3DALA

Methyltransferase domain of human pr domain-containing protein 1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
179
Chain Sequence
SSGLVPRGSKADMTLWTEAEFEEKCTYIVNDHPWDVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPNRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of methyltransferase domain of human PR domain-containing protein 1
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PR domain zinc finger protein 1
total genus 48
structure length 179
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3dalA00
5KJNA 3F9ZA 3OOIA 4LDGA 3OXGA 3FPDA 4QENA 3MO2A 3OXLA 4E47A 4J7IA 5JIYA 4RZ0A 5F6KC 2W5YA 3BO5A 1MVXA 3KMJA 4FMUA 3M56A 3F9XA 3RAYA 3VUZA 5TH7A 4YPAA 1N6AA 3RU0A 2O8JA 3RJWA 3M53A 3M58A 4NJ5A 1XQHA 5ARGA 5AYFA 3VV0A 3S7DA 3F9WA 3KMTA 2RFIA 3CBPA 5ARFA 1PEGA 3M54A 3OXFA 5T0KA 4AU7A 4BUPA 4WUYA 3EP0A 3DALA 5EX0A 5HI7A 3S7JA 4YNDA 5F5EA 3PDNA 4YNPA 3MEKA 4YPUA 3QWWA 4QEOA 3CBMA 5T5GA 4QEPA 1H3IA 3OPEA 3CBOA 4J7FA 4IJ8A 4YPEA 5LSXA 3IHXA 3K5KA 2JV0A 3QWVA 1ML9A 3OS5A 5CCLA 1MUFA 4IJDA 3MO5A 4H12A 1N3JA 3M59A 1MT6A 4MI0A 5KJKA 3MO0A 5JHNA 3TG5A 5LSZA 5EG2A 2W5ZA 4JLGA 3M55A 1N6CA 3S8PA 3M5AA 2G46A 5CCMA 2QPWA 4O6FA 4JDSA 2IGQA 5KJLA 5JINA 3M57A 5F59A 3F9YA 4C1QA 5EX3A 3QWPA 5TTFA 3RIBA 3KMAA 5JJ0A 5KJMA 5F6LA 3TG4A 3N71A 2F69A 5CPRB 3S7BA 1ZKKA 5HQ8A 4MI5A 4J83A 3DB5A 4J8OA 3RQ4A 5TEGA 4O30A 2BQZA 3SWCA 3SW9A 4YNMA 5T0MA 3HNAA 4NVQA 1MVHA 4I51A 3S7FA 4Z4PA 2R3AA 1O9SA
chains in the Genus database with same CATH superfamily
5KJNA 3F9ZA 3OOIA 4LDGA 3OXGA 3FPDA 4QENA 3MO2A 3OXLA 4E47A 4J7IA 5JIYA 4RZ0A 5F6KC 2W5YA 3BO5A 1MVXA 3KMJA 4FMUA 3M56A 3F9XA 3RAYA 3VUZA 5TH7A 4YPAA 1N6AA 3RU0A 2O8JA 3RJWA 3M53A 3M58A 4NJ5A 1XQHA 5ARGA 5AYFA 3VV0A 3S7DA 3F9WA 3KMTA 2RFIA 3CBPA 5ARFA 1PEGA 3M54A 3OXFA 5T0KA 4AU7A 4BUPA 4WUYA 3EP0A 3DALA 5EX0A 5HI7A 3S7JA 4YNDA 5F5EA 3PDNA 4YNPA 3MEKA 4YPUA 3QWWA 4QEOA 3CBMA 5T5GA 4QEPA 1H3IA 3OPEA 3CBOA 4J7FA 4IJ8A 4YPEA 5LSXA 3IHXA 3K5KA 2JV0A 3QWVA 1ML9A 3OS5A 5CCLA 1MUFA 4IJDA 3MO5A 4H12A 1N3JA 3M59A 1MT6A 4MI0A 5KJKA 3MO0A 5JHNA 3TG5A 5LSZA 5EG2A 2W5ZA 4JLGA 3M55A 1N6CA 3S8PA 3M5AA 2G46A 5CCMA 2QPWA 4O6FA 4JDSA 2IGQA 5KJLA 5JINA 3M57A 5F59A 3F9YA 4C1QA 5EX3A 3QWPA 5TTFA 3RIBA 3KMAA 5JJ0A 5KJMA 5F6LA 3TG4A 3N71A 2F69A 5CPRB 3S7BA 1ZKKA 5HQ8A 4MI5A 4J83A 3DB5A 4J8OA 3RQ4A 5TEGA 4O30A 2BQZA 3SWCA 3SW9A 4YNMA 5T0MA 3HNAA 4NVQA 1MVHA 4I51A 3S7FA 4Z4PA 2R3AA 1O9SA
chains in the Genus database with same CATH topology
5KJNA 3F9ZA 3OOIA 4LDGA 3OXGA 3FPDA 4QENA 3MO2A 3OXLA 4E47A 4J7IA 5JIYA 4RZ0A 5F6KC 2W5YA 3BO5A 1MVXA 3KMJA 4FMUA 3M56A 3F9XA 3RAYA 3VUZA 5TH7A 4YPAA 1N6AA 3RU0A 2O8JA 3RJWA 3M53A 3M58A 4NJ5A 1XQHA 5ARGA 5AYFA 3VV0A 3S7DA 3F9WA 3KMTA 2RFIA 3CBPA 5ARFA 1PEGA 3M54A 3OXFA 5T0KA 4AU7A 4BUPA 4WUYA 3EP0A 3DALA 5EX0A 5HI7A 3S7JA 4YNDA 5F5EA 3PDNA 4YNPA 3MEKA 4YPUA 3QWWA 4QEOA 3CBMA 5T5GA 4QEPA 1H3IA 3OPEA 3CBOA 4J7FA 4IJ8A 4YPEA 5LSXA 3IHXA 3K5KA 2JV0A 3QWVA 1ML9A 3OS5A 5CCLA 1MUFA 4IJDA 3MO5A 4H12A 1N3JA 3M59A 1MT6A 4MI0A 5KJKA 3MO0A 5JHNA 3TG5A 5LSZA 5EG2A 2W5ZA 4JLGA 3M55A 1N6CA 3S8PA 3M5AA 2G46A 5CCMA 2QPWA 4O6FA 4JDSA 2IGQA 5KJLA 5JINA 3M57A 5F59A 3F9YA 4C1QA 5EX3A 3QWPA 5TTFA 3RIBA 3KMAA 5JJ0A 5KJMA 5F6LA 3TG4A 3N71A 2F69A 5CPRB 3S7BA 1ZKKA 5HQ8A 4MI5A 4J83A 3DB5A 4J8OA 3RQ4A 5TEGA 4O30A 2BQZA 3SWCA 3SW9A 4YNMA 5T0MA 3HNAA 4NVQA 1MVHA 4I51A 3S7FA 4Z4PA 2R3AA 1O9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJN A;  3F9Z A;  3OOI A;  4LDG A;  3OXG A;  3FPD A;  4QEN A;  3MO2 A;  3OXL A;  4E47 A;  4J7I A;  5JIY A;  4RZ0 A;  5F6K C;  2W5Y A;  3BO5 A;  1MVX A;  3KMJ A;  4FMU A;  3M56 A;  3F9X A;  3RAY A;  3VUZ A;  5TH7 A;  4YPA A;  1N6A A;  3RU0 A;  2O8J A;  3RJW A;  3M53 A;  3M58 A;  4NJ5 A;  1XQH A;  5ARG A;  5AYF A;  3VV0 A;  3S7D A;  3F9W A;  3KMT A;  2RFI A;  3CBP A;  5ARF A;  1PEG A;  3M54 A;  3OXF A;  5T0K A;  4AU7 A;  4BUP A;  4WUY A;  3EP0 A;  3DAL A;  5EX0 A;  5HI7 A;  3S7J A;  4YND A;  5F5E A;  3PDN A;  4YNP A;  3MEK A;  4YPU A;  3QWW A;  4QEO A;  3CBM A;  5T5G A;  4QEP A;  1H3I A;  3OPE A;  3CBO A;  4J7F A;  4IJ8 A;  4YPE A;  5LSX A;  3IHX A;  3K5K A;  2JV0 A;  3QWV A;  1ML9 A;  3OS5 A;  5CCL A;  1MUF A;  4IJD A;  3MO5 A;  4H12 A;  1N3J A;  3M59 A;  1MT6 A;  4MI0 A;  5KJK A;  3MO0 A;  5JHN A;  3TG5 A;  5LSZ A;  5EG2 A;  2W5Z A;  4JLG A;  3M55 A;  1N6C A;  3S8P A;  3M5A A;  2G46 A;  5CCM A;  2QPW A;  4O6F A;  4JDS A;  2IGQ A;  5KJL A;  5JIN A;  3M57 A;  5F59 A;  3F9Y A;  4C1Q A;  5EX3 A;  3QWP A;  5TTF A;  3RIB A;  3KMA A;  5JJ0 A;  5KJM A;  5F6L A;  3TG4 A;  3N71 A;  2F69 A;  5CPR B;  3S7B A;  1ZKK A;  5HQ8 A;  4MI5 A;  4J83 A;  3DB5 A;  4J8O A;  3RQ4 A;  5TEG A;  4O30 A;  2BQZ A;  3SWC A;  3SW9 A;  4YNM A;  5T0M A;  3HNA A;  4NVQ A;  1MVH A;  4I51 A;  3S7F A;  4Z4P A;  2R3A A;  1O9S A; 
#chains in the Genus database with same CATH topology
 5KJN A;  3F9Z A;  3OOI A;  4LDG A;  3OXG A;  3FPD A;  4QEN A;  3MO2 A;  3OXL A;  4E47 A;  4J7I A;  5JIY A;  4RZ0 A;  5F6K C;  2W5Y A;  3BO5 A;  1MVX A;  3KMJ A;  4FMU A;  3M56 A;  3F9X A;  3RAY A;  3VUZ A;  5TH7 A;  4YPA A;  1N6A A;  3RU0 A;  2O8J A;  3RJW A;  3M53 A;  3M58 A;  4NJ5 A;  1XQH A;  5ARG A;  5AYF A;  3VV0 A;  3S7D A;  3F9W A;  3KMT A;  2RFI A;  3CBP A;  5ARF A;  1PEG A;  3M54 A;  3OXF A;  5T0K A;  4AU7 A;  4BUP A;  4WUY A;  3EP0 A;  3DAL A;  5EX0 A;  5HI7 A;  3S7J A;  4YND A;  5F5E A;  3PDN A;  4YNP A;  3MEK A;  4YPU A;  3QWW A;  4QEO A;  3CBM A;  5T5G A;  4QEP A;  1H3I A;  3OPE A;  3CBO A;  4J7F A;  4IJ8 A;  4YPE A;  5LSX A;  3IHX A;  3K5K A;  2JV0 A;  3QWV A;  1ML9 A;  3OS5 A;  5CCL A;  1MUF A;  4IJD A;  3MO5 A;  4H12 A;  1N3J A;  3M59 A;  1MT6 A;  4MI0 A;  5KJK A;  3MO0 A;  5JHN A;  3TG5 A;  5LSZ A;  5EG2 A;  2W5Z A;  4JLG A;  3M55 A;  1N6C A;  3S8P A;  3M5A A;  2G46 A;  5CCM A;  2QPW A;  4O6F A;  4JDS A;  2IGQ A;  5KJL A;  5JIN A;  3M57 A;  5F59 A;  3F9Y A;  4C1Q A;  5EX3 A;  3QWP A;  5TTF A;  3RIB A;  3KMA A;  5JJ0 A;  5KJM A;  5F6L A;  3TG4 A;  3N71 A;  2F69 A;  5CPR B;  3S7B A;  1ZKK A;  5HQ8 A;  4MI5 A;  4J83 A;  3DB5 A;  4J8O A;  3RQ4 A;  5TEG A;  4O30 A;  2BQZ A;  3SWC A;  3SW9 A;  4YNM A;  5T0M A;  3HNA A;  4NVQ A;  1MVH A;  4I51 A;  3S7F A;  4Z4P A;  2R3A A;  1O9S A; 
#chains in the Genus database with same CATH homology
 5KJN A;  3F9Z A;  3OOI A;  4LDG A;  3OXG A;  3FPD A;  4QEN A;  3MO2 A;  3OXL A;  4E47 A;  4J7I A;  5JIY A;  4RZ0 A;  5F6K C;  2W5Y A;  3BO5 A;  1MVX A;  3KMJ A;  4FMU A;  3M56 A;  3F9X A;  3RAY A;  3VUZ A;  5TH7 A;  4YPA A;  1N6A A;  3RU0 A;  2O8J A;  3RJW A;  3M53 A;  3M58 A;  4NJ5 A;  1XQH A;  5ARG A;  5AYF A;  3VV0 A;  3S7D A;  3F9W A;  3KMT A;  2RFI A;  3CBP A;  5ARF A;  1PEG A;  3M54 A;  3OXF A;  5T0K A;  4AU7 A;  4BUP A;  4WUY A;  3EP0 A;  3DAL A;  5EX0 A;  5HI7 A;  3S7J A;  4YND A;  5F5E A;  3PDN A;  4YNP A;  3MEK A;  4YPU A;  3QWW A;  4QEO A;  3CBM A;  5T5G A;  4QEP A;  1H3I A;  3OPE A;  3CBO A;  4J7F A;  4IJ8 A;  4YPE A;  5LSX A;  3IHX A;  3K5K A;  2JV0 A;  3QWV A;  1ML9 A;  3OS5 A;  5CCL A;  1MUF A;  4IJD A;  3MO5 A;  4H12 A;  1N3J A;  3M59 A;  1MT6 A;  4MI0 A;  5KJK A;  3MO0 A;  5JHN A;  3TG5 A;  5LSZ A;  5EG2 A;  2W5Z A;  4JLG A;  3M55 A;  1N6C A;  3S8P A;  3M5A A;  2G46 A;  5CCM A;  2QPW A;  4O6F A;  4JDS A;  2IGQ A;  5KJL A;  5JIN A;  3M57 A;  5F59 A;  3F9Y A;  4C1Q A;  5EX3 A;  3QWP A;  5TTF A;  3RIB A;  3KMA A;  5JJ0 A;  5KJM A;  5F6L A;  3TG4 A;  3N71 A;  2F69 A;  5CPR B;  3S7B A;  1ZKK A;  5HQ8 A;  4MI5 A;  4J83 A;  3DB5 A;  4J8O A;  3RQ4 A;  5TEG A;  4O30 A;  2BQZ A;  3SWC A;  3SW9 A;  4YNM A;  5T0M A;  3HNA A;  4NVQ A;  1MVH A;  4I51 A;  3S7F A;  4Z4P A;  2R3A A;  1O9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...