5ARGA

Smyd2 in complex with sgc probe bay-598
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
426
structure length
426
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
total genus 151
structure length 426
sequence length 426
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5argA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5argA01
4ME2A 4GYWA 2VSYA 1W3BA 3Q47B 5KJNA 3LY9A 3Q15A 2IGQA 1MUFA 5JJTA 3ZPJA 1N3JA 2LNIA 4MI0A 2XGOA 5KJLA 1KT1A 3PE4A 3UQ3A 3QOUA 4HOSA 1QZ2A 2HYZA 3AS4A 3NF1A 5TTFA 4J0UA 3VTYA 5FT9A 2R5SA 2VSNA 3ASDA 3Q5MA 4NVQA 3CK8A 5C1DA 3UPVA 2FBNA 2PL2A 4N2QA 2KC7A 3VUZA 2JLBA 4RG6A 2AVPA 3PE3A 4J8DA 1ELRA 1XQHA 4N2SA 4GZ3A 1HXIA 4YVOA 2KCVA 3S7DA 1HZ4A 1WM5A 5D0OD 4LDGA 5BNWA 4U0UA 4U0ZA 5EKQD 4G24A 3QWPA 5JINA 3KS2A 1IHGA 5TEGA 3LPZA 4UQYA 3CVQA 5FZSA 5FZRA 3N71A 2Q7FA 2XGMA 3EDTB 2YHCA 4QEPA 1O9SA 2HO1A 5F6KC 3ESKA 3CBMA 3QWVA 4IJDA 4CGVA 4G25A 5ARFA 1NA0A 4CGWA 4J8EA 4BTBA 4GYYA 5JJ7A 2UY1B 4UI9K 4C1QA 2XPIA 1TJCA 2VYIA 4YNPA 4J8FA 3CEQA 3LCAA 3ASFA 3O48A 3M56A 2L6JA 4YPUA 3M53A 4YPAA 4U07A 3M55A 3E4BA 3CVNA 4WNFA 4AY6A 4F3VA 1FCHA 5T5GA 2PQNA 4AIFA 1WAO1 4KBQA 4GPKA 4KXKB 3FPDA 2NC9A 4G1TA 4JDSA 4WNGA 5JHNA 4I2WA 4JHRA 3CV0A 2VGXA 3TG4A 4JLGA 3UUXA 3CBOA 4BTAA 4Z4PA 4AY5A 2GW1A 3M59A 4U04A 5M72A 3SF4A 3KD7A 3PDNA 3BO5A 3RU0A 2VQ2A 3FFLA 3TAXA 3F9WA 5A7DB 4GZ6A 4J8OA 3EP0A 3MKRA 3FP3A 5FJYA 1NA3A 4G23A 1ML9A 4CDRA 5HQ8A 2Y4UA 5BW8C 3K9IA 3ZHEB 1PC2A 1HH8A 1ZU2A 3MA5A 4WNDA 4I17A 5LCWJ 4FMUA 4QEOA 3AS8A 4N3AA 2PQRA 1KLXA 4JA7A 3SZ7A 5TH7A 3S7BA 5LCWC 4N3CA 4H7YA 2W5YA 5G05J 4B94A 5KJKA 3LY8A 2LSVA 4E47A 5DBKA 5EG2A 3RIBA 1PEGA 3GW4A 4N39A 4H12A 4APOA 2QPWA 3M5AA 3DB5A 3U4TA 5CCLA 3SW9A 2FO7A 5CHEE 4J7FA 3ZN3A 3QKYA 5AYFA 2KCKA 5CPRB 4GYOA 4HOTA 5JJ6A 3RJWA 2E2EA 5T0KA 3KMAA 3AS5A 2WPVA 4U0SA 5F6LA 3BEEA 4GA0A 3CK9A 2BQZA 5LSXA 3RO3A 3KMJA 3CKBA 3S7FA 4KYOB 3LY7A 3FWVA 2XCCA 3ASGA 4EQFA 4BT9A 2FI7A 4HOQA 4UQXA 1IYGA 4UI9J 3OS5A 2JV0A 2VGYA 3GZ2A 3CVPA 3KMTA 4XI0A 3OXLA 2WQHA 1E96B 3HYMB 2O8JA 4UI9C 3CK7A 4Y6CA 5G04J 3DALA 2ONDA 1H3IA 5F5EA 2KCLA 1ZBPA 5BT1A 5F59A 3TG5A 3JYSA 5G04C 4Y6WA 3S8PA 4JL0A 2IFUA 4AM9A 2C0MA 4I1AA 2C2LA 4IN3B 2RFIA 1MVXA 3IEGA 4UQZA 2G46A 3GZ1A 2QFCA 1Y8MA 5FTPA 1ELWA 2Y4TA 1N6CA 4G26A 3RJVA 5D0QD 2UWJG 3OOIA 1A17A 3K5KA 3GYZA 3TGOA 5JIYA 4JA9A 4HOUA 3HNAA 3RO2A 1P5QA 3F9ZA 4ABNA 2XGSA 2P58C 5EX0A 2VGXB 4GZ5A 4W9RA 4WNEA 3M54A 3QDNA 4YVQC 4WUYA 5EX3A 2LSUA 4YNMA 1ZKKA 4GA2A 2FF4A 3U3WA 3OXFA 3RQ4A 4BWRA 5AYWD 5JJ0A 4A1SA 4GCOA 5ARGA 4I51A 1NZNA 3MO0A 3R9AB 3ZGQA 3ZFWA 4NRHB 5G05C 3F9YA 2J9QA 3M57A 2DBAA 2UY1A 4I9CA 3F9XA 2I6HA 3KAEA 3S7JA 2XCBA 4XIFA 4LEUA 3MO2A 4J7IA 5DIZA 2W5ZA 3CKCA 2BUGA 4I9EA 5FZQA 4G2VA 4RZ0A 3VTXA 4GA1A 4I2ZA 1KT0A 3RKVA 1QQEA 1XNFA 4XI9A 3ASHA 4QENA 3RAYA 4GCNA 4H7XA 1MVHA 4MI5A 3CVLA 3MV3B 3ULQA 4O6FA 4O30A 3Q4AB 1YA0A 4RG9A 1OUVA 4N3BA 2FEZA 2PZIA 3MV2B 4NQ0A 4IJ8A 2IF4A 3MEKA 2R3AA 4BT8A 5LSZA 3M58A 2XEVA 2HR2A 3SWCA 3IHXA 2OOEA 5KJMA 3VV0A 2V5FA 4NJ5A 2KATA 1B89A 2YQ8A 2C0LA 5CCMA 1MT6A 4J83A 4YPEA 3OXGA 5HI7A 5T0MA 3WXXA 3ZHEA 3QWWA 4YNDA 1N6AA 4BUPA 3LYAA 4AU7A 3OPEA 3CBPA 4HORA 4N5CA 3URZA 2F69A 2MHKA 3MO5A 5A6CA 3Q49B 3LKUA
chains in the Genus database with same CATH superfamily
1O5MA 3Q47B 2IGQA 5AARA 2XGOA 5AQ9A 1KT1A 1O1RA 3Q9UC 3UQ3A 3AS4A 1JCSA 3VTYA 2JABA 2P9KG 2YNQA 5FT9A 2VSNA 3DPYA 1TNBA 4NVQA 1EDUA 5C1DA 3HG0D 1FT2A 2HM8A 2KC7A 2H6IA 2JLBA 3CHPA 4OAUC 5IY5E 2J08A 4GZ3A 3E33A 4LERA 4YVOA 4DJAA 3PS6A 4A1GA 5D0OD 4GMLA 4C48B 5BNWA 5T4YA 1BI8B 2Y3AA 5JINA 1IHGA 3SHFA 1MX2A 5EYPF 5TEGA 2XRYA 3KEZA 5CBOA 4PH4B 1EYHA 3FU6A 4UUCA 5KCMA 1MX4A 3FU5A 1TNUA 4F53A 3V2XA 2EILE 3ABLE 2HO1A 4GTRA 1OCOE 4FU3A 2KZTB 4CGWA 4J8EA 1E8ZA 3CVXA 3BU8A 3SBSA 5JJ7A 4P29A 3B13A 4AEZC 4FJZA 4NURA 4YNPA 4J8FA 3FEXA 4GPMA 4TRQA 3LCAA 2R59A 1OWLA 5BXOA 3M56A 3PNLB 3JXIA 3T9KA 3FU3A 1MZCA 3M53A 4URKA 3B7TA 4HQDA 3CVNA 3D9OA 3DSVA 3ASNE 4F3VA 1K8KG 5T5GA 3AU5A 1D9SA 2ETCA 3FPDA 2KM4A 3HVEA 3QARA 2MRIA 3FTSA 5JHNA 4EHMA 2VGXA 3UUXA 5J08A 3D9KA 5ANRA 3PDNA 3FFLA 1H0AA 4GZ6A 4J8OA 3OAWA 4ILHB 5AJDA 5FJYA 1NA3A 4G23A 3RSEG 1LF8A 1H2TC 1ELKA 2VTBA 4GTPA 1HH8A 3L6AA 4QEOA 3FH5A 2LXMA 4MS6A 3HXDA 1U3CA 4FP7A 4F7AA 4CYMD 4U8HA 3S7BA 2WMNA 5B3SE 3UM0A 2GRPB 2W5YA 5KJKA 2QY7A 4NIKA 3FDHA 2LSVA 5KNHD 4E47A 2GRNB 3RIBA 5BV0A 1PEGA 4XKCA 4APOA 2IEJA 2XRZA 1K1BA 2FO7A 5CHEE 3LS8A 2KCKA 1N0RA 2EQXA 2RFMA 4LNBA 2MYOA 4L2YA 3CK9A 3JQ1A 1N4SA 3CHSA 4GTMA 3CKBA 4FULA 3UIPC 1UG3A 3LY7A 3ZW3A 1DVPA 3NBNB 3ULYA 1N9AA 1JWGA 4PS3A 3UT8A 2L0TB 1H2VC 4GTSA 5LFAA 4ATZD 4AXHA 4UI9C 3CK7A 1DC2A 3G2TA 2ONDA 3FTZA 4U96D 2ZIRA 2CHXA 1OY3D 4CRWA 5F59A 3EUVA 3CHMA 4EBAG 2C0MA 2P9LG 2DZOA 4G11A 4ZHBA 3R9MA 1DCQA 1MVXA 5JHBA 3CHOA 3CGHA 2H6GA 4FADA 1Y8MA 2DYSE 4MBGA 1N6CA 2ZGGA 4CZ2D 1OWOA 3EU5A 4K5CA 3BG0B 4JEUA 3LVQE 3PNTB 3RK6A 1JWFA 3RO2A 2V5QC 1UJJA 4MKTA 3L13A 3JQ0A 3LXUX 4W9RA 4HXIA 3DXKG 3FUHA 3TXNA 1WDYA 3AU4A 3IHVA 4GA2A 3RQ4A 4BWRA 5EILA 5T3RA 1IQUA 1H2UA 4R7LA 4CDMA 2IO3C 3ONKA 4YDOA 3ZFWA 4NRHB 1TN7A 5G05C 3CR3A 2A5EA 3M57A 2DBAA 2F8YA 2Y1LE 2X6HA 4XIFA 2Y69E 3Q73A 4TV3A 5H7PA 2XS8A 4I9EA 3NQPA 3VTXA 3CQCB 4JD2G 1KT0A 5ENOD 4PS8A 4KVOA 1NFIE 4QENA 1OWNA 3RAYA 3L08A 2XENA 4JPSA 4O1PA 1E8WA 4O6FA 4O30A 5ENSD 1Q2ZA 1OUVA 3CSTA 2PZIA 5B1BE 1N4QA 2HE0A 3PREA 2L9BA 1YCSB 3ASOE 4LG6A 5T8IA 4FLHA 3BG1B 3M58A 3SWCA 2LAIA 4JHKA 4HB5A 3EHRA 5KJMA 4JB8P 2IONA 3ZYKA 2V5FA 2KATA 3FUIA 4DX1A 4Q94A 2C0LA 1EPUA 3HXCA 4BY6A 3RRMB 5T0MA 3UIOC 4GB9A 3QWWA 4GMRA 4TUUA 4AU7A 4HORA 2I2OA 3ZVVA 4AOFA 3Q49B 3U9WA 3RRUA 1SW6A 4GYWA 2CHWA 2P9PG 2VSYA 1W3BA 2BKKB 3ZPJA 3Q9NC 1N3JA 1JUQA 3RAUA 3PE4A 4TXQA 4HRMB 4HOSA 2QYJA 1QZ2A 3NF1A 5TTFA 3CHRA 5D66A 1HG2A 3Q5MA 3ASDA 3LDZA 1OCRE 4ZFHA 2AVPA 4FA6A 3IKOB 3PZ1A 3ZXPA 2B6CA 1HXIA 1MX6A 3S7DA 1WM5A 3TWUA 2LXLA 3F6QA 3DSUA 4G24A 4XEIG 4A55A 1TNZA 2P9NG 4PDXA 1OCCE 3CVQA 1UJKA 5FZSA 5FZRA 2XGMA 3D9LA 3PVLA 4QEPA 1O9SA 3ESKA 3LVRE 3FUFA 4LCTA 4JZYA 1NA0A 3HHMA 4GYYA 4UI9K 4C1QA 2XPIA 4KMOA 1TJCA 2VYIA 1L5JA 3E34A 3FULA 4DRXE 4YPAA 3AJIA 4G8KA 3M55A 3TWXA 4AY6A 2EIJE 4AIFA 2PM6A 1WAO1 5KNGA 4KXKB 4FC8A 3D9HA 5JMND 4I2WA 4JHRA 3TG4A 5KBAA 1V55E 3J5PA 2CG2A 1NP7A 2P9SG 4BTAA 4AY5A 4U63A 2AXUA 3APFA 1FVHA 1N4PA 3BO5A 5E76A 1N54A 3RU0A 1TN6A 3Q75A 3EP0A 3MKQB 3V2OA 1H19A 3J5QB 2DVWA 1S0PA 1Z3XA 3ABKE 3DSXA 1N4RA 5J90A 2FULA 1NL4A 3MA5A 3PZ4A 5LCWJ 2DYRE 4GZDA 4KVMA 1NI1A 5TH7A 3TWRA 5AQAA 4N3CA 3ESLA 3ZU7B 4H7YA 3JUIA 5G05J 1SZAA 3SNXA 2QC9A 5EG2A 3L54A 3ZYQA 3GW4A 4N39A 2KZTA 3M5AA 2OEVA 4HBDA 3TWVA 3DB5A 3VLFA 3SW9A 4L23A 5AYFA 1OCZE 2DZNA 4HLLA 2E2EA 4C9BB 5ENNA 3BEEA 2L6BA 2IO2C 3KMJA 3FTWA 3S7FA 1EF1C 4KYOB 3FTUA 2ZU6B 3FWVA 2CFUA 1ZB1A 1IYGA 2Y0BG 3KMTA 1TNOA 1K3ZD 4QFVA 2X6IA 4DUIA 3FUMA 1YMPA 3DALA 4IYPA 3V79K 2NSZA 2KCLA 3EHNA 3P2BA 2GGFA 3TG5A 5G04C 4Y6WA 3E37A 4JL0A 3NB2A 3P1UA 4HNAD 2IFUA 4U8YD 3GZ1A 4DPRA 5HKPA 2Y4TA 3FTYA 3RJVA 1HF8A 1A17A 3K5KA 3GYZA 5JIYA 1N52A 4HOUA 2WM9A 3I4GA 1WG0A 1KZOA 4N5QA 5EX0A 1FPPA 5HS0A 2VGXB 2CG3A 1QBQA 1PAQA 4GZ5A 4WNEA 2XS1A 3QDNA 1DCEA 3C72A 1GW6A 4Z68A 5EX3A 3ABME 3AAAC 3HXEA 3UI2A 3SFXA 2LSUA 4YNMA 1ZKKA 1LTXA 2E0IA 3OXFA 2X6JA 3PZDA 4DLOA 4GCOA 2OVBA 3MO0A 3ZGQA 3F9YA 4L1BA 2VTBB 2UY1A 2I6HA 4FHKA 3KAEA 4CDNA 3SD5A 3UX4A 3MO2A 4J7IA 3UMVA 3CKCA 4EECA 2BUGA 4HI9A 4HFGA 5FZQA 2AXVA 3I3NA 4RZ0A 3UKUG 1MJ0A 2XQ0A 1H6PA 1QQEA 2GRRB 1XNFA 4O1OA 4XI9A 3UINC 3ASHA 1Y6IA 4H7XA 1MVHA 4BX8A 4EZJA 3MV3B 3ULQA 5D2MC 3DEOA 2M63A 1AP7A 3L22A 4RG9A 4N3BA 2FEZA 2R03A 4NQ0A 5ENQD 4A3VA 2V8SE 3FUKA 3EHMA 2GRLA 1O1TA 1Z3YA 2F0YA 1TR4A 3D9IA 3L9TA 1B89A 4KZCA 4J83A 2J4BA 4EZLA 1V54E 4BUPA 3ZHEA 1N6AA 3NAWA 5FIOA 3ONLA 3OPEA 1H6KA 4N5CA 2IQCA 2F69A 3G2VA 2MHKA 3LKUA 3LEWA 2A4ZA 1TJFA 3Q15A 5FQ8A 4HRLA 3S2AA 4X8QA 4CEMA 4MI0A 4I43A 2VSXE 2J4DA 5KJLA 3MYVA 4XE0A 4KZ0A 2IJGX 4B0ZA 1PY1A 4J0UA 3MX3A 3VLDA 1SZ9A 3PZ2A 2FBNA 3APDA 2PL2A 3B7SA 3PE3A 1OWMA 5FQ4A 4J8SA 1ELRA 1SA4A 1XQHA 2DCPA 4N2SA 4UWLA 1AWCB 1LD8A 3V31A 3FEYA 4U0UA 4U0ZA 1HG5A 4UWKA 1UOHA 4F1PA 2X3MA 3QWPA 2ETBA 2GRQB 3KS2A 3MZLB 3LPZA 3PZ3A 3KSQA 4GTOA 1X5BA 3N71A 4WWOA 2Q7FA 3EDTB 3EIQC 2YHCA 3IXEA 4I1OB 3I4RB 3UM1A 4I6JA 4WWNA 4XX5A 4IJDA 3CHQA 4RLYA 4JHJA 5ARFA 4GMJA 5CEDB 1INZA 2P9UG 3DSWA 4V3IA 1TEZA 3APCA 4HRNA 3BUAA 4G8LA 3Q7FA 3CEQA 3PUKA 2MOWA 5LOZA 4YPUA 2PM7A 2R05A 1BD8A 2EIME 3D9MA 1KPSB 2AXZA 2WXMA 2F8XK 3QNKA 3E4BA 2AWIA 4WNFA 5BV1A 2XHEA 2XZDG 1O1SA 1FCHA 3D3MA 2NC9A 4JDSA 4TXRA 4JLGA 2GW1A 3ZEFA 3M59A 4ILGA 1SQMA 2QYUA 3KD7A 4BX9A 2EINE 4BSXA 2VQ2A 3F9WA 3ZUVB 2WXLA 3MKRA 5BPPA 4LSZE 2X38A 2Y4UA 3G2WA 4TXPA 4DX2A 1U2VG 2CHZA 1HFAA 2WXJA 2J09A 5CBNA 1ZU2A 4I17A 4FMUA 3AS8A 2XEEA 4N3AA 1UN8A 4PS7A 2R02A 5FQ7A 4JA7A 1UN9A 3SZ7A 2NXPA 1OT8A 4JVSA 2H6HA 3C3RA 3FUEA 1BLXB 3LY8A 3QC1A 1IHBA 1VDYA 2WXQA 3DRAA 3TXMA 4HVBA 4H12A 2V4LA 1H6OA 4UWFA 5CCLA 1D8DA 3ZN3A 2B0OE 3HXFA 5CPRB 5FQ6A 3KMAA 3AS5A 3RRNB 2WPVA 4A63B 5F6LA 5CEAA 4GA0A 4K03A 4GU5A 4M3OA 5LSXA 3RO3A 3NOGD 2WXRA 1FVFA 1E7VA 2XCCA 3ASGA 3FU0A 4EQFA 4BT9A 2FI7A 4HOQA 5ITZF 2I1JA 3L82A 4FHJA 4UQXA 2RD0A 4UI9J 3OS5A 3IBEA 2VGYA 3GZ2A 4XI0A 2WQHA 4IULA 1E96B 3HYMB 4OVUA 3TWTA 3KSLA 3B95A 4YDWA 3ULEG 3SI5A 3CVYA 4UWGA 1OXJA 4CCAA 2BKGA 4MRUA 3C5RA 5CRVA 2IY0C 5BT1A 5BXUA 2LAHA 4DK5A 2C2LA 1IKND 4YDEA 3UXGA 2RFIA 4GTVA 1HX8A 1IXVA 3UM3A 3ZRHA 4J6IA 2I9CA 3AG1E 2QFCA 2VSOE 5FTPA 4B8CB 3DEPA 4DX6D 2UWJG 2WXNA 2WXGA 3DXMG 4B89A 3HNAA 1D8EA 1P5QA 3F9ZA 4ABNA 2XGSA 2GRMA 3R7QA 2WXIA 4LRZA 5G2NA 1HE8A 4RSYA 3M54A 4YVQC 3Q7AA 2ZXWE 3KEAA 1HU3A 1QYMA 4I6EA 3DSSA 1N11A 5AYWD 5JJ0A 4A1SA 2XPZA 1G3NB 2P9IG 3HRAA 3HDXA 1NZNA 3R9AB 4NACA 3IHYA 2EIKE 5HRYA 2J9QA 3BQOA 2KBXA 4I9CA 2WXHA 3EU9A 3F9XA 3S7JA 4LEUA 5DIZA 2W5ZA 4EPZA 4JC8A 3CQGB 4G2VA 3LJNA 1RW2A 1E7UA 4Q96A 4DX5D 5EN5D 3Q79A 3D9JA 3PH0C 3CVLA 3ISMC 3PRZA 4J7WA 2XPYA 3ML9A 4FJYA 4JEHA 1A5EA 3ZYMA 1WY6A 3CVVA 2I1KA 3ZYLA 3FUJA 3MV2B 4IJ8A 3ZXSA 3MEKA 3X2QE 3EIJA 2R3AA 5LSZA 2XEVA 3MJWA 3IV0A 5CMWA 3AG2E 3IHXA 3QB2A 1RZ4A 1N95A 4OYSA 2AJAA 4U8VD 3AG3E 4NJ5A 3FY4A 2ZISA 5CCMA 1MT6A 1X81A 3UT4A 4TUMA 3NOCD 3UKRG 2LO6A 2QZAA 4O60A 5AN8A 5HI7A 1Z5SC 5JHAA 2OV8A 4YNDA 1E8XA 2VJ8A 2J49A 3NZUA 3CVUA 3DWLG 5KWDA 4L9PA 5A6CA 2BEDA 4K5BA 4ME2A 1IQRA 4I6GA 4FLBA 3C98A 3HVEB 5KJNA 3LY9A 3T8KA 1MUFA 5JJTA 2WQ6A 1TN8A 1LD7A 2LNIA 3FTXA 2YHEA 4CT0A 2RG8A 4EBAA 3QOUA 4L7TA 2HYZA 3G2UA 4GZCA 2R5SA 3CK8A 5AIJA 3UPVA 3VUZA 4N2QA 4RG6A 4E6HA 4UWHA 4J8DA 4BETA 2KCVA 3MGBA 3U64A 1HZ4A 4OAVB 4LDGA 5EKQD 1U3DA 1SVXA 1JCQA 3CSFA 1N94A 4UQYA 4IRUA 2V0PA 3QJZA 4L2LA 1KZPA 3CIAA 4AJWA 4C0MA 5FINA 3TWSA 3QK0A 4XZ4A 5EYLA 5CERB 3UT7A 5F6KC 3CBMA 2DIWA 3QWVA 4CGVA 4G25A 4BTBA 3EHQA 2V4HC 2UY1B 3DPDA 3T5VA 1HO8A 5AENA 4ILIA 2VGEA 3UTMA 4WAFA 3ASFA 3O48A 2L6JA 3T8MA 2IU1A 5A23A 2IOLA 1SA5A 4K5AB 2AW6A 2WXOA 4BEPA 1Z6TA 4U07A 4AP2A 4D10C 1K1AA 3SFYA 4GTTA 1JCRA 3G2SA 2PQNA 4KBQA 4GPKA 4G1TA 5BUZA 4WNGA 1E90A 3CV0A 4ATGA 4YDYA 5G55A 4Q69A 3CBOA 4Z4PA 3PEUB 2DWZA 4DI3A 4U04A 3FH8A 5M72A 3SF4A 2NYJA 1DNPA 1UW4B 4A3TA 3DBSA 2BTDA 3SO8A 3TAXA 3SBTB 4ANUA 5A7DB 1TYQG 2KXPC 3FP3A 5LP0A 3D9PA 1ML9A 5CECB 4CDRA 5HQ8A 2XZTG 2WQ7A 5BW8C 3FUDA 3K9IA 1XGWA 4AVXA 3ZHEB 1PC2A 4WNDA 1QNFA 2OEWA 2PQRA 3JXJA 2ILRA 1KLXA 1S63A 1E8YA 3ENEA 2WXFA 4LNGA 2RKKA 1BU9A 3T5XA 5LCWC 2OVFA 4RQIA 4BERA 2WXKA 2RFAA 4B94A 4MLPA 2R17C 3ZNGA 3ZKJA 5DBKA 2QPWA 4I1MA 5EIDA 3U4TA 4KT6B 2XEHA 4J7FA 1TNYA 4HS2A 3QKYA 4JXTA 4WWPA 4GYOA 4HOTA 3PUJA 5JJ6A 4U95D 5CRUA 3RJWA 5T0KA 2WB2A 1N0QA 4U0SA 1OWPA 2X6KA 4QQIA 4DX7D 2BQZA 2IOSA 4BFRA 2BF0X 3MCXA 3SFZA 4OVVA 2CFZA 4LNUD 4K0RA 3OTNA 5ENTD 3SGHA 1MQSA 2A5UA 2YINA 3TWWA 2JV0A 2F37A 3CVPA 3E30A 3TWQA 2P2CP 3OXLA 3B7BA 4C0EA 4ACLA 2O8JA 4XKBA 4Y6CA 3FHEA 5G04J 4CT4A 2PNNA 1FT1A 1H3IA 5F5EA 4B8AA 2WVIA 1ZBPA 3GZSA 2JEKA 2GROB 3JYSA 3E32A 3LJ3A 4BSZB 4LUNU 3S8PA 4JW1A 3D9NA 4RVBA 4AM9A 4I1AA 1BPOA 4IN3B 3FTVA 3CVWA 3IEGA 4UQZA 2G46A 3HIZA 1ELWA 5AQ7A 2FO1E 1HS6A 4BESA 4APFA 4G26A 5D0QD 3OOIA 3TGOA 3JCKC 3I5PA 4JA9A 4DI4A 3QAQA 3WG7E 2P58C 2WMOA 3Q78A 4J8YA 5AJLA 4GTQA 4WUYA 4EZKA 3TJPA 3ZIMA 4AV7A 5E75A 3TL5A 2J8SD 3SQVA 2FF4A 2J07A 3U3WA 1S64A 3PEVB 3DSTA 3L17A 5ARGA 4I51A 4PUCA 2OCCE 3O4ZA 2LUHA 3B7RL 3VLEA 1BI7B 2XCBA 5JA4D 5ANLA 2H6FA 2R2LA 3ML8A 4ANXA 4GA1A 4I2ZA 2ETAA 1YYHA 3RKVA 2L0IA 3CLJA 1MYOA 3C3OA 3SY2A 3C3QA 4F1SA 5EDSA 4M7CA 3U66A 4GCNA 3R7RA 3AG4E 2X6FA 3W9GA 4F6RD 4MI5A 4U7EB 1JPLA 5B1AE 3UM2A 2ZGDA 3Q4AB 3V30A 1YA0A 5CMYA 5ENRD 1S70B 3L16A 5C2YA 5AQBA 2IF4A 5EIBE 5LX8A 4DLQA 3HXBA 4HLEA 3NZSA 4ACKA 4B93B 4HI8A 4BT8A 2HR2A 4E85A 1MHQA 3B7UX 2OOEA 4ANWA 3VV0A 3MKQA 5FWQA 5AAOA 2YQ8A 2WXPA 4YPEA 3OXGA 3EJNA 3FH7A 3WXXA 4GAAA 4ANVA 3LYAA 3CBPA 3W9FA 3JUEA 3URZA 3MO5A 3FUNA 5ENPD
chains in the Genus database with same CATH topology
3LEWA 4ME2A 3U9WA 1IQRA 2A4ZA 3RRUA 1TJFA 4GYWA 2CHWA 4FLBA 4I6GA 2VSYA 1W3BA 3C98A 3Q47B 3HVEB 5KJNA 3LY9A 3Q15A 5FQ8A 2IGQA 1MUFA 5JJTA 3ZPJA 3S2AA 2WQ6A 1N3JA 4CEMA 1JUQA 2LNIA 4MI0A 4I43A 2VSXE 2XGOA 2J4DA 3FTXA 5KJLA 2YHEA 1KT1A 3MYVA 3PE4A 4XE0A 4KZ0A 4CT0A 2RG8A 4EBAA 3UQ3A 3QOUA 4L7TA 4HOSA 2IJGX 1QZ2A 2HYZA 3G2UA 4B0ZA 3AS4A 3NF1A 1PY1A 5TTFA 3CHRA 4GZCA 4J0UA 3MX3A 3VTYA 2YNQA 3VLDA 5FT9A 1HG2A 2R5SA 2VSNA 3ASDA 3Q5MA 4NVQA 1EDUA 1SZ9A 3CK8A 5AIJA 5C1DA 3UPVA 2FBNA 3APDA 2PL2A 2HM8A 2KC7A 3CHPA 2JLBA 4N2QA 3LDZA 3VUZA 3B7SA 4RG6A 2AVPA 1OWMA 3PE3A 4UWHA 5FQ4A 4E6HA 4J8DA 4FA6A 3IKOB 4J8SA 1ELRA 2J08A 1XQHA 2DCPA 4N2SA 4GZ3A 4UWLA 4LERA 1HXIA 4YVOA 4DJAA 3PS6A 2KCVA 3MGBA 4A1GA 3S7DA 3U64A 1HZ4A 1WM5A 5D0OD 4GMLA 3FEYA 4LDGA 5BNWA 4U0UA 4U0ZA 1HG5A 4UWKA 5EKQD 4G24A 1U3DA 5T4YA 2X3MA 3QWPA 2Y3AA 3CSFA 5JINA 3KS2A 1IHGA 3SHFA 3MZLB 4A55A 5TEGA 3LPZA 4UQYA 4IRUA 4PDXA 2V0PA 2XRYA 3QJZA 3CVQA 1UJKA 1X5BA 3CIAA 3KEZA 4L2LA 5FZSA 5FZRA 3N71A 4PH4B 4WWOA 2Q7FA 1EYHA 2XGMA 3EDTB 3EIQC 4AJWA 2YHCA 3FU6A 3QK0A 4C0MA 5KCMA 4I1OB 3I4RB 3D9LA 4XZ4A 3FU5A 3PVLA 4I6JA 4F53A 4QEPA 1O9SA 3UT7A 2HO1A 5F6KC 3ESKA 3LVRE 3CBMA 2DIWA 4WWNA 4XX5A 3QWVA 4IJDA 4CGVA 4G25A 4FU3A 3CHQA 3FUFA 4LCTA 2KZTB 4JZYA 4JHJA 5ARFA 1NA0A 4CGWA 4GMJA 4J8EA 1E8ZA 4BTBA 1INZA 3HHMA 3CVXA 4GYYA 3SBSA 2UY1B 3DPDA 4P29A 1HO8A 5JJ7A 3T5VA 3B13A 4UI9K 4V3IA 1TEZA 4AEZC 3APCA 4FJZA 5AENA 4C1QA 4ILIA 2XPIA 4KMOA 1TJCA 2VYIA 4NURA 4YNPA 4J8FA 3FEXA 1L5JA 4WAFA 3CEQA 4TRQA 3LCAA 3ASFA 2R59A 1OWLA 3O48A 2L6JA 3PUKA 3T8MA 3M56A 2MOWA 2IU1A 5LOZA 4YPUA 3PNLB 5A23A 2IOLA 2PM7A 3FU3A 3FULA 3M53A 4YPAA 4URKA 2AW6A 3B7TA 3D9MA 2WXMA 2AXZA 2WXOA 1Z6TA 4U07A 4AP2A 3M55A 3QNKA 3E4BA 2AWIA 3CVNA 4WNFA 3D9OA 4D10C 5BV1A 2XHEA 4AY6A 4F3VA 1FCHA 3G2SA 5T5GA 2PQNA 4AIFA 2PM6A 1WAO1 3AU5A 4KBQA 4GPKA 4KXKB 3D3MA 2NC9A 4G1TA 3FPDA 4FC8A 4JDSA 5BUZA 2KM4A 3HVEA 3QARA 2MRIA 3FTSA 4WNGA 5JHNA 4I2WA 1E90A 3CV0A 4JHRA 2VGXA 4ATGA 3TG4A 4JLGA 3UUXA 5J08A 5G55A 2CG2A 3D9KA 1NP7A 4Q69A 3CBOA 4BTAA 4Z4PA 4AY5A 2GW1A 3PEUB 3ZEFA 4ILGA 3M59A 4DI3A 4U04A 3FH8A 4U63A 1SQMA 5M72A 3SF4A 2AXUA 3APFA 4NJ5A 3KD7A 1DNPA 5ANRA 3PDNA 4BX9A 1FVHA 3BO5A 1UW4B 4A3TA 3DBSA 1N54A 2BTDA 5E76A 3RU0A 4BSXA 2VQ2A 3FFLA 3SBTB 3TAXA 3F9WA 4ANUA 2WXLA 1H0AA 4GZ6A 5A7DB 4J8OA 3EP0A 3OAWA 4ILHB 5AJDA 3MKRA 3FP3A 5BPPA 5LP0A 3MKQB 5FJYA 1NA3A 3D9PA 4G23A 1ML9A 3OPEA 2X38A 1H19A 4CDRA 5HQ8A 2Y4UA 1LF8A 3G2WA 2WQ7A 1S0PA 5BW8C 1H2TC 1ELKA 1Z3XA 2CHZA 3FUDA 3K9IA 1XGWA 1HFAA 2WXJA 2VTBA 4AVXA 5J90A 3ZHEB 2J09A 2FULA 1PC2A 1HH8A 1ZU2A 3MA5A 4WNDA 4I17A 5LCWJ 1QNFA 4FMUA 3L6AA 4QEOA 3FH5A 3AS8A 4N3AA 2PQRA 4MS6A 1UN8A 4PS7A 2ILRA 1U3CA 4FP7A 4GZDA 4KVMA 1KLXA 5FQ7A 1E8YA 4F7AA 4JA7A 1UN9A 3SZ7A 3ENEA 2NXPA 2WXFA 4JVSA 4U8HA 3S7BA 3T5XA 5LCWC 5TH7A 2WMNA 4N3CA 3ESLA 2OVFA 3FUEA 4H7YA 2W5YA 2WXKA 3JUIA 5G05J 4B94A 5KJKA 1SZAA 2QY7A 4MLPA 2R17C 3LY8A 3QC1A 3FDHA 2LSVA 3SNXA 4E47A 1VDYA 5DBKA 5EG2A 2WXQA 3RIBA 3L54A 5BV0A 1PEGA 3ZYQA 3GW4A 3TXMA 4XKCA 4N39A 4HVBA 2KZTA 4H12A 4APOA 2V4LA 2QPWA 3M5AA 2XRZA 4I1MA 4UWFA 3DB5A 3U4TA 5CCLA 4KT6B 3VLFA 3SW9A 2FO7A 4L23A 5CHEE 4J7FA 3ZN3A 4HS2A 3QKYA 5AYFA 3LS8A 2KCKA 4JXTA 4WWPA 2EQXA 5CPRB 4GYOA 4HOTA 3PUJA 5FQ6A 5JJ6A 2E2EA 3RJWA 5T0KA 3KMAA 3AS5A 3RRNB 2WB2A 2WPVA 4L2YA 4C9BB 4U0SA 1OWPA 5ENNA 3BEEA 4GA0A 3CK9A 5F6LA 2X6KA 3JQ1A 4K03A 3CHSA 2BQZA 4GU5A 4M3OA 2IOSA 5LSXA 3RO3A 4BFRA 2BF0X 3KMJA 3CKBA 3MCXA 3FTWA 3S7FA 1EF1C 4FULA 2WXRA 3SFZA 1FVFA 1UG3A 4KYOB 3FTUA 1E7VA 3LY7A 3ZW3A 2ZU6B 3FWVA 4OVVA 1DVPA 2CFZA 2CFUA 4K0RA 2XCCA 3ASGA 3FU0A 3OTNA 4EQFA 4BT9A 2FI7A 1JWGA 4HOQA 2I1JA 4PS3A 4FHJA 4UQXA 3UT8A 2L0TB 2RD0A 4UI9J 1IYGA 3SGHA 1MQSA 2A5UA 3OS5A 3IBEA 2YINA 2JV0A 2VGYA 3GZ2A 1H2VC 3CVPA 4XI0A 3KMTA 4QFVA 3OXLA 2WQHA 4IULA 5LFAA 1E96B 3HYMB 4OVUA 4C0EA 2X6IA 4ACLA 4AXHA 2O8JA 4XKBA 3SI5A 4UI9C 3CVYA 3CK7A 3FUMA 4UWGA 4Y6CA 3FHEA 3G2TA 2ONDA 3FTZA 5G04J 4CT4A 3DALA 1H3IA 4IYPA 5F5EA 4CCAA 4B8AA 4MRUA 2WVIA 2NSZA 2KCLA 3EHNA 1ZBPA 2CHXA 3GZSA 5BT1A 4CRWA 3P2BA 2GGFA 2JEKA 5F59A 3TG5A 3JYSA 3LJ3A 5G04C 4Y6WA 2LAHA 4LUNU 4JL0A 3S8PA 4JW1A 3D9NA 3P1UA 3CHMA 4RVBA 4DK5A 2IFUA 4EBAG 4AM9A 2C0MA 4I1AA 2C2LA 1BPOA 4IN3B 4G11A 2RFIA 1HX8A 3FTVA 3ZRHA 4J6IA 1MVXA 3CVWA 3IEGA 5JHBA 4UQZA 2G46A 3CHOA 3CGHA 2I9CA 3GZ1A 2QFCA 4FADA 4DPRA 3HIZA 2VSOE 1Y8MA 5FTPA 1ELWA 1HS6A 4B8CB 2Y4TA 4APFA 3FTYA 1N6CA 4G26A 3RJVA 5D0QD 1HF8A 2UWJG 1OWOA 3OOIA 1A17A 3K5KA 2WXNA 3GYZA 3BG0B 3JCKC 1N52A 3TGOA 5JIYA 4JEUA 3I5PA 2WXGA 3LVQE 4B89A 4JA9A 4HOUA 3HNAA 3PNTB 3RK6A 1JWFA 3RO2A 2WM9A 3I4GA 1P5QA 4DI4A 3F9ZA 3QAQA 4ABNA 2XGSA 2P58C 5EX0A 1UJJA 4MKTA 2GRMA 3L13A 2VGXB 3JQ0A 2CG3A 2WMOA 3LXUX 3R7QA 2WXIA 4LRZA 5G2NA 1PAQA 4GZ5A 1HE8A 4HXIA 4RSYA 4W9RA 5AJLA 4WNEA 3M54A 3QDNA 4YVQC 3FUHA 3TXNA 4WUYA 1GW6A 4EZKA 5EX3A 3TJPA 3ZIMA 4AV7A 1HU3A 5E75A 3TL5A 2LSUA 4YNMA 4I6EA 1ZKKA 3AU4A 3IHVA 4GA2A 2FF4A 2J07A 3U3WA 2E0IA 3OXFA 4BWRA 2X6JA 5AYWD 3RQ4A 5JJ0A 3PZDA 4A1SA 2XPZA 5T3RA 3PEVB 1IQUA 1H2UA 3L17A 3HDXA 4R7LA 4CDMA 4DLOA 4GCOA 5ARGA 4I51A 2OVBA 3ONKA 1NZNA 3MO0A 3R9AB 3ZGQA 3ZFWA 4NRHB 4NACA 5G05C 3IHYA 3F9YA 4L1BA 4PUCA 2J9QA 3CR3A 3O4ZA 2VTBB 3M57A 2DBAA 2UY1A 4I9CA 2WXHA 3F9XA 3B7RL 2I6HA 4FHKA 3VLEA 3KAEA 2X6HA 3S7JA 3SD5A 4CDNA 2XCBA 4XIFA 4LEUA 3UX4A 3MO2A 4J7IA 5DIZA 3UMVA 4TV3A 2W5ZA 3CKCA 5ANLA 4EECA 2BUGA 4EPZA 4JC8A 4I9EA 4HFGA 3CQGB 3NQPA 2AXVA 5FZQA 3I3NA 3ML8A 4G2VA 4ANXA 4RZ0A 3VTXA 3CQCB 4GA1A 4I2ZA 1E7UA 1KT0A 2XQ0A 4Q96A 3RKVA 2L0IA 4PS8A 3CLJA 4KVOA 1QQEA 4F1SA 5EDSA 1XNFA 4XI9A 3ASHA 4QENA 1OWNA 3U66A 3RAYA 4GCNA 1Y6IA 3L08A 3R7RA 3D9JA 4H7XA 2X6FA 4JPSA 1MVHA 4BX8A 4MI5A 3PH0C 3CVLA 4EZJA 1E8WA 1JPLA 3MV3B 3ULQA 3PRZA 2XPYA 3ML9A 2M63A 4O6FA 4O30A 4FJYA 3Q4AB 4JEHA 3L22A 1YA0A 3ZYMA 1WY6A 4RG9A 1OUVA 4N3BA 2FEZA 3ZYKA 5CMYA 3CSTA 3CVVA 2I1KA 3ZYLA 2PZIA 3FUJA 3L16A 3MV2B 4NQ0A 4IJ8A 5C2YA 2IF4A 5LX8A 3ZXSA 4A3VA 3MEKA 4DLQA 4HLEA 3EIJA 3NZSA 4ACKA 2V8SE 3PREA 2L9BA 3FUKA 4BT8A 2R3AA 5LSZA 5T8IA 4FLHA 3BG1B 3M58A 2XEVA 2HR2A 3EHMA 3MJWA 2GRLA 3SWCA 2LAIA 4E85A 1MHQA 3B7UX 3IV0A 4JHKA 1Z3YA 5CMWA 3IHXA 3QB2A 2OOEA 5KJMA 4OYSA 4ANWA 3VV0A 2IONA 2V5FA 3FUIA 2KATA 3D9IA 3FY4A 1B89A 3MKQA 2YQ8A 4KZCA 5FWQA 4Q94A 2C0LA 5CCMA 2WXPA 1EPUA 1MT6A 4J83A 4YPEA 3OXGA 3UT4A 3EJNA 2J4BA 2LO6A 5HI7A 4BY6A 4EZLA 3FH7A 3RRMB 5T0MA 5JHAA 4GB9A 2OV8A 4GAAA 3QWWA 4YNDA 3WXXA 3ZHEA 4ANVA 1N6AA 4BUPA 4TUUA 3LYAA 1E8XA 4AU7A 3ONLA 2VJ8A 2J49A 1H6KA 3CBPA 3NZUA 3CVUA 4HORA 2I2OA 2IQCA 4N5CA 3G2VA 2MHKA 3URZA 2F69A 3ZVVA 4AOFA 3MO5A 5A6CA 3Q49B 3FUNA 3LKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME2 A;  4GYW A;  2VSY A;  1W3B A;  3Q47 B;  5KJN A;  3LY9 A;  3Q15 A;  2IGQ A;  1MUF A;  5JJT A;  3ZPJ A;  1N3J A;  2LNI A;  4MI0 A;  2XGO A;  5KJL A;  1KT1 A;  3PE4 A;  3UQ3 A;  3QOU A;  4HOS A;  1QZ2 A;  2HYZ A;  3AS4 A;  3NF1 A;  5TTF A;  4J0U A;  3VTY A;  5FT9 A;  2R5S A;  2VSN A;  3ASD A;  3Q5M A;  4NVQ A;  3CK8 A;  5C1D A;  3UPV A;  2FBN A;  2PL2 A;  4N2Q A;  2KC7 A;  3VUZ A;  2JLB A;  4RG6 A;  2AVP A;  3PE3 A;  4J8D A;  1ELR A;  1XQH A;  4N2S A;  4GZ3 A;  1HXI A;  4YVO A;  2KCV A;  3S7D A;  1HZ4 A;  1WM5 A;  5D0O D;  4LDG A;  5BNW A;  4U0U A;  4U0Z A;  5EKQ D;  4G24 A;  3QWP A;  5JIN A;  3KS2 A;  1IHG A;  5TEG A;  3LPZ A;  4UQY A;  3CVQ A;  5FZS A;  5FZR A;  3N71 A;  2Q7F A;  2XGM A;  3EDT B;  2YHC A;  4QEP A;  1O9S A;  2HO1 A;  5F6K C;  3ESK A;  3CBM A;  3QWV A;  4IJD A;  4CGV A;  4G25 A;  5ARF A;  1NA0 A;  4CGW A;  4J8E A;  4BTB A;  4GYY A;  5JJ7 A;  2UY1 B;  4UI9 K;  4C1Q A;  2XPI A;  1TJC A;  2VYI A;  4YNP A;  4J8F A;  3CEQ A;  3LCA A;  3ASF A;  3O48 A;  3M56 A;  2L6J A;  4YPU A;  3M53 A;  4YPA A;  4U07 A;  3M55 A;  3E4B A;  3CVN A;  4WNF A;  4AY6 A;  4F3V A;  1FCH A;  5T5G A;  2PQN A;  4AIF A;  1WAO 1;  4KBQ A;  4GPK A;  4KXK B;  3FPD A;  2NC9 A;  4G1T A;  4JDS A;  4WNG A;  5JHN A;  4I2W A;  4JHR A;  3CV0 A;  2VGX A;  3TG4 A;  4JLG A;  3UUX A;  3CBO A;  4BTA A;  4Z4P A;  4AY5 A;  2GW1 A;  3M59 A;  4U04 A;  5M72 A;  3SF4 A;  3KD7 A;  3PDN A;  3BO5 A;  3RU0 A;  2VQ2 A;  3FFL A;  3TAX A;  3F9W A;  5A7D B;  4GZ6 A;  4J8O A;  3EP0 A;  3MKR A;  3FP3 A;  5FJY A;  1NA3 A;  4G23 A;  1ML9 A;  4CDR A;  5HQ8 A;  2Y4U A;  5BW8 C;  3K9I A;  3ZHE B;  1PC2 A;  1HH8 A;  1ZU2 A;  3MA5 A;  4WND A;  4I17 A;  5LCW J;  4FMU A;  4QEO A;  3AS8 A;  4N3A A;  2PQR A;  1KLX A;  4JA7 A;  3SZ7 A;  5TH7 A;  3S7B A;  5LCW C;  4N3C A;  4H7Y A;  2W5Y A;  5G05 J;  4B94 A;  5KJK A;  3LY8 A;  2LSV A;  4E47 A;  5DBK A;  5EG2 A;  3RIB A;  1PEG A;  3GW4 A;  4N39 A;  4H12 A;  4APO A;  2QPW A;  3M5A A;  3DB5 A;  3U4T A;  5CCL A;  3SW9 A;  2FO7 A;  5CHE E;  4J7F A;  3ZN3 A;  3QKY A;  5AYF A;  2KCK A;  5CPR B;  4GYO A;  4HOT A;  5JJ6 A;  3RJW A;  2E2E A;  5T0K A;  3KMA A;  3AS5 A;  2WPV A;  4U0S A;  5F6L A;  3BEE A;  4GA0 A;  3CK9 A;  2BQZ A;  5LSX A;  3RO3 A;  3KMJ A;  3CKB A;  3S7F A;  4KYO B;  3LY7 A;  3FWV A;  2XCC A;  3ASG A;  4EQF A;  4BT9 A;  2FI7 A;  4HOQ A;  4UQX A;  1IYG A;  4UI9 J;  3OS5 A;  2JV0 A;  2VGY A;  3GZ2 A;  3CVP A;  3KMT A;  4XI0 A;  3OXL A;  2WQH A;  1E96 B;  3HYM B;  2O8J A;  4UI9 C;  3CK7 A;  4Y6C A;  5G04 J;  3DAL A;  2OND A;  1H3I A;  5F5E A;  2KCL A;  1ZBP A;  5BT1 A;  5F59 A;  3TG5 A;  3JYS A;  5G04 C;  4Y6W A;  3S8P A;  4JL0 A;  2IFU A;  4AM9 A;  2C0M A;  4I1A A;  2C2L A;  4IN3 B;  2RFI A;  1MVX A;  3IEG A;  4UQZ A;  2G46 A;  3GZ1 A;  2QFC A;  1Y8M A;  5FTP A;  1ELW A;  2Y4T A;  1N6C A;  4G26 A;  3RJV A;  5D0Q D;  2UWJ G;  3OOI A;  1A17 A;  3K5K A;  3GYZ A;  3TGO A;  5JIY A;  4JA9 A;  4HOU A;  3HNA A;  3RO2 A;  1P5Q A;  3F9Z A;  4ABN A;  2XGS A;  2P58 C;  5EX0 A;  2VGX B;  4GZ5 A;  4W9R A;  4WNE A;  3M54 A;  3QDN A;  4YVQ C;  4WUY A;  5EX3 A;  2LSU A;  4YNM A;  1ZKK A;  4GA2 A;  2FF4 A;  3U3W A;  3OXF A;  3RQ4 A;  4BWR A;  5AYW D;  5JJ0 A;  4A1S A;  4GCO A;  5ARG A;  4I51 A;  1NZN A;  3MO0 A;  3R9A B;  3ZGQ A;  3ZFW A;  4NRH B;  5G05 C;  3F9Y A;  2J9Q A;  3M57 A;  2DBA A;  2UY1 A;  4I9C A;  3F9X A;  2I6H A;  3KAE A;  3S7J A;  2XCB A;  4XIF A;  4LEU A;  3MO2 A;  4J7I A;  5DIZ A;  2W5Z A;  3CKC A;  2BUG A;  4I9E A;  5FZQ A;  4G2V A;  4RZ0 A;  3VTX A;  4GA1 A;  4I2Z A;  1KT0 A;  3RKV A;  1QQE A;  1XNF A;  4XI9 A;  3ASH A;  4QEN A;  3RAY A;  4GCN A;  4H7X A;  1MVH A;  4MI5 A;  3CVL A;  3MV3 B;  3ULQ A;  4O6F A;  4O30 A;  3Q4A B;  1YA0 A;  4RG9 A;  1OUV A;  4N3B A;  2FEZ A;  2PZI A;  3MV2 B;  4NQ0 A;  4IJ8 A;  2IF4 A;  3MEK A;  2R3A A;  4BT8 A;  5LSZ A;  3M58 A;  2XEV A;  2HR2 A;  3SWC A;  3IHX A;  2OOE A;  5KJM A;  3VV0 A;  2V5F A;  4NJ5 A;  2KAT A;  1B89 A;  2YQ8 A;  2C0L A;  5CCM A;  1MT6 A;  4J83 A;  4YPE A;  3OXG A;  5HI7 A;  5T0M A;  3WXX A;  3ZHE A;  3QWW A;  4YND A;  1N6A A;  4BUP A;  3LYA A;  4AU7 A;  3OPE A;  3CBP A;  4HOR A;  4N5C A;  3URZ A;  2F69 A;  2MHK A;  3MO5 A;  5A6C A;  3Q49 B;  3LKU A; 
#chains in the Genus database with same CATH topology
 1O5M A;  3Q47 B;  2IGQ A;  5AAR A;  2XGO A;  5AQ9 A;  1KT1 A;  1O1R A;  3Q9U C;  3UQ3 A;  3AS4 A;  1JCS A;  3VTY A;  2JAB A;  2P9K G;  2YNQ A;  5FT9 A;  2VSN A;  3DPY A;  1TNB A;  4NVQ A;  1EDU A;  5C1D A;  3HG0 D;  1FT2 A;  2HM8 A;  2KC7 A;  2H6I A;  2JLB A;  3CHP A;  4OAU C;  5IY5 E;  2J08 A;  4GZ3 A;  3E33 A;  4LER A;  4YVO A;  4DJA A;  3PS6 A;  4A1G A;  5D0O D;  4GML A;  4C48 B;  5BNW A;  5T4Y A;  1BI8 B;  2Y3A A;  5JIN A;  1IHG A;  3SHF A;  1MX2 A;  5EYP F;  5TEG A;  2XRY A;  3KEZ A;  5CBO A;  4PH4 B;  1EYH A;  3FU6 A;  4UUC A;  5KCM A;  1MX4 A;  3FU5 A;  1TNU A;  4F53 A;  3V2X A;  2EIL E;  3ABL E;  2HO1 A;  4GTR A;  1OCO E;  4FU3 A;  2KZT B;  4CGW A;  4J8E A;  1E8Z A;  3CVX A;  3BU8 A;  3SBS A;  5JJ7 A;  4P29 A;  3B13 A;  4AEZ C;  4FJZ A;  4NUR A;  4YNP A;  4J8F A;  3FEX A;  4GPM A;  4TRQ A;  3LCA A;  2R59 A;  1OWL A;  5BXO A;  3M56 A;  3PNL B;  3JXI A;  3T9K A;  3FU3 A;  1MZC A;  3M53 A;  4URK A;  3B7T A;  4HQD A;  3CVN A;  3D9O A;  3DSV A;  3ASN E;  4F3V A;  1K8K G;  5T5G A;  3AU5 A;  1D9S A;  2ETC A;  3FPD A;  2KM4 A;  3HVE A;  3QAR A;  2MRI A;  3FTS A;  5JHN A;  4EHM A;  2VGX A;  3UUX A;  5J08 A;  3D9K A;  5ANR A;  3PDN A;  3FFL A;  1H0A A;  4GZ6 A;  4J8O A;  3OAW A;  4ILH B;  5AJD A;  5FJY A;  1NA3 A;  4G23 A;  3RSE G;  1LF8 A;  1H2T C;  1ELK A;  2VTB A;  4GTP A;  1HH8 A;  3L6A A;  4QEO A;  3FH5 A;  2LXM A;  4MS6 A;  3HXD A;  1U3C A;  4FP7 A;  4F7A A;  4CYM D;  4U8H A;  3S7B A;  2WMN A;  5B3S E;  3UM0 A;  2GRP B;  2W5Y A;  5KJK A;  2QY7 A;  4NIK A;  3FDH A;  2LSV A;  5KNH D;  4E47 A;  2GRN B;  3RIB A;  5BV0 A;  1PEG A;  4XKC A;  4APO A;  2IEJ A;  2XRZ A;  1K1B A;  2FO7 A;  5CHE E;  3LS8 A;  2KCK A;  1N0R A;  2EQX A;  2RFM A;  4LNB A;  2MYO A;  4L2Y A;  3CK9 A;  3JQ1 A;  1N4S A;  3CHS A;  4GTM A;  3CKB A;  4FUL A;  3UIP C;  1UG3 A;  3LY7 A;  3ZW3 A;  1DVP A;  3NBN B;  3ULY A;  1N9A A;  1JWG A;  4PS3 A;  3UT8 A;  2L0T B;  1H2V C;  4GTS A;  5LFA A;  4ATZ D;  4AXH A;  4UI9 C;  3CK7 A;  1DC2 A;  3G2T A;  2OND A;  3FTZ A;  4U96 D;  2ZIR A;  2CHX A;  1OY3 D;  4CRW A;  5F59 A;  3EUV A;  3CHM A;  4EBA G;  2C0M A;  2P9L G;  2DZO A;  4G11 A;  4ZHB A;  3R9M A;  1DCQ A;  1MVX A;  5JHB A;  3CHO A;  3CGH A;  2H6G A;  4FAD A;  1Y8M A;  2DYS E;  4MBG A;  1N6C A;  2ZGG A;  4CZ2 D;  1OWO A;  3EU5 A;  4K5C A;  3BG0 B;  4JEU A;  3LVQ E;  3PNT B;  3RK6 A;  1JWF A;  3RO2 A;  2V5Q C;  1UJJ A;  4MKT A;  3L13 A;  3JQ0 A;  3LXU X;  4W9R A;  4HXI A;  3DXK G;  3FUH A;  3TXN A;  1WDY A;  3AU4 A;  3IHV A;  4GA2 A;  3RQ4 A;  4BWR A;  5EIL A;  5T3R A;  1IQU A;  1H2U A;  4R7L A;  4CDM A;  2IO3 C;  3ONK A;  4YDO A;  3ZFW A;  4NRH B;  1TN7 A;  5G05 C;  3CR3 A;  2A5E A;  3M57 A;  2DBA A;  2F8Y A;  2Y1L E;  2X6H A;  4XIF A;  2Y69 E;  3Q73 A;  4TV3 A;  5H7P A;  2XS8 A;  4I9E A;  3NQP A;  3VTX A;  3CQC B;  4JD2 G;  1KT0 A;  5ENO D;  4PS8 A;  4KVO A;  1NFI E;  4QEN A;  1OWN A;  3RAY A;  3L08 A;  2XEN A;  4JPS A;  4O1P A;  1E8W A;  4O6F A;  4O30 A;  5ENS D;  1Q2Z A;  1OUV A;  3CST A;  2PZI A;  5B1B E;  1N4Q A;  2HE0 A;  3PRE A;  2L9B A;  1YCS B;  3ASO E;  4LG6 A;  5T8I A;  4FLH A;  3BG1 B;  3M58 A;  3SWC A;  2LAI A;  4JHK A;  4HB5 A;  3EHR A;  5KJM A;  4JB8 P;  2ION A;  3ZYK A;  2V5F A;  2KAT A;  3FUI A;  4DX1 A;  4Q94 A;  2C0L A;  1EPU A;  3HXC A;  4BY6 A;  3RRM B;  5T0M A;  3UIO C;  4GB9 A;  3QWW A;  4GMR A;  4TUU A;  4AU7 A;  4HOR A;  2I2O A;  3ZVV A;  4AOF A;  3Q49 B;  3U9W A;  3RRU A;  1SW6 A;  4GYW A;  2CHW A;  2P9P G;  2VSY A;  1W3B A;  2BKK B;  3ZPJ A;  3Q9N C;  1N3J A;  1JUQ A;  3RAU A;  3PE4 A;  4TXQ A;  4HRM B;  4HOS A;  2QYJ A;  1QZ2 A;  3NF1 A;  5TTF A;  3CHR A;  5D66 A;  1HG2 A;  3Q5M A;  3ASD A;  3LDZ A;  1OCR E;  4ZFH A;  2AVP A;  4FA6 A;  3IKO B;  3PZ1 A;  3ZXP A;  2B6C A;  1HXI A;  1MX6 A;  3S7D A;  1WM5 A;  3TWU A;  2LXL A;  3F6Q A;  3DSU A;  4G24 A;  4XEI G;  4A55 A;  1TNZ A;  2P9N G;  4PDX A;  1OCC E;  3CVQ A;  1UJK A;  5FZS A;  5FZR A;  2XGM A;  3D9L A;  3PVL A;  4QEP A;  1O9S A;  3ESK A;  3LVR E;  3FUF A;  4LCT A;  4JZY A;  1NA0 A;  3HHM A;  4GYY A;  4UI9 K;  4C1Q A;  2XPI A;  4KMO A;  1TJC A;  2VYI A;  1L5J A;  3E34 A;  3FUL A;  4DRX E;  4YPA A;  3AJI A;  4G8K A;  3M55 A;  3TWX A;  4AY6 A;  2EIJ E;  4AIF A;  2PM6 A;  1WAO 1;  5KNG A;  4KXK B;  4FC8 A;  3D9H A;  5JMN D;  4I2W A;  4JHR A;  3TG4 A;  5KBA A;  1V55 E;  3J5P A;  2CG2 A;  1NP7 A;  2P9S G;  4BTA A;  4AY5 A;  4U63 A;  2AXU A;  3APF A;  1FVH A;  1N4P A;  3BO5 A;  5E76 A;  1N54 A;  3RU0 A;  1TN6 A;  3Q75 A;  3EP0 A;  3MKQ B;  3V2O A;  1H19 A;  3J5Q B;  2DVW A;  1S0P A;  1Z3X A;  3ABK E;  3DSX A;  1N4R A;  5J90 A;  2FUL A;  1NL4 A;  3MA5 A;  3PZ4 A;  5LCW J;  2DYR E;  4GZD A;  4KVM A;  1NI1 A;  5TH7 A;  3TWR A;  5AQA A;  4N3C A;  3ESL A;  3ZU7 B;  4H7Y A;  3JUI A;  5G05 J;  1SZA A;  3SNX A;  2QC9 A;  5EG2 A;  3L54 A;  3ZYQ A;  3GW4 A;  4N39 A;  2KZT A;  3M5A A;  2OEV A;  4HBD A;  3TWV A;  3DB5 A;  3VLF A;  3SW9 A;  4L23 A;  5AYF A;  1OCZ E;  2DZN A;  4HLL A;  2E2E A;  4C9B B;  5ENN A;  3BEE A;  2L6B A;  2IO2 C;  3KMJ A;  3FTW A;  3S7F A;  1EF1 C;  4KYO B;  3FTU A;  2ZU6 B;  3FWV A;  2CFU A;  1ZB1 A;  1IYG A;  2Y0B G;  3KMT A;  1TNO A;  1K3Z D;  4QFV A;  2X6I A;  4DUI A;  3FUM A;  1YMP A;  3DAL A;  4IYP A;  3V79 K;  2NSZ A;  2KCL A;  3EHN A;  3P2B A;  2GGF A;  3TG5 A;  5G04 C;  4Y6W A;  3E37 A;  4JL0 A;  3NB2 A;  3P1U A;  4HNA D;  2IFU A;  4U8Y D;  3GZ1 A;  4DPR A;  5HKP A;  2Y4T A;  3FTY A;  3RJV A;  1HF8 A;  1A17 A;  3K5K A;  3GYZ A;  5JIY A;  1N52 A;  4HOU A;  2WM9 A;  3I4G A;  1WG0 A;  1KZO A;  4N5Q A;  5EX0 A;  1FPP A;  5HS0 A;  2VGX B;  2CG3 A;  1QBQ A;  1PAQ A;  4GZ5 A;  4WNE A;  2XS1 A;  3QDN A;  1DCE A;  3C72 A;  1GW6 A;  4Z68 A;  5EX3 A;  3ABM E;  3AAA C;  3HXE A;  3UI2 A;  3SFX A;  2LSU A;  4YNM A;  1ZKK A;  1LTX A;  2E0I A;  3OXF A;  2X6J A;  3PZD A;  4DLO A;  4GCO A;  2OVB A;  3MO0 A;  3ZGQ A;  3F9Y A;  4L1B A;  2VTB B;  2UY1 A;  2I6H A;  4FHK A;  3KAE A;  4CDN A;  3SD5 A;  3UX4 A;  3MO2 A;  4J7I A;  3UMV A;  3CKC A;  4EEC A;  2BUG A;  4HI9 A;  4HFG A;  5FZQ A;  2AXV A;  3I3N A;  4RZ0 A;  3UKU G;  1MJ0 A;  2XQ0 A;  1H6P A;  1QQE A;  2GRR B;  1XNF A;  4O1O A;  4XI9 A;  3UIN C;  3ASH A;  1Y6I A;  4H7X A;  1MVH A;  4BX8 A;  4EZJ A;  3MV3 B;  3ULQ A;  5D2M C;  3DEO A;  2M63 A;  1AP7 A;  3L22 A;  4RG9 A;  4N3B A;  2FEZ A;  2R03 A;  4NQ0 A;  5ENQ D;  4A3V A;  2V8S E;  3FUK A;  3EHM A;  2GRL A;  1O1T A;  1Z3Y A;  2F0Y A;  1TR4 A;  3D9I A;  3L9T A;  1B89 A;  4KZC A;  4J83 A;  2J4B A;  4EZL A;  1V54 E;  4BUP A;  3ZHE A;  1N6A A;  3NAW A;  5FIO A;  3ONL A;  3OPE A;  1H6K A;  4N5C A;  2IQC A;  2F69 A;  3G2V A;  2MHK A;  3LKU A;  3LEW A;  2A4Z A;  1TJF A;  3Q15 A;  5FQ8 A;  4HRL A;  3S2A A;  4X8Q A;  4CEM A;  4MI0 A;  4I43 A;  2VSX E;  2J4D A;  5KJL A;  3MYV A;  4XE0 A;  4KZ0 A;  2IJG X;  4B0Z A;  1PY1 A;  4J0U A;  3MX3 A;  3VLD A;  1SZ9 A;  3PZ2 A;  2FBN A;  3APD A;  2PL2 A;  3B7S A;  3PE3 A;  1OWM A;  5FQ4 A;  4J8S A;  1ELR A;  1SA4 A;  1XQH A;  2DCP A;  4N2S A;  4UWL A;  1AWC B;  1LD8 A;  3V31 A;  3FEY A;  4U0U A;  4U0Z A;  1HG5 A;  4UWK A;  1UOH A;  4F1P A;  2X3M A;  3QWP A;  2ETB A;  2GRQ B;  3KS2 A;  3MZL B;  3LPZ A;  3PZ3 A;  3KSQ A;  4GTO A;  1X5B A;  3N71 A;  4WWO A;  2Q7F A;  3EDT B;  3EIQ C;  2YHC A;  3IXE A;  4I1O B;  3I4R B;  3UM1 A;  4I6J A;  4WWN A;  4XX5 A;  4IJD A;  3CHQ A;  4RLY A;  4JHJ A;  5ARF A;  4GMJ A;  5CED B;  1INZ A;  2P9U G;  3DSW A;  4V3I A;  1TEZ A;  3APC A;  4HRN A;  3BUA A;  4G8L A;  3Q7F A;  3CEQ A;  3PUK A;  2MOW A;  5LOZ A;  4YPU A;  2PM7 A;  2R05 A;  1BD8 A;  2EIM E;  3D9M A;  1KPS B;  2AXZ A;  2WXM A;  2F8X K;  3QNK A;  3E4B A;  2AWI A;  4WNF A;  5BV1 A;  2XHE A;  2XZD G;  1O1S A;  1FCH A;  3D3M A;  2NC9 A;  4JDS A;  4TXR A;  4JLG A;  2GW1 A;  3ZEF A;  3M59 A;  4ILG A;  1SQM A;  2QYU A;  3KD7 A;  4BX9 A;  2EIN E;  4BSX A;  2VQ2 A;  3F9W A;  3ZUV B;  2WXL A;  3MKR A;  5BPP A;  4LSZ E;  2X38 A;  2Y4U A;  3G2W A;  4TXP A;  4DX2 A;  1U2V G;  2CHZ A;  1HFA A;  2WXJ A;  2J09 A;  5CBN A;  1ZU2 A;  4I17 A;  4FMU A;  3AS8 A;  2XEE A;  4N3A A;  1UN8 A;  4PS7 A;  2R02 A;  5FQ7 A;  4JA7 A;  1UN9 A;  3SZ7 A;  2NXP A;  1OT8 A;  4JVS A;  2H6H A;  3C3R A;  3FUE A;  1BLX B;  3LY8 A;  3QC1 A;  1IHB A;  1VDY A;  2WXQ A;  3DRA A;  3TXM A;  4HVB A;  4H12 A;  2V4L A;  1H6O A;  4UWF A;  5CCL A;  1D8D A;  3ZN3 A;  2B0O E;  3HXF A;  5CPR B;  5FQ6 A;  3KMA A;  3AS5 A;  3RRN B;  2WPV A;  4A63 B;  5F6L A;  5CEA A;  4GA0 A;  4K03 A;  4GU5 A;  4M3O A;  5LSX A;  3RO3 A;  3NOG D;  2WXR A;  1FVF A;  1E7V A;  2XCC A;  3ASG A;  3FU0 A;  4EQF A;  4BT9 A;  2FI7 A;  4HOQ A;  5ITZ F;  2I1J A;  3L82 A;  4FHJ A;  4UQX A;  2RD0 A;  4UI9 J;  3OS5 A;  3IBE A;  2VGY A;  3GZ2 A;  4XI0 A;  2WQH A;  4IUL A;  1E96 B;  3HYM B;  4OVU A;  3TWT A;  3KSL A;  3B95 A;  4YDW A;  3ULE G;  3SI5 A;  3CVY A;  4UWG A;  1OXJ A;  4CCA A;  2BKG A;  4MRU A;  3C5R A;  5CRV A;  2IY0 C;  5BT1 A;  5BXU A;  2LAH A;  4DK5 A;  2C2L A;  1IKN D;  4YDE A;  3UXG A;  2RFI A;  4GTV A;  1HX8 A;  1IXV A;  3UM3 A;  3ZRH A;  4J6I A;  2I9C A;  3AG1 E;  2QFC A;  2VSO E;  5FTP A;  4B8C B;  3DEP A;  4DX6 D;  2UWJ G;  2WXN A;  2WXG A;  3DXM G;  4B89 A;  3HNA A;  1D8E A;  1P5Q A;  3F9Z A;  4ABN A;  2XGS A;  2GRM A;  3R7Q A;  2WXI A;  4LRZ A;  5G2N A;  1HE8 A;  4RSY A;  3M54 A;  4YVQ C;  3Q7A A;  2ZXW E;  3KEA A;  1HU3 A;  1QYM A;  4I6E A;  3DSS A;  1N11 A;  5AYW D;  5JJ0 A;  4A1S A;  2XPZ A;  1G3N B;  2P9I G;  3HRA A;  3HDX A;  1NZN A;  3R9A B;  4NAC A;  3IHY A;  2EIK E;  5HRY A;  2J9Q A;  3BQO A;  2KBX A;  4I9C A;  2WXH A;  3EU9 A;  3F9X A;  3S7J A;  4LEU A;  5DIZ A;  2W5Z A;  4EPZ A;  4JC8 A;  3CQG B;  4G2V A;  3LJN A;  1RW2 A;  1E7U A;  4Q96 A;  4DX5 D;  5EN5 D;  3Q79 A;  3D9J A;  3PH0 C;  3CVL A;  3ISM C;  3PRZ A;  4J7W A;  2XPY A;  3ML9 A;  4FJY A;  4JEH A;  1A5E A;  3ZYM A;  1WY6 A;  3CVV A;  2I1K A;  3ZYL A;  3FUJ A;  3MV2 B;  4IJ8 A;  3ZXS A;  3MEK A;  3X2Q E;  3EIJ A;  2R3A A;  5LSZ A;  2XEV A;  3MJW A;  3IV0 A;  5CMW A;  3AG2 E;  3IHX A;  3QB2 A;  1RZ4 A;  1N95 A;  4OYS A;  2AJA A;  4U8V D;  3AG3 E;  4NJ5 A;  3FY4 A;  2ZIS A;  5CCM A;  1MT6 A;  1X81 A;  3UT4 A;  4TUM A;  3NOC D;  3UKR G;  2LO6 A;  2QZA A;  4O60 A;  5AN8 A;  5HI7 A;  1Z5S C;  5JHA A;  2OV8 A;  4YND A;  1E8X A;  2VJ8 A;  2J49 A;  3NZU A;  3CVU A;  3DWL G;  5KWD A;  4L9P A;  5A6C A;  2BED A;  4K5B A;  4ME2 A;  1IQR A;  4I6G A;  4FLB A;  3C98 A;  3HVE B;  5KJN A;  3LY9 A;  3T8K A;  1MUF A;  5JJT A;  2WQ6 A;  1TN8 A;  1LD7 A;  2LNI A;  3FTX A;  2YHE A;  4CT0 A;  2RG8 A;  4EBA A;  3QOU A;  4L7T A;  2HYZ A;  3G2U A;  4GZC A;  2R5S A;  3CK8 A;  5AIJ A;  3UPV A;  3VUZ A;  4N2Q A;  4RG6 A;  4E6H A;  4UWH A;  4J8D A;  4BET A;  2KCV A;  3MGB A;  3U64 A;  1HZ4 A;  4OAV B;  4LDG A;  5EKQ D;  1U3D A;  1SVX A;  1JCQ A;  3CSF A;  1N94 A;  4UQY A;  4IRU A;  2V0P A;  3QJZ A;  4L2L A;  1KZP A;  3CIA A;  4AJW A;  4C0M A;  5FIN A;  3TWS A;  3QK0 A;  4XZ4 A;  5EYL A;  5CER B;  3UT7 A;  5F6K C;  3CBM A;  2DIW A;  3QWV A;  4CGV A;  4G25 A;  4BTB A;  3EHQ A;  2V4H C;  2UY1 B;  3DPD A;  3T5V A;  1HO8 A;  5AEN A;  4ILI A;  2VGE A;  3UTM A;  4WAF A;  3ASF A;  3O48 A;  2L6J A;  3T8M A;  2IU1 A;  5A23 A;  2IOL A;  1SA5 A;  4K5A B;  2AW6 A;  2WXO A;  4BEP A;  1Z6T A;  4U07 A;  4AP2 A;  4D10 C;  1K1A A;  3SFY A;  4GTT A;  1JCR A;  3G2S A;  2PQN A;  4KBQ A;  4GPK A;  4G1T A;  5BUZ A;  4WNG A;  1E90 A;  3CV0 A;  4ATG A;  4YDY A;  5G55 A;  4Q69 A;  3CBO A;  4Z4P A;  3PEU B;  2DWZ A;  4DI3 A;  4U04 A;  3FH8 A;  5M72 A;  3SF4 A;  2NYJ A;  1DNP A;  1UW4 B;  4A3T A;  3DBS A;  2BTD A;  3SO8 A;  3TAX A;  3SBT B;  4ANU A;  5A7D B;  1TYQ G;  2KXP C;  3FP3 A;  5LP0 A;  3D9P A;  1ML9 A;  5CEC B;  4CDR A;  5HQ8 A;  2XZT G;  2WQ7 A;  5BW8 C;  3FUD A;  3K9I A;  1XGW A;  4AVX A;  3ZHE B;  1PC2 A;  4WND A;  1QNF A;  2OEW A;  2PQR A;  3JXJ A;  2ILR A;  1KLX A;  1S63 A;  1E8Y A;  3ENE A;  2WXF A;  4LNG A;  2RKK A;  1BU9 A;  3T5X A;  5LCW C;  2OVF A;  4RQI A;  4BER A;  2WXK A;  2RFA A;  4B94 A;  4MLP A;  2R17 C;  3ZNG A;  3ZKJ A;  5DBK A;  2QPW A;  4I1M A;  5EID A;  3U4T A;  4KT6 B;  2XEH A;  4J7F A;  1TNY A;  4HS2 A;  3QKY A;  4JXT A;  4WWP A;  4GYO A;  4HOT A;  3PUJ A;  5JJ6 A;  4U95 D;  5CRU A;  3RJW A;  5T0K A;  2WB2 A;  1N0Q A;  4U0S A;  1OWP A;  2X6K A;  4QQI A;  4DX7 D;  2BQZ A;  2IOS A;  4BFR A;  2BF0 X;  3MCX A;  3SFZ A;  4OVV A;  2CFZ A;  4LNU D;  4K0R A;  3OTN A;  5ENT D;  3SGH A;  1MQS A;  2A5U A;  2YIN A;  3TWW A;  2JV0 A;  2F37 A;  3CVP A;  3E30 A;  3TWQ A;  2P2C P;  3OXL A;  3B7B A;  4C0E A;  4ACL A;  2O8J A;  4XKB A;  4Y6C A;  3FHE A;  5G04 J;  4CT4 A;  2PNN A;  1FT1 A;  1H3I A;  5F5E A;  4B8A A;  2WVI A;  1ZBP A;  3GZS A;  2JEK A;  2GRO B;  3JYS A;  3E32 A;  3LJ3 A;  4BSZ B;  4LUN U;  3S8P A;  4JW1 A;  3D9N A;  4RVB A;  4AM9 A;  4I1A A;  1BPO A;  4IN3 B;  3FTV A;  3CVW A;  3IEG A;  4UQZ A;  2G46 A;  3HIZ A;  1ELW A;  5AQ7 A;  2FO1 E;  1HS6 A;  4BES A;  4APF A;  4G26 A;  5D0Q D;  3OOI A;  3TGO A;  3JCK C;  3I5P A;  4JA9 A;  4DI4 A;  3QAQ A;  3WG7 E;  2P58 C;  2WMO A;  3Q78 A;  4J8Y A;  5AJL A;  4GTQ A;  4WUY A;  4EZK A;  3TJP A;  3ZIM A;  4AV7 A;  5E75 A;  3TL5 A;  2J8S D;  3SQV A;  2FF4 A;  2J07 A;  3U3W A;  1S64 A;  3PEV B;  3DST A;  3L17 A;  5ARG A;  4I51 A;  4PUC A;  2OCC E;  3O4Z A;  2LUH A;  3B7R L;  3VLE A;  1BI7 B;  2XCB A;  5JA4 D;  5ANL A;  2H6F A;  2R2L A;  3ML8 A;  4ANX A;  4GA1 A;  4I2Z A;  2ETA A;  1YYH A;  3RKV A;  2L0I A;  3CLJ A;  1MYO A;  3C3O A;  3SY2 A;  3C3Q A;  4F1S A;  5EDS A;  4M7C A;  3U66 A;  4GCN A;  3R7R A;  3AG4 E;  2X6F A;  3W9G A;  4F6R D;  4MI5 A;  4U7E B;  1JPL A;  5B1A E;  3UM2 A;  2ZGD A;  3Q4A B;  3V30 A;  1YA0 A;  5CMY A;  5ENR D;  1S70 B;  3L16 A;  5C2Y A;  5AQB A;  2IF4 A;  5EIB E;  5LX8 A;  4DLQ A;  3HXB A;  4HLE A;  3NZS A;  4ACK A;  4B93 B;  4HI8 A;  4BT8 A;  2HR2 A;  4E85 A;  1MHQ A;  3B7U X;  2OOE A;  4ANW A;  3VV0 A;  3MKQ A;  5FWQ A;  5AAO A;  2YQ8 A;  2WXP A;  4YPE A;  3OXG A;  3EJN A;  3FH7 A;  3WXX A;  4GAA A;  4ANV A;  3LYA A;  3CBP A;  3W9F A;  3JUE A;  3URZ A;  3MO5 A;  3FUN A;  5ENP D; 
#chains in the Genus database with same CATH homology
 3LEW A;  4ME2 A;  3U9W A;  1IQR A;  2A4Z A;  3RRU A;  1TJF A;  4GYW A;  2CHW A;  4FLB A;  4I6G A;  2VSY A;  1W3B A;  3C98 A;  3Q47 B;  3HVE B;  5KJN A;  3LY9 A;  3Q15 A;  5FQ8 A;  2IGQ A;  1MUF A;  5JJT A;  3ZPJ A;  3S2A A;  2WQ6 A;  1N3J A;  4CEM A;  1JUQ A;  2LNI A;  4MI0 A;  4I43 A;  2VSX E;  2XGO A;  2J4D A;  3FTX A;  5KJL A;  2YHE A;  1KT1 A;  3MYV A;  3PE4 A;  4XE0 A;  4KZ0 A;  4CT0 A;  2RG8 A;  4EBA A;  3UQ3 A;  3QOU A;  4L7T A;  4HOS A;  2IJG X;  1QZ2 A;  2HYZ A;  3G2U A;  4B0Z A;  3AS4 A;  3NF1 A;  1PY1 A;  5TTF A;  3CHR A;  4GZC A;  4J0U A;  3MX3 A;  3VTY A;  2YNQ A;  3VLD A;  5FT9 A;  1HG2 A;  2R5S A;  2VSN A;  3ASD A;  3Q5M A;  4NVQ A;  1EDU A;  1SZ9 A;  3CK8 A;  5AIJ A;  5C1D A;  3UPV A;  2FBN A;  3APD A;  2PL2 A;  2HM8 A;  2KC7 A;  3CHP A;  2JLB A;  4N2Q A;  3LDZ A;  3VUZ A;  3B7S A;  4RG6 A;  2AVP A;  1OWM A;  3PE3 A;  4UWH A;  5FQ4 A;  4E6H A;  4J8D A;  4FA6 A;  3IKO B;  4J8S A;  1ELR A;  2J08 A;  1XQH A;  2DCP A;  4N2S A;  4GZ3 A;  4UWL A;  4LER A;  1HXI A;  4YVO A;  4DJA A;  3PS6 A;  2KCV A;  3MGB A;  4A1G A;  3S7D A;  3U64 A;  1HZ4 A;  1WM5 A;  5D0O D;  4GML A;  3FEY A;  4LDG A;  5BNW A;  4U0U A;  4U0Z A;  1HG5 A;  4UWK A;  5EKQ D;  4G24 A;  1U3D A;  5T4Y A;  2X3M A;  3QWP A;  2Y3A A;  3CSF A;  5JIN A;  3KS2 A;  1IHG A;  3SHF A;  3MZL B;  4A55 A;  5TEG A;  3LPZ A;  4UQY A;  4IRU A;  4PDX A;  2V0P A;  2XRY A;  3QJZ A;  3CVQ A;  1UJK A;  1X5B A;  3CIA A;  3KEZ A;  4L2L A;  5FZS A;  5FZR A;  3N71 A;  4PH4 B;  4WWO A;  2Q7F A;  1EYH A;  2XGM A;  3EDT B;  3EIQ C;  4AJW A;  2YHC A;  3FU6 A;  3QK0 A;  4C0M A;  5KCM A;  4I1O B;  3I4R B;  3D9L A;  4XZ4 A;  3FU5 A;  3PVL A;  4I6J A;  4F53 A;  4QEP A;  1O9S A;  3UT7 A;  2HO1 A;  5F6K C;  3ESK A;  3LVR E;  3CBM A;  2DIW A;  4WWN A;  4XX5 A;  3QWV A;  4IJD A;  4CGV A;  4G25 A;  4FU3 A;  3CHQ A;  3FUF A;  4LCT A;  2KZT B;  4JZY A;  4JHJ A;  5ARF A;  1NA0 A;  4CGW A;  4GMJ A;  4J8E A;  1E8Z A;  4BTB A;  1INZ A;  3HHM A;  3CVX A;  4GYY A;  3SBS A;  2UY1 B;  3DPD A;  4P29 A;  1HO8 A;  5JJ7 A;  3T5V A;  3B13 A;  4UI9 K;  4V3I A;  1TEZ A;  4AEZ C;  3APC A;  4FJZ A;  5AEN A;  4C1Q A;  4ILI A;  2XPI A;  4KMO A;  1TJC A;  2VYI A;  4NUR A;  4YNP A;  4J8F A;  3FEX A;  1L5J A;  4WAF A;  3CEQ A;  4TRQ A;  3LCA A;  3ASF A;  2R59 A;  1OWL A;  3O48 A;  2L6J A;  3PUK A;  3T8M A;  3M56 A;  2MOW A;  2IU1 A;  5LOZ A;  4YPU A;  3PNL B;  5A23 A;  2IOL A;  2PM7 A;  3FU3 A;  3FUL A;  3M53 A;  4YPA A;  4URK A;  2AW6 A;  3B7T A;  3D9M A;  2WXM A;  2AXZ A;  2WXO A;  1Z6T A;  4U07 A;  4AP2 A;  3M55 A;  3QNK A;  3E4B A;  2AWI A;  3CVN A;  4WNF A;  3D9O A;  4D10 C;  5BV1 A;  2XHE A;  4AY6 A;  4F3V A;  1FCH A;  3G2S A;  5T5G A;  2PQN A;  4AIF A;  2PM6 A;  1WAO 1;  3AU5 A;  4KBQ A;  4GPK A;  4KXK B;  3D3M A;  2NC9 A;  4G1T A;  3FPD A;  4FC8 A;  4JDS A;  5BUZ A;  2KM4 A;  3HVE A;  3QAR A;  2MRI A;  3FTS A;  4WNG A;  5JHN A;  4I2W A;  1E90 A;  3CV0 A;  4JHR A;  2VGX A;  4ATG A;  3TG4 A;  4JLG A;  3UUX A;  5J08 A;  5G55 A;  2CG2 A;  3D9K A;  1NP7 A;  4Q69 A;  3CBO A;  4BTA A;  4Z4P A;  4AY5 A;  2GW1 A;  3PEU B;  3ZEF A;  4ILG A;  3M59 A;  4DI3 A;  4U04 A;  3FH8 A;  4U63 A;  1SQM A;  5M72 A;  3SF4 A;  2AXU A;  3APF A;  4NJ5 A;  3KD7 A;  1DNP A;  5ANR A;  3PDN A;  4BX9 A;  1FVH A;  3BO5 A;  1UW4 B;  4A3T A;  3DBS A;  1N54 A;  2BTD A;  5E76 A;  3RU0 A;  4BSX A;  2VQ2 A;  3FFL A;  3SBT B;  3TAX A;  3F9W A;  4ANU A;  2WXL A;  1H0A A;  4GZ6 A;  5A7D B;  4J8O A;  3EP0 A;  3OAW A;  4ILH B;  5AJD A;  3MKR A;  3FP3 A;  5BPP A;  5LP0 A;  3MKQ B;  5FJY A;  1NA3 A;  3D9P A;  4G23 A;  1ML9 A;  3OPE A;  2X38 A;  1H19 A;  4CDR A;  5HQ8 A;  2Y4U A;  1LF8 A;  3G2W A;  2WQ7 A;  1S0P A;  5BW8 C;  1H2T C;  1ELK A;  1Z3X A;  2CHZ A;  3FUD A;  3K9I A;  1XGW A;  1HFA A;  2WXJ A;  2VTB A;  4AVX A;  5J90 A;  3ZHE B;  2J09 A;  2FUL A;  1PC2 A;  1HH8 A;  1ZU2 A;  3MA5 A;  4WND A;  4I17 A;  5LCW J;  1QNF A;  4FMU A;  3L6A A;  4QEO A;  3FH5 A;  3AS8 A;  4N3A A;  2PQR A;  4MS6 A;  1UN8 A;  4PS7 A;  2ILR A;  1U3C A;  4FP7 A;  4GZD A;  4KVM A;  1KLX A;  5FQ7 A;  1E8Y A;  4F7A A;  4JA7 A;  1UN9 A;  3SZ7 A;  3ENE A;  2NXP A;  2WXF A;  4JVS A;  4U8H A;  3S7B A;  3T5X A;  5LCW C;  5TH7 A;  2WMN A;  4N3C A;  3ESL A;  2OVF A;  3FUE A;  4H7Y A;  2W5Y A;  2WXK A;  3JUI A;  5G05 J;  4B94 A;  5KJK A;  1SZA A;  2QY7 A;  4MLP A;  2R17 C;  3LY8 A;  3QC1 A;  3FDH A;  2LSV A;  3SNX A;  4E47 A;  1VDY A;  5DBK A;  5EG2 A;  2WXQ A;  3RIB A;  3L54 A;  5BV0 A;  1PEG A;  3ZYQ A;  3GW4 A;  3TXM A;  4XKC A;  4N39 A;  4HVB A;  2KZT A;  4H12 A;  4APO A;  2V4L A;  2QPW A;  3M5A A;  2XRZ A;  4I1M A;  4UWF A;  3DB5 A;  3U4T A;  5CCL A;  4KT6 B;  3VLF A;  3SW9 A;  2FO7 A;  4L23 A;  5CHE E;  4J7F A;  3ZN3 A;  4HS2 A;  3QKY A;  5AYF A;  3LS8 A;  2KCK A;  4JXT A;  4WWP A;  2EQX A;  5CPR B;  4GYO A;  4HOT A;  3PUJ A;  5FQ6 A;  5JJ6 A;  2E2E A;  3RJW A;  5T0K A;  3KMA A;  3AS5 A;  3RRN B;  2WB2 A;  2WPV A;  4L2Y A;  4C9B B;  4U0S A;  1OWP A;  5ENN A;  3BEE A;  4GA0 A;  3CK9 A;  5F6L A;  2X6K A;  3JQ1 A;  4K03 A;  3CHS A;  2BQZ A;  4GU5 A;  4M3O A;  2IOS A;  5LSX A;  3RO3 A;  4BFR A;  2BF0 X;  3KMJ A;  3CKB A;  3MCX A;  3FTW A;  3S7F A;  1EF1 C;  4FUL A;  2WXR A;  3SFZ A;  1FVF A;  1UG3 A;  4KYO B;  3FTU A;  1E7V A;  3LY7 A;  3ZW3 A;  2ZU6 B;  3FWV A;  4OVV A;  1DVP A;  2CFZ A;  2CFU A;  4K0R A;  2XCC A;  3ASG A;  3FU0 A;  3OTN A;  4EQF A;  4BT9 A;  2FI7 A;  1JWG A;  4HOQ A;  2I1J A;  4PS3 A;  4FHJ A;  4UQX A;  3UT8 A;  2L0T B;  2RD0 A;  4UI9 J;  1IYG A;  3SGH A;  1MQS A;  2A5U A;  3OS5 A;  3IBE A;  2YIN A;  2JV0 A;  2VGY A;  3GZ2 A;  1H2V C;  3CVP A;  4XI0 A;  3KMT A;  4QFV A;  3OXL A;  2WQH A;  4IUL A;  5LFA A;  1E96 B;  3HYM B;  4OVU A;  4C0E A;  2X6I A;  4ACL A;  4AXH A;  2O8J A;  4XKB A;  3SI5 A;  4UI9 C;  3CVY A;  3CK7 A;  3FUM A;  4UWG A;  4Y6C A;  3FHE A;  3G2T A;  2OND A;  3FTZ A;  5G04 J;  4CT4 A;  3DAL A;  1H3I A;  4IYP A;  5F5E A;  4CCA A;  4B8A A;  4MRU A;  2WVI A;  2NSZ A;  2KCL A;  3EHN A;  1ZBP A;  2CHX A;  3GZS A;  5BT1 A;  4CRW A;  3P2B A;  2GGF A;  2JEK A;  5F59 A;  3TG5 A;  3JYS A;  3LJ3 A;  5G04 C;  4Y6W A;  2LAH A;  4LUN U;  4JL0 A;  3S8P A;  4JW1 A;  3D9N A;  3P1U A;  3CHM A;  4RVB A;  4DK5 A;  2IFU A;  4EBA G;  4AM9 A;  2C0M A;  4I1A A;  2C2L A;  1BPO A;  4IN3 B;  4G11 A;  2RFI A;  1HX8 A;  3FTV A;  3ZRH A;  4J6I A;  1MVX A;  3CVW A;  3IEG A;  5JHB A;  4UQZ A;  2G46 A;  3CHO A;  3CGH A;  2I9C A;  3GZ1 A;  2QFC A;  4FAD A;  4DPR A;  3HIZ A;  2VSO E;  1Y8M A;  5FTP A;  1ELW A;  1HS6 A;  4B8C B;  2Y4T A;  4APF A;  3FTY A;  1N6C A;  4G26 A;  3RJV A;  5D0Q D;  1HF8 A;  2UWJ G;  1OWO A;  3OOI A;  1A17 A;  3K5K A;  2WXN A;  3GYZ A;  3BG0 B;  3JCK C;  1N52 A;  3TGO A;  5JIY A;  4JEU A;  3I5P A;  2WXG A;  3LVQ E;  4B89 A;  4JA9 A;  4HOU A;  3HNA A;  3PNT B;  3RK6 A;  1JWF A;  3RO2 A;  2WM9 A;  3I4G A;  1P5Q A;  4DI4 A;  3F9Z A;  3QAQ A;  4ABN A;  2XGS A;  2P58 C;  5EX0 A;  1UJJ A;  4MKT A;  2GRM A;  3L13 A;  2VGX B;  3JQ0 A;  2CG3 A;  2WMO A;  3LXU X;  3R7Q A;  2WXI A;  4LRZ A;  5G2N A;  1PAQ A;  4GZ5 A;  1HE8 A;  4HXI A;  4RSY A;  4W9R A;  5AJL A;  4WNE A;  3M54 A;  3QDN A;  4YVQ C;  3FUH A;  3TXN A;  4WUY A;  1GW6 A;  4EZK A;  5EX3 A;  3TJP A;  3ZIM A;  4AV7 A;  1HU3 A;  5E75 A;  3TL5 A;  2LSU A;  4YNM A;  4I6E A;  1ZKK A;  3AU4 A;  3IHV A;  4GA2 A;  2FF4 A;  2J07 A;  3U3W A;  2E0I A;  3OXF A;  4BWR A;  2X6J A;  5AYW D;  3RQ4 A;  5JJ0 A;  3PZD A;  4A1S A;  2XPZ A;  5T3R A;  3PEV B;  1IQU A;  1H2U A;  3L17 A;  3HDX A;  4R7L A;  4CDM A;  4DLO A;  4GCO A;  5ARG A;  4I51 A;  2OVB A;  3ONK A;  1NZN A;  3MO0 A;  3R9A B;  3ZGQ A;  3ZFW A;  4NRH B;  4NAC A;  5G05 C;  3IHY A;  3F9Y A;  4L1B A;  4PUC A;  2J9Q A;  3CR3 A;  3O4Z A;  2VTB B;  3M57 A;  2DBA A;  2UY1 A;  4I9C A;  2WXH A;  3F9X A;  3B7R L;  2I6H A;  4FHK A;  3VLE A;  3KAE A;  2X6H A;  3S7J A;  3SD5 A;  4CDN A;  2XCB A;  4XIF A;  4LEU A;  3UX4 A;  3MO2 A;  4J7I A;  5DIZ A;  3UMV A;  4TV3 A;  2W5Z A;  3CKC A;  5ANL A;  4EEC A;  2BUG A;  4EPZ A;  4JC8 A;  4I9E A;  4HFG A;  3CQG B;  3NQP A;  2AXV A;  5FZQ A;  3I3N A;  3ML8 A;  4G2V A;  4ANX A;  4RZ0 A;  3VTX A;  3CQC B;  4GA1 A;  4I2Z A;  1E7U A;  1KT0 A;  2XQ0 A;  4Q96 A;  3RKV A;  2L0I A;  4PS8 A;  3CLJ A;  4KVO A;  1QQE A;  4F1S A;  5EDS A;  1XNF A;  4XI9 A;  3ASH A;  4QEN A;  1OWN A;  3U66 A;  3RAY A;  4GCN A;  1Y6I A;  3L08 A;  3R7R A;  3D9J A;  4H7X A;  2X6F A;  4JPS A;  1MVH A;  4BX8 A;  4MI5 A;  3PH0 C;  3CVL A;  4EZJ A;  1E8W A;  1JPL A;  3MV3 B;  3ULQ A;  3PRZ A;  2XPY A;  3ML9 A;  2M63 A;  4O6F A;  4O30 A;  4FJY A;  3Q4A B;  4JEH A;  3L22 A;  1YA0 A;  3ZYM A;  1WY6 A;  4RG9 A;  1OUV A;  4N3B A;  2FEZ A;  3ZYK A;  5CMY A;  3CST A;  3CVV A;  2I1K A;  3ZYL A;  2PZI A;  3FUJ A;  3L16 A;  3MV2 B;  4NQ0 A;  4IJ8 A;  5C2Y A;  2IF4 A;  5LX8 A;  3ZXS A;  4A3V A;  3MEK A;  4DLQ A;  4HLE A;  3EIJ A;  3NZS A;  4ACK A;  2V8S E;  3PRE A;  2L9B A;  3FUK A;  4BT8 A;  2R3A A;  5LSZ A;  5T8I A;  4FLH A;  3BG1 B;  3M58 A;  2XEV A;  2HR2 A;  3EHM A;  3MJW A;  2GRL A;  3SWC A;  2LAI A;  4E85 A;  1MHQ A;  3B7U X;  3IV0 A;  4JHK A;  1Z3Y A;  5CMW A;  3IHX A;  3QB2 A;  2OOE A;  5KJM A;  4OYS A;  4ANW A;  3VV0 A;  2ION A;  2V5F A;  3FUI A;  2KAT A;  3D9I A;  3FY4 A;  1B89 A;  3MKQ A;  2YQ8 A;  4KZC A;  5FWQ A;  4Q94 A;  2C0L A;  5CCM A;  2WXP A;  1EPU A;  1MT6 A;  4J83 A;  4YPE A;  3OXG A;  3UT4 A;  3EJN A;  2J4B A;  2LO6 A;  5HI7 A;  4BY6 A;  4EZL A;  3FH7 A;  3RRM B;  5T0M A;  5JHA A;  4GB9 A;  2OV8 A;  4GAA A;  3QWW A;  4YND A;  3WXX A;  3ZHE A;  4ANV A;  1N6A A;  4BUP A;  4TUU A;  3LYA A;  1E8X A;  4AU7 A;  3ONL A;  2VJ8 A;  2J49 A;  1H6K A;  3CBP A;  3NZU A;  3CVU A;  4HOR A;  2I2O A;  2IQC A;  4N5C A;  3G2V A;  2MHK A;  3URZ A;  2F69 A;  3ZVV A;  4AOF A;  3MO5 A;  5A6C A;  3Q49 B;  3FUN A;  3LKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...