3F9XA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20me2 / adohcy
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9xA00
4H12A 5TTFA 3F9XA 4Z4PA 3OOIA 3RIBA 4RZ0A 3KMJA 3K5KA 5EX3A 3PDNA 3RQ4A 4QEOA 2JV0A 1MVHA 3OXLA 4J7IA 5CPRB 3QWPA 4YPAA 4O6FA 3IHXA 4WUYA 4LDGA 5HQ8A 1H3IA 5KJNA 2O8JA 5T5GA 1N6AA 3N71A 2RFIA 3QWWA 1ML9A 5EG2A 5JINA 4C1QA 3FPDA 3RAYA 4IJDA 3BO5A 3M56A 3SWCA 3M54A 3VUZA 3F9YA 4NJ5A 5TH7A 3MO0A 3CBPA 3OXFA 3MO2A 1XQHA 4I51A 3CBMA 3F9ZA 4J7FA 4YNDA 4FMUA 3OPEA 4AU7A 3KMTA 4JLGA 2G46A 4YNPA 3M53A 3M57A 5T0KA 1MT6A 3QWVA 3M59A 1ZKKA 3VV0A 5JJ0A 3TG4A 3SW9A 3S7BA 4BUPA 3F9WA 1O9SA 3DB5A 1MUFA 4O30A 5LSXA 5HI7A 3MEKA 4MI0A 3RJWA 2F69A 5KJMA 5T0MA 3EP0A 2QPWA 3HNAA 5F6LA 3S7FA 3TG5A 2IGQA 3RU0A 3OXGA 1PEGA 2BQZA 3OS5A 1N6CA 4E47A 5F59A 3S8PA 5ARGA 5KJLA 5JIYA 4JDSA 3KMAA 1N3JA 5F5EA 1MVXA 5LSZA 4NVQA 4YNMA 2W5YA 3M55A 5TEGA 5EX0A 4J83A 3MO5A 5F6KC 5ARFA 5JHNA 4QENA 5CCMA 3CBOA 3M58A 4QEPA 2W5ZA 2R3AA 5KJKA 3M5AA 5AYFA 5CCLA 4YPEA 3S7DA 3S7JA 4YPUA 3DALA 4MI5A 4J8OA 4IJ8A
chains in the Genus database with same CATH superfamily
4H12A 5TTFA 3F9XA 4Z4PA 3OOIA 3RIBA 4RZ0A 3KMJA 3K5KA 5EX3A 3PDNA 3RQ4A 4QEOA 2JV0A 1MVHA 3OXLA 4J7IA 5CPRB 3QWPA 4YPAA 4O6FA 3IHXA 4WUYA 4LDGA 5HQ8A 1H3IA 5KJNA 2O8JA 5T5GA 1N6AA 3N71A 2RFIA 3QWWA 1ML9A 5EG2A 5JINA 4C1QA 3FPDA 3RAYA 4IJDA 3BO5A 3M56A 3SWCA 3M54A 3VUZA 3F9YA 4NJ5A 5TH7A 3MO0A 3CBPA 3OXFA 3MO2A 1XQHA 4I51A 3CBMA 3F9ZA 4J7FA 4YNDA 4FMUA 3OPEA 4AU7A 3KMTA 4JLGA 2G46A 4YNPA 3M53A 3M57A 5T0KA 1MT6A 3QWVA 3M59A 1ZKKA 3VV0A 5JJ0A 3TG4A 3SW9A 3S7BA 4BUPA 3F9WA 1O9SA 3DB5A 1MUFA 4O30A 5LSXA 5HI7A 3MEKA 4MI0A 3RJWA 2F69A 5KJMA 5T0MA 3EP0A 2QPWA 3HNAA 5F6LA 3S7FA 3TG5A 2IGQA 3RU0A 3OXGA 1PEGA 2BQZA 3OS5A 1N6CA 4E47A 5F59A 3S8PA 5ARGA 5KJLA 5JIYA 4JDSA 3KMAA 1N3JA 5F5EA 1MVXA 5LSZA 4NVQA 4YNMA 2W5YA 3M55A 5TEGA 5EX0A 4J83A 3MO5A 5F6KC 5ARFA 5JHNA 4QENA 5CCMA 3CBOA 3M58A 4QEPA 2W5ZA 2R3AA 5KJKA 3M5AA 5AYFA 5CCLA 4YPEA 3S7DA 3S7JA 4YPUA 3DALA 4MI5A 4J8OA 4IJ8A
chains in the Genus database with same CATH topology
4H12A 5TTFA 3F9XA 4Z4PA 3OOIA 3RIBA 4RZ0A 3KMJA 3K5KA 5EX3A 3PDNA 3RQ4A 4QEOA 2JV0A 1MVHA 3OXLA 4J7IA 5CPRB 3QWPA 4YPAA 4O6FA 3IHXA 4WUYA 4LDGA 5HQ8A 1H3IA 5KJNA 2O8JA 5T5GA 1N6AA 3N71A 2RFIA 3QWWA 1ML9A 5EG2A 5JINA 4C1QA 3FPDA 3RAYA 4IJDA 3BO5A 3M56A 3SWCA 3M54A 3VUZA 3F9YA 4NJ5A 5TH7A 3MO0A 3CBPA 3OXFA 3MO2A 1XQHA 4I51A 3CBMA 3F9ZA 4J7FA 4YNDA 4FMUA 3OPEA 4AU7A 3KMTA 4JLGA 2G46A 4YNPA 3M53A 3M57A 5T0KA 1MT6A 3QWVA 3M59A 1ZKKA 3VV0A 5JJ0A 3TG4A 3SW9A 3S7BA 4BUPA 3F9WA 1O9SA 3DB5A 1MUFA 4O30A 5LSXA 5HI7A 3MEKA 4MI0A 3RJWA 2F69A 5KJMA 5T0MA 3EP0A 2QPWA 3HNAA 5F6LA 3S7FA 3TG5A 2IGQA 3RU0A 3OXGA 1PEGA 2BQZA 3OS5A 1N6CA 4E47A 5F59A 3S8PA 5ARGA 5KJLA 5JIYA 4JDSA 3KMAA 1N3JA 5F5EA 1MVXA 5LSZA 4NVQA 4YNMA 2W5YA 3M55A 5TEGA 5EX0A 4J83A 3MO5A 5F6KC 5ARFA 5JHNA 4QENA 5CCMA 3CBOA 3M58A 4QEPA 2W5ZA 2R3AA 5KJKA 3M5AA 5AYFA 5CCLA 4YPEA 3S7DA 3S7JA 4YPUA 3DALA 4MI5A 4J8OA 4IJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H12 A;  5TTF A;  3F9X A;  4Z4P A;  3OOI A;  3RIB A;  4RZ0 A;  3KMJ A;  3K5K A;  5EX3 A;  3PDN A;  3RQ4 A;  4QEO A;  2JV0 A;  1MVH A;  3OXL A;  4J7I A;  5CPR B;  3QWP A;  4YPA A;  4O6F A;  3IHX A;  4WUY A;  4LDG A;  5HQ8 A;  1H3I A;  5KJN A;  2O8J A;  5T5G A;  1N6A A;  3N71 A;  2RFI A;  3QWW A;  1ML9 A;  5EG2 A;  5JIN A;  4C1Q A;  3FPD A;  3RAY A;  4IJD A;  3BO5 A;  3M56 A;  3SWC A;  3M54 A;  3VUZ A;  3F9Y A;  4NJ5 A;  5TH7 A;  3MO0 A;  3CBP A;  3OXF A;  3MO2 A;  1XQH A;  4I51 A;  3CBM A;  3F9Z A;  4J7F A;  4YND A;  4FMU A;  3OPE A;  4AU7 A;  3KMT A;  4JLG A;  2G46 A;  4YNP A;  3M53 A;  3M57 A;  5T0K A;  1MT6 A;  3QWV A;  3M59 A;  1ZKK A;  3VV0 A;  5JJ0 A;  3TG4 A;  3SW9 A;  3S7B A;  4BUP A;  3F9W A;  1O9S A;  3DB5 A;  1MUF A;  4O30 A;  5LSX A;  5HI7 A;  3MEK A;  4MI0 A;  3RJW A;  2F69 A;  5KJM A;  5T0M A;  3EP0 A;  2QPW A;  3HNA A;  5F6L A;  3S7F A;  3TG5 A;  2IGQ A;  3RU0 A;  3OXG A;  1PEG A;  2BQZ A;  3OS5 A;  1N6C A;  4E47 A;  5F59 A;  3S8P A;  5ARG A;  5KJL A;  5JIY A;  4JDS A;  3KMA A;  1N3J A;  5F5E A;  1MVX A;  5LSZ A;  4NVQ A;  4YNM A;  2W5Y A;  3M55 A;  5TEG A;  5EX0 A;  4J83 A;  3MO5 A;  5F6K C;  5ARF A;  5JHN A;  4QEN A;  5CCM A;  3CBO A;  3M58 A;  4QEP A;  2W5Z A;  2R3A A;  5KJK A;  3M5A A;  5AYF A;  5CCL A;  4YPE A;  3S7D A;  3S7J A;  4YPU A;  3DAL A;  4MI5 A;  4J8O A;  4IJ8 A; 
#chains in the Genus database with same CATH topology
 4H12 A;  5TTF A;  3F9X A;  4Z4P A;  3OOI A;  3RIB A;  4RZ0 A;  3KMJ A;  3K5K A;  5EX3 A;  3PDN A;  3RQ4 A;  4QEO A;  2JV0 A;  1MVH A;  3OXL A;  4J7I A;  5CPR B;  3QWP A;  4YPA A;  4O6F A;  3IHX A;  4WUY A;  4LDG A;  5HQ8 A;  1H3I A;  5KJN A;  2O8J A;  5T5G A;  1N6A A;  3N71 A;  2RFI A;  3QWW A;  1ML9 A;  5EG2 A;  5JIN A;  4C1Q A;  3FPD A;  3RAY A;  4IJD A;  3BO5 A;  3M56 A;  3SWC A;  3M54 A;  3VUZ A;  3F9Y A;  4NJ5 A;  5TH7 A;  3MO0 A;  3CBP A;  3OXF A;  3MO2 A;  1XQH A;  4I51 A;  3CBM A;  3F9Z A;  4J7F A;  4YND A;  4FMU A;  3OPE A;  4AU7 A;  3KMT A;  4JLG A;  2G46 A;  4YNP A;  3M53 A;  3M57 A;  5T0K A;  1MT6 A;  3QWV A;  3M59 A;  1ZKK A;  3VV0 A;  5JJ0 A;  3TG4 A;  3SW9 A;  3S7B A;  4BUP A;  3F9W A;  1O9S A;  3DB5 A;  1MUF A;  4O30 A;  5LSX A;  5HI7 A;  3MEK A;  4MI0 A;  3RJW A;  2F69 A;  5KJM A;  5T0M A;  3EP0 A;  2QPW A;  3HNA A;  5F6L A;  3S7F A;  3TG5 A;  2IGQ A;  3RU0 A;  3OXG A;  1PEG A;  2BQZ A;  3OS5 A;  1N6C A;  4E47 A;  5F59 A;  3S8P A;  5ARG A;  5KJL A;  5JIY A;  4JDS A;  3KMA A;  1N3J A;  5F5E A;  1MVX A;  5LSZ A;  4NVQ A;  4YNM A;  2W5Y A;  3M55 A;  5TEG A;  5EX0 A;  4J83 A;  3MO5 A;  5F6K C;  5ARF A;  5JHN A;  4QEN A;  5CCM A;  3CBO A;  3M58 A;  4QEP A;  2W5Z A;  2R3A A;  5KJK A;  3M5A A;  5AYF A;  5CCL A;  4YPE A;  3S7D A;  3S7J A;  4YPU A;  3DAL A;  4MI5 A;  4J8O A;  4IJ8 A; 
#chains in the Genus database with same CATH homology
 4H12 A;  5TTF A;  3F9X A;  4Z4P A;  3OOI A;  3RIB A;  4RZ0 A;  3KMJ A;  3K5K A;  5EX3 A;  3PDN A;  3RQ4 A;  4QEO A;  2JV0 A;  1MVH A;  3OXL A;  4J7I A;  5CPR B;  3QWP A;  4YPA A;  4O6F A;  3IHX A;  4WUY A;  4LDG A;  5HQ8 A;  1H3I A;  5KJN A;  2O8J A;  5T5G A;  1N6A A;  3N71 A;  2RFI A;  3QWW A;  1ML9 A;  5EG2 A;  5JIN A;  4C1Q A;  3FPD A;  3RAY A;  4IJD A;  3BO5 A;  3M56 A;  3SWC A;  3M54 A;  3VUZ A;  3F9Y A;  4NJ5 A;  5TH7 A;  3MO0 A;  3CBP A;  3OXF A;  3MO2 A;  1XQH A;  4I51 A;  3CBM A;  3F9Z A;  4J7F A;  4YND A;  4FMU A;  3OPE A;  4AU7 A;  3KMT A;  4JLG A;  2G46 A;  4YNP A;  3M53 A;  3M57 A;  5T0K A;  1MT6 A;  3QWV A;  3M59 A;  1ZKK A;  3VV0 A;  5JJ0 A;  3TG4 A;  3SW9 A;  3S7B A;  4BUP A;  3F9W A;  1O9S A;  3DB5 A;  1MUF A;  4O30 A;  5LSX A;  5HI7 A;  3MEK A;  4MI0 A;  3RJW A;  2F69 A;  5KJM A;  5T0M A;  3EP0 A;  2QPW A;  3HNA A;  5F6L A;  3S7F A;  3TG5 A;  2IGQ A;  3RU0 A;  3OXG A;  1PEG A;  2BQZ A;  3OS5 A;  1N6C A;  4E47 A;  5F59 A;  3S8P A;  5ARG A;  5KJL A;  5JIY A;  4JDS A;  3KMA A;  1N3J A;  5F5E A;  1MVX A;  5LSZ A;  4NVQ A;  4YNM A;  2W5Y A;  3M55 A;  5TEG A;  5EX0 A;  4J83 A;  3MO5 A;  5F6K C;  5ARF A;  5JHN A;  4QEN A;  5CCM A;  3CBO A;  3M58 A;  4QEP A;  2W5Z A;  2R3A A;  5KJK A;  3M5A A;  5AYF A;  5CCL A;  4YPE A;  3S7D A;  3S7J A;  4YPU A;  3DAL A;  4MI5 A;  4J8O A;  4IJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...