5ARGA

Smyd2 in complex with sgc probe bay-598
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
426
structure length
426
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
total genus 151
structure length 426
sequence length 426
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5argA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5argA01
4YVOA 2VYIA 4HOUA 2R5SA 3Q47B 3QDNA 3SZ7A 5D0OD 4GZ5A 2XEVA 5JJ7A 4Z4PA 4WNDA 4B94A 4HOSA 3BEEA 4NVQA 5TH7A 3TGOA 3CVPA 1MVHA 5FZRA 4N2QA 3QOUA 3ASFA 3KMTA 2FF4A 3Q15A 4GA1A 3CKBA 3Q49B 2Q7FA 5AYFA 4G24A 5KJLA 3ZGQA 3RAYA 4I17A 1NZNA 5FZQA 4I9EA 4N39A 5TEGA 4WNFA 3K5KA 1MT6A 2QFCA 4CGWA 5CPRB 3CK9A 3TAXA 3ULQA 3Q4AB 5HQ8A 4BT9A 4ABNA 5LSXA 4RZ0A 3M56A 3E4BA 3Q5MA 4YNPA 5AYWD 5ARFA 2LSVA 3MEKA 2JV0A 3OOIA 3RKVA 3CBPA 3ESKA 2JLBA 3S7JA 3KD7A 3URZA 1PEGA 4CGVA 3CV0A 3ZHEB 1ML9A 2IFUA 4BTBA 4BT8A 4AIFA 1Y8MA 5JJ0A 3KMAA 5F59A 5T5GA 4XI0A 3FFLA 3S7DA 5FTPA 2WQHA 5F6LA 1HXIA 3CVNA 4KYOB 3M58A 2MHKA 4IN3B 5ARGA 2W5ZA 5BW8C 1KT1A 4KXKB 3M54A 3CEQA 2KCKA 5BT1A 4N3CA 3OXLA 4IJDA 5DBKA 3N71A 3DB5A 5D0QD 5BNWA 2PL2A 3UUXA 4AY5A 4JHRA 5F5EA 3LYAA 3F9ZA 4GA2A 5LCWC 1MVXA 4GA0A 4G23A 4W9RA 2IGQA 2I6HA 3PE3A 2VGXA 1ZKKA 2AVPA 4N3AA 2UY1A 5EX3A 4UQZA 3VUZA 1O9SA 2GW1A 2BQZA 4J8DA 4UI9J 1TJCA 5EX0A 2C2LA 2XGMA 4WNGA 4UQXA 5CHEE 1KLXA 2UWJG 3ZPJA 5KJNA 4UI9K 3OXFA 3VV0A 1H3IA 4J7IA 3GW4A 3FWVA 3PE4A 2NC9A 4APOA 5F6KC 4XIFA 4UI9C 5G05C 5G04C 3CKCA 3S7BA 4H7YA 1ELRA 4U04A 2FI7A 3M57A 4I51A 5M72A 4U0UA 5G04J 5G05J 4JL0A 5A7DB 2DBAA 4GCNA 2P58C 2C0MA 4O6FA 4I9CA 2LNIA 3LY7A 1ELWA 3KMJA 1P5QA 3DALA 3KS2A 3M59A 3JYSA 5CCLA 3EP0A 4QEOA 5TTFA 4U0ZA 3OS5A 5FZSA 4U0SA 4GPKA 3ZHEA 4N2SA 3ZN3A 4J8OA 3RO3A 3VTXA 4CDRA 5JIYA 5LSZA 3MV3B 5C1DA 5EKQD 3MV2B 4MI0A 1WAO1 2KCVA 3FPDA 4LDGA 3FP3A 3MA5A 4J8FA 2OOEA 1NA3A 4GYWA 2PQNA 3IEGA 5FJYA 2YHCA 2O8JA 4Y6WA 2KATA 1B89A 4GYYA 2XCCA 3UQ3A 3U4TA 4YNMA 2V5FA 3GYZA 3RU0A 3F9XA 4U07A 3RJVA 4O30A 4J7FA 1ZU2A 1PC2A 1IHGA 3MO5A 4ME2A 2UY1B 2XCBA 3IHXA 4HOQA 2VGYA 2XGOA 1N6AA 1NA0A 3QKYA 4J83A 2L6JA 4JDSA 2VQ2A 1WM5A 4N5CA 3QWWA 5T0MA 4GCOA 2FBNA 5JJ6A 4GYOA 3CK8A 4C1QA 4YPUA 2QPWA 3BO5A 4RG9A 1OUVA 2HR2A 5CCMA 3M53A 3M55A 2HO1A 4JA9A 2Y4UA 3K9IA 4MI5A 2LSUA 2KC7A 4F3VA 3GZ2A 3O48A 4G2VA 2R3AA 3U3WA 3RO2A 2G46A 3WXXA 4NJ5A 5KJMA 4EQFA 5JINA 1ZBPA 3NF1A 3MKRA 3EDTB 4G26A 4IJ8A 3TG4A 4UQYA 4Y6CA 1HZ4A 3AS4A 3HYMB 3MO0A 4QEPA 4BWRA 5JJTA 3F9WA 3MO2A 2VSNA 4JA7A 5HI7A 3LY9A 5A6CA 3CBOA 5EG2A 5LCWJ 2RFIA 3SWCA 4YVQC 3ZFWA 3CK7A 4GZ3A 2F69A 2J9QA 4GZ6A 1KT0A 1FCHA 4AY6A 1XQHA 4I1AA 3QWPA 4N3BA 3PDNA 4JLGA 1MUFA 4HORA 4YPAA 5JHNA 4XI9A 1YA0A 2HYZA 2E2EA 2C0LA 1HH8A 4G25A 4RG6A 4QENA 2FEZA 2IF4A 3UPVA 3VTYA 4G1TA 4HOTA 4E47A 1N3JA 5KJKA 3ASDA 3AS8A 4H7XA 4LEUA 1IYGA 4J0UA 5DIZA 3TG5A 2KCLA 2W5YA 4FMUA 4NQ0A 2YQ8A 4I2ZA 3RJWA 2XGSA 4J8EA 3R9AB 4BUPA 3LY8A 1N6CA 3ASHA 3F9YA 4BTAA 3M5AA 2VGXB 5FT9A 3AS5A 4WNEA 3GZ1A 4NRHB 3KAEA 3OPEA 3CVLA 1W3BA 2Y4TA 3LPZA 1QZ2A 2FO7A 2VSYA 1XNFA 3QWVA 5T0KA 4I2WA 3LCAA 1E96B 3CBMA 3RQ4A 3SW9A 2XPIA 4WUYA 3RIBA 4A1SA 4AM9A 4AU7A 2PZIA 4KBQA 2PQRA 1A17A 3ASGA 1QQEA 3CVQA 3SF4A 4H12A 4YNDA 4YPEA 2ONDA 3HNAA 3S8PA 3LKUA 2WPVA 3OXGA 2BUGA 3S7FA
chains in the Genus database with same CATH superfamily
3T8MA 3ZYQA 1QBQA 5ANRA 4FA6A 4PS7A 3Q47B 3SD5A 1NFIE 3ZRHA 2OVBA 4Z4PA 3IKOB 3LXUX 4WNDA 4JC8A 3SO8A 3UM3A 3CLJA 1JCQA 1MVHA 3FH7A 4YDWA 4U96D 5HRYA 3Q15A 3NBNB 3Q49B 1SZ9A 1N54A 5AYFA 4G24A 1Z3YA 5KJLA 3ZGQA 4CRWA 3RAYA 3IHVA 4J8SA 1K1AA 1X5BA 4QFVA 4I9EA 5AJDA 4LNUD 3L16A 3B7BA 2QFCA 4JPSA 5CPRB 3TAXA 2WXRA 3QAQA 1FT2A 3M56A 3D9KA 2EINE 4ZHBA 3ZYMA 4GMLA 3MEKA 3OOIA 1BI7B 4ACKA 3ULYA 3ESKA 2CG3A 1NP7A 4XX5A 3URZA 5AN8A 1PEGA 3RK6A 2IFUA 5BXUA 4BTBA 4TV3A 4A3VA 5F59A 2A5UA 3IHYA 4JVSA 5FTPA 1E8ZA 5F6LA 1HXIA 4KYOB 4WWNA 3Q7FA 2MHKA 5ARGA 4CT0A 2W5ZA 2GRQB 1X81A 3FTVA 5E75A 3TL5A 3OXLA 3CR3A 4Q94A 3N71A 3DB5A 5BPPA 2PM7A 4J8YA 1SZAA 5T8IA 2CHZA 4GA0A 3VLEA 4G23A 4W9RA 1N0QA 3ML8A 4OVUA 4PUCA 1ZKKA 3AAAC 2VSXE 5ENQD 5AJLA 2WMOA 3PUJA 3ZUVB 2BQZA 1H6KA 2EIKE 4OYSA 2J4BA 4I1MA 2WXPA 4J8DA 2R05A 4XE0A 5EX0A 2C2LA 4ILGA 3FUNA 1UJKA 5KJNA 5FINA 3OXFA 3F6QA 4A63B 3PE4A 2XZDG 1H0AA 2DZOA 2NC9A 3HXBA 4BETA 4XIFA 3CHSA 1UW4B 3CVVA 5KNHD 5M72A 4BY6A 5B3SE 5G05J 2DBAA 3DBSA 5FWQA 3ZW3A 2P58C 4I9CA 4BSZB 3MZLB 4F6RD 3FUFA 3KS2A 4O1PA 4QEOA 4TUUA 3G2WA 3PZ1A 5FZSA 4U0SA 4GPKA 3LEWA 3ZHEA 4KVOA 2AJAA 1EPUA 3JQ0A 3RO3A 3P1UA 5A23A 2ILRA 4JHJA 2WXQA 3E32A 5D66A 3SBSA 5LSZA 5C1DA 3FUKA 2OCCE 4A55A 3MV2B 1WAO1 3MA5A 1NA3A 4HRLA 3IEGA 5FJYA 3MX3A 4BEPA 1S63A 2O8JA 3DSXA 3U4TA 3ZXSA 2GRRB 4IULA 3GYZA 3PZ4A 3F9XA 1SA5A 1ZU2A 2WB2A 1IHGA 2XPYA 2LXMA 1EYHA 2UY1B 2J4DA 3V30A 5KWDA 4MKTA 3E34A 3QKYA 2XQ0A 3R9MA 1U2VG 2B6CA 1WM5A 3W9GA 4QQIA 3QK0A 3VLDA 3HRAA 5T0MA 1ELKA 4F53A 2WQ6A 1E90A 3CHRA 2VGEA 3EJNA 4IYPA 4AOFA 3M55A 2DYSE 2LSUA 4X8QA 5CBOA 2KC7A 4F3VA 1Z5SC 4HFGA 3U3WA 2R17C 4WAFA 4CYMD 1BPOA 2VTBA 2QC9A 5CEDB 1DVPA 2F37A 3APCA 2WXKA 5JINA 1HO8A 3SNXA 3L9TA 3FHEA 4Y6CA 5JMND 2L0TB 4MRUA 2A5EA 5JJTA 3CIAA 3DSUA 4PS8A 1WY6A 3FUIA 1RZ4A 3CVXA 1UOHA 3J5PA 1FCHA 4KMOA 4AY6A 1XQHA 3FULA 2RD0A 4JLGA 1MUFA 2J07A 2E2EA 3MKQA 1JWFA 3D9JA 3G2TA 1HH8A 3FUEA 2X3MA 2XRYA 3NOCD 4CZ2D 1TEZA 4HOTA 1N3JA 4UWHA 5DIZA 2BTDA 3Q73A 4B8CB 1JUQA 4BX9A 4OVVA 4I2ZA 3IXEA 1OWNA 4J8EA 4ATGA 4DLOA 1N6CA 1TYQG 4BTAA 3M5AA 1HF8A 2QYJA 2HM8A 1OWLA 3ONKA 1KZOA 4GB9A 1LD8A 2GRMA 2Y4TA 4Q96A 2FO7A 4LRZA 1XNFA 1OT8A 3LCAA 3DXMG 4EZLA 4UUCA 2CHWA 4I6JA 3TXNA 1QQEA 3CVQA 3Q78A 3SF4A 4H12A 3HNAA 3OXGA 4WWPA 2X6JA 3PEUB 2NXPA 3C72A 3HXDA 4LUNU 3FU5A 2R5SA 3SZ7A 5JJ7A 3AU5A 4F7AA 2R59A 3FTXA 3BEEA 5TH7A 1FVFA 2MYOA 4YDYA 3TWTA 1L5JA 4GTVA 3BG0B 4TXPA 2XEEA 1Q2ZA 3C98A 3ENEA 3UMVA 5ENTD 2IO3C 1NZNA 2AXUA 4KVMA 5TEGA 2LXLA 4WNFA 3IBEA 3FTYA 3PS6A 1N11A 3DEPA 3T9KA 3CHOA 1N94A 3NAWA 4DX7D 4YNPA 4JW1A 2E0IA 3KSLA 5AYWD 2KXPC 4G8KA 1E7VA 2ZU6B 4RVBA 1V55E 3RKVA 3CBPA 3QC1A 3CQCB 1U3DA 2JLBA 4I6GA 1VDYA 2P9LG 3FUMA 5B1BE 2MRIA 3ZHEB 1ML9A 2IOSA 1Y8MA 4G8LA 5JJ0A 3KMAA 2ZGGA 4XI0A 3FFLA 3S7DA 2WQHA 3ESLA 4LNGA 4EBAA 5BUZA 2ETAA 4IN3B 4C0MA 3D9IA 3CEQA 3D3MA 3KEZA 5CMYA 2WQ7A 4M7CA 3L6AA 5DBKA 3FH5A 3UUXA 3OTNA 4JHRA 5F5EA 3F9ZA 1LD7A 3R7RA 4UWGA 2DWZA 1TN6A 3TWQA 2IGQA 3I3NA 3D9HA 2UY1A 4UWKA 1N0RA 4UQZA 4PH4B 3DSTA 4HVBA 2JEKA 1O9SA 2GW1A 1DNPA 3TJPA 4HI8A 2I9CA 3EHMA 3HXCA 3SQVA 2J09A 4L7TA 3ZIMA 1TJCA 3MYVA 2XGMA 4WNGA 3J5QB 5CHEE 4DPRA 1MX4A 2P2CP 4FHKA 4UI9K 1A5EA 5J90A 3FWVA 4O60A 3UM2A 3CVUA 4LCTA 4M3OA 1S0PA 3NZUA 5G05C 1ELRA 3RSEG 4U04A 4HB5A 4I51A 3U64A 4FADA 4GZDA 2F8XK 2VTBB 2GRPB 2X6IA 4DK5A 4ANXA 2EIME 2IQCA 5FQ6A 5KCMA 1P5QA 3FUDA 3M59A 1O1TA 1DC2A 5CECB 4EZKA 4P29A 3UT8A 3BUAA 2I2OA 1OWOA 3PZ3A 4IRUA 4L1BA 4N2SA 3V31A 5JIYA 3MV3B 1SW6A 4HXIA 4GU5A 4JB8P 4LDGA 4J8FA 2OOEA 5T3RA 4V3IA 2PQNA 5KBAA 2YHCA 3SHFA 3B95A 2J08A 4Y6WA 2ETCA 1B89A 4GYYA 2XCCA 4HLLA 2V5FA 3RU0A 1O1SA 4U07A 2EIJE 1PC2A 3FU0A 3T5VA 4HS2A 3ASOE 5LX8A 1S64A 2VGYA 2XGOA 2IEJA 3SFXA 2H6HA 4DJAA 1O1RA 4ZFHA 4JDSA 1HG2A 4BFRA 2H6IA 3QWWA 4I6EA 4A3TA 2CG2A 2GRLA 2FBNA 3OAWA 1AWCB 3BO5A 4RG9A 3FUHA 2DCPA 2HR2A 3EIQC 3M53A 5FIOA 3MKQB 4EECA 2Y4UA 2Y3AA 1SA4A 3ZVVA 3HHMA 2G46A 2IO2C 3WXXA 3IV0A 5E76A 4CT4A 4NJ5A 2OEVA 1TN7A 4DX1A 2WXMA 4G26A 4AEZC 5C2YA 4IJ8A 3TG4A 3B7SA 4UQYA 3HYMB 4JZYA 3MO0A 4BWRA 2IJGX 3F9WA 1HU3A 2VSNA 3PNLB 3MO2A 5LFAA 1ZB1A 3LY9A 5EG2A 4Z68A 2DIWA 5LCWJ 3ZFWA 1H2TC 4ACLA 3KEAA 4ILIA 3CK7A 2F69A 2Y0BG 4GZ6A 3ZNGA 1G3NB 1TR4A 3QWPA 3ZYLA 4URKA 5CEAA 1NI1A 2OEWA 4NURA 3AJIA 1HE8A 4RG6A 4QENA 3DPYA 5J08A 3FTUA 4G1TA 4NIKA 3AS8A 1IYGA 3R7QA 4CDNA 4E6HA 3Q75A 4LG6A 1FPPA 3RRNB 1PY1A 3DSWA 3S2AA 2XGSA 2XEHA 3PH0C 4BUPA 4EBAG 1RW2A 4EHMA 5CERB 3ASHA 3F9YA 5FT9A 2V5QC 3CHPA 3AS5A 4NACA 3GZ1A 3CVLA 1W3BA 3LJ3A 3I5PA 1D8DA 2F0YA 2VSYA 5G2NA 2YNQA 4U8YD 1E96B 3CBMA 3RQ4A 2RFAA 3SW9A 4K5AB 2XPIA 5JA4D 4AM9A 4DUIA 4AU7A 4KBQA 1O5MA 2PQRA 1A17A 3U9WA 4YNDA 2WM9A 2ONDA 1AP7A 3LKUA 2BUGA 2AXVA 4YVOA 2VYIA 3QDNA 2XEVA 3SGHA 5BXOA 3D9LA 4B94A 4HOSA 2XS8A 1TNBA 3TGOA 3UXGA 5FZRA 1LF8A 3QOUA 3TWVA 2RKKA 4GA1A 1OCRE 3CKBA 2Q7FA 4F1PA 3APDA 3C3OA 2CFZA 1IQRA 1SQMA 3HXEA 3K5KA 3NB2A 4CGWA 3CK9A 3Q4AB 5HQ8A 5LSXA 4RZ0A 4GTTA 3UT7A 3Q5MA 1UN9A 3ZU7B 5ARFA 1JCSA 3RRMB 3SBTB 2LSVA 4ANUA 2YHEA 1E8WA 3CHQA 4APFA 3SI5A 2X6HA 4R7LA 4MBGA 3D9MA 1TNOA 3FTWA 3CV0A 4CGVA 4FP7A 4DX2A 5T5GA 5ENNA 3ONLA 3L17A 3PRZA 1WDYA 5G55A 2P9UG 4K5CA 1YMPA 4UWLA 3D9PA 5ENRD 1EF1C 2YINA 1FT1A 3FH8A 1KT1A 4KXKB 2I1JA 2KCKA 3AG3E 1E8XA 2P9SG 3ULEG 4N3CA 3DEOA 2P9IG 3C3QA 5LOZA 5ITZF 3UIOC 5D0QD 4OAUC 4AY5A 5AQAA 4A1GA 4HI9A 4GA2A 1MVXA 2RG8A 2ZISA 3AU4A 3UX4A 4YDOA 3MJWA 3PNTB 2XHEA 3CSTA 2AVPA 3E33A 3CVWA 5EX3A 3VUZA 4HBDA 4GTOA 3PZ2A 4BERA 3Q9NC 4FC8A 5HKPA 2AW6A 3ZPJA 5CRUA 1PAQA 3VV0A 4J7IA 2MOWA 1D8EA 3V2XA 3FU6A 4D10C 3X2QE 3FTSA 3S7BA 4H7YA 3B7UX 2X38A 3MGBA 3L54A 2FI7A 5AQ7A 1OXJA 4XKBA 1H6PA 3WG7E 3TWRA 5G04J 4JL0A 1DCQA 5B1AE 2FULA 2LNIA 3LY7A 1IXVA 2VJ8A 5EIBE 3KMJA 1KPSB 4JEUA 4DX5D 2DZNA 3JYSA 4DRXE 1N4SA 5CCLA 3EP0A 2GROB 5TTFA 4U0ZA 2WVIA 2F8YA 4J6IA 3DPDA 5ANLA 5KNGA 1K8KG 3B7TA 3L08A 4TUMA 3ZN3A 4J8OA 1N9AA 3VTXA 3HIZA 3MCXA 1H2VC 3Q79A 4J7WA 5EKQD 4KZCA 4TXRA 4MI0A 3FPDA 4GYWA 1E7UA 3PZDA 2P9NG 5IY5E 4YNMA 2M63A 2J8SD 3RJVA 2R2LA 4AJWA 3UIPC 2IU1A 2EQXA 4CDMA 2XCBA 3IHXA 5CBNA 4HOQA 4N5QA 4J83A 2VQ2A 2QZAA 3CGHA 4N5CA 3TXMA 4JHKA 5ENSD 4TRQA 4GCOA 4GYOA 3CK8A 4YPUA 1BD8A 2QPWA 1OUVA 1S70B 4ANWA 4AP2A 3B13A 1TJFA 4XKCA 3GZ2A 1BI8B 3RO2A 4XZ4A 2L0IA 3BQOA 1Z6TA 1H19A 2IY0C 3ZXPA 2BKKB 4EQFA 3NF1A 2PM6A 5CMWA 3MKRA 3G2SA 3DRAA 3EDTB 4GPMA 4JXTA 1HZ4A 2DYRE 3AS4A 3PUKA 4PS3A 4QEPA 4JA7A 5HI7A 4O1OA 3CBOA 5A6CA 2KZTA 2RFIA 3SWCA 4YVQC 4KT6B 4K03A 3GZSA 2V0PA 2Y1LE 2QY7A 1TNUA 4I1AA 1LTXA 4N3BA 3AG2E 4HORA 5JHNA 4XI9A 1YA0A 2HYZA 2C0LA 2R03A 1MX2A 4G25A 2FEZA 3JUIA 2H6FA 3O4ZA 4DI3A 2LAIA 1GW6A 3VTYA 3ASDA 4H7XA 4J0UA 2W5YA 1MQSA 4NQ0A 2YQ8A 3R9AB 3LY8A 4AXHA 2VGXB 2BEDA 2RFMA 4WNEA 4CCAA 4NRHB 4C48B 4HNAD 5ENOD 2NYJA 1MX6A 1Y6IA 4L9PA 3QARA 5T0KA 3HVEA 4I2WA 2V8SE 4B0ZA 4A1SA 2WXOA 1HFAA 2PZIA 3ASGA 1JCRA 3S8PA 3LJNA 1JPLA 1YYHA 3FDHA 4HOUA 3EHRA 1BLXB 1JWGA 5D0OD 3ABME 4GZ5A 2X6KA 1V54E 4RQIA 4B93B 4Q69A 5EILA 4FHJA 4MS6A 4NVQA 3CVPA 3U66A 4N2QA 4L2YA 1WG0A 4LNBA 5T4YA 3ASFA 5AQ9A 3KMTA 2FF4A 4G11A 3LS8A 5AARA 2A4ZA 4AV7A 4I17A 3EIJA 4E85A 3CQGB 4C9BB 5FZQA 4N39A 4GTMA 1N95A 3NZSA 2WMNA 4GTQA 3W9FA 3C5RA 3EU9A 1MT6A 4TXQA 2OV8A 3ULQA 5AAOA 1MHQA 4BT9A 4ABNA 2GGFA 3ASNE 3E4BA 3Q9UC 1H2UA 2IOLA 4FULA 3EHQA 3DSSA 4PDXA 3T8KA 4ANVA 5BV0A 2JV0A 4JD2G 3BG1B 4GZCA 1D9SA 1SVXA 4U7EB 3RRUA 2P9KG 1Z3XA 1OCZE 3DXKG 1IQUA 2KBXA 3S7JA 3KD7A 4YDEA 3ML9A 5EYLA 4FU3A 4DLQA 4BT8A 4AIFA 2JABA 1U3CA 2VSOE 4L23A 3TWXA 5JHAA 1E8YA 1NL4A 3CVNA 2XENA 3QJZA 3M58A 4GMJA 4DI4A 1OCCE 5BW8C 3M54A 2I1KA 5BT1A 3DSVA 3QNKA 4IJDA 2ZXWE 5BNWA 2PL2A 4CEMA 1QNFA 3LYAA 5LCWC 2FO1E 4UWFA 2H6GA 3I4RB 2I6HA 3PE3A 2VGXA 4N3AA 3FTZA 2LAHA 3EU5A 3LVQE 4K0RA 2CFUA 3D9OA 1MZCA 3NQPA 1UJJA 3SY2A 3CSFA 5AENA 4UI9J 4OAVB 4GTPA 4HRMB 4UQXA 3AG1E 4U95D 1KLXA 2UWJG 4KZ0A 4B89A 3EHNA 2QYUA 1H3IA 1UN8A 3GW4A 3TWWA 4APOA 1IKND 3ZKJA 5F6KC 3PEVB 4FLBA 4BESA 4UI9C 5CRVA 3C3RA 5G04C 4LSZE 3CKCA 1MJ0A 3G2VA 4ILHB 4L2LA 3FUJA 3JXJA 2ZGDA 3M57A 4DX6D 5LP0A 4U0UA 2HE0A 3UT4A 5FQ4A 5A7DB 1TNZA 4GCNA 4GAAA 2WXHA 2C0MA 4O6FA 1TN8A 1ELWA 3UKUG 3D9NA 1UG3A 3DALA 1XGWA 3L22A 3OS5A 4AVXA 1OWMA 1EDUA 1DCEA 2WXFA 3UM0A 1FVHA 2XPZA 4GTSA 3HVEB 3FU3A 3UTMA 2P9PG 4GMRA 4CDRA 1BU9A 1K1BA 2NSZA 1OY3D 5EN5D 2XZTG 5JHBA 2KCVA 3FP3A 3LVRE 5H7PA 2BKGA 3EUVA 2ETBA 4K5BA 4JEHA 4HQDA 4U8HA 2KATA 3LDZA 3KSQA 5AIJA 3UQ3A 4GTRA 2DVWA 2WXJA 1INZA 3CVYA 3QB2A 4O30A 4J7FA 3Q7AA 1H6OA 3MO5A 1MYOA 4ME2A 4HLEA 4LERA 1HX8A 1N6AA 1NA0A 3SFYA 2L6JA 3APFA 4RLYA 1HS6A 3FY4A 3UINC 2XRZA 4FJZA 3JCKC 4I1OB 2ZIRA 5JJ6A 1OCOE 3T5XA 4C1QA 2WXNA 3P2BA 1IHBA 3ABLE 5CCMA 3JXIA 1QYMA 3E30A 2HO1A 4JA9A 4WWOA 2KM4A 3K9IA 4MI5A 4HRNA 3O48A 4G2VA 3L13A 2R3AA 4BSXA 4EZJA 3RAUA 1KZPA 1N4PA 4B8AA 3PVLA 2AXZA 5KJMA 3JUEA 1ZBPA 5BV1A 2BF0X 3PREA 3HG0D 4FJYA 3ZYKA 2L9BA 4BX8A 4XEIG 4ATZD 2XS1A 2B0OE 3TWSA 3UKRG 1OWPA 2KZTB 5HS0A 2IONA 3B7RL 3UM1A 2LUHA 3UI2A 1N4RA 4EPZA 4GZ3A 3DWLG 2WXIA 2J9QA 3E37A 1KT0A 3ZEFA 3PDNA 1K3ZD 4RSYA 4FLHA 3VLFA 4YPAA 5AQBA 3BU8A 3JQ1A 4I43A 3FEXA 2OVFA 2WXGA 2IF4A 2X6FA 2V4HC 3AG4E 3UPVA 5FQ7A 3V79K 4E47A 5KJKA 4LEUA 2J49A 2LO6A 3TG5A 2AWIA 2KCLA 4FMUA 3CHMA 4F1SA 4MLPA 5EYPF 3RJWA 1TNYA 5EDSA 3G2UA 2WXLA 4U63A 5ENPD 1N4QA 1HG5A 2GRNB 3ISMC 3SFZA 2PNNA 3KAEA 2CHXA 3FEYA 3OPEA 2L6BA 3LPZA 3V2OA 1QZ2A 5FQ8A 3HDXA 3NOGD 3QWVA 2R02A 1YCSB 2EILE 4U8VD 1N52A 3ABKE 5D2MC 2V4LA 4WUYA 3RIBA 5EIDA 3L82A 4C0EA 4YPEA 3TWUA 2WPVA 2Y69E 3HXFA 3I4GA 3S7FA
chains in the Genus database with same CATH topology
3PEUB 2NXPA 4YVOA 3T8MA 3ZYQA 2VYIA 4HOUA 3FDHA 5ANRA 4LUNU 4FA6A 3FU5A 4PS7A 2R5SA 3Q47B 3QDNA 3SD5A 3SZ7A 1JWGA 5D0OD 4GZ5A 2XEVA 5JJ7A 2X6KA 3SGHA 3ZRHA 3AU5A 4F7AA 4Q69A 2OVBA 4Z4PA 3IKOB 3D9LA 3LXUX 4FHJA 4JC8A 4WNDA 2R59A 3FTXA 4B94A 4MS6A 4HOSA 3BEEA 4NVQA 5TH7A 1FVFA 3CLJA 3TGOA 3CVPA 3FH7A 5FZRA 3U66A 1LF8A 4N2QA 1MVHA 4L2YA 5T4YA 1L5JA 3QOUA 3ASFA 3BG0B 3KMTA 2FF4A 3Q15A 4G11A 4GA1A 3LS8A 3CKBA 3Q49B 1SZ9A 2Q7FA 1N54A 3APDA 3C98A 3ENEA 5AYFA 4G24A 2A4ZA 1Z3YA 3UMVA 5KJLA 3ZGQA 4CRWA 3RAYA 4AV7A 4I17A 3IHVA 4J8SA 3EIJA 4E85A 2CFZA 1NZNA 3CQGB 4C9BB 1X5BA 5FZQA 1IQRA 2AXUA 1SQMA 4QFVA 4KVMA 4I9EA 4N39A 5TEGA 5AJDA 4WNFA 3K5KA 3NZSA 3IBEA 2WMNA 3FTYA 3PS6A 3L16A 1MT6A 2QFCA 4CGWA 4JPSA 5CPRB 3CK9A 2OV8A 3TAXA 3Q4AB 3ULQA 2WXRA 5HQ8A 1MHQA 4BT9A 4ABNA 5LSXA 3QAQA 4RZ0A 2GGFA 3CHOA 3M56A 3E4BA 3UT7A 3D9KA 3Q5MA 4YNPA 4JW1A 1UN9A 1H2UA 2IOLA 2E0IA 4FULA 5AYWD 5ARFA 3RRMB 3SBTB 3ZYMA 4PDXA 4ANVA 4GMLA 2LSVA 3MEKA 5BV0A 1E7VA 2ZU6B 4RVBA 2YHEA 1E8WA 4ANUA 2JV0A 3OOIA 3RKVA 3CHQA 4APFA 3SI5A 3BG1B 4GZCA 3CBPA 4ACKA 3QC1A 2X6HA 3ESKA 3CQCB 3RRUA 1U3DA 2JLBA 1Z3XA 2CG3A 1NP7A 4I6GA 1VDYA 3S7JA 1IQUA 4R7LA 4XX5A 3FUMA 3KD7A 3ML9A 3URZA 4FU3A 3D9MA 2MRIA 4DLQA 3FTWA 1PEGA 3CV0A 3RK6A 4CGVA 3ZHEB 1ML9A 2IFUA 4BTBA 2IOSA 4BT8A 4AIFA 1Y8MA 5JJ0A 4TV3A 4FP7A 4A3VA 3KMAA 5F59A 1U3CA 2A5UA 3IHYA 5ENNA 5T5GA 4XI0A 3FFLA 3ONLA 3S7DA 4JVSA 2VSOE 4L23A 2WQHA 5FTPA 5JHAA 3L17A 3PRZA 1E8ZA 3ESLA 1E8YA 5F6LA 1HXIA 3CVNA 5G55A 4KYOB 3QJZA 4WWNA 4UWLA 4GMJA 4EBAA 5BUZA 3M58A 2MHKA 3D9PA 1EF1C 4IN3B 5ARGA 4DI4A 4CT0A 2W5ZA 2YINA 4C0MA 3FH8A 5BW8C 1KT1A 3D9IA 4KXKB 3M54A 2I1JA 2I1KA 3CEQA 2KCKA 5BT1A 1E8XA 3D3MA 3FTVA 3KEZA 5CMYA 5E75A 4N3CA 3TL5A 2WQ7A 3QNKA 3OXLA 4IJDA 3L6AA 5DBKA 5LOZA 3CR3A 4Q94A 3N71A 3DB5A 3FH5A 2PM7A 5D0QD 5BNWA 5BPPA 2PL2A 4CEMA 1QNFA 3UUXA 3OTNA 4AY5A 4JHRA 1SZAA 5F5EA 3LYAA 4A1GA 3F9ZA 4GA2A 5T8IA 3R7RA 2CHZA 5LCWC 1MVXA 2RG8A 4UWGA 4GA0A 4UWFA 3VLEA 3AU4A 4G23A 4W9RA 3I4RB 3UX4A 2IGQA 3I3NA 2I6HA 3MJWA 3PE3A 3ML8A 3PNTB 2VGXA 4OVUA 4PUCA 1ZKKA 2XHEA 3CSTA 2AVPA 2VSXE 4N3AA 2UY1A 4UWKA 3CVWA 5EX3A 3FTZA 4UQZA 4PH4B 3VUZA 5AJLA 2WMOA 4HVBA 3PUJA 2JEKA 2LAHA 1O9SA 2GW1A 2BQZA 1DNPA 1H6KA 4OYSA 3LVQE 3TJPA 2I9CA 3EHMA 4K0RA 2J4BA 2CFUA 3D9OA 3NQPA 2WXPA 4I1MA 2J09A 1UJJA 4L7TA 3CSFA 4J8DA 4UI9J 3ZIMA 5AENA 1TJCA 4XE0A 3MYVA 4FC8A 5EX0A 2C2LA 2XGMA 4ILGA 4WNGA 4UQXA 3FUNA 5CHEE 4DPRA 2AW6A 1KLXA 2UWJG 1UJKA 3ZPJA 4FHKA 4KZ0A 1PAQA 3EHNA 3OXFA 4UI9K 4B89A 5KJNA 3VV0A 1H3IA 1UN8A 5J90A 4J7IA 3GW4A 3FWVA 3PE4A 1H0AA 2MOWA 2NC9A 4APOA 5F6KC 3PEVB 3CHSA 4FLBA 4LCTA 4XIFA 4M3OA 4UI9C 3CVUA 1UW4B 1S0PA 3FU6A 3NZUA 4D10C 5G05C 5G04C 3CKCA 3FTSA 3S7BA 4H7YA 3B7UX 1ELRA 2X38A 3G2VA 3MGBA 4ILHB 3CVVA 3L54A 2FI7A 3FUJA 4L2LA 4U04A 3M57A 4XKBA 5LP0A 5M72A 4I51A 4U0UA 3U64A 4FADA 3UT4A 4GZDA 4BY6A 5G04J 5G05J 4JL0A 2VTBB 5FQ4A 5A7DB 2DBAA 3DBSA 2FULA 5FWQA 4GCNA 4GAAA 3ZW3A 2P58C 2X6IA 2C0MA 2WXHA 4O6FA 4I9CA 2LNIA 3LY7A 4DK5A 4ANXA 2IQCA 2VJ8A 1ELWA 3KMJA 3MZLB 3D9NA 5FQ6A 1UG3A 5KCMA 4JEUA 1P5QA 3FUDA 1XGWA 3FUFA 3DALA 3KS2A 3M59A 3JYSA 4EZKA 5CCLA 3EP0A 4P29A 4QEOA 3L22A 5TTFA 4U0ZA 2WVIA 3OS5A 3UT8A 4TUUA 3G2WA 4J6IA 1OWMA 3DPDA 4AVXA 5FZSA 4U0SA 4GPKA 1EDUA 1OWOA 2I2OA 3LEWA 5ANLA 3ZHEA 4IRUA 4KVOA 4L1BA 4N2SA 2WXFA 3B7TA 1FVHA 3L08A 1EPUA 3JQ0A 3ZN3A 2XPZA 4J8OA 3RO3A 3HVEB 3P1UA 5A23A 3VTXA 3FU3A 2ILRA 3HIZA 3MCXA 1H2VC 4CDRA 5JIYA 4JHJA 2WXQA 3SBSA 5LSZA 3MV3B 2NSZA 5C1DA 5EKQD 3FUKA 4HXIA 4KZCA 4GU5A 4A55A 3MV2B 5JHBA 4MI0A 1WAO1 2KCVA 3FPDA 4LDGA 3FP3A 3LVRE 3MA5A 4J8FA 2OOEA 5T3RA 1NA3A 4V3IA 4GYWA 1E7UA 2PQNA 3IEGA 5FJYA 2YHCA 3SHFA 3MX3A 3PZDA 4JEHA 2O8JA 4U8HA 2J08A 2KATA 3LDZA 4Y6WA 5AIJA 1B89A 4GYYA 2XCCA 3UQ3A 3U4TA 4YNMA 2WXJA 2M63A 1INZA 3ZXSA 4IULA 2V5FA 3GYZA 3RU0A 3QB2A 3CVYA 3F9XA 4U07A 3RJVA 4O30A 4J7FA 1ZU2A 2WB2A 1PC2A 1IHGA 2XPYA 3FU0A 4AJWA 3T5VA 4HS2A 3MO5A 1EYHA 2IU1A 2EQXA 4ME2A 4CDMA 2UY1B 2XCBA 3IHXA 4HLEA 2J4DA 5LX8A 4HOQA 2VGYA 2XGOA 4LERA 1HX8A 4MKTA 1N6AA 1NA0A 4DJAA 3QKYA 4J83A 2XQ0A 2L6JA 3APFA 4JDSA 1HS6A 1HG2A 2VQ2A 1WM5A 3FY4A 4BFRA 3CGHA 4N5CA 2XRZA 4FJZA 3QWWA 3JCKC 4I6EA 4JHKA 3TXMA 3QK0A 4A3TA 2CG2A 3VLDA 4TRQA 2GRLA 4I1OB 5T0MA 4GCOA 1ELKA 2FBNA 4F53A 5JJ6A 3T5XA 4GYOA 3CK8A 2WQ6A 4C1QA 2WXNA 1E90A 3OAWA 3P2BA 4YPUA 2QPWA 3BO5A 3CHRA 4RG9A 3EJNA 1OUVA 2DCPA 2HR2A 3EIQC 3FUHA 4IYPA 5CCMA 4AOFA 3M53A 3M55A 2HO1A 3MKQB 4JA9A 4WWOA 2Y4UA 4AP2A 4ANWA 2Y3AA 2KM4A 4EECA 3K9IA 4MI5A 3B13A 2LSUA 1TJFA 4XKCA 2KC7A 4F3VA 3GZ2A 3O48A 4G2VA 3L13A 3ZVVA 2R3AA 4HFGA 3U3WA 3HHMA 4BSXA 3RO2A 2R17C 4XZ4A 2L0IA 2G46A 4EZJA 4WAFA 3WXXA 3IV0A 1Z6TA 1H19A 1BPOA 5E76A 4B8AA 2VTBA 3PVLA 4CT4A 1DVPA 4NJ5A 2AXZA 5KJMA 3APCA 2WXKA 4EQFA 5JINA 1ZBPA 1HO8A 5BV1A 3NF1A 2PM6A 2BF0X 5CMWA 3MKRA 3PREA 3G2SA 2WXMA 3EDTB 4G26A 4AEZC 5C2YA 4FJYA 4JXTA 3SNXA 4IJ8A 3TG4A 3B7SA 2L9BA 4UQYA 3ZYKA 3FHEA 4Y6CA 4BX8A 1HZ4A 2L0TB 3AS4A 3HYMB 4JZYA 4MRUA 3PUKA 4PS3A 4BWRA 2IJGX 5JJTA 3F9WA 3MO0A 4QEPA 1HU3A 2VSNA 3PNLB 4JA7A 5HI7A 3CIAA 3MO2A 5LFAA 1OWPA 2KZTB 3LY9A 4PS8A 5A6CA 1WY6A 3FUIA 3CBOA 5EG2A 2DIWA 2KZTA 5LCWJ 4YVQC 2RFIA 3SWCA 4KT6B 1H2TC 2IONA 3B7RL 4K03A 3ZFWA 4ACLA 3GZSA 4ILIA 4EPZA 2V0PA 3CK7A 4GZ3A 3CVXA 2F69A 2WXIA 2J9QA 4GZ6A 2QY7A 1KT0A 1FCHA 4KMOA 4AY6A 1XQHA 3FULA 4I1AA 3QWPA 4N3BA 3ZEFA 3ZYLA 3PDNA 4URKA 2RD0A 4JLGA 4RSYA 1MUFA 4FLHA 3VLFA 4HORA 4YPAA 5JHNA 2J07A 4XI9A 1YA0A 2HYZA 2E2EA 4NURA 3MKQA 1JWFA 3D9JA 2C0LA 3G2TA 1HH8A 3JQ1A 1HE8A 3FUEA 2X3MA 4G25A 4RG6A 4QENA 4I43A 3FEXA 2FEZA 3JUIA 5J08A 2OVFA 2XRYA 2WXGA 3O4ZA 4DI3A 3FTUA 2IF4A 2X6FA 2LAIA 1GW6A 5FQ7A 3UPVA 3VTYA 4G1TA 1TEZA 4HOTA 4E47A 1N3JA 5KJKA 3ASDA 3AS8A 4H7XA 4LEUA 4UWHA 1IYGA 2J49A 2LO6A 4J0UA 3R7QA 5DIZA 3TG5A 2AWIA 2KCLA 4CDNA 2BTDA 4E6HA 2W5YA 4FMUA 4B8CB 1MQSA 1JUQA 3CHMA 4NQ0A 4F1SA 2YQ8A 4MLPA 4BX9A 4OVVA 4I2ZA 3RJWA 3RRNB 1PY1A 1OWNA 3S2AA 2XGSA 5EDSA 3G2UA 4J8EA 2WXLA 4U63A 4ATGA 3R9AB 3PH0C 1HG5A 4DLOA 4BUPA 3LY8A 4EBAG 1N6CA 4AXHA 3ASHA 3F9YA 4BTAA 3M5AA 1HF8A 2VGXB 5FT9A 3CHPA 3SFZA 2HM8A 3AS5A 1OWLA 4WNEA 4NACA 3ONKA 4CCAA 3GZ1A 4NRHB 3KAEA 2CHXA 3FEYA 3OPEA 4GB9A 3CVLA 2GRMA 1W3BA 2Y4TA 3LJ3A 3I5PA 3LPZA 4Q96A 1QZ2A 5FQ8A 2FO7A 4LRZA 2VSYA 3HDXA 1XNFA 1Y6IA 3QWVA 3QARA 5G2NA 2YNQA 5T0KA 3HVEA 4I2WA 1N52A 3LCAA 1E96B 3CBMA 3RQ4A 2V4LA 3SW9A 2XPIA 4WUYA 2V8SE 3RIBA 4EZLA 4B0ZA 4A1SA 4AM9A 2WXOA 1HFAA 2CHWA 4AU7A 2PZIA 4I6JA 4KBQA 2PQRA 1A17A 4C0EA 3TXNA 3ASGA 1QQEA 3CVQA 3U9WA 3SF4A 4H12A 4YNDA 4YPEA 2WM9A 2ONDA 3HNAA 3S8PA 3LKUA 2WPVA 3OXGA 2BUGA 1JPLA 3I4GA 4WWPA 3S7FA 2X6JA 2AXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVO A;  2VYI A;  4HOU A;  2R5S A;  3Q47 B;  3QDN A;  3SZ7 A;  5D0O D;  4GZ5 A;  2XEV A;  5JJ7 A;  4Z4P A;  4WND A;  4B94 A;  4HOS A;  3BEE A;  4NVQ A;  5TH7 A;  3TGO A;  3CVP A;  1MVH A;  5FZR A;  4N2Q A;  3QOU A;  3ASF A;  3KMT A;  2FF4 A;  3Q15 A;  4GA1 A;  3CKB A;  3Q49 B;  2Q7F A;  5AYF A;  4G24 A;  5KJL A;  3ZGQ A;  3RAY A;  4I17 A;  1NZN A;  5FZQ A;  4I9E A;  4N39 A;  5TEG A;  4WNF A;  3K5K A;  1MT6 A;  2QFC A;  4CGW A;  5CPR B;  3CK9 A;  3TAX A;  3ULQ A;  3Q4A B;  5HQ8 A;  4BT9 A;  4ABN A;  5LSX A;  4RZ0 A;  3M56 A;  3E4B A;  3Q5M A;  4YNP A;  5AYW D;  5ARF A;  2LSV A;  3MEK A;  2JV0 A;  3OOI A;  3RKV A;  3CBP A;  3ESK A;  2JLB A;  3S7J A;  3KD7 A;  3URZ A;  1PEG A;  4CGV A;  3CV0 A;  3ZHE B;  1ML9 A;  2IFU A;  4BTB A;  4BT8 A;  4AIF A;  1Y8M A;  5JJ0 A;  3KMA A;  5F59 A;  5T5G A;  4XI0 A;  3FFL A;  3S7D A;  5FTP A;  2WQH A;  5F6L A;  1HXI A;  3CVN A;  4KYO B;  3M58 A;  2MHK A;  4IN3 B;  5ARG A;  2W5Z A;  5BW8 C;  1KT1 A;  4KXK B;  3M54 A;  3CEQ A;  2KCK A;  5BT1 A;  4N3C A;  3OXL A;  4IJD A;  5DBK A;  3N71 A;  3DB5 A;  5D0Q D;  5BNW A;  2PL2 A;  3UUX A;  4AY5 A;  4JHR A;  5F5E A;  3LYA A;  3F9Z A;  4GA2 A;  5LCW C;  1MVX A;  4GA0 A;  4G23 A;  4W9R A;  2IGQ A;  2I6H A;  3PE3 A;  2VGX A;  1ZKK A;  2AVP A;  4N3A A;  2UY1 A;  5EX3 A;  4UQZ A;  3VUZ A;  1O9S A;  2GW1 A;  2BQZ A;  4J8D A;  4UI9 J;  1TJC A;  5EX0 A;  2C2L A;  2XGM A;  4WNG A;  4UQX A;  5CHE E;  1KLX A;  2UWJ G;  3ZPJ A;  5KJN A;  4UI9 K;  3OXF A;  3VV0 A;  1H3I A;  4J7I A;  3GW4 A;  3FWV A;  3PE4 A;  2NC9 A;  4APO A;  5F6K C;  4XIF A;  4UI9 C;  5G05 C;  5G04 C;  3CKC A;  3S7B A;  4H7Y A;  1ELR A;  4U04 A;  2FI7 A;  3M57 A;  4I51 A;  5M72 A;  4U0U A;  5G04 J;  5G05 J;  4JL0 A;  5A7D B;  2DBA A;  4GCN A;  2P58 C;  2C0M A;  4O6F A;  4I9C A;  2LNI A;  3LY7 A;  1ELW A;  3KMJ A;  1P5Q A;  3DAL A;  3KS2 A;  3M59 A;  3JYS A;  5CCL A;  3EP0 A;  4QEO A;  5TTF A;  4U0Z A;  3OS5 A;  5FZS A;  4U0S A;  4GPK A;  3ZHE A;  4N2S A;  3ZN3 A;  4J8O A;  3RO3 A;  3VTX A;  4CDR A;  5JIY A;  5LSZ A;  3MV3 B;  5C1D A;  5EKQ D;  3MV2 B;  4MI0 A;  1WAO 1;  2KCV A;  3FPD A;  4LDG A;  3FP3 A;  3MA5 A;  4J8F A;  2OOE A;  1NA3 A;  4GYW A;  2PQN A;  3IEG A;  5FJY A;  2YHC A;  2O8J A;  4Y6W A;  2KAT A;  1B89 A;  4GYY A;  2XCC A;  3UQ3 A;  3U4T A;  4YNM A;  2V5F A;  3GYZ A;  3RU0 A;  3F9X A;  4U07 A;  3RJV A;  4O30 A;  4J7F A;  1ZU2 A;  1PC2 A;  1IHG A;  3MO5 A;  4ME2 A;  2UY1 B;  2XCB A;  3IHX A;  4HOQ A;  2VGY A;  2XGO A;  1N6A A;  1NA0 A;  3QKY A;  4J83 A;  2L6J A;  4JDS A;  2VQ2 A;  1WM5 A;  4N5C A;  3QWW A;  5T0M A;  4GCO A;  2FBN A;  5JJ6 A;  4GYO A;  3CK8 A;  4C1Q A;  4YPU A;  2QPW A;  3BO5 A;  4RG9 A;  1OUV A;  2HR2 A;  5CCM A;  3M53 A;  3M55 A;  2HO1 A;  4JA9 A;  2Y4U A;  3K9I A;  4MI5 A;  2LSU A;  2KC7 A;  4F3V A;  3GZ2 A;  3O48 A;  4G2V A;  2R3A A;  3U3W A;  3RO2 A;  2G46 A;  3WXX A;  4NJ5 A;  5KJM A;  4EQF A;  5JIN A;  1ZBP A;  3NF1 A;  3MKR A;  3EDT B;  4G26 A;  4IJ8 A;  3TG4 A;  4UQY A;  4Y6C A;  1HZ4 A;  3AS4 A;  3HYM B;  3MO0 A;  4QEP A;  4BWR A;  5JJT A;  3F9W A;  3MO2 A;  2VSN A;  4JA7 A;  5HI7 A;  3LY9 A;  5A6C A;  3CBO A;  5EG2 A;  5LCW J;  2RFI A;  3SWC A;  4YVQ C;  3ZFW A;  3CK7 A;  4GZ3 A;  2F69 A;  2J9Q A;  4GZ6 A;  1KT0 A;  1FCH A;  4AY6 A;  1XQH A;  4I1A A;  3QWP A;  4N3B A;  3PDN A;  4JLG A;  1MUF A;  4HOR A;  4YPA A;  5JHN A;  4XI9 A;  1YA0 A;  2HYZ A;  2E2E A;  2C0L A;  1HH8 A;  4G25 A;  4RG6 A;  4QEN A;  2FEZ A;  2IF4 A;  3UPV A;  3VTY A;  4G1T A;  4HOT A;  4E47 A;  1N3J A;  5KJK A;  3ASD A;  3AS8 A;  4H7X A;  4LEU A;  1IYG A;  4J0U A;  5DIZ A;  3TG5 A;  2KCL A;  2W5Y A;  4FMU A;  4NQ0 A;  2YQ8 A;  4I2Z A;  3RJW A;  2XGS A;  4J8E A;  3R9A B;  4BUP A;  3LY8 A;  1N6C A;  3ASH A;  3F9Y A;  4BTA A;  3M5A A;  2VGX B;  5FT9 A;  3AS5 A;  4WNE A;  3GZ1 A;  4NRH B;  3KAE A;  3OPE A;  3CVL A;  1W3B A;  2Y4T A;  3LPZ A;  1QZ2 A;  2FO7 A;  2VSY A;  1XNF A;  3QWV A;  5T0K A;  4I2W A;  3LCA A;  1E96 B;  3CBM A;  3RQ4 A;  3SW9 A;  2XPI A;  4WUY A;  3RIB A;  4A1S A;  4AM9 A;  4AU7 A;  2PZI A;  4KBQ A;  2PQR A;  1A17 A;  3ASG A;  1QQE A;  3CVQ A;  3SF4 A;  4H12 A;  4YND A;  4YPE A;  2OND A;  3HNA A;  3S8P A;  3LKU A;  2WPV A;  3OXG A;  2BUG A;  3S7F A; 
#chains in the Genus database with same CATH topology
 3T8M A;  3ZYQ A;  1QBQ A;  5ANR A;  4FA6 A;  4PS7 A;  3Q47 B;  3SD5 A;  1NFI E;  3ZRH A;  2OVB A;  4Z4P A;  3IKO B;  3LXU X;  4WND A;  4JC8 A;  3SO8 A;  3UM3 A;  3CLJ A;  1JCQ A;  1MVH A;  3FH7 A;  4YDW A;  4U96 D;  5HRY A;  3Q15 A;  3NBN B;  3Q49 B;  1SZ9 A;  1N54 A;  5AYF A;  4G24 A;  1Z3Y A;  5KJL A;  3ZGQ A;  4CRW A;  3RAY A;  3IHV A;  4J8S A;  1K1A A;  1X5B A;  4QFV A;  4I9E A;  5AJD A;  4LNU D;  3L16 A;  3B7B A;  2QFC A;  4JPS A;  5CPR B;  3TAX A;  2WXR A;  3QAQ A;  1FT2 A;  3M56 A;  3D9K A;  2EIN E;  4ZHB A;  3ZYM A;  4GML A;  3MEK A;  3OOI A;  1BI7 B;  4ACK A;  3ULY A;  3ESK A;  2CG3 A;  1NP7 A;  4XX5 A;  3URZ A;  5AN8 A;  1PEG A;  3RK6 A;  2IFU A;  5BXU A;  4BTB A;  4TV3 A;  4A3V A;  5F59 A;  2A5U A;  3IHY A;  4JVS A;  5FTP A;  1E8Z A;  5F6L A;  1HXI A;  4KYO B;  4WWN A;  3Q7F A;  2MHK A;  5ARG A;  4CT0 A;  2W5Z A;  2GRQ B;  1X81 A;  3FTV A;  5E75 A;  3TL5 A;  3OXL A;  3CR3 A;  4Q94 A;  3N71 A;  3DB5 A;  5BPP A;  2PM7 A;  4J8Y A;  1SZA A;  5T8I A;  2CHZ A;  4GA0 A;  3VLE A;  4G23 A;  4W9R A;  1N0Q A;  3ML8 A;  4OVU A;  4PUC A;  1ZKK A;  3AAA C;  2VSX E;  5ENQ D;  5AJL A;  2WMO A;  3PUJ A;  3ZUV B;  2BQZ A;  1H6K A;  2EIK E;  4OYS A;  2J4B A;  4I1M A;  2WXP A;  4J8D A;  2R05 A;  4XE0 A;  5EX0 A;  2C2L A;  4ILG A;  3FUN A;  1UJK A;  5KJN A;  5FIN A;  3OXF A;  3F6Q A;  4A63 B;  3PE4 A;  2XZD G;  1H0A A;  2DZO A;  2NC9 A;  3HXB A;  4BET A;  4XIF A;  3CHS A;  1UW4 B;  3CVV A;  5KNH D;  5M72 A;  4BY6 A;  5B3S E;  5G05 J;  2DBA A;  3DBS A;  5FWQ A;  3ZW3 A;  2P58 C;  4I9C A;  4BSZ B;  3MZL B;  4F6R D;  3FUF A;  3KS2 A;  4O1P A;  4QEO A;  4TUU A;  3G2W A;  3PZ1 A;  5FZS A;  4U0S A;  4GPK A;  3LEW A;  3ZHE A;  4KVO A;  2AJA A;  1EPU A;  3JQ0 A;  3RO3 A;  3P1U A;  5A23 A;  2ILR A;  4JHJ A;  2WXQ A;  3E32 A;  5D66 A;  3SBS A;  5LSZ A;  5C1D A;  3FUK A;  2OCC E;  4A55 A;  3MV2 B;  1WAO 1;  3MA5 A;  1NA3 A;  4HRL A;  3IEG A;  5FJY A;  3MX3 A;  4BEP A;  1S63 A;  2O8J A;  3DSX A;  3U4T A;  3ZXS A;  2GRR B;  4IUL A;  3GYZ A;  3PZ4 A;  3F9X A;  1SA5 A;  1ZU2 A;  2WB2 A;  1IHG A;  2XPY A;  2LXM A;  1EYH A;  2UY1 B;  2J4D A;  3V30 A;  5KWD A;  4MKT A;  3E34 A;  3QKY A;  2XQ0 A;  3R9M A;  1U2V G;  2B6C A;  1WM5 A;  3W9G A;  4QQI A;  3QK0 A;  3VLD A;  3HRA A;  5T0M A;  1ELK A;  4F53 A;  2WQ6 A;  1E90 A;  3CHR A;  2VGE A;  3EJN A;  4IYP A;  4AOF A;  3M55 A;  2DYS E;  2LSU A;  4X8Q A;  5CBO A;  2KC7 A;  4F3V A;  1Z5S C;  4HFG A;  3U3W A;  2R17 C;  4WAF A;  4CYM D;  1BPO A;  2VTB A;  2QC9 A;  5CED B;  1DVP A;  2F37 A;  3APC A;  2WXK A;  5JIN A;  1HO8 A;  3SNX A;  3L9T A;  3FHE A;  4Y6C A;  5JMN D;  2L0T B;  4MRU A;  2A5E A;  5JJT A;  3CIA A;  3DSU A;  4PS8 A;  1WY6 A;  3FUI A;  1RZ4 A;  3CVX A;  1UOH A;  3J5P A;  1FCH A;  4KMO A;  4AY6 A;  1XQH A;  3FUL A;  2RD0 A;  4JLG A;  1MUF A;  2J07 A;  2E2E A;  3MKQ A;  1JWF A;  3D9J A;  3G2T A;  1HH8 A;  3FUE A;  2X3M A;  2XRY A;  3NOC D;  4CZ2 D;  1TEZ A;  4HOT A;  1N3J A;  4UWH A;  5DIZ A;  2BTD A;  3Q73 A;  4B8C B;  1JUQ A;  4BX9 A;  4OVV A;  4I2Z A;  3IXE A;  1OWN A;  4J8E A;  4ATG A;  4DLO A;  1N6C A;  1TYQ G;  4BTA A;  3M5A A;  1HF8 A;  2QYJ A;  2HM8 A;  1OWL A;  3ONK A;  1KZO A;  4GB9 A;  1LD8 A;  2GRM A;  2Y4T A;  4Q96 A;  2FO7 A;  4LRZ A;  1XNF A;  1OT8 A;  3LCA A;  3DXM G;  4EZL A;  4UUC A;  2CHW A;  4I6J A;  3TXN A;  1QQE A;  3CVQ A;  3Q78 A;  3SF4 A;  4H12 A;  3HNA A;  3OXG A;  4WWP A;  2X6J A;  3PEU B;  2NXP A;  3C72 A;  3HXD A;  4LUN U;  3FU5 A;  2R5S A;  3SZ7 A;  5JJ7 A;  3AU5 A;  4F7A A;  2R59 A;  3FTX A;  3BEE A;  5TH7 A;  1FVF A;  2MYO A;  4YDY A;  3TWT A;  1L5J A;  4GTV A;  3BG0 B;  4TXP A;  2XEE A;  1Q2Z A;  3C98 A;  3ENE A;  3UMV A;  5ENT D;  2IO3 C;  1NZN A;  2AXU A;  4KVM A;  5TEG A;  2LXL A;  4WNF A;  3IBE A;  3FTY A;  3PS6 A;  1N11 A;  3DEP A;  3T9K A;  3CHO A;  1N94 A;  3NAW A;  4DX7 D;  4YNP A;  4JW1 A;  2E0I A;  3KSL A;  5AYW D;  2KXP C;  4G8K A;  1E7V A;  2ZU6 B;  4RVB A;  1V55 E;  3RKV A;  3CBP A;  3QC1 A;  3CQC B;  1U3D A;  2JLB A;  4I6G A;  1VDY A;  2P9L G;  3FUM A;  5B1B E;  2MRI A;  3ZHE B;  1ML9 A;  2IOS A;  1Y8M A;  4G8L A;  5JJ0 A;  3KMA A;  2ZGG A;  4XI0 A;  3FFL A;  3S7D A;  2WQH A;  3ESL A;  4LNG A;  4EBA A;  5BUZ A;  2ETA A;  4IN3 B;  4C0M A;  3D9I A;  3CEQ A;  3D3M A;  3KEZ A;  5CMY A;  2WQ7 A;  4M7C A;  3L6A A;  5DBK A;  3FH5 A;  3UUX A;  3OTN A;  4JHR A;  5F5E A;  3F9Z A;  1LD7 A;  3R7R A;  4UWG A;  2DWZ A;  1TN6 A;  3TWQ A;  2IGQ A;  3I3N A;  3D9H A;  2UY1 A;  4UWK A;  1N0R A;  4UQZ A;  4PH4 B;  3DST A;  4HVB A;  2JEK A;  1O9S A;  2GW1 A;  1DNP A;  3TJP A;  4HI8 A;  2I9C A;  3EHM A;  3HXC A;  3SQV A;  2J09 A;  4L7T A;  3ZIM A;  1TJC A;  3MYV A;  2XGM A;  4WNG A;  3J5Q B;  5CHE E;  4DPR A;  1MX4 A;  2P2C P;  4FHK A;  4UI9 K;  1A5E A;  5J90 A;  3FWV A;  4O60 A;  3UM2 A;  3CVU A;  4LCT A;  4M3O A;  1S0P A;  3NZU A;  5G05 C;  1ELR A;  3RSE G;  4U04 A;  4HB5 A;  4I51 A;  3U64 A;  4FAD A;  4GZD A;  2F8X K;  2VTB B;  2GRP B;  2X6I A;  4DK5 A;  4ANX A;  2EIM E;  2IQC A;  5FQ6 A;  5KCM A;  1P5Q A;  3FUD A;  3M59 A;  1O1T A;  1DC2 A;  5CEC B;  4EZK A;  4P29 A;  3UT8 A;  3BUA A;  2I2O A;  1OWO A;  3PZ3 A;  4IRU A;  4L1B A;  4N2S A;  3V31 A;  5JIY A;  3MV3 B;  1SW6 A;  4HXI A;  4GU5 A;  4JB8 P;  4LDG A;  4J8F A;  2OOE A;  5T3R A;  4V3I A;  2PQN A;  5KBA A;  2YHC A;  3SHF A;  3B95 A;  2J08 A;  4Y6W A;  2ETC A;  1B89 A;  4GYY A;  2XCC A;  4HLL A;  2V5F A;  3RU0 A;  1O1S A;  4U07 A;  2EIJ E;  1PC2 A;  3FU0 A;  3T5V A;  4HS2 A;  3ASO E;  5LX8 A;  1S64 A;  2VGY A;  2XGO A;  2IEJ A;  3SFX A;  2H6H A;  4DJA A;  1O1R A;  4ZFH A;  4JDS A;  1HG2 A;  4BFR A;  2H6I A;  3QWW A;  4I6E A;  4A3T A;  2CG2 A;  2GRL A;  2FBN A;  3OAW A;  1AWC B;  3BO5 A;  4RG9 A;  3FUH A;  2DCP A;  2HR2 A;  3EIQ C;  3M53 A;  5FIO A;  3MKQ B;  4EEC A;  2Y4U A;  2Y3A A;  1SA4 A;  3ZVV A;  3HHM A;  2G46 A;  2IO2 C;  3WXX A;  3IV0 A;  5E76 A;  4CT4 A;  4NJ5 A;  2OEV A;  1TN7 A;  4DX1 A;  2WXM A;  4G26 A;  4AEZ C;  5C2Y A;  4IJ8 A;  3TG4 A;  3B7S A;  4UQY A;  3HYM B;  4JZY A;  3MO0 A;  4BWR A;  2IJG X;  3F9W A;  1HU3 A;  2VSN A;  3PNL B;  3MO2 A;  5LFA A;  1ZB1 A;  3LY9 A;  5EG2 A;  4Z68 A;  2DIW A;  5LCW J;  3ZFW A;  1H2T C;  4ACL A;  3KEA A;  4ILI A;  3CK7 A;  2F69 A;  2Y0B G;  4GZ6 A;  3ZNG A;  1G3N B;  1TR4 A;  3QWP A;  3ZYL A;  4URK A;  5CEA A;  1NI1 A;  2OEW A;  4NUR A;  3AJI A;  1HE8 A;  4RG6 A;  4QEN A;  3DPY A;  5J08 A;  3FTU A;  4G1T A;  4NIK A;  3AS8 A;  1IYG A;  3R7Q A;  4CDN A;  4E6H A;  3Q75 A;  4LG6 A;  1FPP A;  3RRN B;  1PY1 A;  3DSW A;  3S2A A;  2XGS A;  2XEH A;  3PH0 C;  4BUP A;  4EBA G;  1RW2 A;  4EHM A;  5CER B;  3ASH A;  3F9Y A;  5FT9 A;  2V5Q C;  3CHP A;  3AS5 A;  4NAC A;  3GZ1 A;  3CVL A;  1W3B A;  3LJ3 A;  3I5P A;  1D8D A;  2F0Y A;  2VSY A;  5G2N A;  2YNQ A;  4U8Y D;  1E96 B;  3CBM A;  3RQ4 A;  2RFA A;  3SW9 A;  4K5A B;  2XPI A;  5JA4 D;  4AM9 A;  4DUI A;  4AU7 A;  4KBQ A;  1O5M A;  2PQR A;  1A17 A;  3U9W A;  4YND A;  2WM9 A;  2OND A;  1AP7 A;  3LKU A;  2BUG A;  2AXV A;  4YVO A;  2VYI A;  3QDN A;  2XEV A;  3SGH A;  5BXO A;  3D9L A;  4B94 A;  4HOS A;  2XS8 A;  1TNB A;  3TGO A;  3UXG A;  5FZR A;  1LF8 A;  3QOU A;  3TWV A;  2RKK A;  4GA1 A;  1OCR E;  3CKB A;  2Q7F A;  4F1P A;  3APD A;  3C3O A;  2CFZ A;  1IQR A;  1SQM A;  3HXE A;  3K5K A;  3NB2 A;  4CGW A;  3CK9 A;  3Q4A B;  5HQ8 A;  5LSX A;  4RZ0 A;  4GTT A;  3UT7 A;  3Q5M A;  1UN9 A;  3ZU7 B;  5ARF A;  1JCS A;  3RRM B;  3SBT B;  2LSV A;  4ANU A;  2YHE A;  1E8W A;  3CHQ A;  4APF A;  3SI5 A;  2X6H A;  4R7L A;  4MBG A;  3D9M A;  1TNO A;  3FTW A;  3CV0 A;  4CGV A;  4FP7 A;  4DX2 A;  5T5G A;  5ENN A;  3ONL A;  3L17 A;  3PRZ A;  1WDY A;  5G55 A;  2P9U G;  4K5C A;  1YMP A;  4UWL A;  3D9P A;  5ENR D;  1EF1 C;  2YIN A;  1FT1 A;  3FH8 A;  1KT1 A;  4KXK B;  2I1J A;  2KCK A;  3AG3 E;  1E8X A;  2P9S G;  3ULE G;  4N3C A;  3DEO A;  2P9I G;  3C3Q A;  5LOZ A;  5ITZ F;  3UIO C;  5D0Q D;  4OAU C;  4AY5 A;  5AQA A;  4A1G A;  4HI9 A;  4GA2 A;  1MVX A;  2RG8 A;  2ZIS A;  3AU4 A;  3UX4 A;  4YDO A;  3MJW A;  3PNT B;  2XHE A;  3CST A;  2AVP A;  3E33 A;  3CVW A;  5EX3 A;  3VUZ A;  4HBD A;  4GTO A;  3PZ2 A;  4BER A;  3Q9N C;  4FC8 A;  5HKP A;  2AW6 A;  3ZPJ A;  5CRU A;  1PAQ A;  3VV0 A;  4J7I A;  2MOW A;  1D8E A;  3V2X A;  3FU6 A;  4D10 C;  3X2Q E;  3FTS A;  3S7B A;  4H7Y A;  3B7U X;  2X38 A;  3MGB A;  3L54 A;  2FI7 A;  5AQ7 A;  1OXJ A;  4XKB A;  1H6P A;  3WG7 E;  3TWR A;  5G04 J;  4JL0 A;  1DCQ A;  5B1A E;  2FUL A;  2LNI A;  3LY7 A;  1IXV A;  2VJ8 A;  5EIB E;  3KMJ A;  1KPS B;  4JEU A;  4DX5 D;  2DZN A;  3JYS A;  4DRX E;  1N4S A;  5CCL A;  3EP0 A;  2GRO B;  5TTF A;  4U0Z A;  2WVI A;  2F8Y A;  4J6I A;  3DPD A;  5ANL A;  5KNG A;  1K8K G;  3B7T A;  3L08 A;  4TUM A;  3ZN3 A;  4J8O A;  1N9A A;  3VTX A;  3HIZ A;  3MCX A;  1H2V C;  3Q79 A;  4J7W A;  5EKQ D;  4KZC A;  4TXR A;  4MI0 A;  3FPD A;  4GYW A;  1E7U A;  3PZD A;  2P9N G;  5IY5 E;  4YNM A;  2M63 A;  2J8S D;  3RJV A;  2R2L A;  4AJW A;  3UIP C;  2IU1 A;  2EQX A;  4CDM A;  2XCB A;  3IHX A;  5CBN A;  4HOQ A;  4N5Q A;  4J83 A;  2VQ2 A;  2QZA A;  3CGH A;  4N5C A;  3TXM A;  4JHK A;  5ENS D;  4TRQ A;  4GCO A;  4GYO A;  3CK8 A;  4YPU A;  1BD8 A;  2QPW A;  1OUV A;  1S70 B;  4ANW A;  4AP2 A;  3B13 A;  1TJF A;  4XKC A;  3GZ2 A;  1BI8 B;  3RO2 A;  4XZ4 A;  2L0I A;  3BQO A;  1Z6T A;  1H19 A;  2IY0 C;  3ZXP A;  2BKK B;  4EQF A;  3NF1 A;  2PM6 A;  5CMW A;  3MKR A;  3G2S A;  3DRA A;  3EDT B;  4GPM A;  4JXT A;  1HZ4 A;  2DYR E;  3AS4 A;  3PUK A;  4PS3 A;  4QEP A;  4JA7 A;  5HI7 A;  4O1O A;  3CBO A;  5A6C A;  2KZT A;  2RFI A;  3SWC A;  4YVQ C;  4KT6 B;  4K03 A;  3GZS A;  2V0P A;  2Y1L E;  2QY7 A;  1TNU A;  4I1A A;  1LTX A;  4N3B A;  3AG2 E;  4HOR A;  5JHN A;  4XI9 A;  1YA0 A;  2HYZ A;  2C0L A;  2R03 A;  1MX2 A;  4G25 A;  2FEZ A;  3JUI A;  2H6F A;  3O4Z A;  4DI3 A;  2LAI A;  1GW6 A;  3VTY A;  3ASD A;  4H7X A;  4J0U A;  2W5Y A;  1MQS A;  4NQ0 A;  2YQ8 A;  3R9A B;  3LY8 A;  4AXH A;  2VGX B;  2BED A;  2RFM A;  4WNE A;  4CCA A;  4NRH B;  4C48 B;  4HNA D;  5ENO D;  2NYJ A;  1MX6 A;  1Y6I A;  4L9P A;  3QAR A;  5T0K A;  3HVE A;  4I2W A;  2V8S E;  4B0Z A;  4A1S A;  2WXO A;  1HFA A;  2PZI A;  3ASG A;  1JCR A;  3S8P A;  3LJN A;  1JPL A;  1YYH A;  3FDH A;  4HOU A;  3EHR A;  1BLX B;  1JWG A;  5D0O D;  3ABM E;  4GZ5 A;  2X6K A;  1V54 E;  4RQI A;  4B93 B;  4Q69 A;  5EIL A;  4FHJ A;  4MS6 A;  4NVQ A;  3CVP A;  3U66 A;  4N2Q A;  4L2Y A;  1WG0 A;  4LNB A;  5T4Y A;  3ASF A;  5AQ9 A;  3KMT A;  2FF4 A;  4G11 A;  3LS8 A;  5AAR A;  2A4Z A;  4AV7 A;  4I17 A;  3EIJ A;  4E85 A;  3CQG B;  4C9B B;  5FZQ A;  4N39 A;  4GTM A;  1N95 A;  3NZS A;  2WMN A;  4GTQ A;  3W9F A;  3C5R A;  3EU9 A;  1MT6 A;  4TXQ A;  2OV8 A;  3ULQ A;  5AAO A;  1MHQ A;  4BT9 A;  4ABN A;  2GGF A;  3ASN E;  3E4B A;  3Q9U C;  1H2U A;  2IOL A;  4FUL A;  3EHQ A;  3DSS A;  4PDX A;  3T8K A;  4ANV A;  5BV0 A;  2JV0 A;  4JD2 G;  3BG1 B;  4GZC A;  1D9S A;  1SVX A;  4U7E B;  3RRU A;  2P9K G;  1Z3X A;  1OCZ E;  3DXK G;  1IQU A;  2KBX A;  3S7J A;  3KD7 A;  4YDE A;  3ML9 A;  5EYL A;  4FU3 A;  4DLQ A;  4BT8 A;  4AIF A;  2JAB A;  1U3C A;  2VSO E;  4L23 A;  3TWX A;  5JHA A;  1E8Y A;  1NL4 A;  3CVN A;  2XEN A;  3QJZ A;  3M58 A;  4GMJ A;  4DI4 A;  1OCC E;  5BW8 C;  3M54 A;  2I1K A;  5BT1 A;  3DSV A;  3QNK A;  4IJD A;  2ZXW E;  5BNW A;  2PL2 A;  4CEM A;  1QNF A;  3LYA A;  5LCW C;  2FO1 E;  4UWF A;  2H6G A;  3I4R B;  2I6H A;  3PE3 A;  2VGX A;  4N3A A;  3FTZ A;  2LAH A;  3EU5 A;  3LVQ E;  4K0R A;  2CFU A;  3D9O A;  1MZC A;  3NQP A;  1UJJ A;  3SY2 A;  3CSF A;  5AEN A;  4UI9 J;  4OAV B;  4GTP A;  4HRM B;  4UQX A;  3AG1 E;  4U95 D;  1KLX A;  2UWJ G;  4KZ0 A;  4B89 A;  3EHN A;  2QYU A;  1H3I A;  1UN8 A;  3GW4 A;  3TWW A;  4APO A;  1IKN D;  3ZKJ A;  5F6K C;  3PEV B;  4FLB A;  4BES A;  4UI9 C;  5CRV A;  3C3R A;  5G04 C;  4LSZ E;  3CKC A;  1MJ0 A;  3G2V A;  4ILH B;  4L2L A;  3FUJ A;  3JXJ A;  2ZGD A;  3M57 A;  4DX6 D;  5LP0 A;  4U0U A;  2HE0 A;  3UT4 A;  5FQ4 A;  5A7D B;  1TNZ A;  4GCN A;  4GAA A;  2WXH A;  2C0M A;  4O6F A;  1TN8 A;  1ELW A;  3UKU G;  3D9N A;  1UG3 A;  3DAL A;  1XGW A;  3L22 A;  3OS5 A;  4AVX A;  1OWM A;  1EDU A;  1DCE A;  2WXF A;  3UM0 A;  1FVH A;  2XPZ A;  4GTS A;  3HVE B;  3FU3 A;  3UTM A;  2P9P G;  4GMR A;  4CDR A;  1BU9 A;  1K1B A;  2NSZ A;  1OY3 D;  5EN5 D;  2XZT G;  5JHB A;  2KCV A;  3FP3 A;  3LVR E;  5H7P A;  2BKG A;  3EUV A;  2ETB A;  4K5B A;  4JEH A;  4HQD A;  4U8H A;  2KAT A;  3LDZ A;  3KSQ A;  5AIJ A;  3UQ3 A;  4GTR A;  2DVW A;  2WXJ A;  1INZ A;  3CVY A;  3QB2 A;  4O30 A;  4J7F A;  3Q7A A;  1H6O A;  3MO5 A;  1MYO A;  4ME2 A;  4HLE A;  4LER A;  1HX8 A;  1N6A A;  1NA0 A;  3SFY A;  2L6J A;  3APF A;  4RLY A;  1HS6 A;  3FY4 A;  3UIN C;  2XRZ A;  4FJZ A;  3JCK C;  4I1O B;  2ZIR A;  5JJ6 A;  1OCO E;  3T5X A;  4C1Q A;  2WXN A;  3P2B A;  1IHB A;  3ABL E;  5CCM A;  3JXI A;  1QYM A;  3E30 A;  2HO1 A;  4JA9 A;  4WWO A;  2KM4 A;  3K9I A;  4MI5 A;  4HRN A;  3O48 A;  4G2V A;  3L13 A;  2R3A A;  4BSX A;  4EZJ A;  3RAU A;  1KZP A;  1N4P A;  4B8A A;  3PVL A;  2AXZ A;  5KJM A;  3JUE A;  1ZBP A;  5BV1 A;  2BF0 X;  3PRE A;  3HG0 D;  4FJY A;  3ZYK A;  2L9B A;  4BX8 A;  4XEI G;  4ATZ D;  2XS1 A;  2B0O E;  3TWS A;  3UKR G;  1OWP A;  2KZT B;  5HS0 A;  2ION A;  3B7R L;  3UM1 A;  2LUH A;  3UI2 A;  1N4R A;  4EPZ A;  4GZ3 A;  3DWL G;  2WXI A;  2J9Q A;  3E37 A;  1KT0 A;  3ZEF A;  3PDN A;  1K3Z D;  4RSY A;  4FLH A;  3VLF A;  4YPA A;  5AQB A;  3BU8 A;  3JQ1 A;  4I43 A;  3FEX A;  2OVF A;  2WXG A;  2IF4 A;  2X6F A;  2V4H C;  3AG4 E;  3UPV A;  5FQ7 A;  3V79 K;  4E47 A;  5KJK A;  4LEU A;  2J49 A;  2LO6 A;  3TG5 A;  2AWI A;  2KCL A;  4FMU A;  3CHM A;  4F1S A;  4MLP A;  5EYP F;  3RJW A;  1TNY A;  5EDS A;  3G2U A;  2WXL A;  4U63 A;  5ENP D;  1N4Q A;  1HG5 A;  2GRN B;  3ISM C;  3SFZ A;  2PNN A;  3KAE A;  2CHX A;  3FEY A;  3OPE A;  2L6B A;  3LPZ A;  3V2O A;  1QZ2 A;  5FQ8 A;  3HDX A;  3NOG D;  3QWV A;  2R02 A;  1YCS B;  2EIL E;  4U8V D;  1N52 A;  3ABK E;  5D2M C;  2V4L A;  4WUY A;  3RIB A;  5EID A;  3L82 A;  4C0E A;  4YPE A;  3TWU A;  2WPV A;  2Y69 E;  3HXF A;  3I4G A;  3S7F A; 
#chains in the Genus database with same CATH homology
 3PEU B;  2NXP A;  4YVO A;  3T8M A;  3ZYQ A;  2VYI A;  4HOU A;  3FDH A;  5ANR A;  4LUN U;  4FA6 A;  3FU5 A;  4PS7 A;  2R5S A;  3Q47 B;  3QDN A;  3SD5 A;  3SZ7 A;  1JWG A;  5D0O D;  4GZ5 A;  2XEV A;  5JJ7 A;  2X6K A;  3SGH A;  3ZRH A;  3AU5 A;  4F7A A;  4Q69 A;  2OVB A;  4Z4P A;  3IKO B;  3D9L A;  3LXU X;  4FHJ A;  4JC8 A;  4WND A;  2R59 A;  3FTX A;  4B94 A;  4MS6 A;  4HOS A;  3BEE A;  4NVQ A;  5TH7 A;  1FVF A;  3CLJ A;  3TGO A;  3CVP A;  3FH7 A;  5FZR A;  3U66 A;  1LF8 A;  4N2Q A;  1MVH A;  4L2Y A;  5T4Y A;  1L5J A;  3QOU A;  3ASF A;  3BG0 B;  3KMT A;  2FF4 A;  3Q15 A;  4G11 A;  4GA1 A;  3LS8 A;  3CKB A;  3Q49 B;  1SZ9 A;  2Q7F A;  1N54 A;  3APD A;  3C98 A;  3ENE A;  5AYF A;  4G24 A;  2A4Z A;  1Z3Y A;  3UMV A;  5KJL A;  3ZGQ A;  4CRW A;  3RAY A;  4AV7 A;  4I17 A;  3IHV A;  4J8S A;  3EIJ A;  4E85 A;  2CFZ A;  1NZN A;  3CQG B;  4C9B B;  1X5B A;  5FZQ A;  1IQR A;  2AXU A;  1SQM A;  4QFV A;  4KVM A;  4I9E A;  4N39 A;  5TEG A;  5AJD A;  4WNF A;  3K5K A;  3NZS A;  3IBE A;  2WMN A;  3FTY A;  3PS6 A;  3L16 A;  1MT6 A;  2QFC A;  4CGW A;  4JPS A;  5CPR B;  3CK9 A;  2OV8 A;  3TAX A;  3Q4A B;  3ULQ A;  2WXR A;  5HQ8 A;  1MHQ A;  4BT9 A;  4ABN A;  5LSX A;  3QAQ A;  4RZ0 A;  2GGF A;  3CHO A;  3M56 A;  3E4B A;  3UT7 A;  3D9K A;  3Q5M A;  4YNP A;  4JW1 A;  1UN9 A;  1H2U A;  2IOL A;  2E0I A;  4FUL A;  5AYW D;  5ARF A;  3RRM B;  3SBT B;  3ZYM A;  4PDX A;  4ANV A;  4GML A;  2LSV A;  3MEK A;  5BV0 A;  1E7V A;  2ZU6 B;  4RVB A;  2YHE A;  1E8W A;  4ANU A;  2JV0 A;  3OOI A;  3RKV A;  3CHQ A;  4APF A;  3SI5 A;  3BG1 B;  4GZC A;  3CBP A;  4ACK A;  3QC1 A;  2X6H A;  3ESK A;  3CQC B;  3RRU A;  1U3D A;  2JLB A;  1Z3X A;  2CG3 A;  1NP7 A;  4I6G A;  1VDY A;  3S7J A;  1IQU A;  4R7L A;  4XX5 A;  3FUM A;  3KD7 A;  3ML9 A;  3URZ A;  4FU3 A;  3D9M A;  2MRI A;  4DLQ A;  3FTW A;  1PEG A;  3CV0 A;  3RK6 A;  4CGV A;  3ZHE B;  1ML9 A;  2IFU A;  4BTB A;  2IOS A;  4BT8 A;  4AIF A;  1Y8M A;  5JJ0 A;  4TV3 A;  4FP7 A;  4A3V A;  3KMA A;  5F59 A;  1U3C A;  2A5U A;  3IHY A;  5ENN A;  5T5G A;  4XI0 A;  3FFL A;  3ONL A;  3S7D A;  4JVS A;  2VSO E;  4L23 A;  2WQH A;  5FTP A;  5JHA A;  3L17 A;  3PRZ A;  1E8Z A;  3ESL A;  1E8Y A;  5F6L A;  1HXI A;  3CVN A;  5G55 A;  4KYO B;  3QJZ A;  4WWN A;  4UWL A;  4GMJ A;  4EBA A;  5BUZ A;  3M58 A;  2MHK A;  3D9P A;  1EF1 C;  4IN3 B;  5ARG A;  4DI4 A;  4CT0 A;  2W5Z A;  2YIN A;  4C0M A;  3FH8 A;  5BW8 C;  1KT1 A;  3D9I A;  4KXK B;  3M54 A;  2I1J A;  2I1K A;  3CEQ A;  2KCK A;  5BT1 A;  1E8X A;  3D3M A;  3FTV A;  3KEZ A;  5CMY A;  5E75 A;  4N3C A;  3TL5 A;  2WQ7 A;  3QNK A;  3OXL A;  4IJD A;  3L6A A;  5DBK A;  5LOZ A;  3CR3 A;  4Q94 A;  3N71 A;  3DB5 A;  3FH5 A;  2PM7 A;  5D0Q D;  5BNW A;  5BPP A;  2PL2 A;  4CEM A;  1QNF A;  3UUX A;  3OTN A;  4AY5 A;  4JHR A;  1SZA A;  5F5E A;  3LYA A;  4A1G A;  3F9Z A;  4GA2 A;  5T8I A;  3R7R A;  2CHZ A;  5LCW C;  1MVX A;  2RG8 A;  4UWG A;  4GA0 A;  4UWF A;  3VLE A;  3AU4 A;  4G23 A;  4W9R A;  3I4R B;  3UX4 A;  2IGQ A;  3I3N A;  2I6H A;  3MJW A;  3PE3 A;  3ML8 A;  3PNT B;  2VGX A;  4OVU A;  4PUC A;  1ZKK A;  2XHE A;  3CST A;  2AVP A;  2VSX E;  4N3A A;  2UY1 A;  4UWK A;  3CVW A;  5EX3 A;  3FTZ A;  4UQZ A;  4PH4 B;  3VUZ A;  5AJL A;  2WMO A;  4HVB A;  3PUJ A;  2JEK A;  2LAH A;  1O9S A;  2GW1 A;  2BQZ A;  1DNP A;  1H6K A;  4OYS A;  3LVQ E;  3TJP A;  2I9C A;  3EHM A;  4K0R A;  2J4B A;  2CFU A;  3D9O A;  3NQP A;  2WXP A;  4I1M A;  2J09 A;  1UJJ A;  4L7T A;  3CSF A;  4J8D A;  4UI9 J;  3ZIM A;  5AEN A;  1TJC A;  4XE0 A;  3MYV A;  4FC8 A;  5EX0 A;  2C2L A;  2XGM A;  4ILG A;  4WNG A;  4UQX A;  3FUN A;  5CHE E;  4DPR A;  2AW6 A;  1KLX A;  2UWJ G;  1UJK A;  3ZPJ A;  4FHK A;  4KZ0 A;  1PAQ A;  3EHN A;  3OXF A;  4UI9 K;  4B89 A;  5KJN A;  3VV0 A;  1H3I A;  1UN8 A;  5J90 A;  4J7I A;  3GW4 A;  3FWV A;  3PE4 A;  1H0A A;  2MOW A;  2NC9 A;  4APO A;  5F6K C;  3PEV B;  3CHS A;  4FLB A;  4LCT A;  4XIF A;  4M3O A;  4UI9 C;  3CVU A;  1UW4 B;  1S0P A;  3FU6 A;  3NZU A;  4D10 C;  5G05 C;  5G04 C;  3CKC A;  3FTS A;  3S7B A;  4H7Y A;  3B7U X;  1ELR A;  2X38 A;  3G2V A;  3MGB A;  4ILH B;  3CVV A;  3L54 A;  2FI7 A;  3FUJ A;  4L2L A;  4U04 A;  3M57 A;  4XKB A;  5LP0 A;  5M72 A;  4I51 A;  4U0U A;  3U64 A;  4FAD A;  3UT4 A;  4GZD A;  4BY6 A;  5G04 J;  5G05 J;  4JL0 A;  2VTB B;  5FQ4 A;  5A7D B;  2DBA A;  3DBS A;  2FUL A;  5FWQ A;  4GCN A;  4GAA A;  3ZW3 A;  2P58 C;  2X6I A;  2C0M A;  2WXH A;  4O6F A;  4I9C A;  2LNI A;  3LY7 A;  4DK5 A;  4ANX A;  2IQC A;  2VJ8 A;  1ELW A;  3KMJ A;  3MZL B;  3D9N A;  5FQ6 A;  1UG3 A;  5KCM A;  4JEU A;  1P5Q A;  3FUD A;  1XGW A;  3FUF A;  3DAL A;  3KS2 A;  3M59 A;  3JYS A;  4EZK A;  5CCL A;  3EP0 A;  4P29 A;  4QEO A;  3L22 A;  5TTF A;  4U0Z A;  2WVI A;  3OS5 A;  3UT8 A;  4TUU A;  3G2W A;  4J6I A;  1OWM A;  3DPD A;  4AVX A;  5FZS A;  4U0S A;  4GPK A;  1EDU A;  1OWO A;  2I2O A;  3LEW A;  5ANL A;  3ZHE A;  4IRU A;  4KVO A;  4L1B A;  4N2S A;  2WXF A;  3B7T A;  1FVH A;  3L08 A;  1EPU A;  3JQ0 A;  3ZN3 A;  2XPZ A;  4J8O A;  3RO3 A;  3HVE B;  3P1U A;  5A23 A;  3VTX A;  3FU3 A;  2ILR A;  3HIZ A;  3MCX A;  1H2V C;  4CDR A;  5JIY A;  4JHJ A;  2WXQ A;  3SBS A;  5LSZ A;  3MV3 B;  2NSZ A;  5C1D A;  5EKQ D;  3FUK A;  4HXI A;  4KZC A;  4GU5 A;  4A55 A;  3MV2 B;  5JHB A;  4MI0 A;  1WAO 1;  2KCV A;  3FPD A;  4LDG A;  3FP3 A;  3LVR E;  3MA5 A;  4J8F A;  2OOE A;  5T3R A;  1NA3 A;  4V3I A;  4GYW A;  1E7U A;  2PQN A;  3IEG A;  5FJY A;  2YHC A;  3SHF A;  3MX3 A;  3PZD A;  4JEH A;  2O8J A;  4U8H A;  2J08 A;  2KAT A;  3LDZ A;  4Y6W A;  5AIJ A;  1B89 A;  4GYY A;  2XCC A;  3UQ3 A;  3U4T A;  4YNM A;  2WXJ A;  2M63 A;  1INZ A;  3ZXS A;  4IUL A;  2V5F A;  3GYZ A;  3RU0 A;  3QB2 A;  3CVY A;  3F9X A;  4U07 A;  3RJV A;  4O30 A;  4J7F A;  1ZU2 A;  2WB2 A;  1PC2 A;  1IHG A;  2XPY A;  3FU0 A;  4AJW A;  3T5V A;  4HS2 A;  3MO5 A;  1EYH A;  2IU1 A;  2EQX A;  4ME2 A;  4CDM A;  2UY1 B;  2XCB A;  3IHX A;  4HLE A;  2J4D A;  5LX8 A;  4HOQ A;  2VGY A;  2XGO A;  4LER A;  1HX8 A;  4MKT A;  1N6A A;  1NA0 A;  4DJA A;  3QKY A;  4J83 A;  2XQ0 A;  2L6J A;  3APF A;  4JDS A;  1HS6 A;  1HG2 A;  2VQ2 A;  1WM5 A;  3FY4 A;  4BFR A;  3CGH A;  4N5C A;  2XRZ A;  4FJZ A;  3QWW A;  3JCK C;  4I6E A;  4JHK A;  3TXM A;  3QK0 A;  4A3T A;  2CG2 A;  3VLD A;  4TRQ A;  2GRL A;  4I1O B;  5T0M A;  4GCO A;  1ELK A;  2FBN A;  4F53 A;  5JJ6 A;  3T5X A;  4GYO A;  3CK8 A;  2WQ6 A;  4C1Q A;  2WXN A;  1E90 A;  3OAW A;  3P2B A;  4YPU A;  2QPW A;  3BO5 A;  3CHR A;  4RG9 A;  3EJN A;  1OUV A;  2DCP A;  2HR2 A;  3EIQ C;  3FUH A;  4IYP A;  5CCM A;  4AOF A;  3M53 A;  3M55 A;  2HO1 A;  3MKQ B;  4JA9 A;  4WWO A;  2Y4U A;  4AP2 A;  4ANW A;  2Y3A A;  2KM4 A;  4EEC A;  3K9I A;  4MI5 A;  3B13 A;  2LSU A;  1TJF A;  4XKC A;  2KC7 A;  4F3V A;  3GZ2 A;  3O48 A;  4G2V A;  3L13 A;  3ZVV A;  2R3A A;  4HFG A;  3U3W A;  3HHM A;  4BSX A;  3RO2 A;  2R17 C;  4XZ4 A;  2L0I A;  2G46 A;  4EZJ A;  4WAF A;  3WXX A;  3IV0 A;  1Z6T A;  1H19 A;  1BPO A;  5E76 A;  4B8A A;  2VTB A;  3PVL A;  4CT4 A;  1DVP A;  4NJ5 A;  2AXZ A;  5KJM A;  3APC A;  2WXK A;  4EQF A;  5JIN A;  1ZBP A;  1HO8 A;  5BV1 A;  3NF1 A;  2PM6 A;  2BF0 X;  5CMW A;  3MKR A;  3PRE A;  3G2S A;  2WXM A;  3EDT B;  4G26 A;  4AEZ C;  5C2Y A;  4FJY A;  4JXT A;  3SNX A;  4IJ8 A;  3TG4 A;  3B7S A;  2L9B A;  4UQY A;  3ZYK A;  3FHE A;  4Y6C A;  4BX8 A;  1HZ4 A;  2L0T B;  3AS4 A;  3HYM B;  4JZY A;  4MRU A;  3PUK A;  4PS3 A;  4BWR A;  2IJG X;  5JJT A;  3F9W A;  3MO0 A;  4QEP A;  1HU3 A;  2VSN A;  3PNL B;  4JA7 A;  5HI7 A;  3CIA A;  3MO2 A;  5LFA A;  1OWP A;  2KZT B;  3LY9 A;  4PS8 A;  5A6C A;  1WY6 A;  3FUI A;  3CBO A;  5EG2 A;  2DIW A;  2KZT A;  5LCW J;  4YVQ C;  2RFI A;  3SWC A;  4KT6 B;  1H2T C;  2ION A;  3B7R L;  4K03 A;  3ZFW A;  4ACL A;  3GZS A;  4ILI A;  4EPZ A;  2V0P A;  3CK7 A;  4GZ3 A;  3CVX A;  2F69 A;  2WXI A;  2J9Q A;  4GZ6 A;  2QY7 A;  1KT0 A;  1FCH A;  4KMO A;  4AY6 A;  1XQH A;  3FUL A;  4I1A A;  3QWP A;  4N3B A;  3ZEF A;  3ZYL A;  3PDN A;  4URK A;  2RD0 A;  4JLG A;  4RSY A;  1MUF A;  4FLH A;  3VLF A;  4HOR A;  4YPA A;  5JHN A;  2J07 A;  4XI9 A;  1YA0 A;  2HYZ A;  2E2E A;  4NUR A;  3MKQ A;  1JWF A;  3D9J A;  2C0L A;  3G2T A;  1HH8 A;  3JQ1 A;  1HE8 A;  3FUE A;  2X3M A;  4G25 A;  4RG6 A;  4QEN A;  4I43 A;  3FEX A;  2FEZ A;  3JUI A;  5J08 A;  2OVF A;  2XRY A;  2WXG A;  3O4Z A;  4DI3 A;  3FTU A;  2IF4 A;  2X6F A;  2LAI A;  1GW6 A;  5FQ7 A;  3UPV A;  3VTY A;  4G1T A;  1TEZ A;  4HOT A;  4E47 A;  1N3J A;  5KJK A;  3ASD A;  3AS8 A;  4H7X A;  4LEU A;  4UWH A;  1IYG A;  2J49 A;  2LO6 A;  4J0U A;  3R7Q A;  5DIZ A;  3TG5 A;  2AWI A;  2KCL A;  4CDN A;  2BTD A;  4E6H A;  2W5Y A;  4FMU A;  4B8C B;  1MQS A;  1JUQ A;  3CHM A;  4NQ0 A;  4F1S A;  2YQ8 A;  4MLP A;  4BX9 A;  4OVV A;  4I2Z A;  3RJW A;  3RRN B;  1PY1 A;  1OWN A;  3S2A A;  2XGS A;  5EDS A;  3G2U A;  4J8E A;  2WXL A;  4U63 A;  4ATG A;  3R9A B;  3PH0 C;  1HG5 A;  4DLO A;  4BUP A;  3LY8 A;  4EBA G;  1N6C A;  4AXH A;  3ASH A;  3F9Y A;  4BTA A;  3M5A A;  1HF8 A;  2VGX B;  5FT9 A;  3CHP A;  3SFZ A;  2HM8 A;  3AS5 A;  1OWL A;  4WNE A;  4NAC A;  3ONK A;  4CCA A;  3GZ1 A;  4NRH B;  3KAE A;  2CHX A;  3FEY A;  3OPE A;  4GB9 A;  3CVL A;  2GRM A;  1W3B A;  2Y4T A;  3LJ3 A;  3I5P A;  3LPZ A;  4Q96 A;  1QZ2 A;  5FQ8 A;  2FO7 A;  4LRZ A;  2VSY A;  3HDX A;  1XNF A;  1Y6I A;  3QWV A;  3QAR A;  5G2N A;  2YNQ A;  5T0K A;  3HVE A;  4I2W A;  1N52 A;  3LCA A;  1E96 B;  3CBM A;  3RQ4 A;  2V4L A;  3SW9 A;  2XPI A;  4WUY A;  2V8S E;  3RIB A;  4EZL A;  4B0Z A;  4A1S A;  4AM9 A;  2WXO A;  1HFA A;  2CHW A;  4AU7 A;  2PZI A;  4I6J A;  4KBQ A;  2PQR A;  1A17 A;  4C0E A;  3TXN A;  3ASG A;  1QQE A;  3CVQ A;  3U9W A;  3SF4 A;  4H12 A;  4YND A;  4YPE A;  2WM9 A;  2OND A;  3HNA A;  3S8P A;  3LKU A;  2WPV A;  3OXG A;  2BUG A;  1JPL A;  3I4G A;  4WWP A;  3S7F A;  2X6J A;  2AXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...