3DALA

Methyltransferase domain of human pr domain-containing protein 1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
179
Chain Sequence
SSGLVPRGSKADMTLWTEAEFEEKCTYIVNDHPWDVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPNRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of methyltransferase domain of human PR domain-containing protein 1
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PR domain zinc finger protein 1
total genus 48
structure length 179
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3dalA00
4JDSA 4AU7A 4C1QA 5JINA 3KMAA 3K5KA 4NVQA 4Z4PA 3MO5A 5HI7A 3F9WA 1MUFA 1PEGA 3KMJA 4J8OA 4YNMA 1N3JA 4YPUA 5LSZA 3MEKA 5F6KC 3TG4A 3M59A 4QEOA 1O9SA 5TH7A 3S8PA 4E47A 1ZKKA 3CBPA 3QWVA 1H3IA 3OPEA 4I51A 3FPDA 3DALA 3F9XA 3M54A 3M58A 3OXLA 2G46A 5T0KA 5LSXA 1MT6A 4FMUA 3M56A 3RJWA 3TG5A 1ML9A 5TEGA 5KJKA 3RQ4A 3RIBA 2JV0A 3MO0A 5EX0A 4O30A 5F59A 5F5EA 4YPAA 5KJMA 4RZ0A 5JIYA 3S7FA 5ARFA 3SWCA 5KJNA 3QWWA 5JHNA 3M5AA 5CCMA 5HQ8A 5T5GA 2RFIA 2QPWA 4YPEA 4JLGA 3M55A 5AYFA 3M57A 3F9ZA 3RAYA 4NJ5A 3DB5A 4IJDA 3OXGA 4YNPA 3S7DA 3SW9A 3M53A 4J7IA 3S7JA 5TTFA 1N6CA 4J83A 5T0MA 2BQZA 3PDNA 5JJ0A 1MVXA 5ARGA 5CPRB 3IHXA 4BUPA 3CBOA 2W5ZA 5EG2A 3VUZA 2W5YA 3RU0A 3EP0A 4H12A 3KMTA 5EX3A 4MI5A 4YNDA 5CCLA 3OOIA 5KJLA 3OXFA 4IJ8A 4WUYA 3BO5A 2R3AA 1XQHA 3N71A 4QEPA 1MVHA 4QENA 3QWPA 3F9YA 4MI0A 4J7FA 2IGQA 2O8JA 3S7BA 1N6AA 3CBMA 3HNAA 4LDGA 2F69A 4O6FA 3OS5A 3VV0A 5F6LA 3MO2A
chains in the Genus database with same CATH superfamily
4JDSA 4AU7A 4C1QA 5JINA 3KMAA 3K5KA 4NVQA 4Z4PA 3MO5A 5HI7A 3F9WA 1MUFA 1PEGA 3KMJA 4J8OA 4YNMA 1N3JA 4YPUA 5LSZA 3MEKA 5F6KC 3TG4A 3M59A 4QEOA 1O9SA 5TH7A 3S8PA 4E47A 1ZKKA 3CBPA 3QWVA 1H3IA 3OPEA 4I51A 3FPDA 3DALA 3F9XA 3M54A 3M58A 3OXLA 2G46A 5T0KA 5LSXA 1MT6A 4FMUA 3M56A 3RJWA 3TG5A 1ML9A 5TEGA 5KJKA 3RQ4A 3RIBA 2JV0A 3MO0A 5EX0A 4O30A 5F59A 5F5EA 4YPAA 5KJMA 4RZ0A 5JIYA 3S7FA 5ARFA 3SWCA 5KJNA 3QWWA 5JHNA 3M5AA 5CCMA 5HQ8A 5T5GA 2RFIA 2QPWA 4YPEA 4JLGA 3M55A 5AYFA 3M57A 3F9ZA 3RAYA 4NJ5A 3DB5A 4IJDA 3OXGA 4YNPA 3S7DA 3SW9A 3M53A 4J7IA 3S7JA 5TTFA 1N6CA 4J83A 5T0MA 2BQZA 3PDNA 5JJ0A 1MVXA 5ARGA 5CPRB 3IHXA 4BUPA 3CBOA 2W5ZA 5EG2A 3VUZA 2W5YA 3RU0A 3EP0A 4H12A 3KMTA 5EX3A 4MI5A 4YNDA 5CCLA 3OOIA 5KJLA 3OXFA 4IJ8A 4WUYA 3BO5A 2R3AA 1XQHA 3N71A 4QEPA 1MVHA 4QENA 3QWPA 3F9YA 4MI0A 4J7FA 2IGQA 2O8JA 3S7BA 1N6AA 3CBMA 3HNAA 4LDGA 2F69A 4O6FA 3OS5A 3VV0A 5F6LA 3MO2A
chains in the Genus database with same CATH topology
4JDSA 4AU7A 4C1QA 5JINA 3KMAA 3K5KA 4NVQA 4Z4PA 3MO5A 5HI7A 3F9WA 1MUFA 1PEGA 3KMJA 4J8OA 4YNMA 1N3JA 4YPUA 5LSZA 3MEKA 5F6KC 3TG4A 3M59A 4QEOA 1O9SA 5TH7A 3S8PA 4E47A 1ZKKA 3CBPA 3QWVA 1H3IA 3OPEA 4I51A 3FPDA 3DALA 3F9XA 3M54A 3M58A 3OXLA 2G46A 5T0KA 5LSXA 1MT6A 4FMUA 3M56A 3RJWA 3TG5A 1ML9A 5TEGA 5KJKA 3RQ4A 3RIBA 2JV0A 3MO0A 5EX0A 4O30A 5F59A 5F5EA 4YPAA 5KJMA 4RZ0A 5JIYA 3S7FA 5ARFA 3SWCA 5KJNA 3QWWA 5JHNA 3M5AA 5CCMA 5HQ8A 5T5GA 2RFIA 2QPWA 4YPEA 4JLGA 3M55A 5AYFA 3M57A 3F9ZA 3RAYA 4NJ5A 3DB5A 4IJDA 3OXGA 4YNPA 3S7DA 3SW9A 3M53A 4J7IA 3S7JA 5TTFA 1N6CA 4J83A 5T0MA 2BQZA 3PDNA 5JJ0A 1MVXA 5ARGA 5CPRB 3IHXA 4BUPA 3CBOA 2W5ZA 5EG2A 3VUZA 2W5YA 3RU0A 3EP0A 4H12A 3KMTA 5EX3A 4MI5A 4YNDA 5CCLA 3OOIA 5KJLA 3OXFA 4IJ8A 4WUYA 3BO5A 2R3AA 1XQHA 3N71A 4QEPA 1MVHA 4QENA 3QWPA 3F9YA 4MI0A 4J7FA 2IGQA 2O8JA 3S7BA 1N6AA 3CBMA 3HNAA 4LDGA 2F69A 4O6FA 3OS5A 3VV0A 5F6LA 3MO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JDS A;  4AU7 A;  4C1Q A;  5JIN A;  3KMA A;  3K5K A;  4NVQ A;  4Z4P A;  3MO5 A;  5HI7 A;  3F9W A;  1MUF A;  1PEG A;  3KMJ A;  4J8O A;  4YNM A;  1N3J A;  4YPU A;  5LSZ A;  3MEK A;  5F6K C;  3TG4 A;  3M59 A;  4QEO A;  1O9S A;  5TH7 A;  3S8P A;  4E47 A;  1ZKK A;  3CBP A;  3QWV A;  1H3I A;  3OPE A;  4I51 A;  3FPD A;  3DAL A;  3F9X A;  3M54 A;  3M58 A;  3OXL A;  2G46 A;  5T0K A;  5LSX A;  1MT6 A;  4FMU A;  3M56 A;  3RJW A;  3TG5 A;  1ML9 A;  5TEG A;  5KJK A;  3RQ4 A;  3RIB A;  2JV0 A;  3MO0 A;  5EX0 A;  4O30 A;  5F59 A;  5F5E A;  4YPA A;  5KJM A;  4RZ0 A;  5JIY A;  3S7F A;  5ARF A;  3SWC A;  5KJN A;  3QWW A;  5JHN A;  3M5A A;  5CCM A;  5HQ8 A;  5T5G A;  2RFI A;  2QPW A;  4YPE A;  4JLG A;  3M55 A;  5AYF A;  3M57 A;  3F9Z A;  3RAY A;  4NJ5 A;  3DB5 A;  4IJD A;  3OXG A;  4YNP A;  3S7D A;  3SW9 A;  3M53 A;  4J7I A;  3S7J A;  5TTF A;  1N6C A;  4J83 A;  5T0M A;  2BQZ A;  3PDN A;  5JJ0 A;  1MVX A;  5ARG A;  5CPR B;  3IHX A;  4BUP A;  3CBO A;  2W5Z A;  5EG2 A;  3VUZ A;  2W5Y A;  3RU0 A;  3EP0 A;  4H12 A;  3KMT A;  5EX3 A;  4MI5 A;  4YND A;  5CCL A;  3OOI A;  5KJL A;  3OXF A;  4IJ8 A;  4WUY A;  3BO5 A;  2R3A A;  1XQH A;  3N71 A;  4QEP A;  1MVH A;  4QEN A;  3QWP A;  3F9Y A;  4MI0 A;  4J7F A;  2IGQ A;  2O8J A;  3S7B A;  1N6A A;  3CBM A;  3HNA A;  4LDG A;  2F69 A;  4O6F A;  3OS5 A;  3VV0 A;  5F6L A;  3MO2 A; 
#chains in the Genus database with same CATH topology
 4JDS A;  4AU7 A;  4C1Q A;  5JIN A;  3KMA A;  3K5K A;  4NVQ A;  4Z4P A;  3MO5 A;  5HI7 A;  3F9W A;  1MUF A;  1PEG A;  3KMJ A;  4J8O A;  4YNM A;  1N3J A;  4YPU A;  5LSZ A;  3MEK A;  5F6K C;  3TG4 A;  3M59 A;  4QEO A;  1O9S A;  5TH7 A;  3S8P A;  4E47 A;  1ZKK A;  3CBP A;  3QWV A;  1H3I A;  3OPE A;  4I51 A;  3FPD A;  3DAL A;  3F9X A;  3M54 A;  3M58 A;  3OXL A;  2G46 A;  5T0K A;  5LSX A;  1MT6 A;  4FMU A;  3M56 A;  3RJW A;  3TG5 A;  1ML9 A;  5TEG A;  5KJK A;  3RQ4 A;  3RIB A;  2JV0 A;  3MO0 A;  5EX0 A;  4O30 A;  5F59 A;  5F5E A;  4YPA A;  5KJM A;  4RZ0 A;  5JIY A;  3S7F A;  5ARF A;  3SWC A;  5KJN A;  3QWW A;  5JHN A;  3M5A A;  5CCM A;  5HQ8 A;  5T5G A;  2RFI A;  2QPW A;  4YPE A;  4JLG A;  3M55 A;  5AYF A;  3M57 A;  3F9Z A;  3RAY A;  4NJ5 A;  3DB5 A;  4IJD A;  3OXG A;  4YNP A;  3S7D A;  3SW9 A;  3M53 A;  4J7I A;  3S7J A;  5TTF A;  1N6C A;  4J83 A;  5T0M A;  2BQZ A;  3PDN A;  5JJ0 A;  1MVX A;  5ARG A;  5CPR B;  3IHX A;  4BUP A;  3CBO A;  2W5Z A;  5EG2 A;  3VUZ A;  2W5Y A;  3RU0 A;  3EP0 A;  4H12 A;  3KMT A;  5EX3 A;  4MI5 A;  4YND A;  5CCL A;  3OOI A;  5KJL A;  3OXF A;  4IJ8 A;  4WUY A;  3BO5 A;  2R3A A;  1XQH A;  3N71 A;  4QEP A;  1MVH A;  4QEN A;  3QWP A;  3F9Y A;  4MI0 A;  4J7F A;  2IGQ A;  2O8J A;  3S7B A;  1N6A A;  3CBM A;  3HNA A;  4LDG A;  2F69 A;  4O6F A;  3OS5 A;  3VV0 A;  5F6L A;  3MO2 A; 
#chains in the Genus database with same CATH homology
 4JDS A;  4AU7 A;  4C1Q A;  5JIN A;  3KMA A;  3K5K A;  4NVQ A;  4Z4P A;  3MO5 A;  5HI7 A;  3F9W A;  1MUF A;  1PEG A;  3KMJ A;  4J8O A;  4YNM A;  1N3J A;  4YPU A;  5LSZ A;  3MEK A;  5F6K C;  3TG4 A;  3M59 A;  4QEO A;  1O9S A;  5TH7 A;  3S8P A;  4E47 A;  1ZKK A;  3CBP A;  3QWV A;  1H3I A;  3OPE A;  4I51 A;  3FPD A;  3DAL A;  3F9X A;  3M54 A;  3M58 A;  3OXL A;  2G46 A;  5T0K A;  5LSX A;  1MT6 A;  4FMU A;  3M56 A;  3RJW A;  3TG5 A;  1ML9 A;  5TEG A;  5KJK A;  3RQ4 A;  3RIB A;  2JV0 A;  3MO0 A;  5EX0 A;  4O30 A;  5F59 A;  5F5E A;  4YPA A;  5KJM A;  4RZ0 A;  5JIY A;  3S7F A;  5ARF A;  3SWC A;  5KJN A;  3QWW A;  5JHN A;  3M5A A;  5CCM A;  5HQ8 A;  5T5G A;  2RFI A;  2QPW A;  4YPE A;  4JLG A;  3M55 A;  5AYF A;  3M57 A;  3F9Z A;  3RAY A;  4NJ5 A;  3DB5 A;  4IJD A;  3OXG A;  4YNP A;  3S7D A;  3SW9 A;  3M53 A;  4J7I A;  3S7J A;  5TTF A;  1N6C A;  4J83 A;  5T0M A;  2BQZ A;  3PDN A;  5JJ0 A;  1MVX A;  5ARG A;  5CPR B;  3IHX A;  4BUP A;  3CBO A;  2W5Z A;  5EG2 A;  3VUZ A;  2W5Y A;  3RU0 A;  3EP0 A;  4H12 A;  3KMT A;  5EX3 A;  4MI5 A;  4YND A;  5CCL A;  3OOI A;  5KJL A;  3OXF A;  4IJ8 A;  4WUY A;  3BO5 A;  2R3A A;  1XQH A;  3N71 A;  4QEP A;  1MVH A;  4QEN A;  3QWP A;  3F9Y A;  4MI0 A;  4J7F A;  2IGQ A;  2O8J A;  3S7B A;  1N6A A;  3CBM A;  3HNA A;  4LDG A;  2F69 A;  4O6F A;  3OS5 A;  3VV0 A;  5F6L A;  3MO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...