3DALA

Methyltransferase domain of human pr domain-containing protein 1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
179
Chain Sequence
b'SSGLVPRGSKADMTLWTEAEFEEKCTYIVNDHPWDVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPNRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 1
molecule tags Transferase
source organism Homo sapiens
publication title The crystal structure of methyltransferase domain of human PR domain-containing protein 1
rcsb
total genus 48
structure length 179
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3dalA00
2O8JA 3KMTA 4J7IA 3M58A 3DB5A 5T0KA 3QWVA 1MT6A 5JHNA 5EX3A 5LSZA 5AYFA 3M5AA 4YPAA 5CPRB 3FPDA 5KJLA 3MEKA 3QWPA 4YPEA 3BO5A 5JJ0A 5T5GA 3RAYA 3CBMA 4YNDA 5CCLA 1ZKKA 5HI7A 3TG4A 1MUFA 4AU7A 3F9YA 4JDSA 3OXGA 2QPWA 3M59A 5JINA 1ML9A 4MI5A 4J8OA 3VUZA 5HQ8A 4YNMA 3S7DA 3KMAA 2IGQA 2RFIA 4IJDA 4E47A 3F9WA 3F9ZA 5EX0A 3M53A 4NJ5A 3RU0A 2W5ZA 4RZ0A 4O30A 4I51A 4O6FA 4MI0A 4YPUA 3SWCA 3OPEA 3OS5A 3EP0A 2R3AA 5F59A 3S7JA 3S8PA 4WUYA 5LSXA 3S7FA 3DALA 3MO5A 2G46A 3RJWA 3KMJA 3CBPA 2F69A 5EG2A 3SW9A 5T0MA 3TG5A 4Z4PA 4QENA 1MVXA 2BQZA 3N71A 4J7FA 3VV0A 5TH7A 3PDNA 4YNPA 3OXLA 5KJKA 4NVQA 3RIBA 5F6LA 4FMUA 4BUPA 1XQHA 5KJMA 1H3IA 3IHXA 4LDGA 5ARFA 3CBOA 4IJ8A 5TEGA 3QWWA 5F6KC 2W5YA 5F5EA 3M57A 3M55A 3HNAA 5TTFA 3S7BA 4C1QA 1N6CA 3F9XA 3OXFA 4JLGA 4QEPA 2JV0A 3M56A 3OOIA 3MO2A 1PEGA 4H12A 3M54A 4QEOA 5JIYA 1O9SA 1MVHA 5ARGA 5CCMA 1N6AA 5KJNA 3RQ4A 3K5KA 3MO0A 4J83A 1N3JA
chains in the Genus database with same CATH superfamily
2O8JA 3KMTA 4J7IA 3M58A 3DB5A 5T0KA 3QWVA 1MT6A 5JHNA 5EX3A 5LSZA 5AYFA 3M5AA 4YPAA 5CPRB 3FPDA 5KJLA 3MEKA 3QWPA 4YPEA 3BO5A 5JJ0A 5T5GA 3RAYA 3CBMA 4YNDA 5CCLA 1ZKKA 5HI7A 3TG4A 1MUFA 4AU7A 3F9YA 4JDSA 3OXGA 2QPWA 3M59A 5JINA 1ML9A 4MI5A 4J8OA 3VUZA 5HQ8A 4YNMA 3S7DA 3KMAA 2IGQA 2RFIA 4IJDA 4E47A 3F9WA 3F9ZA 5EX0A 3M53A 4NJ5A 3RU0A 2W5ZA 4RZ0A 4O30A 4I51A 4O6FA 4MI0A 4YPUA 3SWCA 3OPEA 3OS5A 3EP0A 2R3AA 5F59A 3S7JA 3S8PA 4WUYA 5LSXA 3S7FA 3DALA 3MO5A 2G46A 3RJWA 3KMJA 3CBPA 2F69A 5EG2A 3SW9A 5T0MA 3TG5A 4Z4PA 4QENA 1MVXA 2BQZA 3N71A 4J7FA 3VV0A 5TH7A 3PDNA 4YNPA 3OXLA 5KJKA 4NVQA 3RIBA 5F6LA 4FMUA 4BUPA 1XQHA 5KJMA 1H3IA 3IHXA 4LDGA 5ARFA 3CBOA 4IJ8A 5TEGA 3QWWA 5F6KC 2W5YA 5F5EA 3M57A 3M55A 3HNAA 5TTFA 3S7BA 4C1QA 1N6CA 3F9XA 3OXFA 4JLGA 4QEPA 2JV0A 3M56A 3OOIA 3MO2A 1PEGA 4H12A 3M54A 4QEOA 5JIYA 1O9SA 1MVHA 5ARGA 5CCMA 1N6AA 5KJNA 3RQ4A 3K5KA 3MO0A 4J83A 1N3JA
chains in the Genus database with same CATH topology
2O8JA 3KMTA 4J7IA 3M58A 3DB5A 5T0KA 3QWVA 1MT6A 5JHNA 5EX3A 5LSZA 5AYFA 3M5AA 4YPAA 5CPRB 3FPDA 5KJLA 3MEKA 3QWPA 4YPEA 3BO5A 5JJ0A 5T5GA 3RAYA 3CBMA 4YNDA 5CCLA 1ZKKA 5HI7A 3TG4A 1MUFA 4AU7A 3F9YA 4JDSA 3OXGA 2QPWA 3M59A 5JINA 1ML9A 4MI5A 4J8OA 3VUZA 5HQ8A 4YNMA 3S7DA 3KMAA 2IGQA 2RFIA 4IJDA 4E47A 3F9WA 3F9ZA 5EX0A 3M53A 4NJ5A 3RU0A 2W5ZA 4RZ0A 4O30A 4I51A 4O6FA 4MI0A 4YPUA 3SWCA 3OPEA 3OS5A 3EP0A 2R3AA 5F59A 3S7JA 3S8PA 4WUYA 5LSXA 3S7FA 3DALA 3MO5A 2G46A 3RJWA 3KMJA 3CBPA 2F69A 5EG2A 3SW9A 5T0MA 3TG5A 4Z4PA 4QENA 1MVXA 2BQZA 3N71A 4J7FA 3VV0A 5TH7A 3PDNA 4YNPA 3OXLA 5KJKA 4NVQA 3RIBA 5F6LA 4FMUA 4BUPA 1XQHA 5KJMA 1H3IA 3IHXA 4LDGA 5ARFA 3CBOA 4IJ8A 5TEGA 3QWWA 5F6KC 2W5YA 5F5EA 3M57A 3M55A 3HNAA 5TTFA 3S7BA 4C1QA 1N6CA 3F9XA 3OXFA 4JLGA 4QEPA 2JV0A 3M56A 3OOIA 3MO2A 1PEGA 4H12A 3M54A 4QEOA 5JIYA 1O9SA 1MVHA 5ARGA 5CCMA 1N6AA 5KJNA 3RQ4A 3K5KA 3MO0A 4J83A 1N3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O8J A;  3KMT A;  4J7I A;  3M58 A;  3DB5 A;  5T0K A;  3QWV A;  1MT6 A;  5JHN A;  5EX3 A;  5LSZ A;  5AYF A;  3M5A A;  4YPA A;  5CPR B;  3FPD A;  5KJL A;  3MEK A;  3QWP A;  4YPE A;  3BO5 A;  5JJ0 A;  5T5G A;  3RAY A;  3CBM A;  4YND A;  5CCL A;  1ZKK A;  5HI7 A;  3TG4 A;  1MUF A;  4AU7 A;  3F9Y A;  4JDS A;  3OXG A;  2QPW A;  3M59 A;  5JIN A;  1ML9 A;  4MI5 A;  4J8O A;  3VUZ A;  5HQ8 A;  4YNM A;  3S7D A;  3KMA A;  2IGQ A;  2RFI A;  4IJD A;  4E47 A;  3F9W A;  3F9Z A;  5EX0 A;  3M53 A;  4NJ5 A;  3RU0 A;  2W5Z A;  4RZ0 A;  4O30 A;  4I51 A;  4O6F A;  4MI0 A;  4YPU A;  3SWC A;  3OPE A;  3OS5 A;  3EP0 A;  2R3A A;  5F59 A;  3S7J A;  3S8P A;  4WUY A;  5LSX A;  3S7F A;  3DAL A;  3MO5 A;  2G46 A;  3RJW A;  3KMJ A;  3CBP A;  2F69 A;  5EG2 A;  3SW9 A;  5T0M A;  3TG5 A;  4Z4P A;  4QEN A;  1MVX A;  2BQZ A;  3N71 A;  4J7F A;  3VV0 A;  5TH7 A;  3PDN A;  4YNP A;  3OXL A;  5KJK A;  4NVQ A;  3RIB A;  5F6L A;  4FMU A;  4BUP A;  1XQH A;  5KJM A;  1H3I A;  3IHX A;  4LDG A;  5ARF A;  3CBO A;  4IJ8 A;  5TEG A;  3QWW A;  5F6K C;  2W5Y A;  5F5E A;  3M57 A;  3M55 A;  3HNA A;  5TTF A;  3S7B A;  4C1Q A;  1N6C A;  3F9X A;  3OXF A;  4JLG A;  4QEP A;  2JV0 A;  3M56 A;  3OOI A;  3MO2 A;  1PEG A;  4H12 A;  3M54 A;  4QEO A;  5JIY A;  1O9S A;  1MVH A;  5ARG A;  5CCM A;  1N6A A;  5KJN A;  3RQ4 A;  3K5K A;  3MO0 A;  4J83 A;  1N3J A; 
#chains in the Genus database with same CATH topology
 2O8J A;  3KMT A;  4J7I A;  3M58 A;  3DB5 A;  5T0K A;  3QWV A;  1MT6 A;  5JHN A;  5EX3 A;  5LSZ A;  5AYF A;  3M5A A;  4YPA A;  5CPR B;  3FPD A;  5KJL A;  3MEK A;  3QWP A;  4YPE A;  3BO5 A;  5JJ0 A;  5T5G A;  3RAY A;  3CBM A;  4YND A;  5CCL A;  1ZKK A;  5HI7 A;  3TG4 A;  1MUF A;  4AU7 A;  3F9Y A;  4JDS A;  3OXG A;  2QPW A;  3M59 A;  5JIN A;  1ML9 A;  4MI5 A;  4J8O A;  3VUZ A;  5HQ8 A;  4YNM A;  3S7D A;  3KMA A;  2IGQ A;  2RFI A;  4IJD A;  4E47 A;  3F9W A;  3F9Z A;  5EX0 A;  3M53 A;  4NJ5 A;  3RU0 A;  2W5Z A;  4RZ0 A;  4O30 A;  4I51 A;  4O6F A;  4MI0 A;  4YPU A;  3SWC A;  3OPE A;  3OS5 A;  3EP0 A;  2R3A A;  5F59 A;  3S7J A;  3S8P A;  4WUY A;  5LSX A;  3S7F A;  3DAL A;  3MO5 A;  2G46 A;  3RJW A;  3KMJ A;  3CBP A;  2F69 A;  5EG2 A;  3SW9 A;  5T0M A;  3TG5 A;  4Z4P A;  4QEN A;  1MVX A;  2BQZ A;  3N71 A;  4J7F A;  3VV0 A;  5TH7 A;  3PDN A;  4YNP A;  3OXL A;  5KJK A;  4NVQ A;  3RIB A;  5F6L A;  4FMU A;  4BUP A;  1XQH A;  5KJM A;  1H3I A;  3IHX A;  4LDG A;  5ARF A;  3CBO A;  4IJ8 A;  5TEG A;  3QWW A;  5F6K C;  2W5Y A;  5F5E A;  3M57 A;  3M55 A;  3HNA A;  5TTF A;  3S7B A;  4C1Q A;  1N6C A;  3F9X A;  3OXF A;  4JLG A;  4QEP A;  2JV0 A;  3M56 A;  3OOI A;  3MO2 A;  1PEG A;  4H12 A;  3M54 A;  4QEO A;  5JIY A;  1O9S A;  1MVH A;  5ARG A;  5CCM A;  1N6A A;  5KJN A;  3RQ4 A;  3K5K A;  3MO0 A;  4J83 A;  1N3J A; 
#chains in the Genus database with same CATH homology
 2O8J A;  3KMT A;  4J7I A;  3M58 A;  3DB5 A;  5T0K A;  3QWV A;  1MT6 A;  5JHN A;  5EX3 A;  5LSZ A;  5AYF A;  3M5A A;  4YPA A;  5CPR B;  3FPD A;  5KJL A;  3MEK A;  3QWP A;  4YPE A;  3BO5 A;  5JJ0 A;  5T5G A;  3RAY A;  3CBM A;  4YND A;  5CCL A;  1ZKK A;  5HI7 A;  3TG4 A;  1MUF A;  4AU7 A;  3F9Y A;  4JDS A;  3OXG A;  2QPW A;  3M59 A;  5JIN A;  1ML9 A;  4MI5 A;  4J8O A;  3VUZ A;  5HQ8 A;  4YNM A;  3S7D A;  3KMA A;  2IGQ A;  2RFI A;  4IJD A;  4E47 A;  3F9W A;  3F9Z A;  5EX0 A;  3M53 A;  4NJ5 A;  3RU0 A;  2W5Z A;  4RZ0 A;  4O30 A;  4I51 A;  4O6F A;  4MI0 A;  4YPU A;  3SWC A;  3OPE A;  3OS5 A;  3EP0 A;  2R3A A;  5F59 A;  3S7J A;  3S8P A;  4WUY A;  5LSX A;  3S7F A;  3DAL A;  3MO5 A;  2G46 A;  3RJW A;  3KMJ A;  3CBP A;  2F69 A;  5EG2 A;  3SW9 A;  5T0M A;  3TG5 A;  4Z4P A;  4QEN A;  1MVX A;  2BQZ A;  3N71 A;  4J7F A;  3VV0 A;  5TH7 A;  3PDN A;  4YNP A;  3OXL A;  5KJK A;  4NVQ A;  3RIB A;  5F6L A;  4FMU A;  4BUP A;  1XQH A;  5KJM A;  1H3I A;  3IHX A;  4LDG A;  5ARF A;  3CBO A;  4IJ8 A;  5TEG A;  3QWW A;  5F6K C;  2W5Y A;  5F5E A;  3M57 A;  3M55 A;  3HNA A;  5TTF A;  3S7B A;  4C1Q A;  1N6C A;  3F9X A;  3OXF A;  4JLG A;  4QEP A;  2JV0 A;  3M56 A;  3OOI A;  3MO2 A;  1PEG A;  4H12 A;  3M54 A;  4QEO A;  5JIY A;  1O9S A;  1MVH A;  5ARG A;  5CCM A;  1N6A A;  5KJN A;  3RQ4 A;  3K5K A;  3MO0 A;  4J83 A;  1N3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...