3F9XA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20me2 / adohcy
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD8
total genus 48
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9xA00
3QWVA 5TTFA 3OXLA 5F6KC 4WUYA 5JJ0A 5KJKA 5AYFA 3S8PA 5F59A 3VV0A 4JDSA 3DALA 3K5KA 3M54A 3RQ4A 4J7FA 3RIBA 5F5EA 3CBOA 1H3IA 4J7IA 3OXGA 4J8OA 4BUPA 1MVXA 1ML9A 3IHXA 4H12A 3S7DA 1MUFA 5ARFA 3MEKA 5KJNA 5EX3A 3RJWA 5JINA 5CCLA 3PDNA 5EX0A 4E47A 2QPWA 3SWCA 5T0MA 5CPRB 1N3JA 3QWWA 3DB5A 2R3AA 3OS5A 3F9WA 5F6LA 5T0KA 5EG2A 4Z4PA 5LSXA 5KJLA 5LSZA 3M57A 3BO5A 3KMJA 4JLGA 4RZ0A 3TG5A 3TG4A 5TH7A 5HQ8A 4QEOA 5TEGA 2G46A 3QWPA 3F9YA 4FMUA 4YPEA 4YNMA 3MO5A 3SW9A 5ARGA 3OPEA 3F9ZA 5CCMA 4O6FA 1N6AA 4MI5A 4YNDA 2W5ZA 3S7BA 1MT6A 2F69A 2IGQA 2W5YA 5JIYA 5JHNA 3KMTA 4MI0A 3OXFA 3OOIA 4YPUA 3VUZA 3M5AA 3RAYA 4QENA 4O30A 4AU7A 1O9SA 1MVHA 3S7JA 3CBMA 3M55A 4QEPA 3F9XA 3CBPA 3EP0A 4I51A 1PEGA 3KMAA 4LDGA 3M53A 1ZKKA 3M59A 3FPDA 1XQHA 4C1QA 5KJMA 4YNPA 3M56A 3HNAA 3N71A 3MO2A 5HI7A 2RFIA 4IJDA 3RU0A 3M58A 4IJ8A 4J83A 5T5GA 2BQZA 3MO0A 4YPAA 1N6CA 2JV0A 4NVQA 4NJ5A 2O8JA 3S7FA
chains in the Genus database with same CATH superfamily
3QWVA 5TTFA 3OXLA 5F6KC 4WUYA 5JJ0A 5KJKA 5AYFA 3S8PA 5F59A 3VV0A 4JDSA 3DALA 3K5KA 3M54A 3RQ4A 4J7FA 3RIBA 5F5EA 3CBOA 1H3IA 4J7IA 3OXGA 4J8OA 4BUPA 1MVXA 1ML9A 3IHXA 4H12A 3S7DA 1MUFA 5ARFA 3MEKA 5KJNA 5EX3A 3RJWA 5JINA 5CCLA 3PDNA 5EX0A 4E47A 2QPWA 3SWCA 5T0MA 5CPRB 1N3JA 3QWWA 3DB5A 2R3AA 3OS5A 3F9WA 5F6LA 5T0KA 5EG2A 4Z4PA 5LSXA 5KJLA 5LSZA 3M57A 3BO5A 3KMJA 4JLGA 4RZ0A 3TG5A 3TG4A 5TH7A 5HQ8A 4QEOA 5TEGA 2G46A 3QWPA 3F9YA 4FMUA 4YPEA 4YNMA 3MO5A 3SW9A 5ARGA 3OPEA 3F9ZA 5CCMA 4O6FA 1N6AA 4MI5A 4YNDA 2W5ZA 3S7BA 1MT6A 2F69A 2IGQA 2W5YA 5JIYA 5JHNA 3KMTA 4MI0A 3OXFA 3OOIA 4YPUA 3VUZA 3M5AA 3RAYA 4QENA 4O30A 4AU7A 1O9SA 1MVHA 3S7JA 3CBMA 3M55A 4QEPA 3F9XA 3CBPA 3EP0A 4I51A 1PEGA 3KMAA 4LDGA 3M53A 1ZKKA 3M59A 3FPDA 1XQHA 4C1QA 5KJMA 4YNPA 3M56A 3HNAA 3N71A 3MO2A 5HI7A 2RFIA 4IJDA 3RU0A 3M58A 4IJ8A 4J83A 5T5GA 2BQZA 3MO0A 4YPAA 1N6CA 2JV0A 4NVQA 4NJ5A 2O8JA 3S7FA
chains in the Genus database with same CATH topology
3QWVA 5TTFA 3OXLA 5F6KC 4WUYA 5JJ0A 5KJKA 5AYFA 3S8PA 5F59A 3VV0A 4JDSA 3DALA 3K5KA 3M54A 3RQ4A 4J7FA 3RIBA 5F5EA 3CBOA 1H3IA 4J7IA 3OXGA 4J8OA 4BUPA 1MVXA 1ML9A 3IHXA 4H12A 3S7DA 1MUFA 5ARFA 3MEKA 5KJNA 5EX3A 3RJWA 5JINA 5CCLA 3PDNA 5EX0A 4E47A 2QPWA 3SWCA 5T0MA 5CPRB 1N3JA 3QWWA 3DB5A 2R3AA 3OS5A 3F9WA 5F6LA 5T0KA 5EG2A 4Z4PA 5LSXA 5KJLA 5LSZA 3M57A 3BO5A 3KMJA 4JLGA 4RZ0A 3TG5A 3TG4A 5TH7A 5HQ8A 4QEOA 5TEGA 2G46A 3QWPA 3F9YA 4FMUA 4YPEA 4YNMA 3MO5A 3SW9A 5ARGA 3OPEA 3F9ZA 5CCMA 4O6FA 1N6AA 4MI5A 4YNDA 2W5ZA 3S7BA 1MT6A 2F69A 2IGQA 2W5YA 5JIYA 5JHNA 3KMTA 4MI0A 3OXFA 3OOIA 4YPUA 3VUZA 3M5AA 3RAYA 4QENA 4O30A 4AU7A 1O9SA 1MVHA 3S7JA 3CBMA 3M55A 4QEPA 3F9XA 3CBPA 3EP0A 4I51A 1PEGA 3KMAA 4LDGA 3M53A 1ZKKA 3M59A 3FPDA 1XQHA 4C1QA 5KJMA 4YNPA 3M56A 3HNAA 3N71A 3MO2A 5HI7A 2RFIA 4IJDA 3RU0A 3M58A 4IJ8A 4J83A 5T5GA 2BQZA 3MO0A 4YPAA 1N6CA 2JV0A 4NVQA 4NJ5A 2O8JA 3S7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWV A;  5TTF A;  3OXL A;  5F6K C;  4WUY A;  5JJ0 A;  5KJK A;  5AYF A;  3S8P A;  5F59 A;  3VV0 A;  4JDS A;  3DAL A;  3K5K A;  3M54 A;  3RQ4 A;  4J7F A;  3RIB A;  5F5E A;  3CBO A;  1H3I A;  4J7I A;  3OXG A;  4J8O A;  4BUP A;  1MVX A;  1ML9 A;  3IHX A;  4H12 A;  3S7D A;  1MUF A;  5ARF A;  3MEK A;  5KJN A;  5EX3 A;  3RJW A;  5JIN A;  5CCL A;  3PDN A;  5EX0 A;  4E47 A;  2QPW A;  3SWC A;  5T0M A;  5CPR B;  1N3J A;  3QWW A;  3DB5 A;  2R3A A;  3OS5 A;  3F9W A;  5F6L A;  5T0K A;  5EG2 A;  4Z4P A;  5LSX A;  5KJL A;  5LSZ A;  3M57 A;  3BO5 A;  3KMJ A;  4JLG A;  4RZ0 A;  3TG5 A;  3TG4 A;  5TH7 A;  5HQ8 A;  4QEO A;  5TEG A;  2G46 A;  3QWP A;  3F9Y A;  4FMU A;  4YPE A;  4YNM A;  3MO5 A;  3SW9 A;  5ARG A;  3OPE A;  3F9Z A;  5CCM A;  4O6F A;  1N6A A;  4MI5 A;  4YND A;  2W5Z A;  3S7B A;  1MT6 A;  2F69 A;  2IGQ A;  2W5Y A;  5JIY A;  5JHN A;  3KMT A;  4MI0 A;  3OXF A;  3OOI A;  4YPU A;  3VUZ A;  3M5A A;  3RAY A;  4QEN A;  4O30 A;  4AU7 A;  1O9S A;  1MVH A;  3S7J A;  3CBM A;  3M55 A;  4QEP A;  3F9X A;  3CBP A;  3EP0 A;  4I51 A;  1PEG A;  3KMA A;  4LDG A;  3M53 A;  1ZKK A;  3M59 A;  3FPD A;  1XQH A;  4C1Q A;  5KJM A;  4YNP A;  3M56 A;  3HNA A;  3N71 A;  3MO2 A;  5HI7 A;  2RFI A;  4IJD A;  3RU0 A;  3M58 A;  4IJ8 A;  4J83 A;  5T5G A;  2BQZ A;  3MO0 A;  4YPA A;  1N6C A;  2JV0 A;  4NVQ A;  4NJ5 A;  2O8J A;  3S7F A; 
#chains in the Genus database with same CATH topology
 3QWV A;  5TTF A;  3OXL A;  5F6K C;  4WUY A;  5JJ0 A;  5KJK A;  5AYF A;  3S8P A;  5F59 A;  3VV0 A;  4JDS A;  3DAL A;  3K5K A;  3M54 A;  3RQ4 A;  4J7F A;  3RIB A;  5F5E A;  3CBO A;  1H3I A;  4J7I A;  3OXG A;  4J8O A;  4BUP A;  1MVX A;  1ML9 A;  3IHX A;  4H12 A;  3S7D A;  1MUF A;  5ARF A;  3MEK A;  5KJN A;  5EX3 A;  3RJW A;  5JIN A;  5CCL A;  3PDN A;  5EX0 A;  4E47 A;  2QPW A;  3SWC A;  5T0M A;  5CPR B;  1N3J A;  3QWW A;  3DB5 A;  2R3A A;  3OS5 A;  3F9W A;  5F6L A;  5T0K A;  5EG2 A;  4Z4P A;  5LSX A;  5KJL A;  5LSZ A;  3M57 A;  3BO5 A;  3KMJ A;  4JLG A;  4RZ0 A;  3TG5 A;  3TG4 A;  5TH7 A;  5HQ8 A;  4QEO A;  5TEG A;  2G46 A;  3QWP A;  3F9Y A;  4FMU A;  4YPE A;  4YNM A;  3MO5 A;  3SW9 A;  5ARG A;  3OPE A;  3F9Z A;  5CCM A;  4O6F A;  1N6A A;  4MI5 A;  4YND A;  2W5Z A;  3S7B A;  1MT6 A;  2F69 A;  2IGQ A;  2W5Y A;  5JIY A;  5JHN A;  3KMT A;  4MI0 A;  3OXF A;  3OOI A;  4YPU A;  3VUZ A;  3M5A A;  3RAY A;  4QEN A;  4O30 A;  4AU7 A;  1O9S A;  1MVH A;  3S7J A;  3CBM A;  3M55 A;  4QEP A;  3F9X A;  3CBP A;  3EP0 A;  4I51 A;  1PEG A;  3KMA A;  4LDG A;  3M53 A;  1ZKK A;  3M59 A;  3FPD A;  1XQH A;  4C1Q A;  5KJM A;  4YNP A;  3M56 A;  3HNA A;  3N71 A;  3MO2 A;  5HI7 A;  2RFI A;  4IJD A;  3RU0 A;  3M58 A;  4IJ8 A;  4J83 A;  5T5G A;  2BQZ A;  3MO0 A;  4YPA A;  1N6C A;  2JV0 A;  4NVQ A;  4NJ5 A;  2O8J A;  3S7F A; 
#chains in the Genus database with same CATH homology
 3QWV A;  5TTF A;  3OXL A;  5F6K C;  4WUY A;  5JJ0 A;  5KJK A;  5AYF A;  3S8P A;  5F59 A;  3VV0 A;  4JDS A;  3DAL A;  3K5K A;  3M54 A;  3RQ4 A;  4J7F A;  3RIB A;  5F5E A;  3CBO A;  1H3I A;  4J7I A;  3OXG A;  4J8O A;  4BUP A;  1MVX A;  1ML9 A;  3IHX A;  4H12 A;  3S7D A;  1MUF A;  5ARF A;  3MEK A;  5KJN A;  5EX3 A;  3RJW A;  5JIN A;  5CCL A;  3PDN A;  5EX0 A;  4E47 A;  2QPW A;  3SWC A;  5T0M A;  5CPR B;  1N3J A;  3QWW A;  3DB5 A;  2R3A A;  3OS5 A;  3F9W A;  5F6L A;  5T0K A;  5EG2 A;  4Z4P A;  5LSX A;  5KJL A;  5LSZ A;  3M57 A;  3BO5 A;  3KMJ A;  4JLG A;  4RZ0 A;  3TG5 A;  3TG4 A;  5TH7 A;  5HQ8 A;  4QEO A;  5TEG A;  2G46 A;  3QWP A;  3F9Y A;  4FMU A;  4YPE A;  4YNM A;  3MO5 A;  3SW9 A;  5ARG A;  3OPE A;  3F9Z A;  5CCM A;  4O6F A;  1N6A A;  4MI5 A;  4YND A;  2W5Z A;  3S7B A;  1MT6 A;  2F69 A;  2IGQ A;  2W5Y A;  5JIY A;  5JHN A;  3KMT A;  4MI0 A;  3OXF A;  3OOI A;  4YPU A;  3VUZ A;  3M5A A;  3RAY A;  4QEN A;  4O30 A;  4AU7 A;  1O9S A;  1MVH A;  3S7J A;  3CBM A;  3M55 A;  4QEP A;  3F9X A;  3CBP A;  3EP0 A;  4I51 A;  1PEG A;  3KMA A;  4LDG A;  3M53 A;  1ZKK A;  3M59 A;  3FPD A;  1XQH A;  4C1Q A;  5KJM A;  4YNP A;  3M56 A;  3HNA A;  3N71 A;  3MO2 A;  5HI7 A;  2RFI A;  4IJD A;  3RU0 A;  3M58 A;  4IJ8 A;  4J83 A;  5T5G A;  2BQZ A;  3MO0 A;  4YPA A;  1N6C A;  2JV0 A;  4NVQ A;  4NJ5 A;  2O8J A;  3S7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...