4YPEA

Ash1l set domain h2193f mutant in complex with s-adenosyl methionine (sam)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
b'AMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDFYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase ASH1L
publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ypeA00
3CBPA 1XQHA 4IJ8A 2W5YA 5ARFA 4I51A 3F9WA 4YNDA 5F6LA 3VV0A 4O30A 3IHXA 4J7FA 3CBOA 3RJWA 1N3JA 2RFIA 3TG5A 4YNPA 5JHNA 3MEKA 5CCLA 3M54A 3M58A 3VUZA 5EG2A 3HNAA 3MO2A 3FPDA 5JINA 3DB5A 2R3AA 3MO5A 3M56A 4J7IA 5TH7A 3F9XA 5KJMA 5ARGA 2G46A 3OS5A 3PDNA 4BUPA 4QENA 3F9ZA 5CCMA 3S8PA 4AU7A 1MUFA 3QWVA 4LDGA 5KJLA 3OPEA 3RIBA 5CPRB 4C1QA 4WUYA 4MI0A 3N71A 5LSZA 5KJKA 1O9SA 4JLGA 4QEPA 3M53A 4RZ0A 1ML9A 3SW9A 2O8JA 3KMTA 3RAYA 4H12A 4NJ5A 4YPUA 4MI5A 1MVHA 4E47A 3EP0A 3OXLA 3K5KA 2W5ZA 4Z4PA 4FMUA 5HQ8A 3SWCA 1ZKKA 5T0MA 4NVQA 1N6CA 3QWWA 4YPEA 1PEGA 5T5GA 3S7FA 3BO5A 3RU0A 3DALA 3KMAA 4JDSA 2JV0A 3M5AA 5TEGA 5JJ0A 1H3IA 4J8OA 5AYFA 3M59A 1N6AA 5F6KC 3M55A 5EX0A 5JIYA 5HI7A 5F5EA 3F9YA 2IGQA 5TTFA 4YNMA 3OXGA 3OXFA 4QEOA 3KMJA 3OOIA 1MT6A 3MO0A 3CBMA 5KJNA 2F69A 4YPAA 4IJDA 5F59A 2QPWA 5T0KA 3TG4A 3M57A 4J83A 5EX3A 3S7BA 1MVXA 3RQ4A 2BQZA 4O6FA 3S7JA 3QWPA 3S7DA 5LSXA
chains in the Genus database with same CATH superfamily
3CBPA 1XQHA 4IJ8A 2W5YA 5ARFA 4I51A 3F9WA 4YNDA 5F6LA 3VV0A 4O30A 3IHXA 4J7FA 3CBOA 3RJWA 1N3JA 2RFIA 3TG5A 4YNPA 5JHNA 3MEKA 5CCLA 3M54A 3M58A 3VUZA 5EG2A 3HNAA 3MO2A 3FPDA 5JINA 3DB5A 2R3AA 3MO5A 3M56A 4J7IA 5TH7A 3F9XA 5KJMA 5ARGA 2G46A 3OS5A 3PDNA 4BUPA 4QENA 3F9ZA 5CCMA 3S8PA 4AU7A 1MUFA 3QWVA 4LDGA 5KJLA 3OPEA 3RIBA 5CPRB 4C1QA 4WUYA 4MI0A 3N71A 5LSZA 5KJKA 1O9SA 4JLGA 4QEPA 3M53A 4RZ0A 1ML9A 3SW9A 2O8JA 3KMTA 3RAYA 4H12A 4NJ5A 4YPUA 4MI5A 1MVHA 4E47A 3EP0A 3OXLA 3K5KA 2W5ZA 4Z4PA 4FMUA 5HQ8A 3SWCA 1ZKKA 5T0MA 4NVQA 1N6CA 3QWWA 4YPEA 1PEGA 5T5GA 3S7FA 3BO5A 3RU0A 3DALA 3KMAA 4JDSA 2JV0A 3M5AA 5TEGA 5JJ0A 1H3IA 4J8OA 5AYFA 3M59A 1N6AA 5F6KC 3M55A 5EX0A 5JIYA 5HI7A 5F5EA 3F9YA 2IGQA 5TTFA 4YNMA 3OXGA 3OXFA 4QEOA 3KMJA 3OOIA 1MT6A 3MO0A 3CBMA 5KJNA 2F69A 4YPAA 4IJDA 5F59A 2QPWA 5T0KA 3TG4A 3M57A 4J83A 5EX3A 3S7BA 1MVXA 3RQ4A 2BQZA 4O6FA 3S7JA 3QWPA 3S7DA 5LSXA
chains in the Genus database with same CATH topology
3CBPA 1XQHA 4IJ8A 2W5YA 5ARFA 4I51A 3F9WA 4YNDA 5F6LA 3VV0A 4O30A 3IHXA 4J7FA 3CBOA 3RJWA 1N3JA 2RFIA 3TG5A 4YNPA 5JHNA 3MEKA 5CCLA 3M54A 3M58A 3VUZA 5EG2A 3HNAA 3MO2A 3FPDA 5JINA 3DB5A 2R3AA 3MO5A 3M56A 4J7IA 5TH7A 3F9XA 5KJMA 5ARGA 2G46A 3OS5A 3PDNA 4BUPA 4QENA 3F9ZA 5CCMA 3S8PA 4AU7A 1MUFA 3QWVA 4LDGA 5KJLA 3OPEA 3RIBA 5CPRB 4C1QA 4WUYA 4MI0A 3N71A 5LSZA 5KJKA 1O9SA 4JLGA 4QEPA 3M53A 4RZ0A 1ML9A 3SW9A 2O8JA 3KMTA 3RAYA 4H12A 4NJ5A 4YPUA 4MI5A 1MVHA 4E47A 3EP0A 3OXLA 3K5KA 2W5ZA 4Z4PA 4FMUA 5HQ8A 3SWCA 1ZKKA 5T0MA 4NVQA 1N6CA 3QWWA 4YPEA 1PEGA 5T5GA 3S7FA 3BO5A 3RU0A 3DALA 3KMAA 4JDSA 2JV0A 3M5AA 5TEGA 5JJ0A 1H3IA 4J8OA 5AYFA 3M59A 1N6AA 5F6KC 3M55A 5EX0A 5JIYA 5HI7A 5F5EA 3F9YA 2IGQA 5TTFA 4YNMA 3OXGA 3OXFA 4QEOA 3KMJA 3OOIA 1MT6A 3MO0A 3CBMA 5KJNA 2F69A 4YPAA 4IJDA 5F59A 2QPWA 5T0KA 3TG4A 3M57A 4J83A 5EX3A 3S7BA 1MVXA 3RQ4A 2BQZA 4O6FA 3S7JA 3QWPA 3S7DA 5LSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBP A;  1XQH A;  4IJ8 A;  2W5Y A;  5ARF A;  4I51 A;  3F9W A;  4YND A;  5F6L A;  3VV0 A;  4O30 A;  3IHX A;  4J7F A;  3CBO A;  3RJW A;  1N3J A;  2RFI A;  3TG5 A;  4YNP A;  5JHN A;  3MEK A;  5CCL A;  3M54 A;  3M58 A;  3VUZ A;  5EG2 A;  3HNA A;  3MO2 A;  3FPD A;  5JIN A;  3DB5 A;  2R3A A;  3MO5 A;  3M56 A;  4J7I A;  5TH7 A;  3F9X A;  5KJM A;  5ARG A;  2G46 A;  3OS5 A;  3PDN A;  4BUP A;  4QEN A;  3F9Z A;  5CCM A;  3S8P A;  4AU7 A;  1MUF A;  3QWV A;  4LDG A;  5KJL A;  3OPE A;  3RIB A;  5CPR B;  4C1Q A;  4WUY A;  4MI0 A;  3N71 A;  5LSZ A;  5KJK A;  1O9S A;  4JLG A;  4QEP A;  3M53 A;  4RZ0 A;  1ML9 A;  3SW9 A;  2O8J A;  3KMT A;  3RAY A;  4H12 A;  4NJ5 A;  4YPU A;  4MI5 A;  1MVH A;  4E47 A;  3EP0 A;  3OXL A;  3K5K A;  2W5Z A;  4Z4P A;  4FMU A;  5HQ8 A;  3SWC A;  1ZKK A;  5T0M A;  4NVQ A;  1N6C A;  3QWW A;  4YPE A;  1PEG A;  5T5G A;  3S7F A;  3BO5 A;  3RU0 A;  3DAL A;  3KMA A;  4JDS A;  2JV0 A;  3M5A A;  5TEG A;  5JJ0 A;  1H3I A;  4J8O A;  5AYF A;  3M59 A;  1N6A A;  5F6K C;  3M55 A;  5EX0 A;  5JIY A;  5HI7 A;  5F5E A;  3F9Y A;  2IGQ A;  5TTF A;  4YNM A;  3OXG A;  3OXF A;  4QEO A;  3KMJ A;  3OOI A;  1MT6 A;  3MO0 A;  3CBM A;  5KJN A;  2F69 A;  4YPA A;  4IJD A;  5F59 A;  2QPW A;  5T0K A;  3TG4 A;  3M57 A;  4J83 A;  5EX3 A;  3S7B A;  1MVX A;  3RQ4 A;  2BQZ A;  4O6F A;  3S7J A;  3QWP A;  3S7D A;  5LSX A; 
#chains in the Genus database with same CATH topology
 3CBP A;  1XQH A;  4IJ8 A;  2W5Y A;  5ARF A;  4I51 A;  3F9W A;  4YND A;  5F6L A;  3VV0 A;  4O30 A;  3IHX A;  4J7F A;  3CBO A;  3RJW A;  1N3J A;  2RFI A;  3TG5 A;  4YNP A;  5JHN A;  3MEK A;  5CCL A;  3M54 A;  3M58 A;  3VUZ A;  5EG2 A;  3HNA A;  3MO2 A;  3FPD A;  5JIN A;  3DB5 A;  2R3A A;  3MO5 A;  3M56 A;  4J7I A;  5TH7 A;  3F9X A;  5KJM A;  5ARG A;  2G46 A;  3OS5 A;  3PDN A;  4BUP A;  4QEN A;  3F9Z A;  5CCM A;  3S8P A;  4AU7 A;  1MUF A;  3QWV A;  4LDG A;  5KJL A;  3OPE A;  3RIB A;  5CPR B;  4C1Q A;  4WUY A;  4MI0 A;  3N71 A;  5LSZ A;  5KJK A;  1O9S A;  4JLG A;  4QEP A;  3M53 A;  4RZ0 A;  1ML9 A;  3SW9 A;  2O8J A;  3KMT A;  3RAY A;  4H12 A;  4NJ5 A;  4YPU A;  4MI5 A;  1MVH A;  4E47 A;  3EP0 A;  3OXL A;  3K5K A;  2W5Z A;  4Z4P A;  4FMU A;  5HQ8 A;  3SWC A;  1ZKK A;  5T0M A;  4NVQ A;  1N6C A;  3QWW A;  4YPE A;  1PEG A;  5T5G A;  3S7F A;  3BO5 A;  3RU0 A;  3DAL A;  3KMA A;  4JDS A;  2JV0 A;  3M5A A;  5TEG A;  5JJ0 A;  1H3I A;  4J8O A;  5AYF A;  3M59 A;  1N6A A;  5F6K C;  3M55 A;  5EX0 A;  5JIY A;  5HI7 A;  5F5E A;  3F9Y A;  2IGQ A;  5TTF A;  4YNM A;  3OXG A;  3OXF A;  4QEO A;  3KMJ A;  3OOI A;  1MT6 A;  3MO0 A;  3CBM A;  5KJN A;  2F69 A;  4YPA A;  4IJD A;  5F59 A;  2QPW A;  5T0K A;  3TG4 A;  3M57 A;  4J83 A;  5EX3 A;  3S7B A;  1MVX A;  3RQ4 A;  2BQZ A;  4O6F A;  3S7J A;  3QWP A;  3S7D A;  5LSX A; 
#chains in the Genus database with same CATH homology
 3CBP A;  1XQH A;  4IJ8 A;  2W5Y A;  5ARF A;  4I51 A;  3F9W A;  4YND A;  5F6L A;  3VV0 A;  4O30 A;  3IHX A;  4J7F A;  3CBO A;  3RJW A;  1N3J A;  2RFI A;  3TG5 A;  4YNP A;  5JHN A;  3MEK A;  5CCL A;  3M54 A;  3M58 A;  3VUZ A;  5EG2 A;  3HNA A;  3MO2 A;  3FPD A;  5JIN A;  3DB5 A;  2R3A A;  3MO5 A;  3M56 A;  4J7I A;  5TH7 A;  3F9X A;  5KJM A;  5ARG A;  2G46 A;  3OS5 A;  3PDN A;  4BUP A;  4QEN A;  3F9Z A;  5CCM A;  3S8P A;  4AU7 A;  1MUF A;  3QWV A;  4LDG A;  5KJL A;  3OPE A;  3RIB A;  5CPR B;  4C1Q A;  4WUY A;  4MI0 A;  3N71 A;  5LSZ A;  5KJK A;  1O9S A;  4JLG A;  4QEP A;  3M53 A;  4RZ0 A;  1ML9 A;  3SW9 A;  2O8J A;  3KMT A;  3RAY A;  4H12 A;  4NJ5 A;  4YPU A;  4MI5 A;  1MVH A;  4E47 A;  3EP0 A;  3OXL A;  3K5K A;  2W5Z A;  4Z4P A;  4FMU A;  5HQ8 A;  3SWC A;  1ZKK A;  5T0M A;  4NVQ A;  1N6C A;  3QWW A;  4YPE A;  1PEG A;  5T5G A;  3S7F A;  3BO5 A;  3RU0 A;  3DAL A;  3KMA A;  4JDS A;  2JV0 A;  3M5A A;  5TEG A;  5JJ0 A;  1H3I A;  4J8O A;  5AYF A;  3M59 A;  1N6A A;  5F6K C;  3M55 A;  5EX0 A;  5JIY A;  5HI7 A;  5F5E A;  3F9Y A;  2IGQ A;  5TTF A;  4YNM A;  3OXG A;  3OXF A;  4QEO A;  3KMJ A;  3OOI A;  1MT6 A;  3MO0 A;  3CBM A;  5KJN A;  2F69 A;  4YPA A;  4IJD A;  5F59 A;  2QPW A;  5T0K A;  3TG4 A;  3M57 A;  4J83 A;  5EX3 A;  3S7B A;  1MVX A;  3RQ4 A;  2BQZ A;  4O6F A;  3S7J A;  3QWP A;  3S7D A;  5LSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...