4YPEA

Ash1l set domain h2193f mutant in complex with s-adenosyl methionine (sam)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
AMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDFYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase ASH1L
publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ypeA00
4NVQA 4AU7A 3S7JA 3M5AA 2BQZA 3TG5A 4MI5A 5F6KC 5ARGA 2O8JA 4H12A 3RAYA 3M58A 5F5EA 5CPRB 1N3JA 3OXGA 4QEPA 3EP0A 3MEKA 5T0KA 5HI7A 3M55A 3K5KA 5ARFA 4J8OA 3OOIA 3RJWA 4BUPA 2QPWA 1XQHA 5T0MA 3DB5A 3OXLA 3OS5A 3DALA 5JIYA 3S8PA 5CCMA 5TH7A 5KJKA 5T5GA 3HNAA 3IHXA 3OXFA 3RQ4A 4O6FA 5LSXA 1PEGA 3CBMA 2IGQA 5AYFA 2G46A 4IJ8A 3M57A 5TEGA 2W5ZA 4J7FA 5JINA 3CBOA 3KMJA 3M53A 4YNPA 3TG4A 2R3AA 4JLGA 5F6LA 3M56A 3SWCA 3M59A 3RIBA 3OPEA 3SW9A 3BO5A 4YPUA 3MO2A 3CBPA 5F59A 2W5YA 4C1QA 3S7FA 1N6CA 5EG2A 4J83A 2F69A 5JHNA 5EX0A 4I51A 4FMUA 5HQ8A 4QENA 2JV0A 3N71A 5CCLA 3VUZA 3QWVA 4YNDA 3F9ZA 1ZKKA 1N6AA 5JJ0A 3KMAA 3FPDA 3MO5A 3F9YA 3PDNA 3F9WA 3MO0A 3S7DA 5TTFA 4YPAA 3M54A 4MI0A 5LSZA 4NJ5A 4E47A 3QWPA 5EX3A 3VV0A 4WUYA 4QEOA 4YPEA 1MVXA 4IJDA 3F9XA 4O30A 1H3IA 4RZ0A 4LDGA 4JDSA 1MT6A 3QWWA 4Z4PA 3S7BA 4J7IA 3KMTA 5KJMA 4YNMA 1ML9A 1MUFA 3RU0A 1MVHA 5KJNA 5KJLA 1O9SA 2RFIA
chains in the Genus database with same CATH superfamily
4NVQA 4AU7A 3S7JA 3M5AA 2BQZA 3TG5A 4MI5A 5F6KC 5ARGA 2O8JA 4H12A 3RAYA 3M58A 5F5EA 5CPRB 1N3JA 3OXGA 4QEPA 3EP0A 3MEKA 5T0KA 5HI7A 3M55A 3K5KA 5ARFA 4J8OA 3OOIA 3RJWA 4BUPA 2QPWA 1XQHA 5T0MA 3DB5A 3OXLA 3OS5A 3DALA 5JIYA 3S8PA 5CCMA 5TH7A 5KJKA 5T5GA 3HNAA 3IHXA 3OXFA 3RQ4A 4O6FA 5LSXA 1PEGA 3CBMA 2IGQA 5AYFA 2G46A 4IJ8A 3M57A 5TEGA 2W5ZA 4J7FA 5JINA 3CBOA 3KMJA 3M53A 4YNPA 3TG4A 2R3AA 4JLGA 5F6LA 3M56A 3SWCA 3M59A 3RIBA 3OPEA 3SW9A 3BO5A 4YPUA 3MO2A 3CBPA 5F59A 2W5YA 4C1QA 3S7FA 1N6CA 5EG2A 4J83A 2F69A 5JHNA 5EX0A 4I51A 4FMUA 5HQ8A 4QENA 2JV0A 3N71A 5CCLA 3VUZA 3QWVA 4YNDA 3F9ZA 1ZKKA 1N6AA 5JJ0A 3KMAA 3FPDA 3MO5A 3F9YA 3PDNA 3F9WA 3MO0A 3S7DA 5TTFA 4YPAA 3M54A 4MI0A 5LSZA 4NJ5A 4E47A 3QWPA 5EX3A 3VV0A 4WUYA 4QEOA 4YPEA 1MVXA 4IJDA 3F9XA 4O30A 1H3IA 4RZ0A 4LDGA 4JDSA 1MT6A 3QWWA 4Z4PA 3S7BA 4J7IA 3KMTA 5KJMA 4YNMA 1ML9A 1MUFA 3RU0A 1MVHA 5KJNA 5KJLA 1O9SA 2RFIA
chains in the Genus database with same CATH topology
4NVQA 4AU7A 3S7JA 3M5AA 2BQZA 3TG5A 4MI5A 5F6KC 5ARGA 2O8JA 4H12A 3RAYA 3M58A 5F5EA 5CPRB 1N3JA 3OXGA 4QEPA 3EP0A 3MEKA 5T0KA 5HI7A 3M55A 3K5KA 5ARFA 4J8OA 3OOIA 3RJWA 4BUPA 2QPWA 1XQHA 5T0MA 3DB5A 3OXLA 3OS5A 3DALA 5JIYA 3S8PA 5CCMA 5TH7A 5KJKA 5T5GA 3HNAA 3IHXA 3OXFA 3RQ4A 4O6FA 5LSXA 1PEGA 3CBMA 2IGQA 5AYFA 2G46A 4IJ8A 3M57A 5TEGA 2W5ZA 4J7FA 5JINA 3CBOA 3KMJA 3M53A 4YNPA 3TG4A 2R3AA 4JLGA 5F6LA 3M56A 3SWCA 3M59A 3RIBA 3OPEA 3SW9A 3BO5A 4YPUA 3MO2A 3CBPA 5F59A 2W5YA 4C1QA 3S7FA 1N6CA 5EG2A 4J83A 2F69A 5JHNA 5EX0A 4I51A 4FMUA 5HQ8A 4QENA 2JV0A 3N71A 5CCLA 3VUZA 3QWVA 4YNDA 3F9ZA 1ZKKA 1N6AA 5JJ0A 3KMAA 3FPDA 3MO5A 3F9YA 3PDNA 3F9WA 3MO0A 3S7DA 5TTFA 4YPAA 3M54A 4MI0A 5LSZA 4NJ5A 4E47A 3QWPA 5EX3A 3VV0A 4WUYA 4QEOA 4YPEA 1MVXA 4IJDA 3F9XA 4O30A 1H3IA 4RZ0A 4LDGA 4JDSA 1MT6A 3QWWA 4Z4PA 3S7BA 4J7IA 3KMTA 5KJMA 4YNMA 1ML9A 1MUFA 3RU0A 1MVHA 5KJNA 5KJLA 1O9SA 2RFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NVQ A;  4AU7 A;  3S7J A;  3M5A A;  2BQZ A;  3TG5 A;  4MI5 A;  5F6K C;  5ARG A;  2O8J A;  4H12 A;  3RAY A;  3M58 A;  5F5E A;  5CPR B;  1N3J A;  3OXG A;  4QEP A;  3EP0 A;  3MEK A;  5T0K A;  5HI7 A;  3M55 A;  3K5K A;  5ARF A;  4J8O A;  3OOI A;  3RJW A;  4BUP A;  2QPW A;  1XQH A;  5T0M A;  3DB5 A;  3OXL A;  3OS5 A;  3DAL A;  5JIY A;  3S8P A;  5CCM A;  5TH7 A;  5KJK A;  5T5G A;  3HNA A;  3IHX A;  3OXF A;  3RQ4 A;  4O6F A;  5LSX A;  1PEG A;  3CBM A;  2IGQ A;  5AYF A;  2G46 A;  4IJ8 A;  3M57 A;  5TEG A;  2W5Z A;  4J7F A;  5JIN A;  3CBO A;  3KMJ A;  3M53 A;  4YNP A;  3TG4 A;  2R3A A;  4JLG A;  5F6L A;  3M56 A;  3SWC A;  3M59 A;  3RIB A;  3OPE A;  3SW9 A;  3BO5 A;  4YPU A;  3MO2 A;  3CBP A;  5F59 A;  2W5Y A;  4C1Q A;  3S7F A;  1N6C A;  5EG2 A;  4J83 A;  2F69 A;  5JHN A;  5EX0 A;  4I51 A;  4FMU A;  5HQ8 A;  4QEN A;  2JV0 A;  3N71 A;  5CCL A;  3VUZ A;  3QWV A;  4YND A;  3F9Z A;  1ZKK A;  1N6A A;  5JJ0 A;  3KMA A;  3FPD A;  3MO5 A;  3F9Y A;  3PDN A;  3F9W A;  3MO0 A;  3S7D A;  5TTF A;  4YPA A;  3M54 A;  4MI0 A;  5LSZ A;  4NJ5 A;  4E47 A;  3QWP A;  5EX3 A;  3VV0 A;  4WUY A;  4QEO A;  4YPE A;  1MVX A;  4IJD A;  3F9X A;  4O30 A;  1H3I A;  4RZ0 A;  4LDG A;  4JDS A;  1MT6 A;  3QWW A;  4Z4P A;  3S7B A;  4J7I A;  3KMT A;  5KJM A;  4YNM A;  1ML9 A;  1MUF A;  3RU0 A;  1MVH A;  5KJN A;  5KJL A;  1O9S A;  2RFI A; 
#chains in the Genus database with same CATH topology
 4NVQ A;  4AU7 A;  3S7J A;  3M5A A;  2BQZ A;  3TG5 A;  4MI5 A;  5F6K C;  5ARG A;  2O8J A;  4H12 A;  3RAY A;  3M58 A;  5F5E A;  5CPR B;  1N3J A;  3OXG A;  4QEP A;  3EP0 A;  3MEK A;  5T0K A;  5HI7 A;  3M55 A;  3K5K A;  5ARF A;  4J8O A;  3OOI A;  3RJW A;  4BUP A;  2QPW A;  1XQH A;  5T0M A;  3DB5 A;  3OXL A;  3OS5 A;  3DAL A;  5JIY A;  3S8P A;  5CCM A;  5TH7 A;  5KJK A;  5T5G A;  3HNA A;  3IHX A;  3OXF A;  3RQ4 A;  4O6F A;  5LSX A;  1PEG A;  3CBM A;  2IGQ A;  5AYF A;  2G46 A;  4IJ8 A;  3M57 A;  5TEG A;  2W5Z A;  4J7F A;  5JIN A;  3CBO A;  3KMJ A;  3M53 A;  4YNP A;  3TG4 A;  2R3A A;  4JLG A;  5F6L A;  3M56 A;  3SWC A;  3M59 A;  3RIB A;  3OPE A;  3SW9 A;  3BO5 A;  4YPU A;  3MO2 A;  3CBP A;  5F59 A;  2W5Y A;  4C1Q A;  3S7F A;  1N6C A;  5EG2 A;  4J83 A;  2F69 A;  5JHN A;  5EX0 A;  4I51 A;  4FMU A;  5HQ8 A;  4QEN A;  2JV0 A;  3N71 A;  5CCL A;  3VUZ A;  3QWV A;  4YND A;  3F9Z A;  1ZKK A;  1N6A A;  5JJ0 A;  3KMA A;  3FPD A;  3MO5 A;  3F9Y A;  3PDN A;  3F9W A;  3MO0 A;  3S7D A;  5TTF A;  4YPA A;  3M54 A;  4MI0 A;  5LSZ A;  4NJ5 A;  4E47 A;  3QWP A;  5EX3 A;  3VV0 A;  4WUY A;  4QEO A;  4YPE A;  1MVX A;  4IJD A;  3F9X A;  4O30 A;  1H3I A;  4RZ0 A;  4LDG A;  4JDS A;  1MT6 A;  3QWW A;  4Z4P A;  3S7B A;  4J7I A;  3KMT A;  5KJM A;  4YNM A;  1ML9 A;  1MUF A;  3RU0 A;  1MVH A;  5KJN A;  5KJL A;  1O9S A;  2RFI A; 
#chains in the Genus database with same CATH homology
 4NVQ A;  4AU7 A;  3S7J A;  3M5A A;  2BQZ A;  3TG5 A;  4MI5 A;  5F6K C;  5ARG A;  2O8J A;  4H12 A;  3RAY A;  3M58 A;  5F5E A;  5CPR B;  1N3J A;  3OXG A;  4QEP A;  3EP0 A;  3MEK A;  5T0K A;  5HI7 A;  3M55 A;  3K5K A;  5ARF A;  4J8O A;  3OOI A;  3RJW A;  4BUP A;  2QPW A;  1XQH A;  5T0M A;  3DB5 A;  3OXL A;  3OS5 A;  3DAL A;  5JIY A;  3S8P A;  5CCM A;  5TH7 A;  5KJK A;  5T5G A;  3HNA A;  3IHX A;  3OXF A;  3RQ4 A;  4O6F A;  5LSX A;  1PEG A;  3CBM A;  2IGQ A;  5AYF A;  2G46 A;  4IJ8 A;  3M57 A;  5TEG A;  2W5Z A;  4J7F A;  5JIN A;  3CBO A;  3KMJ A;  3M53 A;  4YNP A;  3TG4 A;  2R3A A;  4JLG A;  5F6L A;  3M56 A;  3SWC A;  3M59 A;  3RIB A;  3OPE A;  3SW9 A;  3BO5 A;  4YPU A;  3MO2 A;  3CBP A;  5F59 A;  2W5Y A;  4C1Q A;  3S7F A;  1N6C A;  5EG2 A;  4J83 A;  2F69 A;  5JHN A;  5EX0 A;  4I51 A;  4FMU A;  5HQ8 A;  4QEN A;  2JV0 A;  3N71 A;  5CCL A;  3VUZ A;  3QWV A;  4YND A;  3F9Z A;  1ZKK A;  1N6A A;  5JJ0 A;  3KMA A;  3FPD A;  3MO5 A;  3F9Y A;  3PDN A;  3F9W A;  3MO0 A;  3S7D A;  5TTF A;  4YPA A;  3M54 A;  4MI0 A;  5LSZ A;  4NJ5 A;  4E47 A;  3QWP A;  5EX3 A;  3VV0 A;  4WUY A;  4QEO A;  4YPE A;  1MVX A;  4IJD A;  3F9X A;  4O30 A;  1H3I A;  4RZ0 A;  4LDG A;  4JDS A;  1MT6 A;  3QWW A;  4Z4P A;  3S7B A;  4J7I A;  3KMT A;  5KJM A;  4YNM A;  1ML9 A;  1MUF A;  3RU0 A;  1MVH A;  5KJN A;  5KJL A;  1O9S A;  2RFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...