3DALA

Methyltransferase domain of human pr domain-containing protein 1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
179
Chain Sequence
b'SSGLVPRGSKADMTLWTEAEFEEKCTYIVNDHPWDVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPNRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 1
publication title The crystal structure of methyltransferase domain of human PR domain-containing protein 1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 179
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3dalA00
3RJWA 3SW9A 5EX0A 2RFIA 2W5YA 4QEOA 3QWWA 3DALA 3S7FA 1N3JA 3M57A 3M53A 3OXGA 4MI5A 3TG4A 3M55A 1MVXA 4H12A 1MUFA 5LSXA 3EP0A 3RQ4A 4C1QA 2F69A 5EG2A 5F6LA 4Z4PA 2O8JA 5TTFA 1N6AA 3HNAA 5T0MA 2R3AA 3IHXA 3QWVA 4QENA 4NVQA 4I51A 5KJLA 3OS5A 1MVHA 3OXFA 3VUZA 3CBMA 3KMAA 3S7JA 4YNMA 3CBPA 3RIBA 3SWCA 3DB5A 3MO5A 5JIYA 3F9YA 3K5KA 5JJ0A 3OPEA 3F9XA 4FMUA 4YNDA 5ARFA 4QEPA 3QWPA 1ZKKA 4JDSA 1H3IA 3F9ZA 4BUPA 4WUYA 5HI7A 3OXLA 3M56A 5JINA 2QPWA 3M58A 5CPRB 1PEGA 4NJ5A 2BQZA 3VV0A 3OOIA 5F5EA 5EX3A 5LSZA 3M59A 4JLGA 3RU0A 4MI0A 5ARGA 5TEGA 5JHNA 3MO0A 4J7FA 4O30A 2G46A 3PDNA 4YPAA 5F59A 5T0KA 3MO2A 1XQHA 1MT6A 5T5GA 4IJ8A 3S7BA 3KMTA 5HQ8A 1ML9A 3MEKA 5CCMA 4AU7A 3S8PA 5CCLA 5KJKA 4YNPA 4RZ0A 5KJNA 3CBOA 3BO5A 1O9SA 3KMJA 3F9WA 3RAYA 5F6KC 4J83A 4LDGA 4J7IA 2IGQA 5AYFA 4E47A 2W5ZA 4J8OA 3TG5A 5KJMA 5TH7A 1N6CA 2JV0A 3N71A 3M5AA 3FPDA 3M54A 4YPEA 4YPUA 4IJDA 4O6FA 3S7DA
chains in the Genus database with same CATH superfamily
3RJWA 3SW9A 5EX0A 2RFIA 2W5YA 4QEOA 3QWWA 3DALA 3S7FA 1N3JA 3M57A 3M53A 3OXGA 4MI5A 3TG4A 3M55A 1MVXA 4H12A 1MUFA 5LSXA 3EP0A 3RQ4A 4C1QA 2F69A 5EG2A 5F6LA 4Z4PA 2O8JA 5TTFA 1N6AA 3HNAA 5T0MA 2R3AA 3IHXA 3QWVA 4QENA 4NVQA 4I51A 5KJLA 3OS5A 1MVHA 3OXFA 3VUZA 3CBMA 3KMAA 3S7JA 4YNMA 3CBPA 3RIBA 3SWCA 3DB5A 3MO5A 5JIYA 3F9YA 3K5KA 5JJ0A 3OPEA 3F9XA 4FMUA 4YNDA 5ARFA 4QEPA 3QWPA 1ZKKA 4JDSA 1H3IA 3F9ZA 4BUPA 4WUYA 5HI7A 3OXLA 3M56A 5JINA 2QPWA 3M58A 5CPRB 1PEGA 4NJ5A 2BQZA 3VV0A 3OOIA 5F5EA 5EX3A 5LSZA 3M59A 4JLGA 3RU0A 4MI0A 5ARGA 5TEGA 5JHNA 3MO0A 4J7FA 4O30A 2G46A 3PDNA 4YPAA 5F59A 5T0KA 3MO2A 1XQHA 1MT6A 5T5GA 4IJ8A 3S7BA 3KMTA 5HQ8A 1ML9A 3MEKA 5CCMA 4AU7A 3S8PA 5CCLA 5KJKA 4YNPA 4RZ0A 5KJNA 3CBOA 3BO5A 1O9SA 3KMJA 3F9WA 3RAYA 5F6KC 4J83A 4LDGA 4J7IA 2IGQA 5AYFA 4E47A 2W5ZA 4J8OA 3TG5A 5KJMA 5TH7A 1N6CA 2JV0A 3N71A 3M5AA 3FPDA 3M54A 4YPEA 4YPUA 4IJDA 4O6FA 3S7DA
chains in the Genus database with same CATH topology
3RJWA 3SW9A 5EX0A 2RFIA 2W5YA 4QEOA 3QWWA 3DALA 3S7FA 1N3JA 3M57A 3M53A 3OXGA 4MI5A 3TG4A 3M55A 1MVXA 4H12A 1MUFA 5LSXA 3EP0A 3RQ4A 4C1QA 2F69A 5EG2A 5F6LA 4Z4PA 2O8JA 5TTFA 1N6AA 3HNAA 5T0MA 2R3AA 3IHXA 3QWVA 4QENA 4NVQA 4I51A 5KJLA 3OS5A 1MVHA 3OXFA 3VUZA 3CBMA 3KMAA 3S7JA 4YNMA 3CBPA 3RIBA 3SWCA 3DB5A 3MO5A 5JIYA 3F9YA 3K5KA 5JJ0A 3OPEA 3F9XA 4FMUA 4YNDA 5ARFA 4QEPA 3QWPA 1ZKKA 4JDSA 1H3IA 3F9ZA 4BUPA 4WUYA 5HI7A 3OXLA 3M56A 5JINA 2QPWA 3M58A 5CPRB 1PEGA 4NJ5A 2BQZA 3VV0A 3OOIA 5F5EA 5EX3A 5LSZA 3M59A 4JLGA 3RU0A 4MI0A 5ARGA 5TEGA 5JHNA 3MO0A 4J7FA 4O30A 2G46A 3PDNA 4YPAA 5F59A 5T0KA 3MO2A 1XQHA 1MT6A 5T5GA 4IJ8A 3S7BA 3KMTA 5HQ8A 1ML9A 3MEKA 5CCMA 4AU7A 3S8PA 5CCLA 5KJKA 4YNPA 4RZ0A 5KJNA 3CBOA 3BO5A 1O9SA 3KMJA 3F9WA 3RAYA 5F6KC 4J83A 4LDGA 4J7IA 2IGQA 5AYFA 4E47A 2W5ZA 4J8OA 3TG5A 5KJMA 5TH7A 1N6CA 2JV0A 3N71A 3M5AA 3FPDA 3M54A 4YPEA 4YPUA 4IJDA 4O6FA 3S7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJW A;  3SW9 A;  5EX0 A;  2RFI A;  2W5Y A;  4QEO A;  3QWW A;  3DAL A;  3S7F A;  1N3J A;  3M57 A;  3M53 A;  3OXG A;  4MI5 A;  3TG4 A;  3M55 A;  1MVX A;  4H12 A;  1MUF A;  5LSX A;  3EP0 A;  3RQ4 A;  4C1Q A;  2F69 A;  5EG2 A;  5F6L A;  4Z4P A;  2O8J A;  5TTF A;  1N6A A;  3HNA A;  5T0M A;  2R3A A;  3IHX A;  3QWV A;  4QEN A;  4NVQ A;  4I51 A;  5KJL A;  3OS5 A;  1MVH A;  3OXF A;  3VUZ A;  3CBM A;  3KMA A;  3S7J A;  4YNM A;  3CBP A;  3RIB A;  3SWC A;  3DB5 A;  3MO5 A;  5JIY A;  3F9Y A;  3K5K A;  5JJ0 A;  3OPE A;  3F9X A;  4FMU A;  4YND A;  5ARF A;  4QEP A;  3QWP A;  1ZKK A;  4JDS A;  1H3I A;  3F9Z A;  4BUP A;  4WUY A;  5HI7 A;  3OXL A;  3M56 A;  5JIN A;  2QPW A;  3M58 A;  5CPR B;  1PEG A;  4NJ5 A;  2BQZ A;  3VV0 A;  3OOI A;  5F5E A;  5EX3 A;  5LSZ A;  3M59 A;  4JLG A;  3RU0 A;  4MI0 A;  5ARG A;  5TEG A;  5JHN A;  3MO0 A;  4J7F A;  4O30 A;  2G46 A;  3PDN A;  4YPA A;  5F59 A;  5T0K A;  3MO2 A;  1XQH A;  1MT6 A;  5T5G A;  4IJ8 A;  3S7B A;  3KMT A;  5HQ8 A;  1ML9 A;  3MEK A;  5CCM A;  4AU7 A;  3S8P A;  5CCL A;  5KJK A;  4YNP A;  4RZ0 A;  5KJN A;  3CBO A;  3BO5 A;  1O9S A;  3KMJ A;  3F9W A;  3RAY A;  5F6K C;  4J83 A;  4LDG A;  4J7I A;  2IGQ A;  5AYF A;  4E47 A;  2W5Z A;  4J8O A;  3TG5 A;  5KJM A;  5TH7 A;  1N6C A;  2JV0 A;  3N71 A;  3M5A A;  3FPD A;  3M54 A;  4YPE A;  4YPU A;  4IJD A;  4O6F A;  3S7D A; 
#chains in the Genus database with same CATH topology
 3RJW A;  3SW9 A;  5EX0 A;  2RFI A;  2W5Y A;  4QEO A;  3QWW A;  3DAL A;  3S7F A;  1N3J A;  3M57 A;  3M53 A;  3OXG A;  4MI5 A;  3TG4 A;  3M55 A;  1MVX A;  4H12 A;  1MUF A;  5LSX A;  3EP0 A;  3RQ4 A;  4C1Q A;  2F69 A;  5EG2 A;  5F6L A;  4Z4P A;  2O8J A;  5TTF A;  1N6A A;  3HNA A;  5T0M A;  2R3A A;  3IHX A;  3QWV A;  4QEN A;  4NVQ A;  4I51 A;  5KJL A;  3OS5 A;  1MVH A;  3OXF A;  3VUZ A;  3CBM A;  3KMA A;  3S7J A;  4YNM A;  3CBP A;  3RIB A;  3SWC A;  3DB5 A;  3MO5 A;  5JIY A;  3F9Y A;  3K5K A;  5JJ0 A;  3OPE A;  3F9X A;  4FMU A;  4YND A;  5ARF A;  4QEP A;  3QWP A;  1ZKK A;  4JDS A;  1H3I A;  3F9Z A;  4BUP A;  4WUY A;  5HI7 A;  3OXL A;  3M56 A;  5JIN A;  2QPW A;  3M58 A;  5CPR B;  1PEG A;  4NJ5 A;  2BQZ A;  3VV0 A;  3OOI A;  5F5E A;  5EX3 A;  5LSZ A;  3M59 A;  4JLG A;  3RU0 A;  4MI0 A;  5ARG A;  5TEG A;  5JHN A;  3MO0 A;  4J7F A;  4O30 A;  2G46 A;  3PDN A;  4YPA A;  5F59 A;  5T0K A;  3MO2 A;  1XQH A;  1MT6 A;  5T5G A;  4IJ8 A;  3S7B A;  3KMT A;  5HQ8 A;  1ML9 A;  3MEK A;  5CCM A;  4AU7 A;  3S8P A;  5CCL A;  5KJK A;  4YNP A;  4RZ0 A;  5KJN A;  3CBO A;  3BO5 A;  1O9S A;  3KMJ A;  3F9W A;  3RAY A;  5F6K C;  4J83 A;  4LDG A;  4J7I A;  2IGQ A;  5AYF A;  4E47 A;  2W5Z A;  4J8O A;  3TG5 A;  5KJM A;  5TH7 A;  1N6C A;  2JV0 A;  3N71 A;  3M5A A;  3FPD A;  3M54 A;  4YPE A;  4YPU A;  4IJD A;  4O6F A;  3S7D A; 
#chains in the Genus database with same CATH homology
 3RJW A;  3SW9 A;  5EX0 A;  2RFI A;  2W5Y A;  4QEO A;  3QWW A;  3DAL A;  3S7F A;  1N3J A;  3M57 A;  3M53 A;  3OXG A;  4MI5 A;  3TG4 A;  3M55 A;  1MVX A;  4H12 A;  1MUF A;  5LSX A;  3EP0 A;  3RQ4 A;  4C1Q A;  2F69 A;  5EG2 A;  5F6L A;  4Z4P A;  2O8J A;  5TTF A;  1N6A A;  3HNA A;  5T0M A;  2R3A A;  3IHX A;  3QWV A;  4QEN A;  4NVQ A;  4I51 A;  5KJL A;  3OS5 A;  1MVH A;  3OXF A;  3VUZ A;  3CBM A;  3KMA A;  3S7J A;  4YNM A;  3CBP A;  3RIB A;  3SWC A;  3DB5 A;  3MO5 A;  5JIY A;  3F9Y A;  3K5K A;  5JJ0 A;  3OPE A;  3F9X A;  4FMU A;  4YND A;  5ARF A;  4QEP A;  3QWP A;  1ZKK A;  4JDS A;  1H3I A;  3F9Z A;  4BUP A;  4WUY A;  5HI7 A;  3OXL A;  3M56 A;  5JIN A;  2QPW A;  3M58 A;  5CPR B;  1PEG A;  4NJ5 A;  2BQZ A;  3VV0 A;  3OOI A;  5F5E A;  5EX3 A;  5LSZ A;  3M59 A;  4JLG A;  3RU0 A;  4MI0 A;  5ARG A;  5TEG A;  5JHN A;  3MO0 A;  4J7F A;  4O30 A;  2G46 A;  3PDN A;  4YPA A;  5F59 A;  5T0K A;  3MO2 A;  1XQH A;  1MT6 A;  5T5G A;  4IJ8 A;  3S7B A;  3KMT A;  5HQ8 A;  1ML9 A;  3MEK A;  5CCM A;  4AU7 A;  3S8P A;  5CCL A;  5KJK A;  4YNP A;  4RZ0 A;  5KJN A;  3CBO A;  3BO5 A;  1O9S A;  3KMJ A;  3F9W A;  3RAY A;  5F6K C;  4J83 A;  4LDG A;  4J7I A;  2IGQ A;  5AYF A;  4E47 A;  2W5Z A;  4J8O A;  3TG5 A;  5KJM A;  5TH7 A;  1N6C A;  2JV0 A;  3N71 A;  3M5A A;  3FPD A;  3M54 A;  4YPE A;  4YPU A;  4IJD A;  4O6F A;  3S7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...