4YPEA

Ash1l set domain h2193f mutant in complex with s-adenosyl methionine (sam)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
AMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDFYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASH1L
total genus 47
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ypeA00
3F9ZA 3BO5A 3RJWA 3M53A 5CCLA 4E47A 3M5AA 3N71A 5LSZA 5T0MA 1H3IA 4BUPA 3QWWA 5ARFA 4YPEA 1MUFA 4J8OA 3CBOA 3CBPA 1MVHA 4I51A 2W5ZA 4IJDA 5HQ8A 4QEOA 3S8PA 3F9XA 5F6LA 5TTFA 4YNDA 5HI7A 4NVQA 3OS5A 4J7FA 2QPWA 4JLGA 4RZ0A 3S7DA 3MO0A 5EX3A 3KMTA 5T0KA 3M54A 2W5YA 3VUZA 4IJ8A 3DB5A 3M55A 5JHNA 3F9WA 3MO2A 3MO5A 3FPDA 2IGQA 5EX0A 1XQHA 5KJLA 3EP0A 5KJKA 4C1QA 3RQ4A 1MVXA 3RAYA 2F69A 4MI5A 5CPRB 5TH7A 5F5EA 1ZKKA 4J83A 5KJMA 4NJ5A 3RIBA 2R3AA 3OOIA 3VV0A 5JIYA 3M57A 4WUYA 5F59A 3IHXA 1PEGA 5ARGA 3S7FA 4YNMA 5F6KC 5JJ0A 2RFIA 3M59A 3K5KA 2O8JA 3OPEA 3DALA 4MI0A 5AYFA 2BQZA 4YPAA 3SW9A 3CBMA 2JV0A 3M56A 4O6FA 3S7BA 3KMJA 5T5GA 5LSXA 3RU0A 3PDNA 4H12A 1N6AA 1MT6A 5KJNA 3F9YA 4AU7A 5EG2A 4YNPA 5TEGA 4QENA 3OXLA 1N3JA 3QWVA 3M58A 4FMUA 3KMAA 4O30A 4QEPA 3OXFA 4LDGA 4Z4PA 3SWCA 3HNAA 3MEKA 3OXGA 1ML9A 5CCMA 4JDSA 2G46A 3QWPA 5JINA 3TG5A 4YPUA 1N6CA 4J7IA 3S7JA 1O9SA 3TG4A
chains in the Genus database with same CATH superfamily
3F9ZA 3BO5A 3RJWA 3M53A 5CCLA 4E47A 3M5AA 3N71A 5LSZA 5T0MA 1H3IA 4BUPA 3QWWA 5ARFA 4YPEA 1MUFA 4J8OA 3CBOA 3CBPA 1MVHA 4I51A 2W5ZA 4IJDA 5HQ8A 4QEOA 3S8PA 3F9XA 5F6LA 5TTFA 4YNDA 5HI7A 4NVQA 3OS5A 4J7FA 2QPWA 4JLGA 4RZ0A 3S7DA 3MO0A 5EX3A 3KMTA 5T0KA 3M54A 2W5YA 3VUZA 4IJ8A 3DB5A 3M55A 5JHNA 3F9WA 3MO2A 3MO5A 3FPDA 2IGQA 5EX0A 1XQHA 5KJLA 3EP0A 5KJKA 4C1QA 3RQ4A 1MVXA 3RAYA 2F69A 4MI5A 5CPRB 5TH7A 5F5EA 1ZKKA 4J83A 5KJMA 4NJ5A 3RIBA 2R3AA 3OOIA 3VV0A 5JIYA 3M57A 4WUYA 5F59A 3IHXA 1PEGA 5ARGA 3S7FA 4YNMA 5F6KC 5JJ0A 2RFIA 3M59A 3K5KA 2O8JA 3OPEA 3DALA 4MI0A 5AYFA 2BQZA 4YPAA 3SW9A 3CBMA 2JV0A 3M56A 4O6FA 3S7BA 3KMJA 5T5GA 5LSXA 3RU0A 3PDNA 4H12A 1N6AA 1MT6A 5KJNA 3F9YA 4AU7A 5EG2A 4YNPA 5TEGA 4QENA 3OXLA 1N3JA 3QWVA 3M58A 4FMUA 3KMAA 4O30A 4QEPA 3OXFA 4LDGA 4Z4PA 3SWCA 3HNAA 3MEKA 3OXGA 1ML9A 5CCMA 4JDSA 2G46A 3QWPA 5JINA 3TG5A 4YPUA 1N6CA 4J7IA 3S7JA 1O9SA 3TG4A
chains in the Genus database with same CATH topology
3F9ZA 3BO5A 3RJWA 3M53A 5CCLA 4E47A 3M5AA 3N71A 5LSZA 5T0MA 1H3IA 4BUPA 3QWWA 5ARFA 4YPEA 1MUFA 4J8OA 3CBOA 3CBPA 1MVHA 4I51A 2W5ZA 4IJDA 5HQ8A 4QEOA 3S8PA 3F9XA 5F6LA 5TTFA 4YNDA 5HI7A 4NVQA 3OS5A 4J7FA 2QPWA 4JLGA 4RZ0A 3S7DA 3MO0A 5EX3A 3KMTA 5T0KA 3M54A 2W5YA 3VUZA 4IJ8A 3DB5A 3M55A 5JHNA 3F9WA 3MO2A 3MO5A 3FPDA 2IGQA 5EX0A 1XQHA 5KJLA 3EP0A 5KJKA 4C1QA 3RQ4A 1MVXA 3RAYA 2F69A 4MI5A 5CPRB 5TH7A 5F5EA 1ZKKA 4J83A 5KJMA 4NJ5A 3RIBA 2R3AA 3OOIA 3VV0A 5JIYA 3M57A 4WUYA 5F59A 3IHXA 1PEGA 5ARGA 3S7FA 4YNMA 5F6KC 5JJ0A 2RFIA 3M59A 3K5KA 2O8JA 3OPEA 3DALA 4MI0A 5AYFA 2BQZA 4YPAA 3SW9A 3CBMA 2JV0A 3M56A 4O6FA 3S7BA 3KMJA 5T5GA 5LSXA 3RU0A 3PDNA 4H12A 1N6AA 1MT6A 5KJNA 3F9YA 4AU7A 5EG2A 4YNPA 5TEGA 4QENA 3OXLA 1N3JA 3QWVA 3M58A 4FMUA 3KMAA 4O30A 4QEPA 3OXFA 4LDGA 4Z4PA 3SWCA 3HNAA 3MEKA 3OXGA 1ML9A 5CCMA 4JDSA 2G46A 3QWPA 5JINA 3TG5A 4YPUA 1N6CA 4J7IA 3S7JA 1O9SA 3TG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9Z A;  3BO5 A;  3RJW A;  3M53 A;  5CCL A;  4E47 A;  3M5A A;  3N71 A;  5LSZ A;  5T0M A;  1H3I A;  4BUP A;  3QWW A;  5ARF A;  4YPE A;  1MUF A;  4J8O A;  3CBO A;  3CBP A;  1MVH A;  4I51 A;  2W5Z A;  4IJD A;  5HQ8 A;  4QEO A;  3S8P A;  3F9X A;  5F6L A;  5TTF A;  4YND A;  5HI7 A;  4NVQ A;  3OS5 A;  4J7F A;  2QPW A;  4JLG A;  4RZ0 A;  3S7D A;  3MO0 A;  5EX3 A;  3KMT A;  5T0K A;  3M54 A;  2W5Y A;  3VUZ A;  4IJ8 A;  3DB5 A;  3M55 A;  5JHN A;  3F9W A;  3MO2 A;  3MO5 A;  3FPD A;  2IGQ A;  5EX0 A;  1XQH A;  5KJL A;  3EP0 A;  5KJK A;  4C1Q A;  3RQ4 A;  1MVX A;  3RAY A;  2F69 A;  4MI5 A;  5CPR B;  5TH7 A;  5F5E A;  1ZKK A;  4J83 A;  5KJM A;  4NJ5 A;  3RIB A;  2R3A A;  3OOI A;  3VV0 A;  5JIY A;  3M57 A;  4WUY A;  5F59 A;  3IHX A;  1PEG A;  5ARG A;  3S7F A;  4YNM A;  5F6K C;  5JJ0 A;  2RFI A;  3M59 A;  3K5K A;  2O8J A;  3OPE A;  3DAL A;  4MI0 A;  5AYF A;  2BQZ A;  4YPA A;  3SW9 A;  3CBM A;  2JV0 A;  3M56 A;  4O6F A;  3S7B A;  3KMJ A;  5T5G A;  5LSX A;  3RU0 A;  3PDN A;  4H12 A;  1N6A A;  1MT6 A;  5KJN A;  3F9Y A;  4AU7 A;  5EG2 A;  4YNP A;  5TEG A;  4QEN A;  3OXL A;  1N3J A;  3QWV A;  3M58 A;  4FMU A;  3KMA A;  4O30 A;  4QEP A;  3OXF A;  4LDG A;  4Z4P A;  3SWC A;  3HNA A;  3MEK A;  3OXG A;  1ML9 A;  5CCM A;  4JDS A;  2G46 A;  3QWP A;  5JIN A;  3TG5 A;  4YPU A;  1N6C A;  4J7I A;  3S7J A;  1O9S A;  3TG4 A; 
#chains in the Genus database with same CATH topology
 3F9Z A;  3BO5 A;  3RJW A;  3M53 A;  5CCL A;  4E47 A;  3M5A A;  3N71 A;  5LSZ A;  5T0M A;  1H3I A;  4BUP A;  3QWW A;  5ARF A;  4YPE A;  1MUF A;  4J8O A;  3CBO A;  3CBP A;  1MVH A;  4I51 A;  2W5Z A;  4IJD A;  5HQ8 A;  4QEO A;  3S8P A;  3F9X A;  5F6L A;  5TTF A;  4YND A;  5HI7 A;  4NVQ A;  3OS5 A;  4J7F A;  2QPW A;  4JLG A;  4RZ0 A;  3S7D A;  3MO0 A;  5EX3 A;  3KMT A;  5T0K A;  3M54 A;  2W5Y A;  3VUZ A;  4IJ8 A;  3DB5 A;  3M55 A;  5JHN A;  3F9W A;  3MO2 A;  3MO5 A;  3FPD A;  2IGQ A;  5EX0 A;  1XQH A;  5KJL A;  3EP0 A;  5KJK A;  4C1Q A;  3RQ4 A;  1MVX A;  3RAY A;  2F69 A;  4MI5 A;  5CPR B;  5TH7 A;  5F5E A;  1ZKK A;  4J83 A;  5KJM A;  4NJ5 A;  3RIB A;  2R3A A;  3OOI A;  3VV0 A;  5JIY A;  3M57 A;  4WUY A;  5F59 A;  3IHX A;  1PEG A;  5ARG A;  3S7F A;  4YNM A;  5F6K C;  5JJ0 A;  2RFI A;  3M59 A;  3K5K A;  2O8J A;  3OPE A;  3DAL A;  4MI0 A;  5AYF A;  2BQZ A;  4YPA A;  3SW9 A;  3CBM A;  2JV0 A;  3M56 A;  4O6F A;  3S7B A;  3KMJ A;  5T5G A;  5LSX A;  3RU0 A;  3PDN A;  4H12 A;  1N6A A;  1MT6 A;  5KJN A;  3F9Y A;  4AU7 A;  5EG2 A;  4YNP A;  5TEG A;  4QEN A;  3OXL A;  1N3J A;  3QWV A;  3M58 A;  4FMU A;  3KMA A;  4O30 A;  4QEP A;  3OXF A;  4LDG A;  4Z4P A;  3SWC A;  3HNA A;  3MEK A;  3OXG A;  1ML9 A;  5CCM A;  4JDS A;  2G46 A;  3QWP A;  5JIN A;  3TG5 A;  4YPU A;  1N6C A;  4J7I A;  3S7J A;  1O9S A;  3TG4 A; 
#chains in the Genus database with same CATH homology
 3F9Z A;  3BO5 A;  3RJW A;  3M53 A;  5CCL A;  4E47 A;  3M5A A;  3N71 A;  5LSZ A;  5T0M A;  1H3I A;  4BUP A;  3QWW A;  5ARF A;  4YPE A;  1MUF A;  4J8O A;  3CBO A;  3CBP A;  1MVH A;  4I51 A;  2W5Z A;  4IJD A;  5HQ8 A;  4QEO A;  3S8P A;  3F9X A;  5F6L A;  5TTF A;  4YND A;  5HI7 A;  4NVQ A;  3OS5 A;  4J7F A;  2QPW A;  4JLG A;  4RZ0 A;  3S7D A;  3MO0 A;  5EX3 A;  3KMT A;  5T0K A;  3M54 A;  2W5Y A;  3VUZ A;  4IJ8 A;  3DB5 A;  3M55 A;  5JHN A;  3F9W A;  3MO2 A;  3MO5 A;  3FPD A;  2IGQ A;  5EX0 A;  1XQH A;  5KJL A;  3EP0 A;  5KJK A;  4C1Q A;  3RQ4 A;  1MVX A;  3RAY A;  2F69 A;  4MI5 A;  5CPR B;  5TH7 A;  5F5E A;  1ZKK A;  4J83 A;  5KJM A;  4NJ5 A;  3RIB A;  2R3A A;  3OOI A;  3VV0 A;  5JIY A;  3M57 A;  4WUY A;  5F59 A;  3IHX A;  1PEG A;  5ARG A;  3S7F A;  4YNM A;  5F6K C;  5JJ0 A;  2RFI A;  3M59 A;  3K5K A;  2O8J A;  3OPE A;  3DAL A;  4MI0 A;  5AYF A;  2BQZ A;  4YPA A;  3SW9 A;  3CBM A;  2JV0 A;  3M56 A;  4O6F A;  3S7B A;  3KMJ A;  5T5G A;  5LSX A;  3RU0 A;  3PDN A;  4H12 A;  1N6A A;  1MT6 A;  5KJN A;  3F9Y A;  4AU7 A;  5EG2 A;  4YNP A;  5TEG A;  4QEN A;  3OXL A;  1N3J A;  3QWV A;  3M58 A;  4FMU A;  3KMA A;  4O30 A;  4QEP A;  3OXF A;  4LDG A;  4Z4P A;  3SWC A;  3HNA A;  3MEK A;  3OXG A;  1ML9 A;  5CCM A;  4JDS A;  2G46 A;  3QWP A;  5JIN A;  3TG5 A;  4YPU A;  1N6C A;  4J7I A;  3S7J A;  1O9S A;  3TG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...