3F9XA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20me2 / adohcy
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9xA00
4YPAA 5CPRB 2RFIA 4AU7A 3OXFA 5KJNA 5T0KA 3DALA 3M55A 3MEKA 3EP0A 3K5KA 4Z4PA 1PEGA 4I51A 3M56A 3F9XA 3RAYA 5HQ8A 1MVHA 5ARFA 4LDGA 3TG4A 4IJ8A 5EG2A 3PDNA 4MI0A 4O30A 2BQZA 5CCMA 4YPEA 4E47A 5LSZA 5F6LA 5HI7A 2JV0A 4C1QA 4QEOA 5JINA 3F9WA 3QWVA 3S7FA 4O6FA 5TEGA 3RJWA 1O9SA 3F9YA 3HNAA 4YNPA 3QWPA 3VUZA 3KMTA 4YPUA 3KMAA 5TTFA 2O8JA 4J8OA 3CBPA 3BO5A 5TH7A 2G46A 1MT6A 3QWWA 3S7BA 4H12A 3OPEA 4IJDA 4QEPA 1MUFA 3OXLA 3OOIA 5ARGA 4YNDA 4JDSA 5LSXA 5CCLA 3M54A 1XQHA 5JHNA 5F5EA 5T5GA 3F9ZA 5F59A 4BUPA 3S7DA 3RU0A 2R3AA 4NVQA 3MO5A 5T0MA 1MVXA 2W5ZA 3RQ4A 4MI5A 2QPWA 3SW9A 5JJ0A 3SWCA 1H3IA 3CBMA 4WUYA 3MO2A 4NJ5A 4J83A 1N6AA 4RZ0A 3TG5A 2F69A 3S7JA 5F6KC 3RIBA 5EX0A 4FMUA 5JIYA 3FPDA 3VV0A 4JLGA 3CBOA 5KJKA 4YNMA 4J7FA 3IHXA 3S8PA 4J7IA 3OXGA 4QENA 5KJMA 2W5YA 1N6CA 3M58A 2IGQA 5KJLA 3OS5A 3KMJA 3M5AA 5AYFA 3DB5A 5EX3A 3N71A 3M59A 3M53A 1ZKKA 1N3JA 1ML9A 3MO0A 3M57A
chains in the Genus database with same CATH superfamily
4YPAA 5CPRB 2RFIA 4AU7A 3OXFA 5KJNA 5T0KA 3DALA 3M55A 3MEKA 3EP0A 3K5KA 4Z4PA 1PEGA 4I51A 3M56A 3F9XA 3RAYA 5HQ8A 1MVHA 5ARFA 4LDGA 3TG4A 4IJ8A 5EG2A 3PDNA 4MI0A 4O30A 2BQZA 5CCMA 4YPEA 4E47A 5LSZA 5F6LA 5HI7A 2JV0A 4C1QA 4QEOA 5JINA 3F9WA 3QWVA 3S7FA 4O6FA 5TEGA 3RJWA 1O9SA 3F9YA 3HNAA 4YNPA 3QWPA 3VUZA 3KMTA 4YPUA 3KMAA 5TTFA 2O8JA 4J8OA 3CBPA 3BO5A 5TH7A 2G46A 1MT6A 3QWWA 3S7BA 4H12A 3OPEA 4IJDA 4QEPA 1MUFA 3OXLA 3OOIA 5ARGA 4YNDA 4JDSA 5LSXA 5CCLA 3M54A 1XQHA 5JHNA 5F5EA 5T5GA 3F9ZA 5F59A 4BUPA 3S7DA 3RU0A 2R3AA 4NVQA 3MO5A 5T0MA 1MVXA 2W5ZA 3RQ4A 4MI5A 2QPWA 3SW9A 5JJ0A 3SWCA 1H3IA 3CBMA 4WUYA 3MO2A 4NJ5A 4J83A 1N6AA 4RZ0A 3TG5A 2F69A 3S7JA 5F6KC 3RIBA 5EX0A 4FMUA 5JIYA 3FPDA 3VV0A 4JLGA 3CBOA 5KJKA 4YNMA 4J7FA 3IHXA 3S8PA 4J7IA 3OXGA 4QENA 5KJMA 2W5YA 1N6CA 3M58A 2IGQA 5KJLA 3OS5A 3KMJA 3M5AA 5AYFA 3DB5A 5EX3A 3N71A 3M59A 3M53A 1ZKKA 1N3JA 1ML9A 3MO0A 3M57A
chains in the Genus database with same CATH topology
4YPAA 5CPRB 2RFIA 4AU7A 3OXFA 5KJNA 5T0KA 3DALA 3M55A 3MEKA 3EP0A 3K5KA 4Z4PA 1PEGA 4I51A 3M56A 3F9XA 3RAYA 5HQ8A 1MVHA 5ARFA 4LDGA 3TG4A 4IJ8A 5EG2A 3PDNA 4MI0A 4O30A 2BQZA 5CCMA 4YPEA 4E47A 5LSZA 5F6LA 5HI7A 2JV0A 4C1QA 4QEOA 5JINA 3F9WA 3QWVA 3S7FA 4O6FA 5TEGA 3RJWA 1O9SA 3F9YA 3HNAA 4YNPA 3QWPA 3VUZA 3KMTA 4YPUA 3KMAA 5TTFA 2O8JA 4J8OA 3CBPA 3BO5A 5TH7A 2G46A 1MT6A 3QWWA 3S7BA 4H12A 3OPEA 4IJDA 4QEPA 1MUFA 3OXLA 3OOIA 5ARGA 4YNDA 4JDSA 5LSXA 5CCLA 3M54A 1XQHA 5JHNA 5F5EA 5T5GA 3F9ZA 5F59A 4BUPA 3S7DA 3RU0A 2R3AA 4NVQA 3MO5A 5T0MA 1MVXA 2W5ZA 3RQ4A 4MI5A 2QPWA 3SW9A 5JJ0A 3SWCA 1H3IA 3CBMA 4WUYA 3MO2A 4NJ5A 4J83A 1N6AA 4RZ0A 3TG5A 2F69A 3S7JA 5F6KC 3RIBA 5EX0A 4FMUA 5JIYA 3FPDA 3VV0A 4JLGA 3CBOA 5KJKA 4YNMA 4J7FA 3IHXA 3S8PA 4J7IA 3OXGA 4QENA 5KJMA 2W5YA 1N6CA 3M58A 2IGQA 5KJLA 3OS5A 3KMJA 3M5AA 5AYFA 3DB5A 5EX3A 3N71A 3M59A 3M53A 1ZKKA 1N3JA 1ML9A 3MO0A 3M57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPA A;  5CPR B;  2RFI A;  4AU7 A;  3OXF A;  5KJN A;  5T0K A;  3DAL A;  3M55 A;  3MEK A;  3EP0 A;  3K5K A;  4Z4P A;  1PEG A;  4I51 A;  3M56 A;  3F9X A;  3RAY A;  5HQ8 A;  1MVH A;  5ARF A;  4LDG A;  3TG4 A;  4IJ8 A;  5EG2 A;  3PDN A;  4MI0 A;  4O30 A;  2BQZ A;  5CCM A;  4YPE A;  4E47 A;  5LSZ A;  5F6L A;  5HI7 A;  2JV0 A;  4C1Q A;  4QEO A;  5JIN A;  3F9W A;  3QWV A;  3S7F A;  4O6F A;  5TEG A;  3RJW A;  1O9S A;  3F9Y A;  3HNA A;  4YNP A;  3QWP A;  3VUZ A;  3KMT A;  4YPU A;  3KMA A;  5TTF A;  2O8J A;  4J8O A;  3CBP A;  3BO5 A;  5TH7 A;  2G46 A;  1MT6 A;  3QWW A;  3S7B A;  4H12 A;  3OPE A;  4IJD A;  4QEP A;  1MUF A;  3OXL A;  3OOI A;  5ARG A;  4YND A;  4JDS A;  5LSX A;  5CCL A;  3M54 A;  1XQH A;  5JHN A;  5F5E A;  5T5G A;  3F9Z A;  5F59 A;  4BUP A;  3S7D A;  3RU0 A;  2R3A A;  4NVQ A;  3MO5 A;  5T0M A;  1MVX A;  2W5Z A;  3RQ4 A;  4MI5 A;  2QPW A;  3SW9 A;  5JJ0 A;  3SWC A;  1H3I A;  3CBM A;  4WUY A;  3MO2 A;  4NJ5 A;  4J83 A;  1N6A A;  4RZ0 A;  3TG5 A;  2F69 A;  3S7J A;  5F6K C;  3RIB A;  5EX0 A;  4FMU A;  5JIY A;  3FPD A;  3VV0 A;  4JLG A;  3CBO A;  5KJK A;  4YNM A;  4J7F A;  3IHX A;  3S8P A;  4J7I A;  3OXG A;  4QEN A;  5KJM A;  2W5Y A;  1N6C A;  3M58 A;  2IGQ A;  5KJL A;  3OS5 A;  3KMJ A;  3M5A A;  5AYF A;  3DB5 A;  5EX3 A;  3N71 A;  3M59 A;  3M53 A;  1ZKK A;  1N3J A;  1ML9 A;  3MO0 A;  3M57 A; 
#chains in the Genus database with same CATH topology
 4YPA A;  5CPR B;  2RFI A;  4AU7 A;  3OXF A;  5KJN A;  5T0K A;  3DAL A;  3M55 A;  3MEK A;  3EP0 A;  3K5K A;  4Z4P A;  1PEG A;  4I51 A;  3M56 A;  3F9X A;  3RAY A;  5HQ8 A;  1MVH A;  5ARF A;  4LDG A;  3TG4 A;  4IJ8 A;  5EG2 A;  3PDN A;  4MI0 A;  4O30 A;  2BQZ A;  5CCM A;  4YPE A;  4E47 A;  5LSZ A;  5F6L A;  5HI7 A;  2JV0 A;  4C1Q A;  4QEO A;  5JIN A;  3F9W A;  3QWV A;  3S7F A;  4O6F A;  5TEG A;  3RJW A;  1O9S A;  3F9Y A;  3HNA A;  4YNP A;  3QWP A;  3VUZ A;  3KMT A;  4YPU A;  3KMA A;  5TTF A;  2O8J A;  4J8O A;  3CBP A;  3BO5 A;  5TH7 A;  2G46 A;  1MT6 A;  3QWW A;  3S7B A;  4H12 A;  3OPE A;  4IJD A;  4QEP A;  1MUF A;  3OXL A;  3OOI A;  5ARG A;  4YND A;  4JDS A;  5LSX A;  5CCL A;  3M54 A;  1XQH A;  5JHN A;  5F5E A;  5T5G A;  3F9Z A;  5F59 A;  4BUP A;  3S7D A;  3RU0 A;  2R3A A;  4NVQ A;  3MO5 A;  5T0M A;  1MVX A;  2W5Z A;  3RQ4 A;  4MI5 A;  2QPW A;  3SW9 A;  5JJ0 A;  3SWC A;  1H3I A;  3CBM A;  4WUY A;  3MO2 A;  4NJ5 A;  4J83 A;  1N6A A;  4RZ0 A;  3TG5 A;  2F69 A;  3S7J A;  5F6K C;  3RIB A;  5EX0 A;  4FMU A;  5JIY A;  3FPD A;  3VV0 A;  4JLG A;  3CBO A;  5KJK A;  4YNM A;  4J7F A;  3IHX A;  3S8P A;  4J7I A;  3OXG A;  4QEN A;  5KJM A;  2W5Y A;  1N6C A;  3M58 A;  2IGQ A;  5KJL A;  3OS5 A;  3KMJ A;  3M5A A;  5AYF A;  3DB5 A;  5EX3 A;  3N71 A;  3M59 A;  3M53 A;  1ZKK A;  1N3J A;  1ML9 A;  3MO0 A;  3M57 A; 
#chains in the Genus database with same CATH homology
 4YPA A;  5CPR B;  2RFI A;  4AU7 A;  3OXF A;  5KJN A;  5T0K A;  3DAL A;  3M55 A;  3MEK A;  3EP0 A;  3K5K A;  4Z4P A;  1PEG A;  4I51 A;  3M56 A;  3F9X A;  3RAY A;  5HQ8 A;  1MVH A;  5ARF A;  4LDG A;  3TG4 A;  4IJ8 A;  5EG2 A;  3PDN A;  4MI0 A;  4O30 A;  2BQZ A;  5CCM A;  4YPE A;  4E47 A;  5LSZ A;  5F6L A;  5HI7 A;  2JV0 A;  4C1Q A;  4QEO A;  5JIN A;  3F9W A;  3QWV A;  3S7F A;  4O6F A;  5TEG A;  3RJW A;  1O9S A;  3F9Y A;  3HNA A;  4YNP A;  3QWP A;  3VUZ A;  3KMT A;  4YPU A;  3KMA A;  5TTF A;  2O8J A;  4J8O A;  3CBP A;  3BO5 A;  5TH7 A;  2G46 A;  1MT6 A;  3QWW A;  3S7B A;  4H12 A;  3OPE A;  4IJD A;  4QEP A;  1MUF A;  3OXL A;  3OOI A;  5ARG A;  4YND A;  4JDS A;  5LSX A;  5CCL A;  3M54 A;  1XQH A;  5JHN A;  5F5E A;  5T5G A;  3F9Z A;  5F59 A;  4BUP A;  3S7D A;  3RU0 A;  2R3A A;  4NVQ A;  3MO5 A;  5T0M A;  1MVX A;  2W5Z A;  3RQ4 A;  4MI5 A;  2QPW A;  3SW9 A;  5JJ0 A;  3SWC A;  1H3I A;  3CBM A;  4WUY A;  3MO2 A;  4NJ5 A;  4J83 A;  1N6A A;  4RZ0 A;  3TG5 A;  2F69 A;  3S7J A;  5F6K C;  3RIB A;  5EX0 A;  4FMU A;  5JIY A;  3FPD A;  3VV0 A;  4JLG A;  3CBO A;  5KJK A;  4YNM A;  4J7F A;  3IHX A;  3S8P A;  4J7I A;  3OXG A;  4QEN A;  5KJM A;  2W5Y A;  1N6C A;  3M58 A;  2IGQ A;  5KJL A;  3OS5 A;  3KMJ A;  3M5A A;  5AYF A;  3DB5 A;  5EX3 A;  3N71 A;  3M59 A;  3M53 A;  1ZKK A;  1N3J A;  1ML9 A;  3MO0 A;  3M57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...