A;  2QFC A;  3CHQ A;  4TUU A;  4DJA A;  4NVQ A;  5T0K A;  3FP3 A;  3I5P A;  3T5X A;  1S0P A;  3CKC A;  1A17 A;  3R7Q A;  1E7U A;  1N52 A;  3IHV A;  3CR3 A;  3MCX A;  4W9R A;  1L5J A;  2C2L A;  2WXG A;  3HYM B;  5G55 A;  5M72 A;  2WVI A;  3VLE A;  4FUL A;  5BV1 A;  5EX0 A;  2XGO A;  3K9I A;  3OXF A;  4C0M A;  3ZHE B;  3U66 A;  3B7T A;  4HOS A;  4NUR A;  4CRW A;  4JW1 A;  4A55 A;  4D10 C;  2WXQ A;  1O9S A;  3ASH A;  3BEE A;  3ZRH A;  2UY1 A;  1XQH A;  2WQ6 A;  3MX3 A;  4FHJ A;  4U0U A;  2XPI A;  3M54 A;  4CDM A;  1SZ9 A;  3UUX A;  3FTU A;  2C0M A;  2DCP A;  3D9O A;  2J49 A;  3MKR A;  2RG8 A;  4KVO A;  2ZU6 B;  4WNF A;  4I17 A;  4KXK B;  1UJK A;  4N2Q A;  3O48 A;  2A5U A;  2Q7F A;  4FLB A;  3FH5 A;  2X3M A;  3RO3 A;  5EKQ D;  3S7B A;  2W5Y A;  4JLG A;  3PUK A;  4JEU A;  4C9B B;  2I6H A;  1H19 A;  2J07 A;  2LSU A;  2X6F A;  1U3D A;  5T0M A;  1TJC A;  2QY7 A;  3G2V A;  1OWO A;  3D9L A;  3B13 A;  3RJV A;  3F9W A;  3OPE A;  3EJN A;  5ARF A;  4KMO A;  1MHQ A;  1NA3 A;  2WPV A;  4Q96 A;  3FUM A;  4Z4P A;  5KJK A;  5JJ7 A;  3E4B A;  2WB2 A;  5JJT A;  3CHO A;  3CV0 A;  3WXX A;  1H2U A;  4FJZ A;  4K03 A;  4J6I A;  3PE4 A;  3ZIM A;  3HIZ A;  5D0Q D;  3K5K A;  3PNL B;  4NRH B;  4PH4 B;  2XCC A;  3G2U A;  3CQG B;  3NZU A;  4UQZ A;  3TXM A;  3PS6 A;  2CHW A;  3FTX A;  3FH7 A;  3L22 A;  2JLB A;  1JWF A;  2WXM A;  4A3T A;  4EBA A;  4AY6 A;  2C0L A;  3KAE A;  2YHC A;  4H7Y A;  5BW8 C;  3CQC B;  3QNK A;  1BPO A;  1UJJ A;  2XEV A;  4RG9 A;  4UQX A;  1NA0 A;  4AV7 A;  4U8H A;  3QJZ A;  3GYZ A;  3IBE A;  4GAA A;  2I9C A;  3ZFW A;  3LPZ A;  1TEZ A;  4G11 A;  3QOU A;  5D0O D;  1JUQ A;  1XNF A;  4Y6W A;  2MHK A;  1H2T C;  3VLF A;  5BPP A;  5JIY A;  3F9Y A;  4J8F A;  3ML9 A;  2BTD A;  1HFA A;  3SGH A;  2GGF A;  1EDU A;  3DAL A;  4YPE A;  4L23 A;  5LCW C;  5EDS A;  3FUH A;  3M56 A;  2OV8 A;  1HO8 A;  1SZA A;  2HR2 A;  3D9I A;  4R7L A;  4KZ0 A;  1SQM A;  2KZT B;  5E76 A;  4ATG A;  2YQ8 A;  4L2L A;  2AXU A;  3APF A;  2UWJ G;  2WXJ A;  4EEC A;  3FEX A;  3PEV B;  3ONK A;  2R59 A;  4WAF A;  4JPS A;  2XGM A;  5CMW A;  4IJD A;  2MRI A;  1NP7 A;  3TL5 A;  1P5Q A;  4HXI A;  4WND A;  4LER A;  2VGY A;  3TJP A;  4AVX A;  4BSX A;  2VSX E;  5FJY A;  3U64 A;  4A3V A;  4KYO B;  3CVQ A;  2L0T B;  3P1U A;  1PEG A;  4JEH A;  3AS4 A;  3ZYQ A;  5FQ8 A;  2X38 A;  1VDY A;  4U0S A;  3APD A;  3CVX A;  3P2B A;  4FA6 A;  1KT1 A;  4KVM A;  3Q5M A;  4XKB A;  3S7J A;  3QB2 A;  3CHS A;  5TTF A;  4JXT A;  2ILR A;  4GYY A;  4GZ5 A;  3HNA A;  3ESL A;  5EG2 A;  2E2E A;  3FPD A;  2M63 A;  4DLQ A;  1UN9 A;  5BV0 A;  3RRN B;  2NSZ A;  3SW9 A;  4QEO A;  3DB5 A;  4I9C A;  4HOU A;  2RD0 A;  4KZC A;  4RVB A;  4APF A;  1PC2 A;  4AP2 A;  3CVV A;  3LVQ E;  1FVF A;  4H12 A;  1FVH A;  2E0I A;  5C1D A;  4JC8 A;  3FUD A;  2NC9 A;  3OTN A;  3ASD A;  3SNX A;  4AJW A;  3PRZ A;  2G46 A;  3FU5 A;  5T5G A;  4PS8 A;  3VTY A;  2VSN A;  1H0A A;  3OXL A;  3CLJ A;  3PUJ A;  2XPZ A;  4IN3 B;  4L2Y A;  5AIJ A;  4GB9 A;  5G04 C;  3DPD A;  5ENN A;  3AU4 A;  3UT4 A;  5CCM A;  2FO7 A;  4B0Z A;  3RJW A;  3S7F A;  2YHE A;  4GA0 A;  4IYP A;  1OWM A;  2BUG A;  3BG0 B;  1HG2 A;  3FUL A;  3LDZ A;  4YPU A;  3S8P A;  5LSZ A;  3CVU A;  2PL2 A;  4LRZ A;  2RFI A;  1UN8 A;  2A4Z A;  3PEU B;  3FUI A;  4UWL A;  4BTB A;  4CT0 A;  3G2W A;  3ZEF A;  4XI0 A;  4F3V A;  3L13 A;  3QWP A;  2WXL A;  4FJY A;  1HX8 A;  2AW6 A;  3TAX A;  4C0E A;  3M59 A;  4ANW A;  5BT1 A;  1HE8 A;  3FTS A;  1MVX A;  2BQZ A;  4V3I A;  3TXN A;  4Q69 A;  4O30 A;  2WXP A;  3FHE A;  3DBS A;  4PS3 A;  4ANX A;  4CGV A;  4BX9 A;  3FTY A;  4FHK A;  3IV0 A;  3LXU X;  4BUP A;  1PAQ A;  2VSO E;  4GMJ A;  3AS5 A;  4BT8 A;  1WM5 A;  3IKO B;  4QFV A;  4J0U A;  3L08 A;  3IHY A;  4N39 A;  5T4Y A;  4WWO A;  4ACL A;  3SBS A;  3HHM A;  3I4R B;  4PS7 A;  3JYS A;  4MLP A;  4H7X A;  1HXI A;  2CG2 A;  2IFU A;  3VLD A;  4RSY A;  5FQ6 A;  4J8O A;  3CHR A;  3CHP A;  4JA7 A;  4EZK A;  2YIN A;  1IQR A;  1ZBP A;  5LFA A;  4WUY A;  4C1Q A;  3QK0 A;  4IRU A;  4TRQ A;  5A7D B;  5F59 A;  2V0P A;  2L0I A;  2NXP A;  2WMO A;  3EHN A;  3TG5 A;  4YPA A;  3RQ4 A;  4NAC A;  1HG5 A;  4UI9 J;  3TG4 A;  3CVP A;  5FQ7 A;  3MO5 A;  1FCH A;  2X6J A;  5E75 A;  4GA1 A;  4YVQ C;  2CFZ A;  4OVU A;  4N2S A;  4J8D A;  5G05 C;  1ML9 A;  5F6K C;  4EZL A;  4QEN A;  4YVO A;  5FWQ A;  1IYG A;  4JHR A;  4I6E A;  4YND A;  1Z3X A;  3I4G A;  3PNT B;  4MKT A;  4N3C A;  3UT7 A;  4NJ5 A;  2V8S E;  4WWP A;  4EPZ A;  3CKB A;  3KS2 A;  3ZVV A;  5A6C A;  2QPW A;  3KMA A;  3M5A A;  3KMT A;  4Y6C A;  2ION A;  5KCM A;  5LOZ A;  2WM9 A;  3L17 A;  1KT0 A;  3ZYL A;  2IGQ A;  3QKY A;  1LF8 A;  3JQ1 A;  4GCO A;  2PZI A;  5JJ0 A;  1HF8 A;  2IF4 A;  2VTB B;  4IJ8 A;  3CBP A;  4GZC A;  3PRE A;  1PY1 A;  4CT4 A;  1E8W A;  4RG6 A;  2Y4T A;  2I1J A;  5FT9 A;  3FTZ A;  2X6K A;  3LCA A;  3QWW A;  4L7T A;  4J7F A;  3ESK A;  4WWN A;  5TEG A;  4AU7 A;  2XGS A;  4DI4 A;  5J08 A;  2X6I A;  2XRZ A;  3PZD A;  4ILG A;  3B7R L;  4A1S A;  5JHA A;  3CVN A;  3FTV A;  3D9P A;  2HM8 A;  2CG3 A;  1MT6 A;  4HOR A;  1E8Z A;  4M3O A;  3N71 A;  2Y4U A;  2WXK A;  4XZ4 A;  3ZHE A;  4E6H A;  1DNP A;  4GZ3 A;  2AXZ A;  4EQF A;  3RAY A;  4EBA G;  2J4B A;  4JHJ A;  3QAQ A;  4I43 A;  3SBT B;  5AYF A;  4KT6 B;  3OOI A;  2PM6 A;  2XPY A;  2VGX A;  4GML A;  4XI9 A;  2R3A A;  4ANV A;  1QZ2 A;  1E96 B;  4I6J A;  4UQY A;  3R7R A;  3CVL A;  3EHM A;  3MZL B;  4ILI A;  2F69 A;  1OWN A;  2AVP A;  3FU0 A;  3S2A A;  5G04 J;  2CHX A;  2VSY A;  3JQ0 A;  1E7V A;  3LJ3 A;  4JA9 A;  3ULQ A;  5LSX A;  3PVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...