3DALA

Methyltransferase domain of human pr domain-containing protein 1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
179
Chain Sequence
SSGLVPRGSKADMTLWTEAEFEEKCTYIVNDHPWDVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPNRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 1
publication title The crystal structure of methyltransferase domain of human PR domain-containing protein 1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 179
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3dalA00
3RJWA 1N6AA 5AYFA 3TG4A 3OPEA 3QWPA 1XQHA 5KJMA 4O30A 3M58A 3S7JA 4QEOA 3OXLA 5F6LA 2F69A 2BQZA 4IJDA 3MO2A 3PDNA 3VV0A 3N71A 5HQ8A 3VUZA 5JJ0A 3M57A 3KMAA 4MI0A 4H12A 5KJKA 3CBOA 5KJNA 3RU0A 3M56A 5F59A 4QEPA 1H3IA 4IJ8A 4JDSA 4E47A 4BUPA 1MUFA 5JINA 3M53A 3KMJA 3BO5A 5TEGA 4WUYA 3S7FA 3TG5A 4AU7A 5TH7A 3OXFA 5HI7A 5LSXA 5TTFA 3MO0A 3SWCA 3K5KA 4J7IA 3HNAA 3F9WA 4YPUA 4NVQA 3SW9A 3M5AA 5CCMA 2JV0A 4JLGA 1MT6A 5ARFA 2R3AA 2QPWA 3IHXA 5LSZA 4FMUA 3RAYA 4J8OA 5KJLA 3KMTA 5F5EA 5F6KC 4J83A 2RFIA 1ZKKA 4Z4PA 4O6FA 4YPAA 3S8PA 5T5GA 3M59A 4MI5A 3MEKA 3OS5A 3MO5A 1PEGA 3F9XA 2O8JA 1O9SA 3RIBA 5JIYA 3FPDA 4J7FA 4YNDA 4YNMA 2W5YA 4RZ0A 5JHNA 4YNPA 3DB5A 1N6CA 4YPEA 3RQ4A 4NJ5A 3QWWA 5EX0A 3OXGA 3F9YA 3CBPA 3DALA 4LDGA 3F9ZA 2IGQA 3M55A 3EP0A 5ARGA 3QWVA 2W5ZA 2G46A 5EG2A 1MVHA 3OOIA 3CBMA 3S7BA 4C1QA 1ML9A 4I51A 3S7DA 5CPRB 4QENA 5T0KA 3M54A 5CCLA 1MVXA 1N3JA 5T0MA 5EX3A
chains in the Genus database with same CATH superfamily
3RJWA 1N6AA 5AYFA 3TG4A 3OPEA 3QWPA 1XQHA 5KJMA 4O30A 3M58A 3S7JA 4QEOA 3OXLA 5F6LA 2F69A 2BQZA 4IJDA 3MO2A 3PDNA 3VV0A 3N71A 5HQ8A 3VUZA 5JJ0A 3M57A 3KMAA 4MI0A 4H12A 5KJKA 3CBOA 5KJNA 3RU0A 3M56A 5F59A 4QEPA 1H3IA 4IJ8A 4JDSA 4E47A 4BUPA 1MUFA 5JINA 3M53A 3KMJA 3BO5A 5TEGA 4WUYA 3S7FA 3TG5A 4AU7A 5TH7A 3OXFA 5HI7A 5LSXA 5TTFA 3MO0A 3SWCA 3K5KA 4J7IA 3HNAA 3F9WA 4YPUA 4NVQA 3SW9A 3M5AA 5CCMA 2JV0A 4JLGA 1MT6A 5ARFA 2R3AA 2QPWA 3IHXA 5LSZA 4FMUA 3RAYA 4J8OA 5KJLA 3KMTA 5F5EA 5F6KC 4J83A 2RFIA 1ZKKA 4Z4PA 4O6FA 4YPAA 3S8PA 5T5GA 3M59A 4MI5A 3MEKA 3OS5A 3MO5A 1PEGA 3F9XA 2O8JA 1O9SA 3RIBA 5JIYA 3FPDA 4J7FA 4YNDA 4YNMA 2W5YA 4RZ0A 5JHNA 4YNPA 3DB5A 1N6CA 4YPEA 3RQ4A 4NJ5A 3QWWA 5EX0A 3OXGA 3F9YA 3CBPA 3DALA 4LDGA 3F9ZA 2IGQA 3M55A 3EP0A 5ARGA 3QWVA 2W5ZA 2G46A 5EG2A 1MVHA 3OOIA 3CBMA 3S7BA 4C1QA 1ML9A 4I51A 3S7DA 5CPRB 4QENA 5T0KA 3M54A 5CCLA 1MVXA 1N3JA 5T0MA 5EX3A
chains in the Genus database with same CATH topology
3RJWA 1N6AA 5AYFA 3TG4A 3OPEA 3QWPA 1XQHA 5KJMA 4O30A 3M58A 3S7JA 4QEOA 3OXLA 5F6LA 2F69A 2BQZA 4IJDA 3MO2A 3PDNA 3VV0A 3N71A 5HQ8A 3VUZA 5JJ0A 3M57A 3KMAA 4MI0A 4H12A 5KJKA 3CBOA 5KJNA 3RU0A 3M56A 5F59A 4QEPA 1H3IA 4IJ8A 4JDSA 4E47A 4BUPA 1MUFA 5JINA 3M53A 3KMJA 3BO5A 5TEGA 4WUYA 3S7FA 3TG5A 4AU7A 5TH7A 3OXFA 5HI7A 5LSXA 5TTFA 3MO0A 3SWCA 3K5KA 4J7IA 3HNAA 3F9WA 4YPUA 4NVQA 3SW9A 3M5AA 5CCMA 2JV0A 4JLGA 1MT6A 5ARFA 2R3AA 2QPWA 3IHXA 5LSZA 4FMUA 3RAYA 4J8OA 5KJLA 3KMTA 5F5EA 5F6KC 4J83A 2RFIA 1ZKKA 4Z4PA 4O6FA 4YPAA 3S8PA 5T5GA 3M59A 4MI5A 3MEKA 3OS5A 3MO5A 1PEGA 3F9XA 2O8JA 1O9SA 3RIBA 5JIYA 3FPDA 4J7FA 4YNDA 4YNMA 2W5YA 4RZ0A 5JHNA 4YNPA 3DB5A 1N6CA 4YPEA 3RQ4A 4NJ5A 3QWWA 5EX0A 3OXGA 3F9YA 3CBPA 3DALA 4LDGA 3F9ZA 2IGQA 3M55A 3EP0A 5ARGA 3QWVA 2W5ZA 2G46A 5EG2A 1MVHA 3OOIA 3CBMA 3S7BA 4C1QA 1ML9A 4I51A 3S7DA 5CPRB 4QENA 5T0KA 3M54A 5CCLA 1MVXA 1N3JA 5T0MA 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJW A;  1N6A A;  5AYF A;  3TG4 A;  3OPE A;  3QWP A;  1XQH A;  5KJM A;  4O30 A;  3M58 A;  3S7J A;  4QEO A;  3OXL A;  5F6L A;  2F69 A;  2BQZ A;  4IJD A;  3MO2 A;  3PDN A;  3VV0 A;  3N71 A;  5HQ8 A;  3VUZ A;  5JJ0 A;  3M57 A;  3KMA A;  4MI0 A;  4H12 A;  5KJK A;  3CBO A;  5KJN A;  3RU0 A;  3M56 A;  5F59 A;  4QEP A;  1H3I A;  4IJ8 A;  4JDS A;  4E47 A;  4BUP A;  1MUF A;  5JIN A;  3M53 A;  3KMJ A;  3BO5 A;  5TEG A;  4WUY A;  3S7F A;  3TG5 A;  4AU7 A;  5TH7 A;  3OXF A;  5HI7 A;  5LSX A;  5TTF A;  3MO0 A;  3SWC A;  3K5K A;  4J7I A;  3HNA A;  3F9W A;  4YPU A;  4NVQ A;  3SW9 A;  3M5A A;  5CCM A;  2JV0 A;  4JLG A;  1MT6 A;  5ARF A;  2R3A A;  2QPW A;  3IHX A;  5LSZ A;  4FMU A;  3RAY A;  4J8O A;  5KJL A;  3KMT A;  5F5E A;  5F6K C;  4J83 A;  2RFI A;  1ZKK A;  4Z4P A;  4O6F A;  4YPA A;  3S8P A;  5T5G A;  3M59 A;  4MI5 A;  3MEK A;  3OS5 A;  3MO5 A;  1PEG A;  3F9X A;  2O8J A;  1O9S A;  3RIB A;  5JIY A;  3FPD A;  4J7F A;  4YND A;  4YNM A;  2W5Y A;  4RZ0 A;  5JHN A;  4YNP A;  3DB5 A;  1N6C A;  4YPE A;  3RQ4 A;  4NJ5 A;  3QWW A;  5EX0 A;  3OXG A;  3F9Y A;  3CBP A;  3DAL A;  4LDG A;  3F9Z A;  2IGQ A;  3M55 A;  3EP0 A;  5ARG A;  3QWV A;  2W5Z A;  2G46 A;  5EG2 A;  1MVH A;  3OOI A;  3CBM A;  3S7B A;  4C1Q A;  1ML9 A;  4I51 A;  3S7D A;  5CPR B;  4QEN A;  5T0K A;  3M54 A;  5CCL A;  1MVX A;  1N3J A;  5T0M A;  5EX3 A; 
#chains in the Genus database with same CATH topology
 3RJW A;  1N6A A;  5AYF A;  3TG4 A;  3OPE A;  3QWP A;  1XQH A;  5KJM A;  4O30 A;  3M58 A;  3S7J A;  4QEO A;  3OXL A;  5F6L A;  2F69 A;  2BQZ A;  4IJD A;  3MO2 A;  3PDN A;  3VV0 A;  3N71 A;  5HQ8 A;  3VUZ A;  5JJ0 A;  3M57 A;  3KMA A;  4MI0 A;  4H12 A;  5KJK A;  3CBO A;  5KJN A;  3RU0 A;  3M56 A;  5F59 A;  4QEP A;  1H3I A;  4IJ8 A;  4JDS A;  4E47 A;  4BUP A;  1MUF A;  5JIN A;  3M53 A;  3KMJ A;  3BO5 A;  5TEG A;  4WUY A;  3S7F A;  3TG5 A;  4AU7 A;  5TH7 A;  3OXF A;  5HI7 A;  5LSX A;  5TTF A;  3MO0 A;  3SWC A;  3K5K A;  4J7I A;  3HNA A;  3F9W A;  4YPU A;  4NVQ A;  3SW9 A;  3M5A A;  5CCM A;  2JV0 A;  4JLG A;  1MT6 A;  5ARF A;  2R3A A;  2QPW A;  3IHX A;  5LSZ A;  4FMU A;  3RAY A;  4J8O A;  5KJL A;  3KMT A;  5F5E A;  5F6K C;  4J83 A;  2RFI A;  1ZKK A;  4Z4P A;  4O6F A;  4YPA A;  3S8P A;  5T5G A;  3M59 A;  4MI5 A;  3MEK A;  3OS5 A;  3MO5 A;  1PEG A;  3F9X A;  2O8J A;  1O9S A;  3RIB A;  5JIY A;  3FPD A;  4J7F A;  4YND A;  4YNM A;  2W5Y A;  4RZ0 A;  5JHN A;  4YNP A;  3DB5 A;  1N6C A;  4YPE A;  3RQ4 A;  4NJ5 A;  3QWW A;  5EX0 A;  3OXG A;  3F9Y A;  3CBP A;  3DAL A;  4LDG A;  3F9Z A;  2IGQ A;  3M55 A;  3EP0 A;  5ARG A;  3QWV A;  2W5Z A;  2G46 A;  5EG2 A;  1MVH A;  3OOI A;  3CBM A;  3S7B A;  4C1Q A;  1ML9 A;  4I51 A;  3S7D A;  5CPR B;  4QEN A;  5T0K A;  3M54 A;  5CCL A;  1MVX A;  1N3J A;  5T0M A;  5EX3 A; 
#chains in the Genus database with same CATH homology
 3RJW A;  1N6A A;  5AYF A;  3TG4 A;  3OPE A;  3QWP A;  1XQH A;  5KJM A;  4O30 A;  3M58 A;  3S7J A;  4QEO A;  3OXL A;  5F6L A;  2F69 A;  2BQZ A;  4IJD A;  3MO2 A;  3PDN A;  3VV0 A;  3N71 A;  5HQ8 A;  3VUZ A;  5JJ0 A;  3M57 A;  3KMA A;  4MI0 A;  4H12 A;  5KJK A;  3CBO A;  5KJN A;  3RU0 A;  3M56 A;  5F59 A;  4QEP A;  1H3I A;  4IJ8 A;  4JDS A;  4E47 A;  4BUP A;  1MUF A;  5JIN A;  3M53 A;  3KMJ A;  3BO5 A;  5TEG A;  4WUY A;  3S7F A;  3TG5 A;  4AU7 A;  5TH7 A;  3OXF A;  5HI7 A;  5LSX A;  5TTF A;  3MO0 A;  3SWC A;  3K5K A;  4J7I A;  3HNA A;  3F9W A;  4YPU A;  4NVQ A;  3SW9 A;  3M5A A;  5CCM A;  2JV0 A;  4JLG A;  1MT6 A;  5ARF A;  2R3A A;  2QPW A;  3IHX A;  5LSZ A;  4FMU A;  3RAY A;  4J8O A;  5KJL A;  3KMT A;  5F5E A;  5F6K C;  4J83 A;  2RFI A;  1ZKK A;  4Z4P A;  4O6F A;  4YPA A;  3S8P A;  5T5G A;  3M59 A;  4MI5 A;  3MEK A;  3OS5 A;  3MO5 A;  1PEG A;  3F9X A;  2O8J A;  1O9S A;  3RIB A;  5JIY A;  3FPD A;  4J7F A;  4YND A;  4YNM A;  2W5Y A;  4RZ0 A;  5JHN A;  4YNP A;  3DB5 A;  1N6C A;  4YPE A;  3RQ4 A;  4NJ5 A;  3QWW A;  5EX0 A;  3OXG A;  3F9Y A;  3CBP A;  3DAL A;  4LDG A;  3F9Z A;  2IGQ A;  3M55 A;  3EP0 A;  5ARG A;  3QWV A;  2W5Z A;  2G46 A;  5EG2 A;  1MVH A;  3OOI A;  3CBM A;  3S7B A;  4C1Q A;  1ML9 A;  4I51 A;  3S7D A;  5CPR B;  4QEN A;  5T0K A;  3M54 A;  5CCL A;  1MVX A;  1N3J A;  5T0M A;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...