4YPEA

Ash1l set domain h2193f mutant in complex with s-adenosyl methionine (sam)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
AMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDFYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASH1L
publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ypeA00
5T5GA 5LSZA 3F9YA 2F69A 3KMJA 3K5KA 3TG4A 3S7DA 4H12A 1XQHA 3OXFA 1O9SA 4WUYA 2R3AA 5T0KA 4RZ0A 3OS5A 3RQ4A 5KJLA 2W5ZA 2QPWA 5EX3A 3RU0A 4FMUA 3M53A 1ML9A 3MO5A 3MEKA 3M57A 5HQ8A 3F9XA 5LSXA 2G46A 1MVXA 5TH7A 5JHNA 5CCLA 1H3IA 5AYFA 4J7FA 4YPEA 5F59A 3S8PA 4LDGA 4C1QA 3N71A 3VV0A 4IJ8A 3TG5A 4AU7A 3S7FA 3CBOA 5CPRB 3RIBA 4MI5A 3OXLA 3PDNA 3M5AA 5T0MA 3QWVA 3QWWA 4QENA 4YPAA 4MI0A 2IGQA 3QWPA 2BQZA 3M54A 4BUPA 3OOIA 3EP0A 4JDSA 1MVHA 4IJDA 3F9WA 4E47A 5JIYA 3RAYA 3HNAA 1ZKKA 4J83A 5TTFA 4YNDA 3RJWA 2O8JA 5EG2A 4O6FA 5F5EA 3S7BA 4Z4PA 3S7JA 3OXGA 5F6KC 5JINA 4I51A 5KJKA 3SW9A 4O30A 3CBPA 3DB5A 3CBMA 5ARFA 3VUZA 4QEOA 5TEGA 4NVQA 4NJ5A 3M56A 5EX0A 4JLGA 5KJMA 4J7IA 1MT6A 3MO2A 5HI7A 1N6AA 4J8OA 1N6CA 3KMTA 3OPEA 5F6LA 5JJ0A 4YNMA 2RFIA 3SWCA 1PEGA 4YPUA 5CCMA 2W5YA 3M59A 4YNPA 4QEPA 3F9ZA 3M55A 3MO0A 1MUFA 3M58A 5ARGA 3KMAA 5KJNA 1N3JA 3DALA 3FPDA 2JV0A 3BO5A 3IHXA
chains in the Genus database with same CATH superfamily
5T5GA 5LSZA 3F9YA 2F69A 3KMJA 3K5KA 3TG4A 3S7DA 4H12A 1XQHA 3OXFA 1O9SA 4WUYA 2R3AA 5T0KA 4RZ0A 3OS5A 3RQ4A 5KJLA 2W5ZA 2QPWA 5EX3A 3RU0A 4FMUA 3M53A 1ML9A 3MO5A 3MEKA 3M57A 5HQ8A 3F9XA 5LSXA 2G46A 1MVXA 5TH7A 5JHNA 5CCLA 1H3IA 5AYFA 4J7FA 4YPEA 5F59A 3S8PA 4LDGA 4C1QA 3N71A 3VV0A 4IJ8A 3TG5A 4AU7A 3S7FA 3CBOA 5CPRB 3RIBA 4MI5A 3OXLA 3PDNA 3M5AA 5T0MA 3QWVA 3QWWA 4QENA 4YPAA 4MI0A 2IGQA 3QWPA 2BQZA 3M54A 4BUPA 3OOIA 3EP0A 4JDSA 1MVHA 4IJDA 3F9WA 4E47A 5JIYA 3RAYA 3HNAA 1ZKKA 4J83A 5TTFA 4YNDA 3RJWA 2O8JA 5EG2A 4O6FA 5F5EA 3S7BA 4Z4PA 3S7JA 3OXGA 5F6KC 5JINA 4I51A 5KJKA 3SW9A 4O30A 3CBPA 3DB5A 3CBMA 5ARFA 3VUZA 4QEOA 5TEGA 4NVQA 4NJ5A 3M56A 5EX0A 4JLGA 5KJMA 4J7IA 1MT6A 3MO2A 5HI7A 1N6AA 4J8OA 1N6CA 3KMTA 3OPEA 5F6LA 5JJ0A 4YNMA 2RFIA 3SWCA 1PEGA 4YPUA 5CCMA 2W5YA 3M59A 4YNPA 4QEPA 3F9ZA 3M55A 3MO0A 1MUFA 3M58A 5ARGA 3KMAA 5KJNA 1N3JA 3DALA 3FPDA 2JV0A 3BO5A 3IHXA
chains in the Genus database with same CATH topology
5T5GA 5LSZA 3F9YA 2F69A 3KMJA 3K5KA 3TG4A 3S7DA 4H12A 1XQHA 3OXFA 1O9SA 4WUYA 2R3AA 5T0KA 4RZ0A 3OS5A 3RQ4A 5KJLA 2W5ZA 2QPWA 5EX3A 3RU0A 4FMUA 3M53A 1ML9A 3MO5A 3MEKA 3M57A 5HQ8A 3F9XA 5LSXA 2G46A 1MVXA 5TH7A 5JHNA 5CCLA 1H3IA 5AYFA 4J7FA 4YPEA 5F59A 3S8PA 4LDGA 4C1QA 3N71A 3VV0A 4IJ8A 3TG5A 4AU7A 3S7FA 3CBOA 5CPRB 3RIBA 4MI5A 3OXLA 3PDNA 3M5AA 5T0MA 3QWVA 3QWWA 4QENA 4YPAA 4MI0A 2IGQA 3QWPA 2BQZA 3M54A 4BUPA 3OOIA 3EP0A 4JDSA 1MVHA 4IJDA 3F9WA 4E47A 5JIYA 3RAYA 3HNAA 1ZKKA 4J83A 5TTFA 4YNDA 3RJWA 2O8JA 5EG2A 4O6FA 5F5EA 3S7BA 4Z4PA 3S7JA 3OXGA 5F6KC 5JINA 4I51A 5KJKA 3SW9A 4O30A 3CBPA 3DB5A 3CBMA 5ARFA 3VUZA 4QEOA 5TEGA 4NVQA 4NJ5A 3M56A 5EX0A 4JLGA 5KJMA 4J7IA 1MT6A 3MO2A 5HI7A 1N6AA 4J8OA 1N6CA 3KMTA 3OPEA 5F6LA 5JJ0A 4YNMA 2RFIA 3SWCA 1PEGA 4YPUA 5CCMA 2W5YA 3M59A 4YNPA 4QEPA 3F9ZA 3M55A 3MO0A 1MUFA 3M58A 5ARGA 3KMAA 5KJNA 1N3JA 3DALA 3FPDA 2JV0A 3BO5A 3IHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T5G A;  5LSZ A;  3F9Y A;  2F69 A;  3KMJ A;  3K5K A;  3TG4 A;  3S7D A;  4H12 A;  1XQH A;  3OXF A;  1O9S A;  4WUY A;  2R3A A;  5T0K A;  4RZ0 A;  3OS5 A;  3RQ4 A;  5KJL A;  2W5Z A;  2QPW A;  5EX3 A;  3RU0 A;  4FMU A;  3M53 A;  1ML9 A;  3MO5 A;  3MEK A;  3M57 A;  5HQ8 A;  3F9X A;  5LSX A;  2G46 A;  1MVX A;  5TH7 A;  5JHN A;  5CCL A;  1H3I A;  5AYF A;  4J7F A;  4YPE A;  5F59 A;  3S8P A;  4LDG A;  4C1Q A;  3N71 A;  3VV0 A;  4IJ8 A;  3TG5 A;  4AU7 A;  3S7F A;  3CBO A;  5CPR B;  3RIB A;  4MI5 A;  3OXL A;  3PDN A;  3M5A A;  5T0M A;  3QWV A;  3QWW A;  4QEN A;  4YPA A;  4MI0 A;  2IGQ A;  3QWP A;  2BQZ A;  3M54 A;  4BUP A;  3OOI A;  3EP0 A;  4JDS A;  1MVH A;  4IJD A;  3F9W A;  4E47 A;  5JIY A;  3RAY A;  3HNA A;  1ZKK A;  4J83 A;  5TTF A;  4YND A;  3RJW A;  2O8J A;  5EG2 A;  4O6F A;  5F5E A;  3S7B A;  4Z4P A;  3S7J A;  3OXG A;  5F6K C;  5JIN A;  4I51 A;  5KJK A;  3SW9 A;  4O30 A;  3CBP A;  3DB5 A;  3CBM A;  5ARF A;  3VUZ A;  4QEO A;  5TEG A;  4NVQ A;  4NJ5 A;  3M56 A;  5EX0 A;  4JLG A;  5KJM A;  4J7I A;  1MT6 A;  3MO2 A;  5HI7 A;  1N6A A;  4J8O A;  1N6C A;  3KMT A;  3OPE A;  5F6L A;  5JJ0 A;  4YNM A;  2RFI A;  3SWC A;  1PEG A;  4YPU A;  5CCM A;  2W5Y A;  3M59 A;  4YNP A;  4QEP A;  3F9Z A;  3M55 A;  3MO0 A;  1MUF A;  3M58 A;  5ARG A;  3KMA A;  5KJN A;  1N3J A;  3DAL A;  3FPD A;  2JV0 A;  3BO5 A;  3IHX A; 
#chains in the Genus database with same CATH topology
 5T5G A;  5LSZ A;  3F9Y A;  2F69 A;  3KMJ A;  3K5K A;  3TG4 A;  3S7D A;  4H12 A;  1XQH A;  3OXF A;  1O9S A;  4WUY A;  2R3A A;  5T0K A;  4RZ0 A;  3OS5 A;  3RQ4 A;  5KJL A;  2W5Z A;  2QPW A;  5EX3 A;  3RU0 A;  4FMU A;  3M53 A;  1ML9 A;  3MO5 A;  3MEK A;  3M57 A;  5HQ8 A;  3F9X A;  5LSX A;  2G46 A;  1MVX A;  5TH7 A;  5JHN A;  5CCL A;  1H3I A;  5AYF A;  4J7F A;  4YPE A;  5F59 A;  3S8P A;  4LDG A;  4C1Q A;  3N71 A;  3VV0 A;  4IJ8 A;  3TG5 A;  4AU7 A;  3S7F A;  3CBO A;  5CPR B;  3RIB A;  4MI5 A;  3OXL A;  3PDN A;  3M5A A;  5T0M A;  3QWV A;  3QWW A;  4QEN A;  4YPA A;  4MI0 A;  2IGQ A;  3QWP A;  2BQZ A;  3M54 A;  4BUP A;  3OOI A;  3EP0 A;  4JDS A;  1MVH A;  4IJD A;  3F9W A;  4E47 A;  5JIY A;  3RAY A;  3HNA A;  1ZKK A;  4J83 A;  5TTF A;  4YND A;  3RJW A;  2O8J A;  5EG2 A;  4O6F A;  5F5E A;  3S7B A;  4Z4P A;  3S7J A;  3OXG A;  5F6K C;  5JIN A;  4I51 A;  5KJK A;  3SW9 A;  4O30 A;  3CBP A;  3DB5 A;  3CBM A;  5ARF A;  3VUZ A;  4QEO A;  5TEG A;  4NVQ A;  4NJ5 A;  3M56 A;  5EX0 A;  4JLG A;  5KJM A;  4J7I A;  1MT6 A;  3MO2 A;  5HI7 A;  1N6A A;  4J8O A;  1N6C A;  3KMT A;  3OPE A;  5F6L A;  5JJ0 A;  4YNM A;  2RFI A;  3SWC A;  1PEG A;  4YPU A;  5CCM A;  2W5Y A;  3M59 A;  4YNP A;  4QEP A;  3F9Z A;  3M55 A;  3MO0 A;  1MUF A;  3M58 A;  5ARG A;  3KMA A;  5KJN A;  1N3J A;  3DAL A;  3FPD A;  2JV0 A;  3BO5 A;  3IHX A; 
#chains in the Genus database with same CATH homology
 5T5G A;  5LSZ A;  3F9Y A;  2F69 A;  3KMJ A;  3K5K A;  3TG4 A;  3S7D A;  4H12 A;  1XQH A;  3OXF A;  1O9S A;  4WUY A;  2R3A A;  5T0K A;  4RZ0 A;  3OS5 A;  3RQ4 A;  5KJL A;  2W5Z A;  2QPW A;  5EX3 A;  3RU0 A;  4FMU A;  3M53 A;  1ML9 A;  3MO5 A;  3MEK A;  3M57 A;  5HQ8 A;  3F9X A;  5LSX A;  2G46 A;  1MVX A;  5TH7 A;  5JHN A;  5CCL A;  1H3I A;  5AYF A;  4J7F A;  4YPE A;  5F59 A;  3S8P A;  4LDG A;  4C1Q A;  3N71 A;  3VV0 A;  4IJ8 A;  3TG5 A;  4AU7 A;  3S7F A;  3CBO A;  5CPR B;  3RIB A;  4MI5 A;  3OXL A;  3PDN A;  3M5A A;  5T0M A;  3QWV A;  3QWW A;  4QEN A;  4YPA A;  4MI0 A;  2IGQ A;  3QWP A;  2BQZ A;  3M54 A;  4BUP A;  3OOI A;  3EP0 A;  4JDS A;  1MVH A;  4IJD A;  3F9W A;  4E47 A;  5JIY A;  3RAY A;  3HNA A;  1ZKK A;  4J83 A;  5TTF A;  4YND A;  3RJW A;  2O8J A;  5EG2 A;  4O6F A;  5F5E A;  3S7B A;  4Z4P A;  3S7J A;  3OXG A;  5F6K C;  5JIN A;  4I51 A;  5KJK A;  3SW9 A;  4O30 A;  3CBP A;  3DB5 A;  3CBM A;  5ARF A;  3VUZ A;  4QEO A;  5TEG A;  4NVQ A;  4NJ5 A;  3M56 A;  5EX0 A;  4JLG A;  5KJM A;  4J7I A;  1MT6 A;  3MO2 A;  5HI7 A;  1N6A A;  4J8O A;  1N6C A;  3KMT A;  3OPE A;  5F6L A;  5JJ0 A;  4YNM A;  2RFI A;  3SWC A;  1PEG A;  4YPU A;  5CCM A;  2W5Y A;  3M59 A;  4YNP A;  4QEP A;  3F9Z A;  3M55 A;  3MO0 A;  1MUF A;  3M58 A;  5ARG A;  3KMA A;  5KJN A;  1N3J A;  3DAL A;  3FPD A;  2JV0 A;  3BO5 A;  3IHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...