3F9XA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20me2 / adohcy
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9xA00
3OOIA 2RFIA 3PDNA 3S7BA 4I51A 4LDGA 3KMAA 4MI5A 3SW9A 3S8PA 1N6AA 5KJNA 3RIBA 3M57A 3OXFA 3QWPA 4QEPA 3RJWA 1MVHA 3N71A 5F6LA 1ML9A 5TTFA 3S7FA 5HI7A 3KMTA 4QEOA 4J83A 4IJDA 3S7DA 4MI0A 1PEGA 4YNPA 2R3AA 2BQZA 3QWVA 4O30A 1O9SA 1MVXA 1ZKKA 4YPAA 3EP0A 2IGQA 5HQ8A 3BO5A 3M59A 4Z4PA 4WUYA 4H12A 3MEKA 3OXGA 3M54A 3IHXA 2W5ZA 3CBPA 5TH7A 4RZ0A 5EX3A 4C1QA 2F69A 3VUZA 2JV0A 4JDSA 3F9ZA 2G46A 5KJMA 1N6CA 5TEGA 5F59A 4IJ8A 4YNDA 3VV0A 5CPRB 3M53A 5LSZA 3RQ4A 3QWWA 3F9YA 4YPUA 3RU0A 5F5EA 3KMJA 1MT6A 5T0MA 4NJ5A 4YPEA 3M55A 4J8OA 3CBMA 3TG4A 3DALA 3MO2A 4NVQA 5ARFA 3RAYA 5LSXA 5JHNA 4J7FA 3DB5A 5CCLA 4O6FA 3OXLA 1MUFA 3FPDA 3M5AA 3OPEA 1N3JA 4FMUA 3MO5A 5F6KC 4BUPA 3HNAA 4J7IA 4JLGA 3SWCA 3F9XA 5ARGA 1XQHA 4QENA 5JJ0A 2W5YA 4YNMA 3OS5A 3M58A 1H3IA 3M56A 5EX0A 5CCMA 3F9WA 5KJLA 2O8JA 5EG2A 3S7JA 5JIYA 3K5KA 3MO0A 5T5GA 3CBOA 5AYFA 4AU7A 4E47A 5KJKA 2QPWA 5T0KA 3TG5A 5JINA
chains in the Genus database with same CATH superfamily
3OOIA 2RFIA 3PDNA 3S7BA 4I51A 4LDGA 3KMAA 4MI5A 3SW9A 3S8PA 1N6AA 5KJNA 3RIBA 3M57A 3OXFA 3QWPA 4QEPA 3RJWA 1MVHA 3N71A 5F6LA 1ML9A 5TTFA 3S7FA 5HI7A 3KMTA 4QEOA 4J83A 4IJDA 3S7DA 4MI0A 1PEGA 4YNPA 2R3AA 2BQZA 3QWVA 4O30A 1O9SA 1MVXA 1ZKKA 4YPAA 3EP0A 2IGQA 5HQ8A 3BO5A 3M59A 4Z4PA 4WUYA 4H12A 3MEKA 3OXGA 3M54A 3IHXA 2W5ZA 3CBPA 5TH7A 4RZ0A 5EX3A 4C1QA 2F69A 3VUZA 2JV0A 4JDSA 3F9ZA 2G46A 5KJMA 1N6CA 5TEGA 5F59A 4IJ8A 4YNDA 3VV0A 5CPRB 3M53A 5LSZA 3RQ4A 3QWWA 3F9YA 4YPUA 3RU0A 5F5EA 3KMJA 1MT6A 5T0MA 4NJ5A 4YPEA 3M55A 4J8OA 3CBMA 3TG4A 3DALA 3MO2A 4NVQA 5ARFA 3RAYA 5LSXA 5JHNA 4J7FA 3DB5A 5CCLA 4O6FA 3OXLA 1MUFA 3FPDA 3M5AA 3OPEA 1N3JA 4FMUA 3MO5A 5F6KC 4BUPA 3HNAA 4J7IA 4JLGA 3SWCA 3F9XA 5ARGA 1XQHA 4QENA 5JJ0A 2W5YA 4YNMA 3OS5A 3M58A 1H3IA 3M56A 5EX0A 5CCMA 3F9WA 5KJLA 2O8JA 5EG2A 3S7JA 5JIYA 3K5KA 3MO0A 5T5GA 3CBOA 5AYFA 4AU7A 4E47A 5KJKA 2QPWA 5T0KA 3TG5A 5JINA
chains in the Genus database with same CATH topology
3OOIA 2RFIA 3PDNA 3S7BA 4I51A 4LDGA 3KMAA 4MI5A 3SW9A 3S8PA 1N6AA 5KJNA 3RIBA 3M57A 3OXFA 3QWPA 4QEPA 3RJWA 1MVHA 3N71A 5F6LA 1ML9A 5TTFA 3S7FA 5HI7A 3KMTA 4QEOA 4J83A 4IJDA 3S7DA 4MI0A 1PEGA 4YNPA 2R3AA 2BQZA 3QWVA 4O30A 1O9SA 1MVXA 1ZKKA 4YPAA 3EP0A 2IGQA 5HQ8A 3BO5A 3M59A 4Z4PA 4WUYA 4H12A 3MEKA 3OXGA 3M54A 3IHXA 2W5ZA 3CBPA 5TH7A 4RZ0A 5EX3A 4C1QA 2F69A 3VUZA 2JV0A 4JDSA 3F9ZA 2G46A 5KJMA 1N6CA 5TEGA 5F59A 4IJ8A 4YNDA 3VV0A 5CPRB 3M53A 5LSZA 3RQ4A 3QWWA 3F9YA 4YPUA 3RU0A 5F5EA 3KMJA 1MT6A 5T0MA 4NJ5A 4YPEA 3M55A 4J8OA 3CBMA 3TG4A 3DALA 3MO2A 4NVQA 5ARFA 3RAYA 5LSXA 5JHNA 4J7FA 3DB5A 5CCLA 4O6FA 3OXLA 1MUFA 3FPDA 3M5AA 3OPEA 1N3JA 4FMUA 3MO5A 5F6KC 4BUPA 3HNAA 4J7IA 4JLGA 3SWCA 3F9XA 5ARGA 1XQHA 4QENA 5JJ0A 2W5YA 4YNMA 3OS5A 3M58A 1H3IA 3M56A 5EX0A 5CCMA 3F9WA 5KJLA 2O8JA 5EG2A 3S7JA 5JIYA 3K5KA 3MO0A 5T5GA 3CBOA 5AYFA 4AU7A 4E47A 5KJKA 2QPWA 5T0KA 3TG5A 5JINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOI A;  2RFI A;  3PDN A;  3S7B A;  4I51 A;  4LDG A;  3KMA A;  4MI5 A;  3SW9 A;  3S8P A;  1N6A A;  5KJN A;  3RIB A;  3M57 A;  3OXF A;  3QWP A;  4QEP A;  3RJW A;  1MVH A;  3N71 A;  5F6L A;  1ML9 A;  5TTF A;  3S7F A;  5HI7 A;  3KMT A;  4QEO A;  4J83 A;  4IJD A;  3S7D A;  4MI0 A;  1PEG A;  4YNP A;  2R3A A;  2BQZ A;  3QWV A;  4O30 A;  1O9S A;  1MVX A;  1ZKK A;  4YPA A;  3EP0 A;  2IGQ A;  5HQ8 A;  3BO5 A;  3M59 A;  4Z4P A;  4WUY A;  4H12 A;  3MEK A;  3OXG A;  3M54 A;  3IHX A;  2W5Z A;  3CBP A;  5TH7 A;  4RZ0 A;  5EX3 A;  4C1Q A;  2F69 A;  3VUZ A;  2JV0 A;  4JDS A;  3F9Z A;  2G46 A;  5KJM A;  1N6C A;  5TEG A;  5F59 A;  4IJ8 A;  4YND A;  3VV0 A;  5CPR B;  3M53 A;  5LSZ A;  3RQ4 A;  3QWW A;  3F9Y A;  4YPU A;  3RU0 A;  5F5E A;  3KMJ A;  1MT6 A;  5T0M A;  4NJ5 A;  4YPE A;  3M55 A;  4J8O A;  3CBM A;  3TG4 A;  3DAL A;  3MO2 A;  4NVQ A;  5ARF A;  3RAY A;  5LSX A;  5JHN A;  4J7F A;  3DB5 A;  5CCL A;  4O6F A;  3OXL A;  1MUF A;  3FPD A;  3M5A A;  3OPE A;  1N3J A;  4FMU A;  3MO5 A;  5F6K C;  4BUP A;  3HNA A;  4J7I A;  4JLG A;  3SWC A;  3F9X A;  5ARG A;  1XQH A;  4QEN A;  5JJ0 A;  2W5Y A;  4YNM A;  3OS5 A;  3M58 A;  1H3I A;  3M56 A;  5EX0 A;  5CCM A;  3F9W A;  5KJL A;  2O8J A;  5EG2 A;  3S7J A;  5JIY A;  3K5K A;  3MO0 A;  5T5G A;  3CBO A;  5AYF A;  4AU7 A;  4E47 A;  5KJK A;  2QPW A;  5T0K A;  3TG5 A;  5JIN A; 
#chains in the Genus database with same CATH topology
 3OOI A;  2RFI A;  3PDN A;  3S7B A;  4I51 A;  4LDG A;  3KMA A;  4MI5 A;  3SW9 A;  3S8P A;  1N6A A;  5KJN A;  3RIB A;  3M57 A;  3OXF A;  3QWP A;  4QEP A;  3RJW A;  1MVH A;  3N71 A;  5F6L A;  1ML9 A;  5TTF A;  3S7F A;  5HI7 A;  3KMT A;  4QEO A;  4J83 A;  4IJD A;  3S7D A;  4MI0 A;  1PEG A;  4YNP A;  2R3A A;  2BQZ A;  3QWV A;  4O30 A;  1O9S A;  1MVX A;  1ZKK A;  4YPA A;  3EP0 A;  2IGQ A;  5HQ8 A;  3BO5 A;  3M59 A;  4Z4P A;  4WUY A;  4H12 A;  3MEK A;  3OXG A;  3M54 A;  3IHX A;  2W5Z A;  3CBP A;  5TH7 A;  4RZ0 A;  5EX3 A;  4C1Q A;  2F69 A;  3VUZ A;  2JV0 A;  4JDS A;  3F9Z A;  2G46 A;  5KJM A;  1N6C A;  5TEG A;  5F59 A;  4IJ8 A;  4YND A;  3VV0 A;  5CPR B;  3M53 A;  5LSZ A;  3RQ4 A;  3QWW A;  3F9Y A;  4YPU A;  3RU0 A;  5F5E A;  3KMJ A;  1MT6 A;  5T0M A;  4NJ5 A;  4YPE A;  3M55 A;  4J8O A;  3CBM A;  3TG4 A;  3DAL A;  3MO2 A;  4NVQ A;  5ARF A;  3RAY A;  5LSX A;  5JHN A;  4J7F A;  3DB5 A;  5CCL A;  4O6F A;  3OXL A;  1MUF A;  3FPD A;  3M5A A;  3OPE A;  1N3J A;  4FMU A;  3MO5 A;  5F6K C;  4BUP A;  3HNA A;  4J7I A;  4JLG A;  3SWC A;  3F9X A;  5ARG A;  1XQH A;  4QEN A;  5JJ0 A;  2W5Y A;  4YNM A;  3OS5 A;  3M58 A;  1H3I A;  3M56 A;  5EX0 A;  5CCM A;  3F9W A;  5KJL A;  2O8J A;  5EG2 A;  3S7J A;  5JIY A;  3K5K A;  3MO0 A;  5T5G A;  3CBO A;  5AYF A;  4AU7 A;  4E47 A;  5KJK A;  2QPW A;  5T0K A;  3TG5 A;  5JIN A; 
#chains in the Genus database with same CATH homology
 3OOI A;  2RFI A;  3PDN A;  3S7B A;  4I51 A;  4LDG A;  3KMA A;  4MI5 A;  3SW9 A;  3S8P A;  1N6A A;  5KJN A;  3RIB A;  3M57 A;  3OXF A;  3QWP A;  4QEP A;  3RJW A;  1MVH A;  3N71 A;  5F6L A;  1ML9 A;  5TTF A;  3S7F A;  5HI7 A;  3KMT A;  4QEO A;  4J83 A;  4IJD A;  3S7D A;  4MI0 A;  1PEG A;  4YNP A;  2R3A A;  2BQZ A;  3QWV A;  4O30 A;  1O9S A;  1MVX A;  1ZKK A;  4YPA A;  3EP0 A;  2IGQ A;  5HQ8 A;  3BO5 A;  3M59 A;  4Z4P A;  4WUY A;  4H12 A;  3MEK A;  3OXG A;  3M54 A;  3IHX A;  2W5Z A;  3CBP A;  5TH7 A;  4RZ0 A;  5EX3 A;  4C1Q A;  2F69 A;  3VUZ A;  2JV0 A;  4JDS A;  3F9Z A;  2G46 A;  5KJM A;  1N6C A;  5TEG A;  5F59 A;  4IJ8 A;  4YND A;  3VV0 A;  5CPR B;  3M53 A;  5LSZ A;  3RQ4 A;  3QWW A;  3F9Y A;  4YPU A;  3RU0 A;  5F5E A;  3KMJ A;  1MT6 A;  5T0M A;  4NJ5 A;  4YPE A;  3M55 A;  4J8O A;  3CBM A;  3TG4 A;  3DAL A;  3MO2 A;  4NVQ A;  5ARF A;  3RAY A;  5LSX A;  5JHN A;  4J7F A;  3DB5 A;  5CCL A;  4O6F A;  3OXL A;  1MUF A;  3FPD A;  3M5A A;  3OPE A;  1N3J A;  4FMU A;  3MO5 A;  5F6K C;  4BUP A;  3HNA A;  4J7I A;  4JLG A;  3SWC A;  3F9X A;  5ARG A;  1XQH A;  4QEN A;  5JJ0 A;  2W5Y A;  4YNM A;  3OS5 A;  3M58 A;  1H3I A;  3M56 A;  5EX0 A;  5CCM A;  3F9W A;  5KJL A;  2O8J A;  5EG2 A;  3S7J A;  5JIY A;  3K5K A;  3MO0 A;  5T5G A;  3CBO A;  5AYF A;  4AU7 A;  4E47 A;  5KJK A;  2QPW A;  5T0K A;  3TG5 A;  5JIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...