5ARGA

Smyd2 in complex with sgc probe bay-598
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
426
structure length
426
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 151
structure length 426
sequence length 426
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5argA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5argA01
3QWWA 3E4BA 4EQFA 3RJWA 4XI9A 4H12A 3RQ4A 3SF4A 1Y8MA 3TG5A 3MV2B 3EP0A 4YVQC 3RAYA 5JJTA 3OOIA 4F3VA 3DALA 5FZRA 2HYZA 4WNDA 3CVLA 4LEUA 4WUYA 3MV3B 4N5CA 4O6FA 3FP3A 5AYWD 3AS5A 4HOQA 2UY1B 3ZFWA 5LCWC 3S8PA 4GZ3A 3CVNA 5D0QD 4N3CA 4LDGA 4KYOB 4YPAA 4Y6WA 5F59A 3M55A 4MI5A 4I1AA 3O48A 3S7FA 4QEPA 4CDRA 5M72A 4NVQA 2LSVA 3ULQA 2OOEA 5DBKA 4AY6A 3LY7A 3SW9A 3GW4A 4H7XA 2KCVA 4IN3B 3KMTA 4GPKA 4I9EA 5KJLA 4UQXA 3KMAA 4ABNA 3ASDA 5T0KA 3K9IA 4HOUA 2C0MA 2C0LA 3KAEA 3RKVA 4WNGA 4N39A 4HOSA 2VQ2A 2XGSA 3PDNA 4GZ5A 3M59A 5AYFA 4U07A 2XGMA 5EG2A 1O9SA 5KJMA 4G23A 2QPWA 3OPEA 3Q15A 4U0ZA 1KLXA 3S7DA 4UI9J 4J7IA 1QZ2A 3GZ1A 3LCAA 5FZQA 3OS5A 1W3BA 4CGVA 4GA0A 3QOUA 3ZPJA 3CBPA 5KJKA 3OXGA 2JLBA 3FWVA 4NJ5A 5C1DA 4Z4PA 2XGOA 4NQ0A 3CBMA 5JINA 5CPRB 3MKRA 4ME2A 2FO7A 5A6CA 3M5AA 3MO5A 1XNFA 5JHNA 4UQZA 2KC7A 4IJ8A 4H7YA 2L6JA 4YPUA 5G05J 3CV0A 1NZNA 3GYZA 4GZ6A 2QFCA 3QKYA 5F6KC 4JL0A 1KT1A 3VTXA 1A17A 2UY1A 5A7DB 1ML9A 2XPIA 2VGYA 4XI0A 2W5ZA 3OXLA 3Q47B 5JJ6A 4AIFA 1WM5A 3NF1A 4NRHB 2G46A 4QENA 5BW8C 3RJVA 4KXKB 4UI9K 5JIYA 5CCMA 4GCOA 3KD7A 3LPZA 1ZKKA 5LSZA 4J7FA 4A1SA 4YPEA 2GW1A 3DB5A 2XCBA 3ZHEA 3Q49B 4UI9C 4APOA 1ZU2A 1MUFA 3RO2A 5TTFA 3SWCA 5HI7A 3IHXA 4JDSA 3LYAA 1H3IA 1HH8A 2NC9A 2XEVA 2O8JA 2BQZA 4KBQA 2Q7FA 3CBOA 3QWPA 4N2SA 3CKBA 4HORA 3LY8A 4I2ZA 4GYWA 4WNEA 5ARFA 4RG6A 3U3WA 1MT6A 1N6CA 4IJDA 4J8OA 5JJ7A 5CCLA 3MA5A 2VGXB 3HNAA 5TH7A 2F69A 4JA9A 4XIFA 3CVPA 4GA1A 3PE3A 1IYGA 1B89A 3BO5A 5EX0A 2C2LA 1ELWA 5G05C 2I6HA 2LSUA 2KCLA 2MHKA 4Y6CA 3R9AB 5FTPA 3VV0A 3VTYA 1HZ4A 3HYMB 2VSYA 4CGWA 4BT9A 1PC2A 2RFIA 1P5QA 2PQRA 4YNDA 3RO3A 3S7BA 3S7JA 5KJNA 4J8DA 5LCWJ 5F6LA 4GA2A 4G24A 4BWRA 3M56A 3ASFA 3F9XA 1NA3A 2PZIA 2LNIA 3K5KA 3CVQA 3EDTB 3BEEA 4O30A 3MO0A 2UWJG 3PE4A 3U4TA 1IHGA 2P58C 4G2VA 5HQ8A 4BTAA 5TEGA 1TJCA 2PQNA 4FMUA 1E96B 2IGQA 4G25A 4J0UA 5CHEE 2R5SA 2KCKA 2FF4A 3F9YA 4MI0A 3M57A 2AVPA 4YVOA 3AS8A 5D0OD 3TGOA 4AM9A 2HR2A 3Q4AB 4G26A 4RZ0A 2VSNA 3RIBA 3ZN3A 2Y4UA 2FEZA 2ONDA 5FZSA 3UQ3A 3UUXA 5F5EA 4E47A 1HXIA 1ZBPA 3M54A 5G04J 1MVHA 2DBAA 4N2QA 5JJ0A 1YA0A 3N71A 4AU7A 2PL2A 3TAXA 4I2WA 4YNPA 4GCNA 3ASHA 4J8FA 4W9RA 2VGXA 3M53A 4BT8A 5LSXA 2R3AA 3MO2A 2FI7A 3F9ZA 4U0UA 2J9QA 1XQHA 2IFUA 1WAO1 3LY9A 4I9CA 3MEKA 2YHCA 4I17A 3KS2A 2JV0A 5FJYA 3ZHEB 2FBNA 3ASGA 2V5FA 1NA0A 2VYIA 5T0MA 1N6AA 3QDNA 3OXFA 4U04A 4I51A 4N3AA 3CK7A 3ZGQA 3QWVA 3FPDA 4C1QA 5DIZA 4BTBA 4B94A 3WXXA 3LKUA 2BUGA 4U0SA 4JLGA 2W5YA 5T5GA 4JHRA 3CK8A 5BT1A 2XCCA 3VUZA 4HOTA 1KT0A 3RU0A 3F9WA 3FFLA 4N3BA 2Y4TA 1OUVA 3CKCA 3CEQA 5ARGA 4BUPA 3JYSA 5FT9A 2YQ8A 3M58A 3KMJA 5G04C 3UPVA 4WNFA 4AY5A 4G1TA 3URZA 1PEGA 2IF4A 4YNMA 2KATA 4QEOA 3SZ7A 1MVXA 3TG4A 4GYYA 1N3JA 4JA7A 2HO1A 4J83A 4J8EA 4UQYA 5EX3A 2E2EA 2WQHA 3AS4A 4RG9A 1QQEA 3Q5MA 5BNWA 2WPVA 4GYOA 3GZ2A 1ELRA 5EKQD 1FCHA 3IEGA 3CK9A 3ESKA
chains in the Genus database with same CATH superfamily
3QWWA 3VLFA 3T5VA 4YDOA 4O1PA 3IHYA 3FU3A 5JJTA 4F3VA 5FZRA 2HYZA 2P9IG 5BV1A 1D8DA 3FP3A 1DCQA 1K8KG 2WXGA 5AYWD 3EIJA 2QY7A 4N3CA 3ABKE 4MRUA 2VTBA 2DYRE 4ZHBA 2Y69E 5M72A 5AARA 1SA4A 3L16A 1KPSB 5KNHD 3LVRE 2F8YA 4IULA 3DXMG 2LXLA 4GTVA 3ML9A 5LOZA 5AJLA 4JD2G 3EHMA 5EYPF 3K9IA 3MKQB 3B7BA 4L2YA 3E37A 4CT4A 1N4RA 3G2TA 4HOSA 4GZ5A 4GZDA 1SA5A 2XZDG 3UM3A 3DSSA 2WMOA 5AAOA 2AWIA 3ZIMA 2QPWA 3NZSA 1EPUA 2WVIA 1HS6A 3GZ1A 3LCAA 5JMND 3FEYA 2AXUA 4KZ0A 3OS5A 1JCSA 2ZXWE 3TL5A 4GA0A 3PRZA 3V79K 3QOUA 4EPZA 3CBPA 4JVSA 3FTSA 3B7TA 3OXGA 3FWVA 3T9KA 3ZXPA 5C1DA 3CHQA 1MJ0A 2ILRA 1BI7B 3SFZA 3UM1A 1PAQA 3NAWA 3UIOC 3FU0A 4J6IA 2WQ7A 1LTXA 4DI4A 3JQ1A 5JHNA 4MKTA 5CEDB 3GYZA 2IO2C 4GZ6A 1MQSA 5CBNA 3ZUVB 1NI1A 1KT1A 3ZVVA 2XPIA 3PZ3A 1V54E 3L54A 2CHXA 5A23A 4FULA 3Q7AA 1IXVA 4HXIA 3D9KA 4I6EA 4KXKB 5JIYA 4N5QA 3TXNA 4APOA 2LUHA 3TWVA 1MUFA 3RO2A 4FLHA 1H3IA 2BQZA 1IQUA 3WG7E 3QWPA 2OEWA 2WM9A 2A5EA 4L9PA 3CHRA 3J5QB 3NQPA 1BPOA 4IJDA 2X3MA 4J8OA 2ETAA 1N4QA 3HNAA 2IY0C 2F69A 4U8VD 3FTVA 3NZUA 3CVPA 4GA1A 1B89A 3BO5A 3OTNA 1ELWA 3TWQA 2KCLA 1N94A 3UM2A 4O60A 3SNXA 2V8SE 1LD8A 2VSOE 3VV0A 3VTYA 2ZU6B 4WWPA 1OCOE 4ILGA 1WDYA 4G11A 3HYMB 2VSYA 4YDEA 3TWSA 1PC2A 4J8DA 5LCWJ 4IRUA 2VSXE 3FEXA 1NL4A 5ENQD 5AQ7A 4B0ZA 3AU4A 1MX2A 1K1AA 3G2WA 4MBGA 3CVXA 2OCCE 3D9MA 3LVQE 3HXEA 3QB2A 3K5KA 4BERA 4U8YD 2J49A 3U4TA 5B3SE 3DWLG 3FDHA 2P58C 3CQGB 4I1OB 5HQ8A 1OWOA 2AXZA 2PQNA 4GMLA 4K03A 4A3TA 5CHEE 2R5SA 5ENRD 2FF4A 4HNAD 3FULA 4DLQA 5CBOA 3PH0C 2XEHA 3R7RA 4WWNA 4JC8A 3ZKJA 2VSNA 1TNYA 1UJJA 5ENPD 3NBNB 1EF1C 3ONLA 5F5EA 4RLYA 1KZOA 5G04J 4U7EB 3V2OA 1Y6IA 3LXUX 5JJ0A 1YA0A 4AU7A 4GCNA 4U8HA 3TWRA 4DX2A 1NP7A 2YHEA 5LSXA 4JEHA 3EJNA 1S0PA 3D9HA 1D8EA 4AV7A 4UWLA 1N9AA 3Q9NC 1LF8A 4CDMA 2FBNA 3ZHEB 4GMRA 5BV0A 5T0MA 4XKBA 3DRAA 1N6AA 3D9JA 1JPLA 2WXIA 3CK7A 3ZGQA 2RFMA 2P9NG 3WXXA 4CRWA 3QNKA 2BUGA 4U0SA 3ZYMA 2P9PG 3AG1E 5BT1A 2I1KA 3VUZA 2FO1E 4DX1A 3IHVA 3U66A 3FUDA 4UWKA 3KSQA 4BUPA 5FT9A 4F6RD 1TYQG 4I43A 2EIJE 3JUIA 1TNZA 2RKKA 4AY5A 4FC8A 4FLBA 4U96D 4HRNA 1PEGA 4I6GA 2KBXA 1TJFA 3FUKA 3SZ7A 1MVXA 4DK5A 3W9GA 3UINC 3TG4A 4GYYA 4J7WA 1N3JA 2IEJA 2HO1A 4LRZA 5D66A 4UQYA 1H6OA 1UW4B 4RG9A 1E7UA 3QAQA 2WPVA 3DSVA 5EKQD 4LERA 4FP7A 3MX3A 3SF4A 3D3MA 2CHZA 3TG5A 3L82A 3KEZA 3OOIA 3DALA 4GMJA 4Z68A 3W9FA 4WNDA 1TNBA 2EIME 2DZOA 2BEDA 1X81A 2BF0X 2X6FA 4O6FA 2R17C 3ML8A 3S2AA 1HF8A 3ZFWA 5LCWC 3RAUA 3KSLA 3ASNE 2YINA 3KEAA 4BETA 2R03A 1N0RA 4YPAA 2CFUA 1IKND 3M55A 4MI5A 4GZCA 1OY3D 3S7FA 3FTXA 4CDRA 2LSVA 1N4PA 1E8WA 2H6GA 2V5QC 2QZAA 2KCVA 3Q7FA 4YDWA 1SZ9A 4OYSA 2WMNA 3ESLA 2ZGGA 4N39A 2XGSA 4FU3A 5AYFA 4U07A 2Y0BG 5KJMA 3D9OA 5H7PA 4ANVA 1KLXA 4EHMA 1UJKA 2E0IA 1W3BA 3ZPJA 5ANRA 5T4YA 2OV8A 4F53A 3BG1B 5JHBA 1OWMA 4NJ5A 4AP2A 1GW6A 4PS8A 5JINA 3CBMA 1L5JA 5CPRB 4GPMA 5FQ4A 3L13A 4AXHA 2QYUA 4GTOA 3SBTB 3TXMA 3V2XA 2VGEA 4UQZA 4GAAA 2KC7A 4BEPA 1H6PA 4H7YA 1E8ZA 4YPUA 2HM8A 3RRMB 3HDXA 3QARA 4ATGA 3QKYA 3Q73A 3FH5A 4GTTA 4KT6B 4JL0A 2KXPC 3VTXA 4AEZC 4FHKA 2I9CA 3TWTA 5A7DB 3UIPC 4C9BB 3OXLA 3L22A 3ABLE 1WM5A 3NF1A 4NRHB 3RJVA 4UI9K 5CCMA 1RW2A 4GCOA 3LPZA 4OVVA 4LNUD 5LSZA 1H2TC 1FVFA 3G2VA 3SFXA 3UX4A 4A1SA 3QJZA 4J7FA 2GW1A 2XCBA 3ZHEA 1ZU2A 3ZYLA 3APFA 2H6IA 3IHXA 3LYAA 4XE0A 4AJWA 3HHMA 3CBOA 1OWPA 3CKBA 4PS7A 5LFAA 4RG6A 1N6CA 1H0AA 4GTQA 5CCLA 5BPPA 2JABA 3AAAC 3MA5A 3FHEA 2GRQB 4JA9A 4XIFA 2WXQA 3LEWA 4B8CB 3PE3A 1IYGA 1UOHA 5EX0A 4KVMA 2ETCA 5G05C 3AJIA 2LSUA 2MHKA 1PY1A 4L2LA 5FTPA 3VLEA 3LS8A 1KZPA 1MHQA 4BSXA 4LNGA 2WXLA 2PQRA 4YNDA 3RO3A 3JUEA 1E90A 1HX8A 4LNBA 1JCQA 4GA2A 4G24A 3F9XA 4JW1A 1NA3A 5J90A 3ZRHA 5CERB 3FY4A 3OAWA 4XX5A 1BI8B 5IY5E 3EHNA 3FUHA 3LJ3A 1SW6A 5LX8A 3BU8A 4G2VA 2V0PA 3PEUB 4K5AB 1E8XA 1TJCA 1E96B 2P2CP 5BXOA 1EDUA 2KCKA 3U64A 3M57A 1SQMA 3SO8A 4EZKA 1Z3YA 4AM9A 2HR2A 1IHBA 4RZ0A 3RIBA 5ENOD 4PS3A 2Y4UA 4X8QA 3I3NA 2FEZA 4GTRA 4A63B 1HXIA 1ZBPA 3ZW3A 5CECB 3DSUA 2QC9A 4N2QA 2LO6A 4YDYA 4YNPA 3FTYA 3ASHA 4J8FA 3ZXSA 5HRYA 5FIOA 4BT8A 4C0EA 3AG4E 4HB5A 2XRZA 1BU9A 3F9ZA 4ACKA 1AWCB 3EIQC 1XQHA 4HBDA 1QYMA 1WAO1 4I9CA 3MJWA 3FTZA 1ZB1A 4I17A 3ABME 5FJYA 1VDYA 3EHQA 1NA0A 5EYLA 3CQCB 3QDNA 2Y3AA 4I51A 4N3AA 4AVXA 2J4DA 2WB2A 4C1QA 5DIZA 2EIKE 5KCMA 4XEIG 4BTBA 2B0OE 3TJPA 3TWWA 4DLOA 2M63A 4JLGA 2MRIA 2W5YA 3VLDA 4JHRA 2XCCA 1S63A 4ANXA 3GZSA 4HOTA 3RU0A 3FFLA 4ATZD 4M7CA 3CIAA 1OUVA 2RG8A 4ILHB 3CEQA 1E8YA 2J8SD 3DEPA 4BFRA 3HIZA 2MYOA 3ENEA 3M58A 3KMJA 1OT8A 2R02A 2KM4A 3PVLA 4YNMA 4UWFA 4P29A 2XHEA 4QEOA 4A1GA 2DWZA 3JXJA 5BXUA 3ONKA 2P9UG 1JCRA 4J8EA 2LAHA 5EDSA 4DX6D 3HXFA 2E2EA 5FINA 5HS0A 4JZYA 1LD7A 2DVWA 4FJYA 3Q5MA 1A5EA 3GZ2A 1FCHA 3R9MA 2JEKA 3PZ4A 2IO3C 1WG0A 1N95A 4B93B 1SZAA 4DI3A 3D9IA 2ZGDA 4EQFA 4XI9A 4H12A 3AG2E 3MV2B 4YVQC 4HLLA 1H6KA 4Q69A 4LEUA 3CSTA 3MV3B 4N5CA 3SQVA 2DCPA 2OVFA 2WXHA 4CCAA 1S64A 3JQ0A 3AS5A 3AU5A 5ANLA 3S8PA 4GZ3A 1JWGA 2PM7A 1YYHA 2VJ8A 1U3CA 4Y6WA 5F59A 3TWXA 3MYVA 3APCA 4I1AA 3O48A 2L6BA 3E32A 4LSZE 2NXPA 3C3OA 3Q79A 2OOEA 1MX6A 4JEUA 3I4GA 2J4BA 3C3RA 4L23A 3KMTA 4GPKA 5KJLA 2XZTG 4UQXA 3KMAA 4ABNA 3ASDA 4HOUA 4U63A 3KAEA 3I4RB 3ZYQA 2XS1A 3RKVA 4ILIA 1MX4A 1TNOA 3M59A 2B6CA 3BG0B 3AG3E 5EG2A 5HKPA 1TEZA 3Q15A 4U0ZA 5BUZA 1QZ2A 3L6AA 4Q96A 5FZQA 3D9NA 2CFZA 4BESA 3L9TA 2XGOA 4IYPA 5EN5D 4GU5A 4LCTA 2Y1LE 2FO7A 5AQ9A 1XNFA 2L6JA 5G05J 2EILE 1NZNA 2IOSA 3MGBA 1DC2A 2EQXA 2FULA 4CT0A 1NFIE 1YCSB 4JPSA 2WXFA 3HXBA 1A17A 2UY1A 2F8XK 2DYSE 3P2BA 2VGYA 4XI0A 2W5ZA 3NB2A 3Q47B 4AIFA 1D9SA 3UKRG 2G46A 2A4ZA 4FJZA 3E30A 2PM6A 4O1OA 2J09A 3KD7A 3DSTA 1DVPA 3CVWA 1ZKKA 4A3VA 4R7LA 4YPEA 3DB5A 2XRYA 4UI9C 1YMPA 1INZA 5TTFA 5HI7A 2RFAA 4JDSA 3FTWA 3DSWA 2NC9A 2XEVA 2O8JA 3E34A 3CHSA 2X38A 4CEMA 4KBQA 2Q7FA 4I1MA 3FUEA 3UXGA 3LY8A 4I2ZA 2IOLA 4GYWA 4WNEA 5ARFA 3U3WA 4APFA 1SVXA 2V4HC 3B13A 5E76A 5JJ7A 5AQBA 5TH7A 3BQOA 3HG0D 3SBSA 1Z5SC 2HE0A 4F7AA 2RD0A 2J07A 4JB8P 5FQ6A 4F1PA 2C2LA 3R7QA 3FH8A 4K5CA 2I6HA 4Y6CA 4RVBA 1HE8A 5ENTD 1HZ4A 4URKA 4FHJA 1O5MA 5G2NA 1X5BA 4CGWA 4J8SA 4BT9A 2RFIA 3RRNB 4HI9A 3S7BA 3S7JA 5C2YA 3ULYA 3MZLB 1UG3A 2XENA 1MYOA 1ELKA 4GB9A 5FWQA 4QQIA 4PUCA 4L1BA 4DJAA 1FT1A 1HG5A 5AJDA 2LNIA 3CVQA 3EDTB 3ZEFA 3Q75A 4E6HA 1OWNA 3BEEA 3MO0A 2ZIRA 3CLJA 2UWJG 4C48B 2WQ6A 4ZFHA 2MOWA 1RZ4A 2AJAA 3P1UA 2IGQA 4J0UA 2X6IA 4MI0A 3FU6A 4E85A 2IU1A 1N11A 4G26A 4M3OA 4I6JA 3G2SA 3CHOA 3PEVB 2ONDA 3UUXA 5FZSA 3UQ3A 4E47A 5ENNA 1H19A 3M54A 4EBAG 2V4LA 1MVHA 4BX9A 3EU9A 4OVUA 2DBAA 2BTDA 4BX8A 2PL2A 5KBAA 4I2WA 4HI8A 3CVUA 2X6HA 2CHWA 2F37A 3B7SA 3RSEG 2VGXA 4G8LA 4W9RA 3M53A 4AOFA 1XGWA 4TXQA 5FQ7A 4ANUA 2X6JA 4V3IA 2FI7A 3IKOB 4U0UA 2AW6A 2GRPB 3D9PA 3MEKA 2YHCA 4L7TA 3KS2A 2IJGX 1OWLA 2F0YA 3C3QA 3OXFA 2DZNA 3EU5A 4WAFA 2WXJA 3FPDA 5ITZF 4B94A 2GROB 3LKUA 5AENA 3EHRA 3C72A 3L17A 3IBEA 2XS8A 5B1BE 3CSFA 2YNQA 3CGHA 1AP7A 3HXDA 4KMOA 2Y4TA 3CKCA 2WXRA 3JYSA 2GGFA 3UPVA 3JCKC 2EINE 4WNFA 3DPDA 3PUKA 2KATA 2P9KG 3PZ2A 3JXIA 1OXJA 1K1BA 2I2OA 4F1SA 4MLPA 2ETBA 1H2VC 4HVBA 1TNUA 2ZISA 3FUIA 2WQHA 2L0IA 4EZLA 4HS2A 4GYOA 5KWDA 1ELRA 3T8MA 3IEGA 3CK9A 3E4BA 3HVEB 3RQ4A 3RJWA 3IV0A 1Y8MA 4MS6A 3EP0A 3V30A 3RAYA 2GRRB 3CVLA 4TV3A 4WUYA 1JWFA 2LXMA 4HOQA 5CEAA 2UY1B 3CVNA 3PNTB 5D0QD 2XPYA 4LDGA 1MZCA 3PUJA 1TR4A 4KYOB 3PZDA 4TUMA 2H6HA 4DPRA 2J08A 2L9BA 3B7RL 4QEPA 4NIKA 1JUQA 4NVQA 3ULQA 3APDA 5DBKA 4AY6A 2KZTB 3LY7A 3SW9A 1UN8A 3GW4A 1OCZE 3SI5A 4H7XA 4IN3B 3Q78A 4I9EA 1Z3XA 3J5PA 5T0KA 5LP0A 2C0MA 2GRMA 4DX7D 2C0LA 1S70B 3ZU7B 4WNGA 4CDNA 1U3DA 2WXNA 2VQ2A 3PDNA 3NOCD 4HQDA 4K0RA 1O1TA 2WXOA 1QBQA 2XGMA 1O9SA 4WWOA 3DPYA 4G23A 3OPEA 1HU3A 3CVVA 1U2VG 4C0MA 3S7DA 4UI9J 3O4ZA 4Q94A 4J7IA 4B89A 2L0TB 5B1AE 3UM0A 1OCRE 1TN7A 4JHJA 1HO8A 4CGVA 3FUNA 5KJKA 2JLBA 1O1SA 4Z4PA 4HRLA 4GTPA 4NQ0A 3UKUG 2QYJA 3MKRA 3SD5A 2P9SG 4ME2A 3ZNGA 5A6CA 1N4SA 4HFGA 1TN8A 3M5AA 3MO5A 4IJ8A 3CV0A 5G55A 2QFCA 3UT7A 5JHAA 5F6KC 5T3RA 4GTMA 4A55A 1ML9A 2R05A 3L08A 5JJ6A 2PNNA 4QENA 4PDXA 5BW8C 4B8AA 3FUFA 2CG2A 1G3NB 3B95A 4HLEA 3MCXA 1O1RA 4LUNU 4RQIA 4UUCA 3UT4A 3Q49B 4DUIA 3SWCA 2P9LG 3T8KA 2CG3A 1HH8A 2H6FA 4UWHA 3CVYA 4OAUC 3F6QA 3SY2A 1BD8A 4N2SA 3UT8A 4HORA 1WY6A 2XQ0A 3ZYKA 4EBAA 4JXTA 1MT6A 3RK6A 2AXVA 3MKQA 3U9WA 4NACA 4QFVA 4TXPA 2LAIA 2VGXB 2I1JA 4BSZB 4UWGA 2VTBB 3HXCA 5CMYA 3B7UX 5CRVA 4ANWA 3FUJA 3R9AB 3UTMA 1Q2ZA 2IQCA 2OVBA 3EUVA 4LG6A 1E7VA 3X2QE 1P5QA 5KJNA 5F6LA 1N0QA 4BWRA 3M56A 3NOGD 1IQRA 4HRMB 3ASFA 3FTUA 5EILA 2PZIA 5AN8A 2X6KA 3BUAA 3FU5A 2XEEA 3TWUA 1N52A 4PH4B 3DBSA 3UI2A 3HVEA 4O30A 4TXRA 3SGHA 5CMWA 4D10C 3PE4A 1FPPA 3C5RA 1IHGA 4FA6A 4DRXE 2OEVA 4BTAA 5ENSD 5TEGA 5FQ8A 4FMUA 1FVHA 4G25A 4CZ2D 2GRLA 3LJNA 3F9YA 3FUMA 5EIBE 2AVPA 4YVOA 5AQAA 5D2MC 3AS8A 5D0OD 2WXKA 3TGOA 3Q4AB 4XKCA 3T5XA 3CHMA 4KVOA 2BKGA 3D9LA 3SHFA 3ZN3A 3RRUA 1QNFA 1TN6A 3PS6A 4TRQA 3UMVA 1UN9A 4TUUA 3I5PA 3PREA 3N71A 2WXMA 4FADA 3TAXA 2KZTA 3IXEA 4NURA 1H2UA 3QC1A 3DXKG 1OCCE 1DNPA 1Z6TA 1BLXB 2R3AA 3MO2A 4J8YA 2NSZA 2J9QA 2WXPA 3DSXA 2IFUA 3SFYA 4BY6A 2R59A 3LY9A 3V31A 5JA4D 2JV0A 3ASGA 2V5FA 2VYIA 2IONA 2NYJA 4U04A 2A5UA 4CYMD 2XPZA 5EIDA 4EZJA 4G8KA 3QWVA 3HRAA 4KZCA 2GRNB 4EECA 5E75A 5T5GA 3E33A 2DIWA 4XZ4A 4ACLA 3CK8A 3DEOA 3ULEG 5KNGA 3ASOE 3C98A 1KT0A 1HFAA 3F9WA 4N3BA 3CR3A 1N54A 5ARGA 2BKKB 5AIJA 3LDZA 2YQ8A 4JHKA 5CRUA 4DX5D 5G04C 1EYHA 1HG2A 1V55E 4G1TA 3URZA 3PNLB 2IF4A 3FH7A 4RSYA 4GTSA 1DCEA 4U95D 4OAVB 1K3ZD 5T8IA 3CHPA 4JA7A 4J83A 3QK0A 5EX3A 3AS4A 1QQEA 5BNWA 5J08A 3G2UA 3PZ1A 3ISMC 2R2LA 1FT2A 4K5BA 3Q9UC 3ESKA
chains in the Genus database with same CATH topology
3QWWA 3MX3A 1SZAA 4DI3A 3E4BA 3HVEB 3VLFA 3T5VA 3D9IA 4EQFA 3RJWA 4XI9A 4H12A 3RQ4A 3IV0A 3D3MA 3SF4A 1Y8MA 2CHZA 3TG5A 4MS6A 3MV2B 3IHYA 4YVQC 3EP0A 3RAYA 3FU3A 3KEZA 5JJTA 3OOIA 4F3VA 3DALA 4GMJA 5FZRA 2HYZA 4WNDA 1H6KA 3CVLA 4Q69A 5BV1A 4TV3A 4LEUA 4WUYA 1JWFA 3CSTA 2BF0X 2X6FA 3MV3B 4N5CA 4O6FA 2R17C 3ML8A 4CCAA 2DCPA 2OVFA 2WXHA 3FP3A 3JQ0A 2WXGA 5AYWD 3AS5A 3EIJA 4HOQA 4EBAA 3S2AA 2UY1B 1HF8A 3AU5A 5ANLA 3ZFWA 5LCWC 3S8PA 4GZ3A 2QY7A 1JWGA 2PM7A 2YINA 3CVNA 3PNTB 5D0QD 2XPYA 4N3CA 4LDGA 4MRUA 3PUJA 2VJ8A 1U3CA 4KYOB 3PZDA 4YPAA 4Y6WA 2CFUA 4DPRA 2VTBA 3M55A 5F59A 2J08A 4MI5A 4GZCA 2L9BA 3MYVA 3APCA 4I1AA 3B7RL 3O48A 3S7FA 4QEPA 3FTXA 4CDRA 1JUQA 5M72A 4NVQA 2LSVA 1E8WA 3ULQA 3L16A 3APDA 2NXPA 2OOEA 4JEUA 3LVRE 3I4GA 5DBKA 4AY6A 2KZTB 3LY7A 2J4BA 4IULA 4L23A 3SW9A 1UN8A 3GW4A 3SI5A 4H7XA 2KCVA 3ML9A 4IN3B 3KMTA 4GPKA 4I9EA 5LOZA 1Z3XA 5AJLA 5KJLA 4UQXA 3KMAA 4ABNA 3ASDA 5T0KA 1SZ9A 3EHMA 3K9IA 4OYSA 2WMNA 5LP0A 3ESLA 3MKQB 4HOUA 2C0MA 2GRMA 4U63A 2C0LA 3KAEA 4L2YA 3I4RB 3ZYQA 3RKVA 4CT4A 4ILIA 4N39A 4WNGA 3G2TA 1U3DA 4CDNA 4HOSA 2WXNA 2VQ2A 2XGSA 3PDNA 4FU3A 4GZDA 4GZ5A 4K0RA 3M59A 5AYFA 2WXOA 3BG0B 4U07A 2WMOA 2XGMA 5EG2A 1O9SA 5KJMA 2AWIA 4WWOA 3D9OA 4G23A 3ZIMA 2QPWA 3OPEA 1HU3A 3NZSA 4ANVA 4C0MA 3Q15A 4U0ZA 1KLXA 3S7DA 3CVVA 4UI9J 3O4ZA 4Q94A 1EPUA 4J7IA 5BUZA 4B89A 1UJKA 2WVIA 2L0TB 1HS6A 1QZ2A 3L6AA 3GZ1A 3LCAA 4Q96A 5FZQA 3FEYA 3D9NA 2AXUA 2E0IA 4KZ0A 3OS5A 4JHJA 1HO8A 1W3BA 4CGVA 3TL5A 4GA0A 3PRZA 3QOUA 3ZPJA 4EPZA 3CBPA 5ANRA 3FUNA 5T4YA 2CFZA 4JVSA 2OV8A 3FTSA 5KJKA 4F53A 3B7TA 3BG1B 3OXGA 2JLBA 3FWVA 5JHBA 1OWMA 4NJ5A 5C1DA 3CHQA 4AP2A 1GW6A 2XGOA 4Z4PA 2ILRA 4PS8A 4NQ0A 3CBMA 5JINA 1L5JA 5CPRB 4IYPA 3SFZA 3MKRA 3SD5A 1PAQA 5FQ4A 4GU5A 3L13A 4LCTA 4ME2A 2FO7A 4AXHA 3FU0A 4J6IA 5A6CA 3SBTB 3TXMA 2WQ7A 4HFGA 3JQ1A 4DI4A 1XNFA 3M5AA 3MO5A 4UQZA 5JHNA 4GAAA 2KC7A 4MKTA 4IJ8A 4H7YA 2L6JA 1E8ZA 5G05J 4YPUA 3CV0A 5G55A 1NZNA 3GYZA 2HM8A 2IOSA 3RRMB 3MGBA 3HDXA 4GZ6A 3QARA 4ATGA 2EQXA 2QFCA 3QKYA 3FH5A 3UT7A 1MQSA 2FULA 5JHAA 5F6KC 4KT6B 4JL0A 4CT0A 1KT1A 5T3RA 3VTXA 4FHKA 2WXFA 4JPSA 1A17A 4AEZC 3ZVVA 2I9CA 2UY1A 5A7DB 4A55A 1ML9A 2XPIA 3L54A 3P2BA 2VGYA 3L08A 4XI0A 2CHXA 4C9BB 5A23A 3OXLA 2W5ZA 3L22A 3Q47B 4FULA 5JJ6A 4AIFA 1WM5A 3NF1A 4HXIA 4NRHB 2G46A 4QENA 2A4ZA 4PDXA 3D9KA 5BW8C 4I6EA 4B8AA 3RJVA 4FJZA 3FUFA 4KXKB 4UI9K 2CG2A 5JIYA 2PM6A 5CCMA 2J09A 4GCOA 3KD7A 3TXNA 4HLEA 3LPZA 4OVVA 3MCXA 1DVPA 3CVWA 1ZKKA 4A3VA 4LUNU 5LSZA 1H2TC 1FVFA 3G2VA 4R7LA 3UX4A 4A1SA 3QJZA 4J7FA 2GW1A 3DB5A 4YPEA 2XCBA 2XRYA 3UT4A 3Q49B 4UI9C 3ZHEA 4APOA 1ZU2A 3ZYLA 3APFA 1INZA 1MUFA 3RO2A 5TTFA 3SWCA 4FLHA 5HI7A 3IHXA 4JDSA 3FTWA 3LYAA 4XE0A 2CG3A 4AJWA 1HH8A 2NC9A 2XEVA 1H3IA 3HHMA 2BQZA 2O8JA 1IQUA 3CHSA 2X38A 4CEMA 4UWHA 4KBQA 2Q7FA 3CVYA 3CBOA 3QWPA 1OWPA 2WM9A 4I1MA 4N2SA 3CKBA 3FUEA 3UT8A 4HORA 1WY6A 2XQ0A 3LY8A 4I2ZA 2IOLA 3CHRA 4GYWA 4PS7A 4JXTA 3NQPA 4RG6A 4WNEA 5ARFA 4APFA 5LFAA 3U3WA 3RK6A 1BPOA 2AXVA 1H0AA 3MKQA 1MT6A 2X3MA 1N6CA 4IJDA 3U9WA 4NACA 3B13A 4QFVA 4J8OA 5E76A 5JJ7A 5CCLA 5BPPA 2LAIA 3MA5A 2VGXB 3HNAA 5TH7A 3SBSA 2I1JA 3FHEA 2F69A 4F7AA 4JA9A 3FTVA 4XIFA 2WXQA 3LEWA 3NZUA 4B8CB 2RD0A 4UWGA 2J07A 3CVPA 4GA1A 3PE3A 1IYGA 5FQ6A 2VTBB 1B89A 3BO5A 3OTNA 5CMYA 5EX0A 2C2LA 4KVMA 1ELWA 3FH8A 5G05C 3R7QA 2I6HA 3B7UX 2LSUA 2KCLA 4ANWA 3FUJA 3SNXA 2MHKA 2V8SE 4Y6CA 3R9AB 4RVBA 1PY1A 4L2LA 5FTPA 2VSOE 3VV0A 3VTYA 3VLEA 3LS8A 1HE8A 2IQCA 2ZU6B 4WWPA 1HZ4A 4URKA 4ILGA 2OVBA 4FHJA 4G11A 3HYMB 5G2NA 2VSYA 1MHQA 1X5BA 4BSXA 4CGWA 1E7VA 4J8SA 4BT9A 1PC2A 2WXLA 1P5QA 2RFIA 2PQRA 4YNDA 3RRNB 3RO3A 3S7BA 3S7JA 5KJNA 4J8DA 5LCWJ 1E90A 5C2YA 4IRUA 5F6LA 2VSXE 3FEXA 1HX8A 1UG3A 3MZLB 3ZYKA 4GA2A 4G24A 4BWRA 3M56A 4B0ZA 1ELKA 4GB9A 1IQRA 3ASFA 3FTUA 3AU4A 3F9XA 4JW1A 1NA3A 5J90A 5FWQA 2PZIA 2X6KA 3G2WA 4PUCA 3CVXA 4L1BA 4DJAA 3ZRHA 3FU5A 1HG5A 3D9MA 3FY4A 3LVQE 3OAWA 4XX5A 3QB2A 5AJDA 2LNIA 3K5KA 3EHNA 1N52A 4PH4B 3CVQA 3EDTB 3ZEFA 3FUHA 4E6HA 2J49A 3DBSA 1OWNA 3BEEA 3HVEA 3LJ3A 4O30A 3SGHA 5CMWA 5LX8A 4D10C 3MO0A 3CLJA 2UWJG 3PE4A 3U4TA 1IHGA 4FA6A 2WQ6A 3FDHA 2P58C 4G2VA 2MOWA 2V0PA 3CQGB 3PEUB 1OWOA 2AXZA 4I1OB 4BTAA 5HQ8A 5TEGA 1E8XA 5FQ8A 1TJCA 2PQNA 4GMLA 4FMUA 1E96B 3P1UA 4K03A 2IGQA 1FVHA 4G25A 4J0UA 4A3TA 5CHEE 2R5SA 2GRLA 1EDUA 2KCKA 2FF4A 3U64A 2X6IA 3FULA 4DLQA 3F9YA 4MI0A 3FUMA 3PH0C 2AVPA 1SQMA 4YVOA 3M57A 3FU6A 4EZKA 4E85A 1Z3YA 3R7RA 4WWNA 3AS8A 5D0OD 2WXKA 3TGOA 2IU1A 2HR2A 3Q4AB 4AM9A 4G26A 4JC8A 4XKCA 4M3OA 3T5XA 4RZ0A 3CHMA 2VSNA 3RIBA 4KVOA 4I6JA 3G2SA 3D9LA 4PS3A 3SHFA 3ZN3A 1UJJA 2Y4UA 3CHOA 3RRUA 3I3NA 1QNFA 2FEZA 2ONDA 3PEVB 5FZSA 3UQ3A 1EF1C 3ONLA 3UUXA 1HXIA 5ENNA 5F5EA 4E47A 1H19A 3PS6A 1TEZA 1ZBPA 4EBAG 2V4LA 3M54A 4TRQA 5G04J 3ZW3A 3UMVA 1MVHA 4BX9A 4OVUA 1UN9A 1Y6IA 3LXUX 4TUUA 2DBAA 3I5PA 3PREA 4N2QA 2BTDA 4BX8A 1YA0A 5JJ0A 3N71A 4AU7A 2WXMA 2LO6A 2PL2A 4FADA 3TAXA 2KZTA 4I2WA 4YNPA 4GCNA 4U8HA 2X6HA 2CHWA 3CVUA 3FTYA 3ASHA 3B7SA 4J8FA 4NURA 3ZXSA 1H2UA 3QC1A 2VGXA 1NP7A 4W9RA 3M53A 2YHEA 1XGWA 5FQ7A 4AOFA 1DNPA 4BT8A 4C0EA 5LSXA 4JEHA 3EJNA 1S0PA 1Z6TA 4ANUA 2XRZA 2X6JA 2R3AA 3MO2A 4V3IA 2FI7A 2NSZA 3IKOB 2J9QA 4U0UA 4ACKA 2AW6A 2WXPA 3EIQC 3F9ZA 1XQHA 2IFUA 4AV7A 4BY6A 1WAO1 4UWLA 2R59A 3D9PA 3LY9A 3MJWA 3MEKA 4I9CA 2YHCA 4L7TA 3FTZA 4I17A 3KS2A 2JV0A 1LF8A 2IJGX 5FJYA 1VDYA 1OWLA 2FBNA 2V5FA 3ASGA 3ZHEB 4CDMA 5BV0A 1NA0A 2VYIA 5T0MA 2IONA 4XKBA 1N6AA 3D9JA 1JPLA 3CQCB 3OXFA 2WXIA 2Y3AA 3QDNA 4U04A 4I51A 2A5UA 4N3AA 4WAFA 2XPZA 3CK7A 4AVXA 3ZGQA 4EZJA 2J4DA 2WXJA 2WB2A 3QWVA 4KZCA 3FPDA 5DIZA 5KCMA 4C1QA 4BTBA 3TJPA 4B94A 3WXXA 4EECA 4CRWA 4DLOA 3LKUA 3QNKA 5AENA 2BUGA 2M63A 4U0SA 2MRIA 3ZYMA 4JLGA 5E75A 2W5YA 5T5GA 3VLDA 2DIWA 4XZ4A 4JHRA 4ACLA 3CK8A 3L17A 3IBEA 5BT1A 2XCCA 2I1KA 3CSFA 3VUZA 4ANXA 2YNQA 3C98A 3GZSA 4HOTA 3CGHA 1KT0A 1HFAA 3RU0A 3F9WA 3FFLA 4KMOA 4N3BA 2Y4TA 3CIAA 3CR3A 3IHVA 1OUVA 3CKCA 2RG8A 4ILHB 1N54A 3CEQA 5ARGA 3FUDA 3U66A 4UWKA 5AIJA 2WXRA 3JYSA 1E8YA 5FT9A 3LDZA 2YQ8A 4BFRA 4BUPA 4JHKA 3HIZA 2GGFA 3ENEA 4I43A 3M58A 3KMJA 5G04C 3JUIA 1EYHA 1HG2A 3UPVA 3JCKC 4FC8A 4WNFA 4AY5A 2KM4A 3PVLA 4G1TA 4FLBA 3URZA 3DPDA 3PNLB 2IF4A 1PEGA 3FH7A 4YNMA 3PUKA 4P29A 4UWFA 2XHEA 2KATA 4RSYA 4QEOA 4I6GA 4A1GA 3FUKA 1TJFA 3SZ7A 3ONKA 4DK5A 1MVXA 3TG4A 2I2OA 4GYYA 5T8IA 4F1SA 3CHPA 4MLPA 1N3JA 4JA7A 1H2VC 2HO1A 4LRZA 4HVBA 4J8EA 2LAHA 4J83A 5EDSA 4UQYA 3QK0A 5EX3A 2E2EA 3FUIA 2WQHA 2L0IA 4JZYA 1UW4B 3AS4A 4RG9A 1E7UA 4FJYA 4EZLA 1QQEA 3Q5MA 3QAQA 5BNWA 2WPVA 4HS2A 4GYOA 5J08A 3G2UA 3GZ2A 1ELRA 5EKQD 3T8MA 1FCHA 4LERA 2JEKA 3IEGA 3CK9A 4FP7A 3ESKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWW A;  3E4B A;  4EQF A;  3RJW A;  4XI9 A;  4H12 A;  3RQ4 A;  3SF4 A;  1Y8M A;  3TG5 A;  3MV2 B;  3EP0 A;  4YVQ C;  3RAY A;  5JJT A;  3OOI A;  4F3V A;  3DAL A;  5FZR A;  2HYZ A;  4WND A;  3CVL A;  4LEU A;  4WUY A;  3MV3 B;  4N5C A;  4O6F A;  3FP3 A;  5AYW D;  3AS5 A;  4HOQ A;  2UY1 B;  3ZFW A;  5LCW C;  3S8P A;  4GZ3 A;  3CVN A;  5D0Q D;  4N3C A;  4LDG A;  4KYO B;  4YPA A;  4Y6W A;  5F59 A;  3M55 A;  4MI5 A;  4I1A A;  3O48 A;  3S7F A;  4QEP A;  4CDR A;  5M72 A;  4NVQ A;  2LSV A;  3ULQ A;  2OOE A;  5DBK A;  4AY6 A;  3LY7 A;  3SW9 A;  3GW4 A;  4H7X A;  2KCV A;  4IN3 B;  3KMT A;  4GPK A;  4I9E A;  5KJL A;  4UQX A;  3KMA A;  4ABN A;  3ASD A;  5T0K A;  3K9I A;  4HOU A;  2C0M A;  2C0L A;  3KAE A;  3RKV A;  4WNG A;  4N39 A;  4HOS A;  2VQ2 A;  2XGS A;  3PDN A;  4GZ5 A;  3M59 A;  5AYF A;  4U07 A;  2XGM A;  5EG2 A;  1O9S A;  5KJM A;  4G23 A;  2QPW A;  3OPE A;  3Q15 A;  4U0Z A;  1KLX A;  3S7D A;  4UI9 J;  4J7I A;  1QZ2 A;  3GZ1 A;  3LCA A;  5FZQ A;  3OS5 A;  1W3B A;  4CGV A;  4GA0 A;  3QOU A;  3ZPJ A;  3CBP A;  5KJK A;  3OXG A;  2JLB A;  3FWV A;  4NJ5 A;  5C1D A;  4Z4P A;  2XGO A;  4NQ0 A;  3CBM A;  5JIN A;  5CPR B;  3MKR A;  4ME2 A;  2FO7 A;  5A6C A;  3M5A A;  3MO5 A;  1XNF A;  5JHN A;  4UQZ A;  2KC7 A;  4IJ8 A;  4H7Y A;  2L6J A;  4YPU A;  5G05 J;  3CV0 A;  1NZN A;  3GYZ A;  4GZ6 A;  2QFC A;  3QKY A;  5F6K C;  4JL0 A;  1KT1 A;  3VTX A;  1A17 A;  2UY1 A;  5A7D B;  1ML9 A;  2XPI A;  2VGY A;  4XI0 A;  2W5Z A;  3OXL A;  3Q47 B;  5JJ6 A;  4AIF A;  1WM5 A;  3NF1 A;  4NRH B;  2G46 A;  4QEN A;  5BW8 C;  3RJV A;  4KXK B;  4UI9 K;  5JIY A;  5CCM A;  4GCO A;  3KD7 A;  3LPZ A;  1ZKK A;  5LSZ A;  4J7F A;  4A1S A;  4YPE A;  2GW1 A;  3DB5 A;  2XCB A;  3ZHE A;  3Q49 B;  4UI9 C;  4APO A;  1ZU2 A;  1MUF A;  3RO2 A;  5TTF A;  3SWC A;  5HI7 A;  3IHX A;  4JDS A;  3LYA A;  1H3I A;  1HH8 A;  2NC9 A;  2XEV A;  2O8J A;  2BQZ A;  4KBQ A;  2Q7F A;  3CBO A;  3QWP A;  4N2S A;  3CKB A;  4HOR A;  3LY8 A;  4I2Z A;  4GYW A;  4WNE A;  5ARF A;  4RG6 A;  3U3W A;  1MT6 A;  1N6C A;  4IJD A;  4J8O A;  5JJ7 A;  5CCL A;  3MA5 A;  2VGX B;  3HNA A;  5TH7 A;  2F69 A;  4JA9 A;  4XIF A;  3CVP A;  4GA1 A;  3PE3 A;  1IYG A;  1B89 A;  3BO5 A;  5EX0 A;  2C2L A;  1ELW A;  5G05 C;  2I6H A;  2LSU A;  2KCL A;  2MHK A;  4Y6C A;  3R9A B;  5FTP A;  3VV0 A;  3VTY A;  1HZ4 A;  3HYM B;  2VSY A;  4CGW A;  4BT9 A;  1PC2 A;  2RFI A;  1P5Q A;  2PQR A;  4YND A;  3RO3 A;  3S7B A;  3S7J A;  5KJN A;  4J8D A;  5LCW J;  5F6L A;  4GA2 A;  4G24 A;  4BWR A;  3M56 A;  3ASF A;  3F9X A;  1NA3 A;  2PZI A;  2LNI A;  3K5K A;  3CVQ A;  3EDT B;  3BEE A;  4O30 A;  3MO0 A;  2UWJ G;  3PE4 A;  3U4T A;  1IHG A;  2P58 C;  4G2V A;  5HQ8 A;  4BTA A;  5TEG A;  1TJC A;  2PQN A;  4FMU A;  1E96 B;  2IGQ A;  4G25 A;  4J0U A;  5CHE E;  2R5S A;  2KCK A;  2FF4 A;  3F9Y A;  4MI0 A;  3M57 A;  2AVP A;  4YVO A;  3AS8 A;  5D0O D;  3TGO A;  4AM9 A;  2HR2 A;  3Q4A B;  4G26 A;  4RZ0 A;  2VSN A;  3RIB A;  3ZN3 A;  2Y4U A;  2FEZ A;  2OND A;  5FZS A;  3UQ3 A;  3UUX A;  5F5E A;  4E47 A;  1HXI A;  1ZBP A;  3M54 A;  5G04 J;  1MVH A;  2DBA A;  4N2Q A;  5JJ0 A;  1YA0 A;  3N71 A;  4AU7 A;  2PL2 A;  3TAX A;  4I2W A;  4YNP A;  4GCN A;  3ASH A;  4J8F A;  4W9R A;  2VGX A;  3M53 A;  4BT8 A;  5LSX A;  2R3A A;  3MO2 A;  2FI7 A;  3F9Z A;  4U0U A;  2J9Q A;  1XQH A;  2IFU A;  1WAO 1;  3LY9 A;  4I9C A;  3MEK A;  2YHC A;  4I17 A;  3KS2 A;  2JV0 A;  5FJY A;  3ZHE B;  2FBN A;  3ASG A;  2V5F A;  1NA0 A;  2VYI A;  5T0M A;  1N6A A;  3QDN A;  3OXF A;  4U04 A;  4I51 A;  4N3A A;  3CK7 A;  3ZGQ A;  3QWV A;  3FPD A;  4C1Q A;  5DIZ A;  4BTB A;  4B94 A;  3WXX A;  3LKU A;  2BUG A;  4U0S A;  4JLG A;  2W5Y A;  5T5G A;  4JHR A;  3CK8 A;  5BT1 A;  2XCC A;  3VUZ A;  4HOT A;  1KT0 A;  3RU0 A;  3F9W A;  3FFL A;  4N3B A;  2Y4T A;  1OUV A;  3CKC A;  3CEQ A;  5ARG A;  4BUP A;  3JYS A;  5FT9 A;  2YQ8 A;  3M58 A;  3KMJ A;  5G04 C;  3UPV A;  4WNF A;  4AY5 A;  4G1T A;  3URZ A;  1PEG A;  2IF4 A;  4YNM A;  2KAT A;  4QEO A;  3SZ7 A;  1MVX A;  3TG4 A;  4GYY A;  1N3J A;  4JA7 A;  2HO1 A;  4J83 A;  4J8E A;  4UQY A;  5EX3 A;  2E2E A;  2WQH A;  3AS4 A;  4RG9 A;  1QQE A;  3Q5M A;  5BNW A;  2WPV A;  4GYO A;  3GZ2 A;  1ELR A;  5EKQ D;  1FCH A;  3IEG A;  3CK9 A;  3ESK A; 
#chains in the Genus database with same CATH topology
 3QWW A;  3VLF A;  3T5V A;  4YDO A;  4O1P A;  3IHY A;  3FU3 A;  5JJT A;  4F3V A;  5FZR A;  2HYZ A;  2P9I G;  5BV1 A;  1D8D A;  3FP3 A;  1DCQ A;  1K8K G;  2WXG A;  5AYW D;  3EIJ A;  2QY7 A;  4N3C A;  3ABK E;  4MRU A;  2VTB A;  2DYR E;  4ZHB A;  2Y69 E;  5M72 A;  5AAR A;  1SA4 A;  3L16 A;  1KPS B;  5KNH D;  3LVR E;  2F8Y A;  4IUL A;  3DXM G;  2LXL A;  4GTV A;  3ML9 A;  5LOZ A;  5AJL A;  4JD2 G;  3EHM A;  5EYP F;  3K9I A;  3MKQ B;  3B7B A;  4L2Y A;  3E37 A;  4CT4 A;  1N4R A;  3G2T A;  4HOS A;  4GZ5 A;  4GZD A;  1SA5 A;  2XZD G;  3UM3 A;  3DSS A;  2WMO A;  5AAO A;  2AWI A;  3ZIM A;  2QPW A;  3NZS A;  1EPU A;  2WVI A;  1HS6 A;  3GZ1 A;  3LCA A;  5JMN D;  3FEY A;  2AXU A;  4KZ0 A;  3OS5 A;  1JCS A;  2ZXW E;  3TL5 A;  4GA0 A;  3PRZ A;  3V79 K;  3QOU A;  4EPZ A;  3CBP A;  4JVS A;  3FTS A;  3B7T A;  3OXG A;  3FWV A;  3T9K A;  3ZXP A;  5C1D A;  3CHQ A;  1MJ0 A;  2ILR A;  1BI7 B;  3SFZ A;  3UM1 A;  1PAQ A;  3NAW A;  3UIO C;  3FU0 A;  4J6I A;  2WQ7 A;  1LTX A;  4DI4 A;  3JQ1 A;  5JHN A;  4MKT A;  5CED B;  3GYZ A;  2IO2 C;  4GZ6 A;  1MQS A;  5CBN A;  3ZUV B;  1NI1 A;  1KT1 A;  3ZVV A;  2XPI A;  3PZ3 A;  1V54 E;  3L54 A;  2CHX A;  5A23 A;  4FUL A;  3Q7A A;  1IXV A;  4HXI A;  3D9K A;  4I6E A;  4KXK B;  5JIY A;  4N5Q A;  3TXN A;  4APO A;  2LUH A;  3TWV A;  1MUF A;  3RO2 A;  4FLH A;  1H3I A;  2BQZ A;  1IQU A;  3WG7 E;  3QWP A;  2OEW A;  2WM9 A;  2A5E A;  4L9P A;  3CHR A;  3J5Q B;  3NQP A;  1BPO A;  4IJD A;  2X3M A;  4J8O A;  2ETA A;  1N4Q A;  3HNA A;  2IY0 C;  2F69 A;  4U8V D;  3FTV A;  3NZU A;  3CVP A;  4GA1 A;  1B89 A;  3BO5 A;  3OTN A;  1ELW A;  3TWQ A;  2KCL A;  1N94 A;  3UM2 A;  4O60 A;  3SNX A;  2V8S E;  1LD8 A;  2VSO E;  3VV0 A;  3VTY A;  2ZU6 B;  4WWP A;  1OCO E;  4ILG A;  1WDY A;  4G11 A;  3HYM B;  2VSY A;  4YDE A;  3TWS A;  1PC2 A;  4J8D A;  5LCW J;  4IRU A;  2VSX E;  3FEX A;  1NL4 A;  5ENQ D;  5AQ7 A;  4B0Z A;  3AU4 A;  1MX2 A;  1K1A A;  3G2W A;  4MBG A;  3CVX A;  2OCC E;  3D9M A;  3LVQ E;  3HXE A;  3QB2 A;  3K5K A;  4BER A;  4U8Y D;  2J49 A;  3U4T A;  5B3S E;  3DWL G;  3FDH A;  2P58 C;  3CQG B;  4I1O B;  5HQ8 A;  1OWO A;  2AXZ A;  2PQN A;  4GML A;  4K03 A;  4A3T A;  5CHE E;  2R5S A;  5ENR D;  2FF4 A;  4HNA D;  3FUL A;  4DLQ A;  5CBO A;  3PH0 C;  2XEH A;  3R7R A;  4WWN A;  4JC8 A;  3ZKJ A;  2VSN A;  1TNY A;  1UJJ A;  5ENP D;  3NBN B;  1EF1 C;  3ONL A;  5F5E A;  4RLY A;  1KZO A;  5G04 J;  4U7E B;  3V2O A;  1Y6I A;  3LXU X;  5JJ0 A;  1YA0 A;  4AU7 A;  4GCN A;  4U8H A;  3TWR A;  4DX2 A;  1NP7 A;  2YHE A;  5LSX A;  4JEH A;  3EJN A;  1S0P A;  3D9H A;  1D8E A;  4AV7 A;  4UWL A;  1N9A A;  3Q9N C;  1LF8 A;  4CDM A;  2FBN A;  3ZHE B;  4GMR A;  5BV0 A;  5T0M A;  4XKB A;  3DRA A;  1N6A A;  3D9J A;  1JPL A;  2WXI A;  3CK7 A;  3ZGQ A;  2RFM A;  2P9N G;  3WXX A;  4CRW A;  3QNK A;  2BUG A;  4U0S A;  3ZYM A;  2P9P G;  3AG1 E;  5BT1 A;  2I1K A;  3VUZ A;  2FO1 E;  4DX1 A;  3IHV A;  3U66 A;  3FUD A;  4UWK A;  3KSQ A;  4BUP A;  5FT9 A;  4F6R D;  1TYQ G;  4I43 A;  2EIJ E;  3JUI A;  1TNZ A;  2RKK A;  4AY5 A;  4FC8 A;  4FLB A;  4U96 D;  4HRN A;  1PEG A;  4I6G A;  2KBX A;  1TJF A;  3FUK A;  3SZ7 A;  1MVX A;  4DK5 A;  3W9G A;  3UIN C;  3TG4 A;  4GYY A;  4J7W A;  1N3J A;  2IEJ A;  2HO1 A;  4LRZ A;  5D66 A;  4UQY A;  1H6O A;  1UW4 B;  4RG9 A;  1E7U A;  3QAQ A;  2WPV A;  3DSV A;  5EKQ D;  4LER A;  4FP7 A;  3MX3 A;  3SF4 A;  3D3M A;  2CHZ A;  3TG5 A;  3L82 A;  3KEZ A;  3OOI A;  3DAL A;  4GMJ A;  4Z68 A;  3W9F A;  4WND A;  1TNB A;  2EIM E;  2DZO A;  2BED A;  1X81 A;  2BF0 X;  2X6F A;  4O6F A;  2R17 C;  3ML8 A;  3S2A A;  1HF8 A;  3ZFW A;  5LCW C;  3RAU A;  3KSL A;  3ASN E;  2YIN A;  3KEA A;  4BET A;  2R03 A;  1N0R A;  4YPA A;  2CFU A;  1IKN D;  3M55 A;  4MI5 A;  4GZC A;  1OY3 D;  3S7F A;  3FTX A;  4CDR A;  2LSV A;  1N4P A;  1E8W A;  2H6G A;  2V5Q C;  2QZA A;  2KCV A;  3Q7F A;  4YDW A;  1SZ9 A;  4OYS A;  2WMN A;  3ESL A;  2ZGG A;  4N39 A;  2XGS A;  4FU3 A;  5AYF A;  4U07 A;  2Y0B G;  5KJM A;  3D9O A;  5H7P A;  4ANV A;  1KLX A;  4EHM A;  1UJK A;  2E0I A;  1W3B A;  3ZPJ A;  5ANR A;  5T4Y A;  2OV8 A;  4F53 A;  3BG1 B;  5JHB A;  1OWM A;  4NJ5 A;  4AP2 A;  1GW6 A;  4PS8 A;  5JIN A;  3CBM A;  1L5J A;  5CPR B;  4GPM A;  5FQ4 A;  3L13 A;  4AXH A;  2QYU A;  4GTO A;  3SBT B;  3TXM A;  3V2X A;  2VGE A;  4UQZ A;  4GAA A;  2KC7 A;  4BEP A;  1H6P A;  4H7Y A;  1E8Z A;  4YPU A;  2HM8 A;  3RRM B;  3HDX A;  3QAR A;  4ATG A;  3QKY A;  3Q73 A;  3FH5 A;  4GTT A;  4KT6 B;  4JL0 A;  2KXP C;  3VTX A;  4AEZ C;  4FHK A;  2I9C A;  3TWT A;  5A7D B;  3UIP C;  4C9B B;  3OXL A;  3L22 A;  3ABL E;  1WM5 A;  3NF1 A;  4NRH B;  3RJV A;  4UI9 K;  5CCM A;  1RW2 A;  4GCO A;  3LPZ A;  4OVV A;  4LNU D;  5LSZ A;  1H2T C;  1FVF A;  3G2V A;  3SFX A;  3UX4 A;  4A1S A;  3QJZ A;  4J7F A;  2GW1 A;  2XCB A;  3ZHE A;  1ZU2 A;  3ZYL A;  3APF A;  2H6I A;  3IHX A;  3LYA A;  4XE0 A;  4AJW A;  3HHM A;  3CBO A;  1OWP A;  3CKB A;  4PS7 A;  5LFA A;  4RG6 A;  1N6C A;  1H0A A;  4GTQ A;  5CCL A;  5BPP A;  2JAB A;  3AAA C;  3MA5 A;  3FHE A;  2GRQ B;  4JA9 A;  4XIF A;  2WXQ A;  3LEW A;  4B8C B;  3PE3 A;  1IYG A;  1UOH A;  5EX0 A;  4KVM A;  2ETC A;  5G05 C;  3AJI A;  2LSU A;  2MHK A;  1PY1 A;  4L2L A;  5FTP A;  3VLE A;  3LS8 A;  1KZP A;  1MHQ A;  4BSX A;  4LNG A;  2WXL A;  2PQR A;  4YND A;  3RO3 A;  3JUE A;  1E90 A;  1HX8 A;  4LNB A;  1JCQ A;  4GA2 A;  4G24 A;  3F9X A;  4JW1 A;  1NA3 A;  5J90 A;  3ZRH A;  5CER B;  3FY4 A;  3OAW A;  4XX5 A;  1BI8 B;  5IY5 E;  3EHN A;  3FUH A;  3LJ3 A;  1SW6 A;  5LX8 A;  3BU8 A;  4G2V A;  2V0P A;  3PEU B;  4K5A B;  1E8X A;  1TJC A;  1E96 B;  2P2C P;  5BXO A;  1EDU A;  2KCK A;  3U64 A;  3M57 A;  1SQM A;  3SO8 A;  4EZK A;  1Z3Y A;  4AM9 A;  2HR2 A;  1IHB A;  4RZ0 A;  3RIB A;  5ENO D;  4PS3 A;  2Y4U A;  4X8Q A;  3I3N A;  2FEZ A;  4GTR A;  4A63 B;  1HXI A;  1ZBP A;  3ZW3 A;  5CEC B;  3DSU A;  2QC9 A;  4N2Q A;  2LO6 A;  4YDY A;  4YNP A;  3FTY A;  3ASH A;  4J8F A;  3ZXS A;  5HRY A;  5FIO A;  4BT8 A;  4C0E A;  3AG4 E;  4HB5 A;  2XRZ A;  1BU9 A;  3F9Z A;  4ACK A;  1AWC B;  3EIQ C;  1XQH A;  4HBD A;  1QYM A;  1WAO 1;  4I9C A;  3MJW A;  3FTZ A;  1ZB1 A;  4I17 A;  3ABM E;  5FJY A;  1VDY A;  3EHQ A;  1NA0 A;  5EYL A;  3CQC B;  3QDN A;  2Y3A A;  4I51 A;  4N3A A;  4AVX A;  2J4D A;  2WB2 A;  4C1Q A;  5DIZ A;  2EIK E;  5KCM A;  4XEI G;  4BTB A;  2B0O E;  3TJP A;  3TWW A;  4DLO A;  2M63 A;  4JLG A;  2MRI A;  2W5Y A;  3VLD A;  4JHR A;  2XCC A;  1S63 A;  4ANX A;  3GZS A;  4HOT A;  3RU0 A;  3FFL A;  4ATZ D;  4M7C A;  3CIA A;  1OUV A;  2RG8 A;  4ILH B;  3CEQ A;  1E8Y A;  2J8S D;  3DEP A;  4BFR A;  3HIZ A;  2MYO A;  3ENE A;  3M58 A;  3KMJ A;  1OT8 A;  2R02 A;  2KM4 A;  3PVL A;  4YNM A;  4UWF A;  4P29 A;  2XHE A;  4QEO A;  4A1G A;  2DWZ A;  3JXJ A;  5BXU A;  3ONK A;  2P9U G;  1JCR A;  4J8E A;  2LAH A;  5EDS A;  4DX6 D;  3HXF A;  2E2E A;  5FIN A;  5HS0 A;  4JZY A;  1LD7 A;  2DVW A;  4FJY A;  3Q5M A;  1A5E A;  3GZ2 A;  1FCH A;  3R9M A;  2JEK A;  3PZ4 A;  2IO3 C;  1WG0 A;  1N95 A;  4B93 B;  1SZA A;  4DI3 A;  3D9I A;  2ZGD A;  4EQF A;  4XI9 A;  4H12 A;  3AG2 E;  3MV2 B;  4YVQ C;  4HLL A;  1H6K A;  4Q69 A;  4LEU A;  3CST A;  3MV3 B;  4N5C A;  3SQV A;  2DCP A;  2OVF A;  2WXH A;  4CCA A;  1S64 A;  3JQ0 A;  3AS5 A;  3AU5 A;  5ANL A;  3S8P A;  4GZ3 A;  1JWG A;  2PM7 A;  1YYH A;  2VJ8 A;  1U3C A;  4Y6W A;  5F59 A;  3TWX A;  3MYV A;  3APC A;  4I1A A;  3O48 A;  2L6B A;  3E32 A;  4LSZ E;  2NXP A;  3C3O A;  3Q79 A;  2OOE A;  1MX6 A;  4JEU A;  3I4G A;  2J4B A;  3C3R A;  4L23 A;  3KMT A;  4GPK A;  5KJL A;  2XZT G;  4UQX A;  3KMA A;  4ABN A;  3ASD A;  4HOU A;  4U63 A;  3KAE A;  3I4R B;  3ZYQ A;  2XS1 A;  3RKV A;  4ILI A;  1MX4 A;  1TNO A;  3M59 A;  2B6C A;  3BG0 B;  3AG3 E;  5EG2 A;  5HKP A;  1TEZ A;  3Q15 A;  4U0Z A;  5BUZ A;  1QZ2 A;  3L6A A;  4Q96 A;  5FZQ A;  3D9N A;  2CFZ A;  4BES A;  3L9T A;  2XGO A;  4IYP A;  5EN5 D;  4GU5 A;  4LCT A;  2Y1L E;  2FO7 A;  5AQ9 A;  1XNF A;  2L6J A;  5G05 J;  2EIL E;  1NZN A;  2IOS A;  3MGB A;  1DC2 A;  2EQX A;  2FUL A;  4CT0 A;  1NFI E;  1YCS B;  4JPS A;  2WXF A;  3HXB A;  1A17 A;  2UY1 A;  2F8X K;  2DYS E;  3P2B A;  2VGY A;  4XI0 A;  2W5Z A;  3NB2 A;  3Q47 B;  4AIF A;  1D9S A;  3UKR G;  2G46 A;  2A4Z A;  4FJZ A;  3E30 A;  2PM6 A;  4O1O A;  2J09 A;  3KD7 A;  3DST A;  1DVP A;  3CVW A;  1ZKK A;  4A3V A;  4R7L A;  4YPE A;  3DB5 A;  2XRY A;  4UI9 C;  1YMP A;  1INZ A;  5TTF A;  5HI7 A;  2RFA A;  4JDS A;  3FTW A;  3DSW A;  2NC9 A;  2XEV A;  2O8J A;  3E34 A;  3CHS A;  2X38 A;  4CEM A;  4KBQ A;  2Q7F A;  4I1M A;  3FUE A;  3UXG A;  3LY8 A;  4I2Z A;  2IOL A;  4GYW A;  4WNE A;  5ARF A;  3U3W A;  4APF A;  1SVX A;  2V4H C;  3B13 A;  5E76 A;  5JJ7 A;  5AQB A;  5TH7 A;  3BQO A;  3HG0 D;  3SBS A;  1Z5S C;  2HE0 A;  4F7A A;  2RD0 A;  2J07 A;  4JB8 P;  5FQ6 A;  4F1P A;  2C2L A;  3R7Q A;  3FH8 A;  4K5C A;  2I6H A;  4Y6C A;  4RVB A;  1HE8 A;  5ENT D;  1HZ4 A;  4URK A;  4FHJ A;  1O5M A;  5G2N A;  1X5B A;  4CGW A;  4J8S A;  4BT9 A;  2RFI A;  3RRN B;  4HI9 A;  3S7B A;  3S7J A;  5C2Y A;  3ULY A;  3MZL B;  1UG3 A;  2XEN A;  1MYO A;  1ELK A;  4GB9 A;  5FWQ A;  4QQI A;  4PUC A;  4L1B A;  4DJA A;  1FT1 A;  1HG5 A;  5AJD A;  2LNI A;  3CVQ A;  3EDT B;  3ZEF A;  3Q75 A;  4E6H A;  1OWN A;  3BEE A;  3MO0 A;  2ZIR A;  3CLJ A;  2UWJ G;  4C48 B;  2WQ6 A;  4ZFH A;  2MOW A;  1RZ4 A;  2AJA A;  3P1U A;  2IGQ A;  4J0U A;  2X6I A;  4MI0 A;  3FU6 A;  4E85 A;  2IU1 A;  1N11 A;  4G26 A;  4M3O A;  4I6J A;  3G2S A;  3CHO A;  3PEV B;  2OND A;  3UUX A;  5FZS A;  3UQ3 A;  4E47 A;  5ENN A;  1H19 A;  3M54 A;  4EBA G;  2V4L A;  1MVH A;  4BX9 A;  3EU9 A;  4OVU A;  2DBA A;  2BTD A;  4BX8 A;  2PL2 A;  5KBA A;  4I2W A;  4HI8 A;  3CVU A;  2X6H A;  2CHW A;  2F37 A;  3B7S A;  3RSE G;  2VGX A;  4G8L A;  4W9R A;  3M53 A;  4AOF A;  1XGW A;  4TXQ A;  5FQ7 A;  4ANU A;  2X6J A;  4V3I A;  2FI7 A;  3IKO B;  4U0U A;  2AW6 A;  2GRP B;  3D9P A;  3MEK A;  2YHC A;  4L7T A;  3KS2 A;  2IJG X;  1OWL A;  2F0Y A;  3C3Q A;  3OXF A;  2DZN A;  3EU5 A;  4WAF A;  2WXJ A;  3FPD A;  5ITZ F;  4B94 A;  2GRO B;  3LKU A;  5AEN A;  3EHR A;  3C72 A;  3L17 A;  3IBE A;  2XS8 A;  5B1B E;  3CSF A;  2YNQ A;  3CGH A;  1AP7 A;  3HXD A;  4KMO A;  2Y4T A;  3CKC A;  2WXR A;  3JYS A;  2GGF A;  3UPV A;  3JCK C;  2EIN E;  4WNF A;  3DPD A;  3PUK A;  2KAT A;  2P9K G;  3PZ2 A;  3JXI A;  1OXJ A;  1K1B A;  2I2O A;  4F1S A;  4MLP A;  2ETB A;  1H2V C;  4HVB A;  1TNU A;  2ZIS A;  3FUI A;  2WQH A;  2L0I A;  4EZL A;  4HS2 A;  4GYO A;  5KWD A;  1ELR A;  3T8M A;  3IEG A;  3CK9 A;  3E4B A;  3HVE B;  3RQ4 A;  3RJW A;  3IV0 A;  1Y8M A;  4MS6 A;  3EP0 A;  3V30 A;  3RAY A;  2GRR B;  3CVL A;  4TV3 A;  4WUY A;  1JWF A;  2LXM A;  4HOQ A;  5CEA A;  2UY1 B;  3CVN A;  3PNT B;  5D0Q D;  2XPY A;  4LDG A;  1MZC A;  3PUJ A;  1TR4 A;  4KYO B;  3PZD A;  4TUM A;  2H6H A;  4DPR A;  2J08 A;  2L9B A;  3B7R L;  4QEP A;  4NIK A;  1JUQ A;  4NVQ A;  3ULQ A;  3APD A;  5DBK A;  4AY6 A;  2KZT B;  3LY7 A;  3SW9 A;  1UN8 A;  3GW4 A;  1OCZ E;  3SI5 A;  4H7X A;  4IN3 B;  3Q78 A;  4I9E A;  1Z3X A;  3J5P A;  5T0K A;  5LP0 A;  2C0M A;  2GRM A;  4DX7 D;  2C0L A;  1S70 B;  3ZU7 B;  4WNG A;  4CDN A;  1U3D A;  2WXN A;  2VQ2 A;  3PDN A;  3NOC D;  4HQD A;  4K0R A;  1O1T A;  2WXO A;  1QBQ A;  2XGM A;  1O9S A;  4WWO A;  3DPY A;  4G23 A;  3OPE A;  1HU3 A;  3CVV A;  1U2V G;  4C0M A;  3S7D A;  4UI9 J;  3O4Z A;  4Q94 A;  4J7I A;  4B89 A;  2L0T B;  5B1A E;  3UM0 A;  1OCR E;  1TN7 A;  4JHJ A;  1HO8 A;  4CGV A;  3FUN A;  5KJK A;  2JLB A;  1O1S A;  4Z4P A;  4HRL A;  4GTP A;  4NQ0 A;  3UKU G;  2QYJ A;  3MKR A;  3SD5 A;  2P9S G;  4ME2 A;  3ZNG A;  5A6C A;  1N4S A;  4HFG A;  1TN8 A;  3M5A A;  3MO5 A;  4IJ8 A;  3CV0 A;  5G55 A;  2QFC A;  3UT7 A;  5JHA A;  5F6K C;  5T3R A;  4GTM A;  4A55 A;  1ML9 A;  2R05 A;  3L08 A;  5JJ6 A;  2PNN A;  4QEN A;  4PDX A;  5BW8 C;  4B8A A;  3FUF A;  2CG2 A;  1G3N B;  3B95 A;  4HLE A;  3MCX A;  1O1R A;  4LUN U;  4RQI A;  4UUC A;  3UT4 A;  3Q49 B;  4DUI A;  3SWC A;  2P9L G;  3T8K A;  2CG3 A;  1HH8 A;  2H6F A;  4UWH A;  3CVY A;  4OAU C;  3F6Q A;  3SY2 A;  1BD8 A;  4N2S A;  3UT8 A;  4HOR A;  1WY6 A;  2XQ0 A;  3ZYK A;  4EBA A;  4JXT A;  1MT6 A;  3RK6 A;  2AXV A;  3MKQ A;  3U9W A;  4NAC A;  4QFV A;  4TXP A;  2LAI A;  2VGX B;  2I1J A;  4BSZ B;  4UWG A;  2VTB B;  3HXC A;  5CMY A;  3B7U X;  5CRV A;  4ANW A;  3FUJ A;  3R9A B;  3UTM A;  1Q2Z A;  2IQC A;  2OVB A;  3EUV A;  4LG6 A;  1E7V A;  3X2Q E;  1P5Q A;  5KJN A;  5F6L A;  1N0Q A;  4BWR A;  3M56 A;  3NOG D;  1IQR A;  4HRM B;  3ASF A;  3FTU A;  5EIL A;  2PZI A;  5AN8 A;  2X6K A;  3BUA A;  3FU5 A;  2XEE A;  3TWU A;  1N52 A;  4PH4 B;  3DBS A;  3UI2 A;  3HVE A;  4O30 A;  4TXR A;  3SGH A;  5CMW A;  4D10 C;  3PE4 A;  1FPP A;  3C5R A;  1IHG A;  4FA6 A;  4DRX E;  2OEV A;  4BTA A;  5ENS D;  5TEG A;  5FQ8 A;  4FMU A;  1FVH A;  4G25 A;  4CZ2 D;  2GRL A;  3LJN A;  3F9Y A;  3FUM A;  5EIB E;  2AVP A;  4YVO A;  5AQA A;  5D2M C;  3AS8 A;  5D0O D;  2WXK A;  3TGO A;  3Q4A B;  4XKC A;  3T5X A;  3CHM A;  4KVO A;  2BKG A;  3D9L A;  3SHF A;  3ZN3 A;  3RRU A;  1QNF A;  1TN6 A;  3PS6 A;  4TRQ A;  3UMV A;  1UN9 A;  4TUU A;  3I5P A;  3PRE A;  3N71 A;  2WXM A;  4FAD A;  3TAX A;  2KZT A;  3IXE A;  4NUR A;  1H2U A;  3QC1 A;  3DXK G;  1OCC E;  1DNP A;  1Z6T A;  1BLX B;  2R3A A;  3MO2 A;  4J8Y A;  2NSZ A;  2J9Q A;  2WXP A;  3DSX A;  2IFU A;  3SFY A;  4BY6 A;  2R59 A;  3LY9 A;  3V31 A;  5JA4 D;  2JV0 A;  3ASG A;  2V5F A;  2VYI A;  2ION A;  2NYJ A;  4U04 A;  2A5U A;  4CYM D;  2XPZ A;  5EID A;  4EZJ A;  4G8K A;  3QWV A;  3HRA A;  4KZC A;  2GRN B;  4EEC A;  5E75 A;  5T5G A;  3E33 A;  2DIW A;  4XZ4 A;  4ACL A;  3CK8 A;  3DEO A;  3ULE G;  5KNG A;  3ASO E;  3C98 A;  1KT0 A;  1HFA A;  3F9W A;  4N3B A;  3CR3 A;  1N54 A;  5ARG A;  2BKK B;  5AIJ A;  3LDZ A;  2YQ8 A;  4JHK A;  5CRU A;  4DX5 D;  5G04 C;  1EYH A;  1HG2 A;  1V55 E;  4G1T A;  3URZ A;  3PNL B;  2IF4 A;  3FH7 A;  4RSY A;  4GTS A;  1DCE A;  4U95 D;  4OAV B;  1K3Z D;  5T8I A;  3CHP A;  4JA7 A;  4J83 A;  3QK0 A;  5EX3 A;  3AS4 A;  1QQE A;  5BNW A;  5J08 A;  3G2U A;  3PZ1 A;  3ISM C;  2R2L A;  1FT2 A;  4K5B A;  3Q9U C;  3ESK A; 
#chains in the Genus database with same CATH homology
 3QWW A;  3MX3 A;  1SZA A;  4DI3 A;  3E4B A;  3HVE B;  3VLF A;  3T5V A;  3D9I A;  4EQF A;  3RJW A;  4XI9 A;  4H12 A;  3RQ4 A;  3IV0 A;  3D3M A;  3SF4 A;  1Y8M A;  2CHZ A;  3TG5 A;  4MS6 A;  3MV2 B;  3IHY A;  4YVQ C;  3EP0 A;  3RAY A;  3FU3 A;  3KEZ A;  5JJT A;  3OOI A;  4F3V A;  3DAL A;  4GMJ A;  5FZR A;  2HYZ A;  4WND A;  1H6K A;  3CVL A;  4Q69 A;  5BV1 A;  4TV3 A;  4LEU A;  4WUY A;  1JWF A;  3CST A;  2BF0 X;  2X6F A;  3MV3 B;  4N5C A;  4O6F A;  2R17 C;  3ML8 A;  4CCA A;  2DCP A;  2OVF A;  2WXH A;  3FP3 A;  3JQ0 A;  2WXG A;  5AYW D;  3AS5 A;  3EIJ A;  4HOQ A;  4EBA A;  3S2A A;  2UY1 B;  1HF8 A;  3AU5 A;  5ANL A;  3ZFW A;  5LCW C;  3S8P A;  4GZ3 A;  2QY7 A;  1JWG A;  2PM7 A;  2YIN A;  3CVN A;  3PNT B;  5D0Q D;  2XPY A;  4N3C A;  4LDG A;  4MRU A;  3PUJ A;  2VJ8 A;  1U3C A;  4KYO B;  3PZD A;  4YPA A;  4Y6W A;  2CFU A;  4DPR A;  2VTB A;  3M55 A;  5F59 A;  2J08 A;  4MI5 A;  4GZC A;  2L9B A;  3MYV A;  3APC A;  4I1A A;  3B7R L;  3O48 A;  3S7F A;  4QEP A;  3FTX A;  4CDR A;  1JUQ A;  5M72 A;  4NVQ A;  2LSV A;  1E8W A;  3ULQ A;  3L16 A;  3APD A;  2NXP A;  2OOE A;  4JEU A;  3LVR E;  3I4G A;  5DBK A;  4AY6 A;  2KZT B;  3LY7 A;  2J4B A;  4IUL A;  4L23 A;  3SW9 A;  1UN8 A;  3GW4 A;  3SI5 A;  4H7X A;  2KCV A;  3ML9 A;  4IN3 B;  3KMT A;  4GPK A;  4I9E A;  5LOZ A;  1Z3X A;  5AJL A;  5KJL A;  4UQX A;  3KMA A;  4ABN A;  3ASD A;  5T0K A;  1SZ9 A;  3EHM A;  3K9I A;  4OYS A;  2WMN A;  5LP0 A;  3ESL A;  3MKQ B;  4HOU A;  2C0M A;  2GRM A;  4U63 A;  2C0L A;  3KAE A;  4L2Y A;  3I4R B;  3ZYQ A;  3RKV A;  4CT4 A;  4ILI A;  4N39 A;  4WNG A;  3G2T A;  1U3D A;  4CDN A;  4HOS A;  2WXN A;  2VQ2 A;  2XGS A;  3PDN A;  4FU3 A;  4GZD A;  4GZ5 A;  4K0R A;  3M59 A;  5AYF A;  2WXO A;  3BG0 B;  4U07 A;  2WMO A;  2XGM A;  5EG2 A;  1O9S A;  5KJM A;  2AWI A;  4WWO A;  3D9O A;  4G23 A;  3ZIM A;  2QPW A;  3OPE A;  1HU3 A;  3NZS A;  4ANV A;  4C0M A;  3Q15 A;  4U0Z A;  1KLX A;  3S7D A;  3CVV A;  4UI9 J;  3O4Z A;  4Q94 A;  1EPU A;  4J7I A;  5BUZ A;  4B89 A;  1UJK A;  2WVI A;  2L0T B;  1HS6 A;  1QZ2 A;  3L6A A;  3GZ1 A;  3LCA A;  4Q96 A;  5FZQ A;  3FEY A;  3D9N A;  2AXU A;  2E0I A;  4KZ0 A;  3OS5 A;  4JHJ A;  1HO8 A;  1W3B A;  4CGV A;  3TL5 A;  4GA0 A;  3PRZ A;  3QOU A;  3ZPJ A;  4EPZ A;  3CBP A;  5ANR A;  3FUN A;  5T4Y A;  2CFZ A;  4JVS A;  2OV8 A;  3FTS A;  5KJK A;  4F53 A;  3B7T A;  3BG1 B;  3OXG A;  2JLB A;  3FWV A;  5JHB A;  1OWM A;  4NJ5 A;  5C1D A;  3CHQ A;  4AP2 A;  1GW6 A;  2XGO A;  4Z4P A;  2ILR A;  4PS8 A;  4NQ0 A;  3CBM A;  5JIN A;  1L5J A;  5CPR B;  4IYP A;  3SFZ A;  3MKR A;  3SD5 A;  1PAQ A;  5FQ4 A;  4GU5 A;  3L13 A;  4LCT A;  4ME2 A;  2FO7 A;  4AXH A;  3FU0 A;  4J6I A;  5A6C A;  3SBT B;  3TXM A;  2WQ7 A;  4HFG A;  3JQ1 A;  4DI4 A;  1XNF A;  3M5A A;  3MO5 A;  4UQZ A;  5JHN A;  4GAA A;  2KC7 A;  4MKT A;  4IJ8 A;  4H7Y A;  2L6J A;  1E8Z A;  5G05 J;  4YPU A;  3CV0 A;  5G55 A;  1NZN A;  3GYZ A;  2HM8 A;  2IOS A;  3RRM B;  3MGB A;  3HDX A;  4GZ6 A;  3QAR A;  4ATG A;  2EQX A;  2QFC A;  3QKY A;  3FH5 A;  3UT7 A;  1MQS A;  2FUL A;  5JHA A;  5F6K C;  4KT6 B;  4JL0 A;  4CT0 A;  1KT1 A;  5T3R A;  3VTX A;  4FHK A;  2WXF A;  4JPS A;  1A17 A;  4AEZ C;  3ZVV A;  2I9C A;  2UY1 A;  5A7D B;  4A55 A;  1ML9 A;  2XPI A;  3L54 A;  3P2B A;  2VGY A;  3L08 A;  4XI0 A;  2CHX A;  4C9B B;  5A23 A;  3OXL A;  2W5Z A;  3L22 A;  3Q47 B;  4FUL A;  5JJ6 A;  4AIF A;  1WM5 A;  3NF1 A;  4HXI A;  4NRH B;  2G46 A;  4QEN A;  2A4Z A;  4PDX A;  3D9K A;  5BW8 C;  4I6E A;  4B8A A;  3RJV A;  4FJZ A;  3FUF A;  4KXK B;  4UI9 K;  2CG2 A;  5JIY A;  2PM6 A;  5CCM A;  2J09 A;  4GCO A;  3KD7 A;  3TXN A;  4HLE A;  3LPZ A;  4OVV A;  3MCX A;  1DVP A;  3CVW A;  1ZKK A;  4A3V A;  4LUN U;  5LSZ A;  1H2T C;  1FVF A;  3G2V A;  4R7L A;  3UX4 A;  4A1S A;  3QJZ A;  4J7F A;  2GW1 A;  3DB5 A;  4YPE A;  2XCB A;  2XRY A;  3UT4 A;  3Q49 B;  4UI9 C;  3ZHE A;  4APO A;  1ZU2 A;  3ZYL A;  3APF A;  1INZ A;  1MUF A;  3RO2 A;  5TTF A;  3SWC A;  4FLH A;  5HI7 A;  3IHX A;  4JDS A;  3FTW A;  3LYA A;  4XE0 A;  2CG3 A;  4AJW A;  1HH8 A;  2NC9 A;  2XEV A;  1H3I A;  3HHM A;  2BQZ A;  2O8J A;  1IQU A;  3CHS A;  2X38 A;  4CEM A;  4UWH A;  4KBQ A;  2Q7F A;  3CVY A;  3CBO A;  3QWP A;  1OWP A;  2WM9 A;  4I1M A;  4N2S A;  3CKB A;  3FUE A;  3UT8 A;  4HOR A;  1WY6 A;  2XQ0 A;  3LY8 A;  4I2Z A;  2IOL A;  3CHR A;  4GYW A;  4PS7 A;  4JXT A;  3NQP A;  4RG6 A;  4WNE A;  5ARF A;  4APF A;  5LFA A;  3U3W A;  3RK6 A;  1BPO A;  2AXV A;  1H0A A;  3MKQ A;  1MT6 A;  2X3M A;  1N6C A;  4IJD A;  3U9W A;  4NAC A;  3B13 A;  4QFV A;  4J8O A;  5E76 A;  5JJ7 A;  5CCL A;  5BPP A;  2LAI A;  3MA5 A;  2VGX B;  3HNA A;  5TH7 A;  3SBS A;  2I1J A;  3FHE A;  2F69 A;  4F7A A;  4JA9 A;  3FTV A;  4XIF A;  2WXQ A;  3LEW A;  3NZU A;  4B8C B;  2RD0 A;  4UWG A;  2J07 A;  3CVP A;  4GA1 A;  3PE3 A;  1IYG A;  5FQ6 A;  2VTB B;  1B89 A;  3BO5 A;  3OTN A;  5CMY A;  5EX0 A;  2C2L A;  4KVM A;  1ELW A;  3FH8 A;  5G05 C;  3R7Q A;  2I6H A;  3B7U X;  2LSU A;  2KCL A;  4ANW A;  3FUJ A;  3SNX A;  2MHK A;  2V8S E;  4Y6C A;  3R9A B;  4RVB A;  1PY1 A;  4L2L A;  5FTP A;  2VSO E;  3VV0 A;  3VTY A;  3VLE A;  3LS8 A;  1HE8 A;  2IQC A;  2ZU6 B;  4WWP A;  1HZ4 A;  4URK A;  4ILG A;  2OVB A;  4FHJ A;  4G11 A;  3HYM B;  5G2N A;  2VSY A;  1MHQ A;  1X5B A;  4BSX A;  4CGW A;  1E7V A;  4J8S A;  4BT9 A;  1PC2 A;  2WXL A;  1P5Q A;  2RFI A;  2PQR A;  4YND A;  3RRN B;  3RO3 A;  3S7B A;  3S7J A;  5KJN A;  4J8D A;  5LCW J;  1E90 A;  5C2Y A;  4IRU A;  5F6L A;  2VSX E;  3FEX A;  1HX8 A;  1UG3 A;  3MZL B;  3ZYK A;  4GA2 A;  4G24 A;  4BWR A;  3M56 A;  4B0Z A;  1ELK A;  4GB9 A;  1IQR A;  3ASF A;  3FTU A;  3AU4 A;  3F9X A;  4JW1 A;  1NA3 A;  5J90 A;  5FWQ A;  2PZI A;  2X6K A;  3G2W A;  4PUC A;  3CVX A;  4L1B A;  4DJA A;  3ZRH A;  3FU5 A;  1HG5 A;  3D9M A;  3FY4 A;  3LVQ E;  3OAW A;  4XX5 A;  3QB2 A;  5AJD A;  2LNI A;  3K5K A;  3EHN A;  1N52 A;  4PH4 B;  3CVQ A;  3EDT B;  3ZEF A;  3FUH A;  4E6H A;  2J49 A;  3DBS A;  1OWN A;  3BEE A;  3HVE A;  3LJ3 A;  4O30 A;  3SGH A;  5CMW A;  5LX8 A;  4D10 C;  3MO0 A;  3CLJ A;  2UWJ G;  3PE4 A;  3U4T A;  1IHG A;  4FA6 A;  2WQ6 A;  3FDH A;  2P58 C;  4G2V A;  2MOW A;  2V0P A;  3CQG B;  3PEU B;  1OWO A;  2AXZ A;  4I1O B;  4BTA A;  5HQ8 A;  5TEG A;  1E8X A;  5FQ8 A;  1TJC A;  2PQN A;  4GML A;  4FMU A;  1E96 B;  3P1U A;  4K03 A;  2IGQ A;  1FVH A;  4G25 A;  4J0U A;  4A3T A;  5CHE E;  2R5S A;  2GRL A;  1EDU A;  2KCK A;  2FF4 A;  3U64 A;  2X6I A;  3FUL A;  4DLQ A;  3F9Y A;  4MI0 A;  3FUM A;  3PH0 C;  2AVP A;  1SQM A;  4YVO A;  3M57 A;  3FU6 A;  4EZK A;  4E85 A;  1Z3Y A;  3R7R A;  4WWN A;  3AS8 A;  5D0O D;  2WXK A;  3TGO A;  2IU1 A;  2HR2 A;  3Q4A B;  4AM9 A;  4G26 A;  4JC8 A;  4XKC A;  4M3O A;  3T5X A;  4RZ0 A;  3CHM A;  2VSN A;  3RIB A;  4KVO A;  4I6J A;  3G2S A;  3D9L A;  4PS3 A;  3SHF A;  3ZN3 A;  1UJJ A;  2Y4U A;  3CHO A;  3RRU A;  3I3N A;  1QNF A;  2FEZ A;  2OND A;  3PEV B;  5FZS A;  3UQ3 A;  1EF1 C;  3ONL A;  3UUX A;  1HXI A;  5ENN A;  5F5E A;  4E47 A;  1H19 A;  3PS6 A;  1TEZ A;  1ZBP A;  4EBA G;  2V4L A;  3M54 A;  4TRQ A;  5G04 J;  3ZW3 A;  3UMV A;  1MVH A;  4BX9 A;  4OVU A;  1UN9 A;  1Y6I A;  3LXU X;  4TUU A;  2DBA A;  3I5P A;  3PRE A;  4N2Q A;  2BTD A;  4BX8 A;  1YA0 A;  5JJ0 A;  3N71 A;  4AU7 A;  2WXM A;  2LO6 A;  2PL2 A;  4FAD A;  3TAX A;  2KZT A;  4I2W A;  4YNP A;  4GCN A;  4U8H A;  2X6H A;  2CHW A;  3CVU A;  3FTY A;  3ASH A;  3B7S A;  4J8F A;  4NUR A;  3ZXS A;  1H2U A;  3QC1 A;  2VGX A;  1NP7 A;  4W9R A;  3M53 A;  2YHE A;  1XGW A;  5FQ7 A;  4AOF A;  1DNP A;  4BT8 A;  4C0E A;  5LSX A;  4JEH A;  3EJN A;  1S0P A;  1Z6T A;  4ANU A;  2XRZ A;  2X6J A;  2R3A A;  3MO2 A;  4V3I A;  2FI7 A;  2NSZ A;  3IKO B;  2J9Q A;  4U0U A;  4ACK A;  2AW6 A;  2WXP A;  3EIQ C;  3F9Z A;  1XQH A;  2IFU A;  4AV7 A;  4BY6 A;  1WAO 1;  4UWL A;  2R59 A;  3D9P A;  3LY9 A;  3MJW A;  3MEK A;  4I9C A;  2YHC A;  4L7T A;  3FTZ A;  4I17 A;  3KS2 A;  2JV0 A;  1LF8 A;  2IJG X;  5FJY A;  1VDY A;  1OWL A;  2FBN A;  2V5F A;  3ASG A;  3ZHE B;  4CDM A;  5BV0 A;  1NA0 A;  2VYI A;  5T0M A;  2ION A;  4XKB A;  1N6A A;  3D9J A;  1JPL A;  3CQC B;  3OXF A;  2WXI A;  2Y3A A;  3QDN A;  4U04 A;  4I51 A;  2A5U A;  4N3A A;  4WAF A;  2XPZ A;  3CK7 A;  4AVX A;  3ZGQ A;  4EZJ A;  2J4D A;  2WXJ A;  2WB2 A;  3QWV A;  4KZC A;  3FPD A;  5DIZ A;  5KCM A;  4C1Q A;  4BTB A;  3TJP A;  4B94 A;  3WXX A;  4EEC A;  4CRW A;  4DLO A;  3LKU A;  3QNK A;  5AEN A;  2BUG A;  2M63 A;  4U0S A;  2MRI A;  3ZYM A;  4JLG A;  5E75 A;  2W5Y A;  5T5G A;  3VLD A;  2DIW A;  4XZ4 A;  4JHR A;  4ACL A;  3CK8 A;  3L17 A;  3IBE A;  5BT1 A;  2XCC A;  2I1K A;  3CSF A;  3VUZ A;  4ANX A;  2YNQ A;  3C98 A;  3GZS A;  4HOT A;  3CGH A;  1KT0 A;  1HFA A;  3RU0 A;  3F9W A;  3FFL A;  4KMO A;  4N3B A;  2Y4T A;  3CIA A;  3CR3 A;  3IHV A;  1OUV A;  3CKC A;  2RG8 A;  4ILH B;  1N54 A;  3CEQ A;  5ARG A;  3FUD A;  3U66 A;  4UWK A;  5AIJ A;  2WXR A;  3JYS A;  1E8Y A;  5FT9 A;  3LDZ A;  2YQ8 A;  4BFR A;  4BUP A;  4JHK A;  3HIZ A;  2GGF A;  3ENE A;  4I43 A;  3M58 A;  3KMJ A;  5G04 C;  3JUI A;  1EYH A;  1HG2 A;  3UPV A;  3JCK C;  4FC8 A;  4WNF A;  4AY5 A;  2KM4 A;  3PVL A;  4G1T A;  4FLB A;  3URZ A;  3DPD A;  3PNL B;  2IF4 A;  1PEG A;  3FH7 A;  4YNM A;  3PUK A;  4P29 A;  4UWF A;  2XHE A;  2KAT A;  4RSY A;  4QEO A;  4I6G A;  4A1G A;  3FUK A;  1TJF A;  3SZ7 A;  3ONK A;  4DK5 A;  1MVX A;  3TG4 A;  2I2O A;  4GYY A;  5T8I A;  4F1S A;  3CHP A;  4MLP A;  1N3J A;  4JA7 A;  1H2V C;  2HO1 A;  4LRZ A;  4HVB A;  4J8E A;  2LAH A;  4J83 A;  5EDS A;  4UQY A;  3QK0 A;  5EX3 A;  2E2E A;  3FUI A;  2WQH A;  2L0I A;  4JZY A;  1UW4 B;  3AS4 A;  4RG9 A;  1E7U A;  4FJY A;  4EZL A;  1QQE A;  3Q5M A;  3QAQ A;  5BNW A;  2WPV A;  4HS2 A;  4GYO A;  5J08 A;  3G2U A;  3GZ2 A;  1ELR A;  5EKQ D;  3T8M A;  1FCH A;  4LER A;  2JEK A;  3IEG A;  3CK9 A;  4FP7 A;  3ESK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...