4WUYA

Crystal structure of protein lysine methyltransferase smyd2 in complex with lly-507, a cell-active, potent and selective inhibitor
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
414
Chain Sequence
b'GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKAEAIRDMVRYARNVIEEFRELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title LLY-507, a Cell-active, Potent, and Selective Inhibitor of Protein-lysine Methyltransferase SMYD2.
pubmed doi rcsb
total genus 145
structure length 414
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4wuyA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4wuyA01
3OPEA 3KS2A 5JJTA 4WNGA 2FBNA 4H7XA 5JHNA 3PDNA 4YNDA 4RG9A 2XGOA 4JA7A 2Q7FA 4BT9A 4RG6A 1MVHA 2DBAA 4J8DA 1MUFA 5T0MA 3NF1A 5D0QD 2PQNA 4NRHB 5KJKA 5FJYA 3M56A 2FF4A 5JJ6A 3PE4A 3VUZA 3SF4A 3S7DA 1FCHA 4U0UA 4ABNA 4GCNA 2IF4A 4WNDA 4I2WA 2JLBA 5G04J 3F9XA 3MO0A 3GZ2A 3RU0A 4FMUA 3QKYA 3OXGA 3MEKA 3M57A 4CGWA 5BT1A 2VGYA 4XI0A 5LSXA 3ASDA 4I1AA 4IN3B 4N5CA 2XGMA 5AYWD 5CPRB 1NZNA 2HO1A 3FFLA 3QDNA 1A17A 4O30A 4U0SA 4N3CA 2XGSA 3IEGA 5TEGA 4J8EA 3RO3A 2UWJG 4N2SA 4KYOB 3KMJA 3DB5A 3ZPJA 4YPEA 1Y8MA 3S7JA 2O8JA 3KAEA 5F6LA 1N6CA 5LCWC 3ESKA 2I6HA 5D0OD 1ZKKA 3SZ7A 2C0MA 3CVQA 4JLGA 3IHXA 2VSYA 3CVPA 3N71A 4J8FA 3Q15A 4IJ8A 2R5SA 3F9WA 2P58C 3S7BA 5EX0A 5A6CA 5DBKA 3VTYA 2JV0A 3SW9A 4GZ5A 2PQRA 2VGXA 3OXLA 4GA1A 4U07A 1QZ2A 2Y4UA 3LPZA 4G23A 4Z4PA 3WXXA 2BUGA 5FTPA 5ARGA 2NC9A 3K5KA 3K9IA 2VYIA 3CBPA 3M55A 3RAYA 5ARFA 3LY9A 3M58A 4BTBA 1H3IA 3AS8A 3FP3A 2WPVA 4KBQA 3Q5MA 5A7DB 4LDGA 2VSNA 1O9SA 5JJ7A 3ASHA 3CEQA 2BQZA 3ZFWA 5CCLA 4WNFA 3OXFA 5M72A 3RKVA 2F69A 4I9CA 5EG2A 3MA5A 3CV0A 2HYZA 1HXIA 2XCBA 3TAXA 1XNFA 2R3AA 4G1TA 3CBMA 5KJLA 3VV0A 3MV3B 5G05J 3RQ4A 2VQ2A 3UQ3A 3CK7A 2W5YA 4JA9A 2QFCA 3F9ZA 4JHRA 3OS5A 3QOUA 2GW1A 4E47A 5FZSA 4BUPA 2C2LA 2PZIA 3Q4AB 4HOUA 2IGQA 1IHGA 5JINA 1P5QA 4XI9A 5KJNA 2C0LA 2G46A 4MI5A 1KLXA 1WAO1 3LKUA 4N2QA 4Y6WA 4A1SA 3KMTA 4EQFA 3AS4A 3OOIA 3ZGQA 1MVXA 4J7IA 3U3WA 3QWWA 5HQ8A 3F9YA 5AYFA 4QEPA 3ULQA 1YA0A 1HZ4A 3ASFA 3FWVA 4CGVA 2FEZA 4JDSA 4W9RA 4J7FA 4YNMA 1ML9A 2UY1A 1IYGA 3S8PA 4UQYA 5F59A 5EKQD 3URZA 3HYMB 3S7FA 4MI0A 1KT0A 1MT6A 2YHCA 4GPKA 2OOEA 1ELRA 4O6FA 1N6AA 4BWRA 2KCLA 2YQ8A 3JYSA 2FO7A 1QQEA 1ZU2A 4G25A 4J0UA 4HORA 3EP0A 2QPWA 5FZQA 4UI9K 3KMAA 3M5AA 3ASGA 2HR2A 2KATA 4G26A 4GYOA 4JL0A 2XPIA 4WUYA 5TH7A 5CHEE 5KJMA 4J83A 1B89A 5JIYA 4KXKB 1XQHA 3MO5A 4H7YA 5F6KC 5G05C 3Q49B 4I2ZA 3MKRA 3GZ1A 3TG4A 4N3BA 3GW4A 3CVLA 2KCVA 3ZN3A 3QWPA 4J8OA 2AVPA 5CCMA 3CVNA 4AIFA 5T0KA 3M54A 2XEVA 2IFUA 3R9AB 3QWVA 3M59A 4YVQC 4IJDA 3CK8A 4ME2A 2LNIA 2Y4TA 2PL2A 3RJVA 3PE3A 5DIZA 5LSZA 4H12A 3RJWA 3ZHEB 4GA0A 3MO2A 3TGOA 4APOA 4CDRA 3BO5A 4I9EA 4QENA 4C1QA 2ONDA 3UPVA 2J9QA 4QEOA 3CKCA 1NA0A 2V5FA 3RIBA 4XIFA 4G2VA 1E96B 4HOSA 1WM5A 2FI7A 3FPDA 4UQXA 5EX3A 5BW8C 3AS5A 4B94A 4NQ0A 4AM9A 5C1DA 4YPAA 2LSVA 3KD7A 3BEEA 4GA2A 4AY5A 5BNWA 4NJ5A 4BTAA 4LEUA 3TG5A 4GYWA 1PEGA 4BT8A 1N3JA 5F5EA 2W5ZA 3MV2B 1ZBPA 3RO2A 4GCOA 4AU7A 4UQZA 4UI9C 4I51A 2VGXB 2E2EA 4F3VA 1HH8A 5JJ0A 4GZ6A 4N3AA 4UI9J 4RZ0A 1TJCA 3SWCA 4HOTA 2XCCA 3M53A 5TTFA 1NA3A 5G04C 2UY1B 2LSUA 4AY6A 3GYZA 3CKBA 4HOQA 4N39A 4Y6CA 3Q47B 5FZRA 2L6JA 5HI7A 3EDTB 4NVQA 3LCAA 4YVOA 5LCWJ 3U4TA 4U04A 2KC7A 2MHKA 3CK9A 5FT9A 3O48A 3LY8A 4WNEA 4I17A 5T5GA 3LY7A 4GZ3A 3UUXA 1PC2A 3LYAA 4YNPA 4U0ZA 4GYYA 1W3BA 3CBOA 4YPUA 1ELWA 1KT1A 2WQHA 1OUVA 4G24A 3E4BA 3HNAA 2RFIA 2KCKA 3ZHEA 3DALA 3VTXA
chains in the Genus database with same CATH superfamily
5FQ4A 4BY6A 4TUUA 3DRAA 2Q7FA 4PS7A 5AQBA 3D9JA 4ATGA 4U7EB 1AWCB 5AQ9A 1BPOA 5D0QD 2QYUA 4RVBA 5BXOA 1H6KA 4KVMA 1TN6A 5FJYA 3I3NA 3SFZA 3AAAC 3PE4A 3VUZA 5ENNA 2F0YA 2L0TB 2IO2C 3E37A 4ABNA 2XRYA 3T9KA 3BUAA 4C0EA 2AXZA 4LERA 5G04J 2GRRB 3MO0A 3OXGA 5BT1A 2VGYA 3FU0A 3D9OA 2DWZA 3ZU7B 3ASDA 1K8KG 1SQMA 3FU6A 3RSEG 2DYRE 3AG2E 1HG2A 4N5CA 5AYWD 4KT6B 1FPPA 3ABKE 2J4BA 4O30A 2H6HA 2V4HC 4PH4B 5KBAA 3KMJA 4TXQA 1N4RA 1OWMA 3ZPJA 3KSQA 3AG3E 3T8KA 3AU5A 2QC9A 4C9BB 1SVXA 3S7JA 4A63B 1TNBA 3PZ3A 2Y1LE 1UN8A 2M63A 3CVQA 2CFZA 3IHXA 4BSXA 3Q15A 2I2OA 3S7BA 4BX9A 1OWPA 2YINA 5E75A 3FTSA 5A6CA 5DBKA 3SW9A 4GZ5A 4E6HA 2PQRA 1HE8A 4U07A 3Q7AA 4Z4PA 2VJ8A 2R03A 3ZXPA 1KZPA 3K9IA 3E34A 3AU4A 3RAYA 3EU9A 4Q94A 2R02A 4HNAD 4BTBA 1H3IA 2WPVA 4CYMD 1N9AA 4KBQA 4DX5D 3Q5MA 5A7DB 2XEHA 2EQXA 3S2AA 1O9SA 3EJNA 4G8KA 3U66A 3TWRA 3KEZA 3FUFA 3G2SA 3SFYA 3FTUA 5BPPA 2WXGA 3UKUG 2VTBA 2GRPB 3CBMA 5JHBA 3J5PA 3HXFA 3FUJA 3FDHA 4FJZA 3CK7A 2CHWA 1TYQG 4JA9A 2R05A 3Q79A 1SA5A 2QFCA 3VLDA 3W9FA 5LOZA 3QOUA 3Q4AB 4I6JA 4JXTA 1LD8A 2P9LG 2L0IA 4O1OA 2WXMA 4I1OB 5EIBE 4EQFA 4ANVA 3OOIA 1HF8A 3SHFA 3VLEA 1S70B 4ILIA 3QWWA 5HQ8A 5AYFA 3FWVA 2FEZA 2IQCA 4TV3A 4JDSA 3OTNA 3QARA 2XS8A 4J7FA 4JVSA 5EKQD 1U3DA 3S7FA 4MI0A 4JEHA 1KT0A 1MT6A 1S64A 1K1AA 3T5VA 1N6AA 4BWRA 4KMOA 3PRZA 1QQEA 3D3MA 4MLPA 4J0UA 2QPWA 2IO3C 2HR2A 1EDUA 2DIWA 5EILA 4J83A 5JA4D 3MO5A 4K5AB 4J6IA 3MKRA 4GMRA 3SFXA 3R7RA 2L6BA 2ZIRA 3FUDA 3GW4A 3DSTA 3CVLA 3D9NA 3ZIMA 4YDEA 3QNKA 5CCMA 2RFAA 5T0KA 2I9CA 3M54A 4JW1A 2IFUA 3CHPA 3SBTB 3PZ1A 5B1BE 4ME2A 2LNIA 2PL2A 5AIJA 4URKA 4GTVA 3G2WA 1O5MA 3HG0D 4H12A 3V2OA 3IBEA 3ZHEB 4K5BA 1MJ0A 3TGOA 1H19A 2V5QC 3DPDA 3HXBA 3PEUB 4TXPA 3CQGB 4CDRA 1SW6A 2IOSA 4CT4A 4C1QA 4OVVA 1N52A 3B7BA 3HXEA 2OCCE 3RIBA 1E7UA 4XIFA 4G2VA 2WXRA 4CRWA 2HE0A 2FI7A 1IHBA 5EIDA 1GW6A 3IHVA 3SI5A 1HFAA 4AM9A 1G3NB 4DUIA 2OVBA 3G2UA 3PZ4A 4F7AA 1NFIE 3KD7A 4BESA 4NJ5A 3APFA 4BTAA 4LEUA 1A5EA 3TG5A 5KCMA 4MS6A 4BT8A 1TNZA 5KWDA 3RO2A 2A5EA 3CVWA 4XE0A 5B1AE 3TWSA 4KVOA 4UQZA 4UI9C 3SO8A 4B89A 4F3VA 1LF8A 4GZ6A 4WWOA 4N3AA 3EHMA 5HS0A 1HX8A 4UI9J 5BXUA 2CHXA 3CSTA 4RZ0A 4FHJA 5AENA 4DK5A 3CKBA 4AOFA 4RQIA 4O60A 2L6JA 5B3SE 3P2BA 5HI7A 4NVQA 2Y0BG 2MHKA 3PNLB 3RAUA 4GTMA 4YDWA 4GZ3A 3DWLG 4BETA 3LYAA 3TXNA 5JHAA 2QY7A 4YPUA 1ELWA 1KPSB 2EILE 2WQHA 3C3OA 4DLOA 4F53A 5EN5D 2CG3A 5JJTA 4WNGA 1INZA 5JHNA 3PDNA 2CHZA 4YNDA 2XGOA 4MBGA 4JA7A 4BT9A 2GRLA 1IQRA 3ZYQA 3SQVA 1IQUA 1DVPA 5ANLA 3R7QA 2OEVA 3E33A 2PQNA 2XS1A 4B0ZA 2F8XK 3V31A 2V4LA 1U3CA 3DSWA 2FF4A 3QC1A 3SF4A 3UM3A 4GPMA 1UOHA 4U0UA 4PDXA 4GCNA 4LNBA 4ANWA 4WNDA 5J90A 3FUIA 2JLBA 3UIOC 3UT7A 4OAVB 2NSZA 3QKYA 4A55A 5CRUA 1HS6A 3MEKA 3NZUA 4XI0A 3JCKC 4I1AA 3DSVA 1JUQA 4C48B 5AQ7A 1NL4A 1IKND 4N3CA 3QJZA 3NOGD 3FEXA 3FTWA 5ENTD 1O1SA 4YDOA 1N54A 1JPLA 4LG6A 1D8EA 1Y8MA 3KEAA 2F37A 2P9IG 5LCWC 1SZAA 4K0RA 3ESKA 3ONLA 5D0OD 3SZ7A 3UKRG 4EZKA 4U63A 4GZDA 4HB5A 3F9WA 3EHQA 5EX0A 1FT2A 2JV0A 2VGXA 3OXLA 1LD7A 3ZRHA 1JWFA 4JEUA 3LPZA 5AAOA 4G23A 3L54A 2ETCA 2A4ZA 3CHMA 2J4DA 3DXMG 3M55A 1V54E 2XRZA 3FTZA 2ZISA 2H6GA 3P1UA 4OAUC 4F1PA 1JCQA 2QZAA 3ZFWA 2NXPA 3JXJA 4WNFA 4N5QA 5M72A 5ENRD 2NYJA 4KZ0A 4I9CA 5FIOA 5EG2A 4ATZD 1OWNA 3MA5A 2BKGA 1DCQA 2HYZA 4GAAA 1X5BA 3L9TA 3TAXA 1SZ9A 4EZJA 4G1TA 5KJLA 2XEEA 3VV0A 3MV3B 4AEZC 2VQ2A 3UI2A 2WXOA 5AQAA 2W5YA 2PNNA 4JHRA 4GTOA 2GW1A 4EBAA 5ENOD 1ZB1A 4FP7A 1IHGA 4XI9A 4M3OA 4JD2G 2C0LA 2G46A 1WAO1 5AJLA 2IEJA 3LKUA 4Y6WA 5C2YA 4OYSA 1Z6TA 4QEPA 3UMVA 3ASFA 1QYMA 3L13A 4YNMA 3HXCA 1ML9A 1PAQA 2BF0X 1QBQA 4UQYA 4JZYA 3HYMB 5J08A 2KZTA 2IOLA 3D9LA 3V30A 3T5XA 4O6FA 3BG1B 4HBDA 4HI8A 2FO7A 3RRUA 4LNGA 3LEWA 2WXPA 4ANXA 4UI9K 1BU9A 3ASGA 2RFMA 1N0RA 4HI9A 1UJKA 3ENEA 2VTBB 2LUHA 2XPIA 1VDYA 5TH7A 5CHEE 5AJDA 1B89A 4KXKB 3HIZA 1XQHA 4H7YA 5F6KC 3NAWA 3Q49B 3L22A 4I2ZA 3GZ1A 1WG0A 4I43A 3TG4A 3SY2A 4ANUA 3QWPA 2X38A 1ELKA 2AVPA 4DJAA 2B0OE 3CVNA 5T4YA 1DNPA 3Q78A 5FQ7A 2XEVA 4K5CA 3R9AB 5T3RA 2X3MA 3CK8A 3FY4A 3SBSA 3PUJA 3TWUA 5ENSD 2VGEA 3MX3A 2VSOE 3VLFA 4GA0A 3FH7A 4UWHA 4FLHA 4JB8P 3APCA 3ASOE 4I9EA 2XPYA 4DRXE 3UPVA 3QAQA 4G11A 3LJNA 2V5FA 1UW4B 3FTXA 5KNHD 3UXGA 2AJAA 2V0PA 1S63A 2EIME 3L08A 3PZDA 1YCSB 3D9PA 3EIQC 2EIKE 4UQXA 4K03A 3AS5A 3FTYA 4YPAA 5KNGA 1HO8A 4AY5A 5BNWA 5D2MC 5CMYA 5F5EA 3RRMB 3MV2B 2XHEA 4I1MA 3QB2A 1XGWA 4LCTA 3HDXA 4FA6A 2VGXB 1PY1A 4XEIG 3I5PA 3SNXA 2WXHA 4M7CA 1HH8A 3NBNB 3ZNGA 3JUEA 4UWLA 5AN8A 3TWVA 3C98A 3SWCA 4HOTA 2XCCA 4B8CB 1WY6A 4U8HA 3BG0B 3M53A 5TTFA 4HVBA 4FJYA 4CCAA 4P29A 3FUHA 4I6EA 2YHEA 5FINA 4N39A 4Y6CA 3Q47B 4O1PA 3EDTB 1JWGA 3SD5A 4J8YA 4V3IA 4U04A 1OT8A 3CGHA 1OXJA 1OY3D 1H2VC 3LY8A 2ETAA 1N94A 1FVHA 3MJWA 4X8QA 4GYYA 3TWQA 1W3BA 4HFGA 2OV8A 1OUVA 4L2YA 3E4BA 3ZVVA 1YMPA 3HNAA 4LUNU 3I4RB 3VTXA 3CQCB 1D8DA 1MX2A 1OCCE 4LSZE 1OCRE 4GTRA 4GZCA 3MYVA 2J49A 4RLYA 2WMNA 1MVHA 2DBAA 4FU3A 4U8YD 4J8DA 1MUFA 1AP7A 1DC2A 5T0MA 5FQ8A 5KJKA 3M56A 1TJFA 3HXDA 3DSXA 1FCHA 4QQIA 4HRNA 4GMLA 2IF4A 4UWGA 4L1BA 3F9XA 3RU0A 2EINE 1TR4A 5HKPA 3UT8A 1D9SA 3M57A 3NB2A 5LSXA 3UTMA 2DZNA 4IN3B 3V2XA 5ANRA 2WM9A 2XGMA 1E8ZA 5CPRB 4R7LA 1X81A 4JHKA 3LS8A 3QDNA 2WXNA 4U0SA 3UM0A 2XGSA 5CEDB 3CVUA 1H6OA 5H7PA 3RK6A 1OCZE 3IEGA 5FQ6A 4J8EA 3Q7FA 3RO3A 3FU3A 3U64A 3UT4A 2KZTB 3R9MA 3DB5A 1UJJA 4YPEA 3LDZA 3C3QA 3KAEA 4IYPA 1N6CA 1U2VG 1IXVA 1MX6A 3UINC 3MGBA 1FVFA 4AP2A 1MQSA 2VSYA 3CVPA 3N71A 2ETBA 3ZYKA 1BI8B 1Z3XA 2P58C 1WDYA 3VTYA 5CBOA 4GA1A 1QZ2A 2Y4UA 4LNUD 1Z5SC 5ENPD 5EYPF 3WXXA 4ILHB 1EYHA 3FUKA 5ARGA 2X6HA 2NC9A 3LXUX 4I6GA 3K5KA 2GRNB 1UN9A 5ARFA 3LY9A 4XKBA 3AS8A 1JCRA 3FP3A 2XZDG 4L9PA 2VSNA 3ASHA 3CEQA 4CT0A 4EPZA 5CCLA 1TN7A 1UG3A 3RKVA 1EF1C 2J09A 3MKQA 3E30A 3CR3A 4GMJA 3HHMA 4J7WA 3NQPA 2R59A 1OCOE 4JHJA 1XNFA 2R3AA 4WWPA 3FH8A 4GTPA 4Q69A 3G2VA 4IRUA 2GRMA 4HLEA 3D9HA 3LVRE 4AJWA 1EPUA 4KZCA 1E8XA 2XZTG 3OS5A 1YYHA 3C5RA 4EECA 4BUPA 2C2LA 5JMND 3JQ0A 4J8SA 4DX6D 5JINA 1P5QA 3FTVA 2V8SE 2X6FA 2DYSE 2AXVA 4HQDA 3DEOA 3DXKG 4PS8A 1TNUA 2IONA 3GZSA 4ACLA 1TEZA 4MI5A 2QYJA 1KLXA 3B95A 4DX2A 2WB2A 3ULYA 4A1SA 5BV0A 3LJ3A 5CMWA 3D9MA 3U3WA 3F9YA 4FLBA 3ULQA 1Y6IA 5ENQD 4BEPA 4XKCA 2X6KA 4QFVA 1IYGA 3EHRA 1Q2ZA 5CECB 3ULEG 4GPKA 3EU5A 4GTTA 4FULA 3X2QE 3B13A 3JYSA 5G55A 2ZGDA 2KM4A 3EP0A 4HORA 5LP0A 3KMAA 3M5AA 1N4PA 2BEDA 1QNFA 2KATA 3PS6A 2KXPC 4GYOA 4JL0A 4WUYA 4Z68A 5KJMA 4BSZB 5JIYA 4CEMA 5G05C 3LVQE 2OVFA 4L23A 2KCVA 3TWTA 3ZN3A 2GGFA 3IKOB 4DI3A 3AG4E 3CVYA 2RKKA 1BLXB 4L2LA 3QWVA 3M59A 4GU5A 4YDYA 4TUMA 2GRQB 3RJVA 3JUIA 3PE3A 2J08A 2CFUA 3DBSA 2MYOA 1N95A 3MO2A 2PM6A 2L9BA 3APDA 2P9NG 4APOA 3TWWA 3BO5A 4QENA 2P9UG 2ONDA 2J9QA 4QEOA 3CKCA 1NA0A 3HVEB 2P9KG 5BV1A 1E96B 1KZOA 2IU1A 5CERB 3C3RA 4A1GA 5EX3A 4IULA 5BW8C 4B94A 5IY5E 3ZUVB 3CHOA 4JPSA 5C1DA 5LFAA 4NIKA 2LSVA 3KSLA 1N11A 3BEEA 3D9IA 2HM8A 2WXJA 1N3JA 3ABME 3DSSA 3JXIA 4BERA 4GCOA 3U9WA 4XX5A 5CBNA 4AU7A 4I51A 2YNQA 4UUCA 4L7TA 1H6PA 3PNTB 3ZKJA 3PVLA 2XPZA 1RZ4A 2J8SD 5G04C 2LO6A 2IY0C 2ILRA 3AG1E 2MOWA 1MZCA 4AY6A 3PH0C 4JC8A 3TL5A 3D9KA 5FZRA 3L16A 1TNYA 2DCPA 3RRNB 3ABLE 3MZLB 4YVOA 4EHMA 3U4TA 1E90A 2KC7A 3CK9A 5FT9A 3O48A 3HVEA 4WNEA 1H2TC 3HRAA 3PEVB 3B7RL 3G2TA 3TWXA 4ILGA 2R2LA 3UUXA 1SA4A 2BTDA 4A3TA 3UIPC 4YNPA 5T8IA 2F8YA 1BD8A 4AXHA 1Z3YA 1KT1A 4G24A 2RFIA 2KCKA 3ZHEA 3DALA 3AJIA 4HRMB 4WAFA 4CDMA 3OPEA 3KS2A 2LAIA 4ACKA 4MKTA 2FBNA 3NZSA 4H7XA 2XENA 4RG9A 4ZFHA 3TXMA 4RG6A 1TN8A 3PREA 2JABA 3ZW3A 2FO1E 3NF1A 4NRHB 2R17C 3PZ2A 2MRIA 1OWLA 2RD0A 4D10C 4EZLA 2P2CP 5JJ6A 1MHQA 3S7DA 1N4QA 1OWOA 4I2WA 4GTQA 3GZ2A 4FMUA 4HLLA 4CGWA 1HG5A 4NURA 2XQ0A 2PM7A 4PUCA 2X6JA 4BFRA 4F6RD 5AARA 1NZNA 2EIJE 2HO1A 3FFLA 4CDNA 1A17A 4HRLA 2ZXWE 5EDSA 3V79K 5TEGA 3MKQB 2UWJG 4N2SA 4MRUA 3QK0A 4KYOB 1K3ZD 3BQOA 3FU5A 2O8JA 5F6LA 1E8WA 3CHQA 2I6HA 5ITZF 1ZKKA 2C0MA 1NP7A 3OAWA 3Q75A 4JLGA 3DEPA 4APFA 3CLJA 2P9SG 4J8FA 4DX1A 4IJ8A 3L6AA 2R5SA 2ZU6B 3ML9A 2DZOA 4F1SA 2P9PG 3EUVA 2WXQA 5G2NA 3CSFA 2A5UA 3I4GA 4AV7A 2B6CA 1N0QA 2BUGA 5FTPA 3IXEA 2JEKA 2IJGX 1N4SA 3ZEFA 2VYIA 3CBPA 3EIJA 4U95D 3B7TA 3M58A 3DPYA 5A23A 4NACA 3SGHA 4FC8A 4B93B 1H0AA 4LDGA 3ESLA 5JJ7A 3ZYMA 2BQZA 1JCSA 2Y3AA 3L82A 3OXFA 3FH5A 2F69A 1O1RA 4Q96A 3C72A 4UWFA 3CV0A 2WXKA 4RSYA 1HXIA 4WWNA 2XCBA 4LRZA 3FHEA 4OVUA 3CVXA 3B7SA 5G05J 3RQ4A 3ZXSA 3UQ3A 2ZGGA 4HXIA 3ML8A 2WXLA 1BI7B 3F9ZA 3Q9NC 2WXFA 4E47A 5FZSA 2PZIA 4HOUA 2IGQA 5KJNA 4XZ4A 2J07A 2RG8A 1HU3A 3F6QA 4N2QA 1S0PA 3Q73A 3KMTA 3ONKA 3AS4A 3W9GA 3ZGQA 1MVXA 4J7IA 3CIAA 1YA0A 1HZ4A 3ISMC 4CGVA 4C0MA 4W9RA 2X6IA 2WVIA 2UY1A 1NI1A 3L17A 3IV0A 5F59A 4E85A 3S8PA 1V55E 2H6IA 3URZA 1H2UA 2YHCA 2OOEA 1ELRA 4CZ2D 5HRYA 2CG2A 3UX4A 2KCLA 2YQ8A 2AXUA 3NOCD 1ZU2A 4G25A 5FZQA 2WXIA 4FADA 4G26A 1E8YA 3B7UX 1FT1A 4ZHBA 4N3BA 4DX7D 4AVXA 4A3VA 4FHKA 4J8OA 5EYLA 5FWQA 3DSUA 4AIFA 2AW6A 2WQ6A 3BU8A 1O1TA 4YVQC 4GB9A 4IJDA 2Y4TA 4PS3A 5D66A 1MYOA 3EHNA 5LX8A 3FUNA 4TRQA 5CEAA 5DIZA 1LTXA 5LSZA 3RJWA 4BX8A 3MCXA 3ZYLA 2LAHA 4UWKA 5BUZA 4EBAG 2FULA 2AWIA 3T8MA 2VSXE 2GROB 3JQ1A 2WQ7A 4HOSA 3CVVA 3E32A 1WM5A 2DVWA 3FPDA 4GTSA 1RW2A 4NQ0A 3UM2A 3TJPA 3CHRA 3J5QB 3CHSA 4DLQA 3FUEA 2E0IA 2I1JA 3O4ZA 4GA2A 4HS2A 2BKKB 2LXMA 1L5JA 4GYWA 1PEGA 2W5ZA 1TNOA 1ZBPA 2KBXA 3PUKA 4DPRA 2OEWA 2E2EA 5JJ0A 5CRVA 4U8VD 1K1BA 2Y69E 1TJCA 2I1KA 3Q9UC 1NA3A 4U96D 5E76A 3IHYA 2UY1B 2LSUA 3FEYA 3GYZA 4HOQA 3FUMA 1E7VA 4TXRA 3FULA 1MX4A 3LCAA 5LCWJ 3ASNE 2LXLA 4I17A 2WMOA 3WG7E 5T5GA 3LY7A 3UM1A 1PC2A 4U0ZA 2H6FA 3CBOA 4DI4A 4B8AA 1DCEA 4G8LA
chains in the Genus database with same CATH topology
4F53A 3OPEA 3KS2A 3CQCB 5FQ4A 2CG3A 5JJTA 2LAIA 4WNGA 4ACKA 1INZA 4MKTA 2FBNA 3NZSA 4H7XA 3PDNA 2CHZA 4TUUA 4YNDA 4RG9A 2XGOA 4BY6A 5JHNA 3TXMA 4GZCA 2Q7FA 4JA7A 3MYVA 4PS7A 4RG6A 4BT9A 2GRLA 1IQRA 3ZYQA 2J49A 1IQUA 1DVPA 2WMNA 3D9JA 2DBAA 3PREA 4FU3A 5ANLA 3R7QA 4ATGA 4J8DA 1MUFA 5T0MA 3ZW3A 5FQ8A 1BPOA 3NF1A 5D0QD 2PQNA 4B0ZA 4RVBA 4NRHB 1H6KA 5KJKA 4KVMA 5FJYA 2R17C 2V4LA 3I3NA 2MRIA 1OWLA 2RD0A 4D10C 3M56A 4EZLA 3SFZA 1U3CA 2FF4A 5JJ6A 3PE4A 1MHQA 3VUZA 3QC1A 3SF4A 5ENNA 2L0TB 3S7DA 1TJFA 1OWOA 1FCHA 4U0UA 4ABNA 4PDXA 4GCNA 2XRYA 4C0EA 4GMLA 2IF4A 4ANWA 4WNDA 2AXZA 4LERA 5J90A 3FUIA 4I2WA 2JLBA 4UWGA 5G04J 4L1BA 3UT7A 3MO0A 3F9XA 2NSZA 3GZ2A 3RU0A 4FMUA 3QKYA 4A55A 3UT8A 1HS6A 3OXGA 3MEKA 3NZUA 4CGWA 1HG5A 2VGYA 3FU0A 5BT1A 3M57A 4XI0A 3D9OA 5LSXA 3JCKC 4NURA 3ASDA 4I1AA 1SQMA 3FU6A 4IN3B 2XQ0A 2PM7A 1HG2A 4PUCA 5ANRA 4N5CA 2WM9A 2XGMA 5AYWD 2X6JA 1E8ZA 4KT6B 1JUQA 4BFRA 5CPRB 1NZNA 2J4BA 4CDNA 2HO1A 3FFLA 4R7LA 4JHKA 3LS8A 3QDNA 1A17A 2WXNA 4O30A 4U0SA 4N3CA 2XGSA 3QJZA 3CVUA 3FEXA 3FTWA 3RK6A 5EDSA 3IEGA 5TEGA 5FQ6A 4J8EA 3MKQB 3RO3A 2UWJG 4N2SA 4PH4B 4MRUA 3FU3A 3QK0A 4KYOB 3U64A 3UT4A 2KZTB 1N54A 3KMJA 3DB5A 1JPLA 1OWMA 3ZPJA 1UJJA 4YPEA 1Y8MA 3AU5A 3LDZA 3FU5A 4C9BB 3S7JA 2O8JA 3KAEA 5F6LA 4IYPA 1N6CA 5LCWC 1E8WA 1SZAA 3CHQA 3ESKA 2I6HA 3ONLA 4K0RA 5D0OD 4F7AA 1ZKKA 1UN8A 3MGBA 1FVFA 2C0MA 2M63A 3CVQA 3SZ7A 1NP7A 3OAWA 4AP2A 4EZKA 4U63A 4JLGA 2CFZA 4GZDA 3IHXA 4APFA 3CLJA 2VSYA 1MQSA 3CVPA 3N71A 4J8FA 3Q15A 4BSXA 2I2OA 4IJ8A 3L6AA 2R5SA 3ZYKA 3F9WA 1Z3XA 2ZU6B 2P58C 3S7BA 3ML9A 4BX9A 1OWPA 5EX0A 2YINA 5E75A 4F1SA 3FTSA 5A6CA 5DBKA 3VTYA 2JV0A 3SW9A 4GZ5A 4E6HA 2PQRA 2VGXA 3OXLA 2WXQA 5G2NA 3CSFA 4GA1A 2A5UA 1HE8A 3I4GA 1QZ2A 2Y4UA 4U07A 4AV7A 3ZRHA 1JWFA 4JEUA 3LPZA 4G23A 4Z4PA 3WXXA 4ILHB 2VJ8A 1EYHA 2BUGA 3L54A 3FUKA 5FTPA 2A4ZA 5ARGA 2X6HA 2NC9A 2JEKA 3LXUX 4I6GA 3K5KA 3K9IA 2IJGX 3ZEFA 2VYIA 3CBPA 3CHMA 2J4DA 3EIJA 3AU4A 3M55A 3RAYA 2XRZA 1UN9A 4Q94A 1MVHA 5ARFA 3B7TA 3LY9A 3M58A 4BTBA 4XKBA 3FTZA 1H3IA 3AS8A 3FP3A 5A23A 2WPVA 3P1UA 4KBQA 4NACA 3Q5MA 3SGHA 4FC8A 5A7DB 1H0AA 4LDGA 3ESLA 2EQXA 2VSNA 3S2AA 1O9SA 5JJ7A 3ASHA 3EJNA 3CEQA 3ZYMA 2BQZA 2Y3AA 3ZFWA 2NXPA 4CT0A 4EPZA 5CCLA 4WNFA 3OXFA 5M72A 3U66A 1UG3A 3FH5A 3FUFA 3KEZA 3RKVA 4KZ0A 1EF1C 2J09A 3G2SA 2F69A 4I9CA 3MKQA 5EG2A 4Q96A 1OWNA 3MA5A 4UWFA 3CR3A 3FTUA 3HHMA 4GMJA 3CV0A 2WXKA 4RSYA 2HYZA 4GAAA 1X5BA 5BPPA 3NQPA 1HXIA 2R59A 4JHJA 4WWNA 2XCBA 2WXGA 3TAXA 4LRZA 2VTBA 1XNFA 1SZ9A 3FHEA 2R3AA 4WWPA 3FH8A 4EZJA 4OVUA 4G1TA 4Q69A 3CVXA 5KJLA 3CBMA 3B7SA 5JHBA 3G2VA 3VV0A 3MV3B 5G05J 3RQ4A 4AEZC 2VQ2A 3UQ3A 3VTXA 2WXOA 3FUJA 3ZXSA 4IRUA 3FDHA 4HXIA 4FJZA 3CK7A 2GRMA 4HLEA 3ML8A 2WXLA 2CHWA 3LVRE 4AJWA 2W5YA 1EPUA 4JA9A 4KZCA 2QFCA 3VLDA 3F9ZA 4JHRA 1E8XA 5LOZA 3OS5A 2WXFA 3QOUA 2GW1A 4QEOA 4EBAA 4EECA 4E47A 5FZSA 4BUPA 2C2LA 2PZIA 3Q4AB 4I6JA 4JXTA 4HOUA 2IGQA 3JQ0A 4J8SA 4FP7A 1IHGA 5JINA 1P5QA 3FTVA 2L0IA 2V8SE 2X6FA 2AXVA 4M3OA 4XI9A 5KJNA 2C0LA 4XZ4A 2G46A 4PS8A 2J07A 3GZSA 2IONA 2RG8A 4ACLA 1TEZA 4MI5A 1KLXA 1WAO1 1HU3A 5AJLA 2WB2A 3LKUA 4N2QA 4Y6WA 4A1SA 5BV0A 1S0PA 2WXMA 4I1OB 3KMTA 3ONKA 4EQFA 3LJ3A 5C2YA 4OYSA 3AS4A 5CMWA 4ANVA 3OOIA 1HF8A 3SHFA 3ZGQA 3D9MA 1MVXA 4J7IA 3VLEA 3U3WA 4ILIA 3CIAA 1Z6TA 3QWWA 5HQ8A 3F9YA 5AYFA 4QEPA 4FLBA 3ULQA 1YA0A 1HZ4A 3ASFA 3FWVA 3UMVA 4CGVA 2FEZA 2IQCA 4TV3A 4C0MA 1Y6IA 3OTNA 3QARA 4JDSA 4W9RA 2X6IA 4DK5A 2WVIA 3L13A 4XKCA 4JVSA 4J7FA 2X6KA 4YNMA 1ML9A 1PAQA 2UY1A 4QFVA 2BF0X 1IYGA 3L17A 3IV0A 4UQYA 5EKQD 4JZYA 3URZA 1U3DA 3HYMB 3S7FA 4E85A 5J08A 1H2UA 4MI0A 2KZTA 1KT0A 4JEHA 1MT6A 2YHCA 2IOLA 3D9LA 4GPKA 2OOEA 3T5XA 3T5VA 1ELRA 4O6FA 1N6AA 2CG2A 4FULA 3BG1B 4BWRA 4KMOA 3PRZA 3UX4A 2KCLA 3B13A 2YQ8A 2AXUA 2FO7A 3JYSA 1QQEA 5G55A 3D3MA 4MLPA 3RRUA 2KM4A 1ZU2A 4G25A 3LEWA 4J0UA 2WXPA 4HORA 3EP0A 2QPWA 5FZQA 4UI9K 4ANXA 5LP0A 3KMAA 3M5AA 3ASGA 2WXIA 1QNFA 2HR2A 1UJKA 2KATA 1EDUA 3PS6A 4FADA 2DIWA 4G26A 1E8YA 3ENEA 2VTBB 3B7UX 4GYOA 4JL0A 2XPIA 1VDYA 4WUYA 5TH7A 5CHEE 5AJDA 5KJMA 4J83A 1B89A 5JIYA 4KXKB 3HIZA 1XQHA 3MO5A 4H7YA 5F6KC 4CEMA 4J6IA 4YPAA 5G05C 3Q49B 3L22A 4I2ZA 3MKRA 3GZ1A 3LVQE 2OVFA 4I43A 3R7RA 3TG4A 4ANUA 4N3BA 4L23A 3FUDA 3GW4A 4AVXA 3CVLA 4A3VA 3D9NA 2KCVA 3ZN3A 4FHKA 2GGFA 3QWPA 2X38A 1ELKA 2AVPA 3QNKA 3IKOB 3ZIMA 4DJAA 4J8OA 5CCMA 4DI3A 3CVNA 5FWQA 5T4YA 1DNPA 4AIFA 5T0KA 2I9CA 3M54A 5FQ7A 2AW6A 2XEVA 4JW1A 2IFUA 2WQ6A 3CHPA 3R9AB 3CVYA 5T3RA 3SBTB 4L2LA 3QWVA 3M59A 4GU5A 2X3MA 4YVQC 4GB9A 4IJDA 3CK8A 4ME2A 2LNIA 3FY4A 2Y4TA 3SBSA 2PL2A 4PS3A 5AIJA 3RJVA 3PUJA 3EHNA 5LX8A 3FUNA 3JUIA 3PE3A 4TRQA 4URKA 3G2WA 3MX3A 2J08A 2VSOE 2CFUA 5DIZA 3DBSA 5LSZA 4H12A 3VLFA 3RJWA 3IBEA 4GA0A 3ZHEB 3FH7A 4BX8A 4UWHA 3MO2A 2PM6A 4FLHA 3TGOA 1H19A 3DPDA 2L9BA 3APDA 3MCXA 3PEUB 3ZYLA 2LAHA 4APOA 3CQGB 4CDRA 3APCA 2IOSA 3BO5A 4I9EA 4QENA 4UWKA 4CT4A 4C1QA 2XPYA 2ONDA 5BUZA 2J9QA 3UPVA 4EBAG 5F59A 3CKCA 1N52A 2FULA 4OVVA 2AWIA 3QAQA 3T8MA 1NA0A 3HVEB 4G11A 2VSXE 2V5FA 3JQ1A 3RIBA 5BV1A 1E7UA 1UW4B 4XIFA 4G2VA 2WQ7A 2WXRA 1E96B 4CRWA 2IU1A 4HOSA 3FTXA 3CVVA 2V0PA 1WM5A 2FI7A 4A1GA 3L08A 3PZDA 3FPDA 3D9PA 3EIQC 4UQXA 5EX3A 4IULA 3AS5A 4K03A 1GW6A 3IHVA 5BW8C 4B94A 4NQ0A 3FTYA 3TJPA 3CHOA 3SI5A 3CHRA 1HFAA 4JPSA 4AM9A 3CHSA 5C1DA 5LFAA 4DLQA 2OVBA 3FUEA 2E0IA 2LSVA 3G2UA 3D9IA 3BEEA 3KD7A 2HM8A 1HO8A 2I1JA 2WXJA 3O4ZA 4GA2A 4HS2A 4AY5A 5BNWA 3APFA 4NJ5A 4BTAA 4LEUA 3TG5A 5KCMA 1L5JA 4GYWA 5CMYA 4MS6A 1PEGA 4BT8A 1N3JA 5F5EA 2W5ZA 3RRMB 3MV2B 1ZBPA 2XHEA 4I1MA 3RO2A 4GCOA 3PUKA 3CVWA 4DPRA 4XE0A 4XX5A 3U9WA 3QB2A 4KVOA 4AU7A 1XGWA 4UQZA 4LCTA 3HDXA 4UI9C 2VGXB 2YNQA 4FA6A 4I51A 1PY1A 3I5PA 3SNXA 4B89A 2E2EA 2WXHA 1LF8A 1HH8A 4L7TA 4F3VA 5JJ0A 4GZ6A 4WWOA 3PNTB 4N3AA 3EHMA 3S8PA 4UWLA 1HX8A 3PVLA 4UI9J 1TJCA 3CSTA 2CHXA 2I1KA 2XPZA 3C98A 4RZ0A 4HOTA 2XCCA 3SWCA 4B8CB 1WY6A 4U8HA 3BG0B 3M53A 5TTFA 1NA3A 4HVBA 5G04C 2LO6A 4FJYA 4CCAA 4P29A 5E76A 4FHJA 5AENA 3IHYA 2ILRA 3FUHA 2MOWA 2UY1B 2LSUA 3FEYA 3GYZA 2YHEA 3CKBA 3PH0C 4I6EA 4AOFA 4JC8A 4AY6A 4HOQA 3FUMA 4N39A 1E7VA 3Q47B 4Y6CA 3TL5A 3D9KA 5FZRA 3L16A 2L6JA 3P2BA 2DCPA 5HI7A 3RRNB 3EDTB 4NVQA 3FULA 1JWGA 3SD5A 3LCAA 3MZLB 4YVOA 4V3IA 5LCWJ 3U4TA 1E90A 4U04A 3CGHA 2KC7A 2MHKA 3CK9A 5FT9A 3O48A 3HVEA 1H2VC 1H2TC 3LY8A 4I17A 4WNEA 3PEVB 2WMOA 3PNLB 5T5GA 3B7RL 3G2TA 3LY7A 4GZ3A 1FVHA 4ILGA 3MJWA 3UUXA 2BTDA 4A3TA 1PC2A 3LYAA 3TXNA 4YNPA 4U0ZA 5T8IA 4GYYA 5JHAA 2QY7A 4AXHA 1W3BA 3CBOA 4YPUA 1ELWA 1Z3YA 4HFGA 2OV8A 1KT1A 1OUVA 2WQHA 4G24A 3E4BA 4L2YA 3ZVVA 3HNAA 4DI4A 2KCKA 3ZHEA 2RFIA 4B8AA 4LUNU 3DALA 3I4RB 4DLOA 4WAFA 4CDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPE A;  3KS2 A;  5JJT A;  4WNG A;  2FBN A;  4H7X A;  5JHN A;  3PDN A;  4YND A;  4RG9 A;  2XGO A;  4JA7 A;  2Q7F A;  4BT9 A;  4RG6 A;  1MVH A;  2DBA A;  4J8D A;  1MUF A;  5T0M A;  3NF1 A;  5D0Q D;  2PQN A;  4NRH B;  5KJK A;  5FJY A;  3M56 A;  2FF4 A;  5JJ6 A;  3PE4 A;  3VUZ A;  3SF4 A;  3S7D A;  1FCH A;  4U0U A;  4ABN A;  4GCN A;  2IF4 A;  4WND A;  4I2W A;  2JLB A;  5G04 J;  3F9X A;  3MO0 A;  3GZ2 A;  3RU0 A;  4FMU A;  3QKY A;  3OXG A;  3MEK A;  3M57 A;  4CGW A;  5BT1 A;  2VGY A;  4XI0 A;  5LSX A;  3ASD A;  4I1A A;  4IN3 B;  4N5C A;  2XGM A;  5AYW D;  5CPR B;  1NZN A;  2HO1 A;  3FFL A;  3QDN A;  1A17 A;  4O30 A;  4U0S A;  4N3C A;  2XGS A;  3IEG A;  5TEG A;  4J8E A;  3RO3 A;  2UWJ G;  4N2S A;  4KYO B;  3KMJ A;  3DB5 A;  3ZPJ A;  4YPE A;  1Y8M A;  3S7J A;  2O8J A;  3KAE A;  5F6L A;  1N6C A;  5LCW C;  3ESK A;  2I6H A;  5D0O D;  1ZKK A;  3SZ7 A;  2C0M A;  3CVQ A;  4JLG A;  3IHX A;  2VSY A;  3CVP A;  3N71 A;  4J8F A;  3Q15 A;  4IJ8 A;  2R5S A;  3F9W A;  2P58 C;  3S7B A;  5EX0 A;  5A6C A;  5DBK A;  3VTY A;  2JV0 A;  3SW9 A;  4GZ5 A;  2PQR A;  2VGX A;  3OXL A;  4GA1 A;  4U07 A;  1QZ2 A;  2Y4U A;  3LPZ A;  4G23 A;  4Z4P A;  3WXX A;  2BUG A;  5FTP A;  5ARG A;  2NC9 A;  3K5K A;  3K9I A;  2VYI A;  3CBP A;  3M55 A;  3RAY A;  5ARF A;  3LY9 A;  3M58 A;  4BTB A;  1H3I A;  3AS8 A;  3FP3 A;  2WPV A;  4KBQ A;  3Q5M A;  5A7D B;  4LDG A;  2VSN A;  1O9S A;  5JJ7 A;  3ASH A;  3CEQ A;  2BQZ A;  3ZFW A;  5CCL A;  4WNF A;  3OXF A;  5M72 A;  3RKV A;  2F69 A;  4I9C A;  5EG2 A;  3MA5 A;  3CV0 A;  2HYZ A;  1HXI A;  2XCB A;  3TAX A;  1XNF A;  2R3A A;  4G1T A;  3CBM A;  5KJL A;  3VV0 A;  3MV3 B;  5G05 J;  3RQ4 A;  2VQ2 A;  3UQ3 A;  3CK7 A;  2W5Y A;  4JA9 A;  2QFC A;  3F9Z A;  4JHR A;  3OS5 A;  3QOU A;  2GW1 A;  4E47 A;  5FZS A;  4BUP A;  2C2L A;  2PZI A;  3Q4A B;  4HOU A;  2IGQ A;  1IHG A;  5JIN A;  1P5Q A;  4XI9 A;  5KJN A;  2C0L A;  2G46 A;  4MI5 A;  1KLX A;  1WAO 1;  3LKU A;  4N2Q A;  4Y6W A;  4A1S A;  3KMT A;  4EQF A;  3AS4 A;  3OOI A;  3ZGQ A;  1MVX A;  4J7I A;  3U3W A;  3QWW A;  5HQ8 A;  3F9Y A;  5AYF A;  4QEP A;  3ULQ A;  1YA0 A;  1HZ4 A;  3ASF A;  3FWV A;  4CGV A;  2FEZ A;  4JDS A;  4W9R A;  4J7F A;  4YNM A;  1ML9 A;  2UY1 A;  1IYG A;  3S8P A;  4UQY A;  5F59 A;  5EKQ D;  3URZ A;  3HYM B;  3S7F A;  4MI0 A;  1KT0 A;  1MT6 A;  2YHC A;  4GPK A;  2OOE A;  1ELR A;  4O6F A;  1N6A A;  4BWR A;  2KCL A;  2YQ8 A;  3JYS A;  2FO7 A;  1QQE A;  1ZU2 A;  4G25 A;  4J0U A;  4HOR A;  3EP0 A;  2QPW A;  5FZQ A;  4UI9 K;  3KMA A;  3M5A A;  3ASG A;  2HR2 A;  2KAT A;  4G26 A;  4GYO A;  4JL0 A;  2XPI A;  4WUY A;  5TH7 A;  5CHE E;  5KJM A;  4J83 A;  1B89 A;  5JIY A;  4KXK B;  1XQH A;  3MO5 A;  4H7Y A;  5F6K C;  5G05 C;  3Q49 B;  4I2Z A;  3MKR A;  3GZ1 A;  3TG4 A;  4N3B A;  3GW4 A;  3CVL A;  2KCV A;  3ZN3 A;  3QWP A;  4J8O A;  2AVP A;  5CCM A;  3CVN A;  4AIF A;  5T0K A;  3M54 A;  2XEV A;  2IFU A;  3R9A B;  3QWV A;  3M59 A;  4YVQ C;  4IJD A;  3CK8 A;  4ME2 A;  2LNI A;  2Y4T A;  2PL2 A;  3RJV A;  3PE3 A;  5DIZ A;  5LSZ A;  4H12 A;  3RJW A;  3ZHE B;  4GA0 A;  3MO2 A;  3TGO A;  4APO A;  4CDR A;  3BO5 A;  4I9E A;  4QEN A;  4C1Q A;  2OND A;  3UPV A;  2J9Q A;  4QEO A;  3CKC A;  1NA0 A;  2V5F A;  3RIB A;  4XIF A;  4G2V A;  1E96 B;  4HOS A;  1WM5 A;  2FI7 A;  3FPD A;  4UQX A;  5EX3 A;  5BW8 C;  3AS5 A;  4B94 A;  4NQ0 A;  4AM9 A;  5C1D A;  4YPA A;  2LSV A;  3KD7 A;  3BEE A;  4GA2 A;  4AY5 A;  5BNW A;  4NJ5 A;  4BTA A;  4LEU A;  3TG5 A;  4GYW A;  1PEG A;  4BT8 A;  1N3J A;  5F5E A;  2W5Z A;  3MV2 B;  1ZBP A;  3RO2 A;  4GCO A;  4AU7 A;  4UQZ A;  4UI9 C;  4I51 A;  2VGX B;  2E2E A;  4F3V A;  1HH8 A;  5JJ0 A;  4GZ6 A;  4N3A A;  4UI9 J;  4RZ0 A;  1TJC A;  3SWC A;  4HOT A;  2XCC A;  3M53 A;  5TTF A;  1NA3 A;  5G04 C;  2UY1 B;  2LSU A;  4AY6 A;  3GYZ A;  3CKB A;  4HOQ A;  4N39 A;  4Y6C A;  3Q47 B;  5FZR A;  2L6J A;  5HI7 A;  3EDT B;  4NVQ A;  3LCA A;  4YVO A;  5LCW J;  3U4T A;  4U04 A;  2KC7 A;  2MHK A;  3CK9 A;  5FT9 A;  3O48 A;  3LY8 A;  4WNE A;  4I17 A;  5T5G A;  3LY7 A;  4GZ3 A;  3UUX A;  1PC2 A;  3LYA A;  4YNP A;  4U0Z A;  4GYY A;  1W3B A;  3CBO A;  4YPU A;  1ELW A;  1KT1 A;  2WQH A;  1OUV A;  4G24 A;  3E4B A;  3HNA A;  2RFI A;  2KCK A;  3ZHE A;  3DAL A;  3VTX A; 
#chains in the Genus database with same CATH topology
 5FQ4 A;  4BY6 A;  4TUU A;  3DRA A;  2Q7F A;  4PS7 A;  5AQB A;  3D9J A;  4ATG A;  4U7E B;  1AWC B;  5AQ9 A;  1BPO A;  5D0Q D;  2QYU A;  4RVB A;  5BXO A;  1H6K A;  4KVM A;  1TN6 A;  5FJY A;  3I3N A;  3SFZ A;  3AAA C;  3PE4 A;  3VUZ A;  5ENN A;  2F0Y A;  2L0T B;  2IO2 C;  3E37 A;  4ABN A;  2XRY A;  3T9K A;  3BUA A;  4C0E A;  2AXZ A;  4LER A;  5G04 J;  2GRR B;  3MO0 A;  3OXG A;  5BT1 A;  2VGY A;  3FU0 A;  3D9O A;  2DWZ A;  3ZU7 B;  3ASD A;  1K8K G;  1SQM A;  3FU6 A;  3RSE G;  2DYR E;  3AG2 E;  1HG2 A;  4N5C A;  5AYW D;  4KT6 B;  1FPP A;  3ABK E;  2J4B A;  4O30 A;  2H6H A;  2V4H C;  4PH4 B;  5KBA A;  3KMJ A;  4TXQ A;  1N4R A;  1OWM A;  3ZPJ A;  3KSQ A;  3AG3 E;  3T8K A;  3AU5 A;  2QC9 A;  4C9B B;  1SVX A;  3S7J A;  4A63 B;  1TNB A;  3PZ3 A;  2Y1L E;  1UN8 A;  2M63 A;  3CVQ A;  2CFZ A;  3IHX A;  4BSX A;  3Q15 A;  2I2O A;  3S7B A;  4BX9 A;  1OWP A;  2YIN A;  5E75 A;  3FTS A;  5A6C A;  5DBK A;  3SW9 A;  4GZ5 A;  4E6H A;  2PQR A;  1HE8 A;  4U07 A;  3Q7A A;  4Z4P A;  2VJ8 A;  2R03 A;  3ZXP A;  1KZP A;  3K9I A;  3E34 A;  3AU4 A;  3RAY A;  3EU9 A;  4Q94 A;  2R02 A;  4HNA D;  4BTB A;  1H3I A;  2WPV A;  4CYM D;  1N9A A;  4KBQ A;  4DX5 D;  3Q5M A;  5A7D B;  2XEH A;  2EQX A;  3S2A A;  1O9S A;  3EJN A;  4G8K A;  3U66 A;  3TWR A;  3KEZ A;  3FUF A;  3G2S A;  3SFY A;  3FTU A;  5BPP A;  2WXG A;  3UKU G;  2VTB A;  2GRP B;  3CBM A;  5JHB A;  3J5P A;  3HXF A;  3FUJ A;  3FDH A;  4FJZ A;  3CK7 A;  2CHW A;  1TYQ G;  4JA9 A;  2R05 A;  3Q79 A;  1SA5 A;  2QFC A;  3VLD A;  3W9F A;  5LOZ A;  3QOU A;  3Q4A B;  4I6J A;  4JXT A;  1LD8 A;  2P9L G;  2L0I A;  4O1O A;  2WXM A;  4I1O B;  5EIB E;  4EQF A;  4ANV A;  3OOI A;  1HF8 A;  3SHF A;  3VLE A;  1S70 B;  4ILI A;  3QWW A;  5HQ8 A;  5AYF A;  3FWV A;  2FEZ A;  2IQC A;  4TV3 A;  4JDS A;  3OTN A;  3QAR A;  2XS8 A;  4J7F A;  4JVS A;  5EKQ D;  1U3D A;  3S7F A;  4MI0 A;  4JEH A;  1KT0 A;  1MT6 A;  1S64 A;  1K1A A;  3T5V A;  1N6A A;  4BWR A;  4KMO A;  3PRZ A;  1QQE A;  3D3M A;  4MLP A;  4J0U A;  2QPW A;  2IO3 C;  2HR2 A;  1EDU A;  2DIW A;  5EIL A;  4J83 A;  5JA4 D;  3MO5 A;  4K5A B;  4J6I A;  3MKR A;  4GMR A;  3SFX A;  3R7R A;  2L6B A;  2ZIR A;  3FUD A;  3GW4 A;  3DST A;  3CVL A;  3D9N A;  3ZIM A;  4YDE A;  3QNK A;  5CCM A;  2RFA A;  5T0K A;  2I9C A;  3M54 A;  4JW1 A;  2IFU A;  3CHP A;  3SBT B;  3PZ1 A;  5B1B E;  4ME2 A;  2LNI A;  2PL2 A;  5AIJ A;  4URK A;  4GTV A;  3G2W A;  1O5M A;  3HG0 D;  4H12 A;  3V2O A;  3IBE A;  3ZHE B;  4K5B A;  1MJ0 A;  3TGO A;  1H19 A;  2V5Q C;  3DPD A;  3HXB A;  3PEU B;  4TXP A;  3CQG B;  4CDR A;  1SW6 A;  2IOS A;  4CT4 A;  4C1Q A;  4OVV A;  1N52 A;  3B7B A;  3HXE A;  2OCC E;  3RIB A;  1E7U A;  4XIF A;  4G2V A;  2WXR A;  4CRW A;  2HE0 A;  2FI7 A;  1IHB A;  5EID A;  1GW6 A;  3IHV A;  3SI5 A;  1HFA A;  4AM9 A;  1G3N B;  4DUI A;  2OVB A;  3G2U A;  3PZ4 A;  4F7A A;  1NFI E;  3KD7 A;  4BES A;  4NJ5 A;  3APF A;  4BTA A;  4LEU A;  1A5E A;  3TG5 A;  5KCM A;  4MS6 A;  4BT8 A;  1TNZ A;  5KWD A;  3RO2 A;  2A5E A;  3CVW A;  4XE0 A;  5B1A E;  3TWS A;  4KVO A;  4UQZ A;  4UI9 C;  3SO8 A;  4B89 A;  4F3V A;  1LF8 A;  4GZ6 A;  4WWO A;  4N3A A;  3EHM A;  5HS0 A;  1HX8 A;  4UI9 J;  5BXU A;  2CHX A;  3CST A;  4RZ0 A;  4FHJ A;  5AEN A;  4DK5 A;  3CKB A;  4AOF A;  4RQI A;  4O60 A;  2L6J A;  5B3S E;  3P2B A;  5HI7 A;  4NVQ A;  2Y0B G;  2MHK A;  3PNL B;  3RAU A;  4GTM A;  4YDW A;  4GZ3 A;  3DWL G;  4BET A;  3LYA A;  3TXN A;  5JHA A;  2QY7 A;  4YPU A;  1ELW A;  1KPS B;  2EIL E;  2WQH A;  3C3O A;  4DLO A;  4F53 A;  5EN5 D;  2CG3 A;  5JJT A;  4WNG A;  1INZ A;  5JHN A;  3PDN A;  2CHZ A;  4YND A;  2XGO A;  4MBG A;  4JA7 A;  4BT9 A;  2GRL A;  1IQR A;  3ZYQ A;  3SQV A;  1IQU A;  1DVP A;  5ANL A;  3R7Q A;  2OEV A;  3E33 A;  2PQN A;  2XS1 A;  4B0Z A;  2F8X K;  3V31 A;  2V4L A;  1U3C A;  3DSW A;  2FF4 A;  3QC1 A;  3SF4 A;  3UM3 A;  4GPM A;  1UOH A;  4U0U A;  4PDX A;  4GCN A;  4LNB A;  4ANW A;  4WND A;  5J90 A;  3FUI A;  2JLB A;  3UIO C;  3UT7 A;  4OAV B;  2NSZ A;  3QKY A;  4A55 A;  5CRU A;  1HS6 A;  3MEK A;  3NZU A;  4XI0 A;  3JCK C;  4I1A A;  3DSV A;  1JUQ A;  4C48 B;  5AQ7 A;  1NL4 A;  1IKN D;  4N3C A;  3QJZ A;  3NOG D;  3FEX A;  3FTW A;  5ENT D;  1O1S A;  4YDO A;  1N54 A;  1JPL A;  4LG6 A;  1D8E A;  1Y8M A;  3KEA A;  2F37 A;  2P9I G;  5LCW C;  1SZA A;  4K0R A;  3ESK A;  3ONL A;  5D0O D;  3SZ7 A;  3UKR G;  4EZK A;  4U63 A;  4GZD A;  4HB5 A;  3F9W A;  3EHQ A;  5EX0 A;  1FT2 A;  2JV0 A;  2VGX A;  3OXL A;  1LD7 A;  3ZRH A;  1JWF A;  4JEU A;  3LPZ A;  5AAO A;  4G23 A;  3L54 A;  2ETC A;  2A4Z A;  3CHM A;  2J4D A;  3DXM G;  3M55 A;  1V54 E;  2XRZ A;  3FTZ A;  2ZIS A;  2H6G A;  3P1U A;  4OAU C;  4F1P A;  1JCQ A;  2QZA A;  3ZFW A;  2NXP A;  3JXJ A;  4WNF A;  4N5Q A;  5M72 A;  5ENR D;  2NYJ A;  4KZ0 A;  4I9C A;  5FIO A;  5EG2 A;  4ATZ D;  1OWN A;  3MA5 A;  2BKG A;  1DCQ A;  2HYZ A;  4GAA A;  1X5B A;  3L9T A;  3TAX A;  1SZ9 A;  4EZJ A;  4G1T A;  5KJL A;  2XEE A;  3VV0 A;  3MV3 B;  4AEZ C;  2VQ2 A;  3UI2 A;  2WXO A;  5AQA A;  2W5Y A;  2PNN A;  4JHR A;  4GTO A;  2GW1 A;  4EBA A;  5ENO D;  1ZB1 A;  4FP7 A;  1IHG A;  4XI9 A;  4M3O A;  4JD2 G;  2C0L A;  2G46 A;  1WAO 1;  5AJL A;  2IEJ A;  3LKU A;  4Y6W A;  5C2Y A;  4OYS A;  1Z6T A;  4QEP A;  3UMV A;  3ASF A;  1QYM A;  3L13 A;  4YNM A;  3HXC A;  1ML9 A;  1PAQ A;  2BF0 X;  1QBQ A;  4UQY A;  4JZY A;  3HYM B;  5J08 A;  2KZT A;  2IOL A;  3D9L A;  3V30 A;  3T5X A;  4O6F A;  3BG1 B;  4HBD A;  4HI8 A;  2FO7 A;  3RRU A;  4LNG A;  3LEW A;  2WXP A;  4ANX A;  4UI9 K;  1BU9 A;  3ASG A;  2RFM A;  1N0R A;  4HI9 A;  1UJK A;  3ENE A;  2VTB B;  2LUH A;  2XPI A;  1VDY A;  5TH7 A;  5CHE E;  5AJD A;  1B89 A;  4KXK B;  3HIZ A;  1XQH A;  4H7Y A;  5F6K C;  3NAW A;  3Q49 B;  3L22 A;  4I2Z A;  3GZ1 A;  1WG0 A;  4I43 A;  3TG4 A;  3SY2 A;  4ANU A;  3QWP A;  2X38 A;  1ELK A;  2AVP A;  4DJA A;  2B0O E;  3CVN A;  5T4Y A;  1DNP A;  3Q78 A;  5FQ7 A;  2XEV A;  4K5C A;  3R9A B;  5T3R A;  2X3M A;  3CK8 A;  3FY4 A;  3SBS A;  3PUJ A;  3TWU A;  5ENS D;  2VGE A;  3MX3 A;  2VSO E;  3VLF A;  4GA0 A;  3FH7 A;  4UWH A;  4FLH A;  4JB8 P;  3APC A;  3ASO E;  4I9E A;  2XPY A;  4DRX E;  3UPV A;  3QAQ A;  4G11 A;  3LJN A;  2V5F A;  1UW4 B;  3FTX A;  5KNH D;  3UXG A;  2AJA A;  2V0P A;  1S63 A;  2EIM E;  3L08 A;  3PZD A;  1YCS B;  3D9P A;  3EIQ C;  2EIK E;  4UQX A;  4K03 A;  3AS5 A;  3FTY A;  4YPA A;  5KNG A;  1HO8 A;  4AY5 A;  5BNW A;  5D2M C;  5CMY A;  5F5E A;  3RRM B;  3MV2 B;  2XHE A;  4I1M A;  3QB2 A;  1XGW A;  4LCT A;  3HDX A;  4FA6 A;  2VGX B;  1PY1 A;  4XEI G;  3I5P A;  3SNX A;  2WXH A;  4M7C A;  1HH8 A;  3NBN B;  3ZNG A;  3JUE A;  4UWL A;  5AN8 A;  3TWV A;  3C98 A;  3SWC A;  4HOT A;  2XCC A;  4B8C B;  1WY6 A;  4U8H A;  3BG0 B;  3M53 A;  5TTF A;  4HVB A;  4FJY A;  4CCA A;  4P29 A;  3FUH A;  4I6E A;  2YHE A;  5FIN A;  4N39 A;  4Y6C A;  3Q47 B;  4O1P A;  3EDT B;  1JWG A;  3SD5 A;  4J8Y A;  4V3I A;  4U04 A;  1OT8 A;  3CGH A;  1OXJ A;  1OY3 D;  1H2V C;  3LY8 A;  2ETA A;  1N94 A;  1FVH A;  3MJW A;  4X8Q A;  4GYY A;  3TWQ A;  1W3B A;  4HFG A;  2OV8 A;  1OUV A;  4L2Y A;  3E4B A;  3ZVV A;  1YMP A;  3HNA A;  4LUN U;  3I4R B;  3VTX A;  3CQC B;  1D8D A;  1MX2 A;  1OCC E;  4LSZ E;  1OCR E;  4GTR A;  4GZC A;  3MYV A;  2J49 A;  4RLY A;  2WMN A;  1MVH A;  2DBA A;  4FU3 A;  4U8Y D;  4J8D A;  1MUF A;  1AP7 A;  1DC2 A;  5T0M A;  5FQ8 A;  5KJK A;  3M56 A;  1TJF A;  3HXD A;  3DSX A;  1FCH A;  4QQI A;  4HRN A;  4GML A;  2IF4 A;  4UWG A;  4L1B A;  3F9X A;  3RU0 A;  2EIN E;  1TR4 A;  5HKP A;  3UT8 A;  1D9S A;  3M57 A;  3NB2 A;  5LSX A;  3UTM A;  2DZN A;  4IN3 B;  3V2X A;  5ANR A;  2WM9 A;  2XGM A;  1E8Z A;  5CPR B;  4R7L A;  1X81 A;  4JHK A;  3LS8 A;  3QDN A;  2WXN A;  4U0S A;  3UM0 A;  2XGS A;  5CED B;  3CVU A;  1H6O A;  5H7P A;  3RK6 A;  1OCZ E;  3IEG A;  5FQ6 A;  4J8E A;  3Q7F A;  3RO3 A;  3FU3 A;  3U64 A;  3UT4 A;  2KZT B;  3R9M A;  3DB5 A;  1UJJ A;  4YPE A;  3LDZ A;  3C3Q A;  3KAE A;  4IYP A;  1N6C A;  1U2V G;  1IXV A;  1MX6 A;  3UIN C;  3MGB A;  1FVF A;  4AP2 A;  1MQS A;  2VSY A;  3CVP A;  3N71 A;  2ETB A;  3ZYK A;  1BI8 B;  1Z3X A;  2P58 C;  1WDY A;  3VTY A;  5CBO A;  4GA1 A;  1QZ2 A;  2Y4U A;  4LNU D;  1Z5S C;  5ENP D;  5EYP F;  3WXX A;  4ILH B;  1EYH A;  3FUK A;  5ARG A;  2X6H A;  2NC9 A;  3LXU X;  4I6G A;  3K5K A;  2GRN B;  1UN9 A;  5ARF A;  3LY9 A;  4XKB A;  3AS8 A;  1JCR A;  3FP3 A;  2XZD G;  4L9P A;  2VSN A;  3ASH A;  3CEQ A;  4CT0 A;  4EPZ A;  5CCL A;  1TN7 A;  1UG3 A;  3RKV A;  1EF1 C;  2J09 A;  3MKQ A;  3E30 A;  3CR3 A;  4GMJ A;  3HHM A;  4J7W A;  3NQP A;  2R59 A;  1OCO E;  4JHJ A;  1XNF A;  2R3A A;  4WWP A;  3FH8 A;  4GTP A;  4Q69 A;  3G2V A;  4IRU A;  2GRM A;  4HLE A;  3D9H A;  3LVR E;  4AJW A;  1EPU A;  4KZC A;  1E8X A;  2XZT G;  3OS5 A;  1YYH A;  3C5R A;  4EEC A;  4BUP A;  2C2L A;  5JMN D;  3JQ0 A;  4J8S A;  4DX6 D;  5JIN A;  1P5Q A;  3FTV A;  2V8S E;  2X6F A;  2DYS E;  2AXV A;  4HQD A;  3DEO A;  3DXK G;  4PS8 A;  1TNU A;  2ION A;  3GZS A;  4ACL A;  1TEZ A;  4MI5 A;  2QYJ A;  1KLX A;  3B95 A;  4DX2 A;  2WB2 A;  3ULY A;  4A1S A;  5BV0 A;  3LJ3 A;  5CMW A;  3D9M A;  3U3W A;  3F9Y A;  4FLB A;  3ULQ A;  1Y6I A;  5ENQ D;  4BEP A;  4XKC A;  2X6K A;  4QFV A;  1IYG A;  3EHR A;  1Q2Z A;  5CEC B;  3ULE G;  4GPK A;  3EU5 A;  4GTT A;  4FUL A;  3X2Q E;  3B13 A;  3JYS A;  5G55 A;  2ZGD A;  2KM4 A;  3EP0 A;  4HOR A;  5LP0 A;  3KMA A;  3M5A A;  1N4P A;  2BED A;  1QNF A;  2KAT A;  3PS6 A;  2KXP C;  4GYO A;  4JL0 A;  4WUY A;  4Z68 A;  5KJM A;  4BSZ B;  5JIY A;  4CEM A;  5G05 C;  3LVQ E;  2OVF A;  4L23 A;  2KCV A;  3TWT A;  3ZN3 A;  2GGF A;  3IKO B;  4DI3 A;  3AG4 E;  3CVY A;  2RKK A;  1BLX B;  4L2L A;  3QWV A;  3M59 A;  4GU5 A;  4YDY A;  4TUM A;  2GRQ B;  3RJV A;  3JUI A;  3PE3 A;  2J08 A;  2CFU A;  3DBS A;  2MYO A;  1N95 A;  3MO2 A;  2PM6 A;  2L9B A;  3APD A;  2P9N G;  4APO A;  3TWW A;  3BO5 A;  4QEN A;  2P9U G;  2OND A;  2J9Q A;  4QEO A;  3CKC A;  1NA0 A;  3HVE B;  2P9K G;  5BV1 A;  1E96 B;  1KZO A;  2IU1 A;  5CER B;  3C3R A;  4A1G A;  5EX3 A;  4IUL A;  5BW8 C;  4B94 A;  5IY5 E;  3ZUV B;  3CHO A;  4JPS A;  5C1D A;  5LFA A;  4NIK A;  2LSV A;  3KSL A;  1N11 A;  3BEE A;  3D9I A;  2HM8 A;  2WXJ A;  1N3J A;  3ABM E;  3DSS A;  3JXI A;  4BER A;  4GCO A;  3U9W A;  4XX5 A;  5CBN A;  4AU7 A;  4I51 A;  2YNQ A;  4UUC A;  4L7T A;  1H6P A;  3PNT B;  3ZKJ A;  3PVL A;  2XPZ A;  1RZ4 A;  2J8S D;  5G04 C;  2LO6 A;  2IY0 C;  2ILR A;  3AG1 E;  2MOW A;  1MZC A;  4AY6 A;  3PH0 C;  4JC8 A;  3TL5 A;  3D9K A;  5FZR A;  3L16 A;  1TNY A;  2DCP A;  3RRN B;  3ABL E;  3MZL B;  4YVO A;  4EHM A;  3U4T A;  1E90 A;  2KC7 A;  3CK9 A;  5FT9 A;  3O48 A;  3HVE A;  4WNE A;  1H2T C;  3HRA A;  3PEV B;  3B7R L;  3G2T A;  3TWX A;  4ILG A;  2R2L A;  3UUX A;  1SA4 A;  2BTD A;  4A3T A;  3UIP C;  4YNP A;  5T8I A;  2F8Y A;  1BD8 A;  4AXH A;  1Z3Y A;  1KT1 A;  4G24 A;  2RFI A;  2KCK A;  3ZHE A;  3DAL A;  3AJI A;  4HRM B;  4WAF A;  4CDM A;  3OPE A;  3KS2 A;  2LAI A;  4ACK A;  4MKT A;  2FBN A;  3NZS A;  4H7X A;  2XEN A;  4RG9 A;  4ZFH A;  3TXM A;  4RG6 A;  1TN8 A;  3PRE A;  2JAB A;  3ZW3 A;  2FO1 E;  3NF1 A;  4NRH B;  2R17 C;  3PZ2 A;  2MRI A;  1OWL A;  2RD0 A;  4D10 C;  4EZL A;  2P2C P;  5JJ6 A;  1MHQ A;  3S7D A;  1N4Q A;  1OWO A;  4I2W A;  4GTQ A;  3GZ2 A;  4FMU A;  4HLL A;  4CGW A;  1HG5 A;  4NUR A;  2XQ0 A;  2PM7 A;  4PUC A;  2X6J A;  4BFR A;  4F6R D;  5AAR A;  1NZN A;  2EIJ E;  2HO1 A;  3FFL A;  4CDN A;  1A17 A;  4HRL A;  2ZXW E;  5EDS A;  3V79 K;  5TEG A;  3MKQ B;  2UWJ G;  4N2S A;  4MRU A;  3QK0 A;  4KYO B;  1K3Z D;  3BQO A;  3FU5 A;  2O8J A;  5F6L A;  1E8W A;  3CHQ A;  2I6H A;  5ITZ F;  1ZKK A;  2C0M A;  1NP7 A;  3OAW A;  3Q75 A;  4JLG A;  3DEP A;  4APF A;  3CLJ A;  2P9S G;  4J8F A;  4DX1 A;  4IJ8 A;  3L6A A;  2R5S A;  2ZU6 B;  3ML9 A;  2DZO A;  4F1S A;  2P9P G;  3EUV A;  2WXQ A;  5G2N A;  3CSF A;  2A5U A;  3I4G A;  4AV7 A;  2B6C A;  1N0Q A;  2BUG A;  5FTP A;  3IXE A;  2JEK A;  2IJG X;  1N4S A;  3ZEF A;  2VYI A;  3CBP A;  3EIJ A;  4U95 D;  3B7T A;  3M58 A;  3DPY A;  5A23 A;  4NAC A;  3SGH A;  4FC8 A;  4B93 B;  1H0A A;  4LDG A;  3ESL A;  5JJ7 A;  3ZYM A;  2BQZ A;  1JCS A;  2Y3A A;  3L82 A;  3OXF A;  3FH5 A;  2F69 A;  1O1R A;  4Q96 A;  3C72 A;  4UWF A;  3CV0 A;  2WXK A;  4RSY A;  1HXI A;  4WWN A;  2XCB A;  4LRZ A;  3FHE A;  4OVU A;  3CVX A;  3B7S A;  5G05 J;  3RQ4 A;  3ZXS A;  3UQ3 A;  2ZGG A;  4HXI A;  3ML8 A;  2WXL A;  1BI7 B;  3F9Z A;  3Q9N C;  2WXF A;  4E47 A;  5FZS A;  2PZI A;  4HOU A;  2IGQ A;  5KJN A;  4XZ4 A;  2J07 A;  2RG8 A;  1HU3 A;  3F6Q A;  4N2Q A;  1S0P A;  3Q73 A;  3KMT A;  3ONK A;  3AS4 A;  3W9G A;  3ZGQ A;  1MVX A;  4J7I A;  3CIA A;  1YA0 A;  1HZ4 A;  3ISM C;  4CGV A;  4C0M A;  4W9R A;  2X6I A;  2WVI A;  2UY1 A;  1NI1 A;  3L17 A;  3IV0 A;  5F59 A;  4E85 A;  3S8P A;  1V55 E;  2H6I A;  3URZ A;  1H2U A;  2YHC A;  2OOE A;  1ELR A;  4CZ2 D;  5HRY A;  2CG2 A;  3UX4 A;  2KCL A;  2YQ8 A;  2AXU A;  3NOC D;  1ZU2 A;  4G25 A;  5FZQ A;  2WXI A;  4FAD A;  4G26 A;  1E8Y A;  3B7U X;  1FT1 A;  4ZHB A;  4N3B A;  4DX7 D;  4AVX A;  4A3V A;  4FHK A;  4J8O A;  5EYL A;  5FWQ A;  3DSU A;  4AIF A;  2AW6 A;  2WQ6 A;  3BU8 A;  1O1T A;  4YVQ C;  4GB9 A;  4IJD A;  2Y4T A;  4PS3 A;  5D66 A;  1MYO A;  3EHN A;  5LX8 A;  3FUN A;  4TRQ A;  5CEA A;  5DIZ A;  1LTX A;  5LSZ A;  3RJW A;  4BX8 A;  3MCX A;  3ZYL A;  2LAH A;  4UWK A;  5BUZ A;  4EBA G;  2FUL A;  2AWI A;  3T8M A;  2VSX E;  2GRO B;  3JQ1 A;  2WQ7 A;  4HOS A;  3CVV A;  3E32 A;  1WM5 A;  2DVW A;  3FPD A;  4GTS A;  1RW2 A;  4NQ0 A;  3UM2 A;  3TJP A;  3CHR A;  3J5Q B;  3CHS A;  4DLQ A;  3FUE A;  2E0I A;  2I1J A;  3O4Z A;  4GA2 A;  4HS2 A;  2BKK B;  2LXM A;  1L5J A;  4GYW A;  1PEG A;  2W5Z A;  1TNO A;  1ZBP A;  2KBX A;  3PUK A;  4DPR A;  2OEW A;  2E2E A;  5JJ0 A;  5CRV A;  4U8V D;  1K1B A;  2Y69 E;  1TJC A;  2I1K A;  3Q9U C;  1NA3 A;  4U96 D;  5E76 A;  3IHY A;  2UY1 B;  2LSU A;  3FEY A;  3GYZ A;  4HOQ A;  3FUM A;  1E7V A;  4TXR A;  3FUL A;  1MX4 A;  3LCA A;  5LCW J;  3ASN E;  2LXL A;  4I17 A;  2WMO A;  3WG7 E;  5T5G A;  3LY7 A;  3UM1 A;  1PC2 A;  4U0Z A;  2H6F A;  3CBO A;  4DI4 A;  4B8A A;  1DCE A;  4G8L A; 
#chains in the Genus database with same CATH homology
 4F53 A;  3OPE A;  3KS2 A;  3CQC B;  5FQ4 A;  2CG3 A;  5JJT A;  2LAI A;  4WNG A;  4ACK A;  1INZ A;  4MKT A;  2FBN A;  3NZS A;  4H7X A;  3PDN A;  2CHZ A;  4TUU A;  4YND A;  4RG9 A;  2XGO A;  4BY6 A;  5JHN A;  3TXM A;  4GZC A;  2Q7F A;  4JA7 A;  3MYV A;  4PS7 A;  4RG6 A;  4BT9 A;  2GRL A;  1IQR A;  3ZYQ A;  2J49 A;  1IQU A;  1DVP A;  2WMN A;  3D9J A;  2DBA A;  3PRE A;  4FU3 A;  5ANL A;  3R7Q A;  4ATG A;  4J8D A;  1MUF A;  5T0M A;  3ZW3 A;  5FQ8 A;  1BPO A;  3NF1 A;  5D0Q D;  2PQN A;  4B0Z A;  4RVB A;  4NRH B;  1H6K A;  5KJK A;  4KVM A;  5FJY A;  2R17 C;  2V4L A;  3I3N A;  2MRI A;  1OWL A;  2RD0 A;  4D10 C;  3M56 A;  4EZL A;  3SFZ A;  1U3C A;  2FF4 A;  5JJ6 A;  3PE4 A;  1MHQ A;  3VUZ A;  3QC1 A;  3SF4 A;  5ENN A;  2L0T B;  3S7D A;  1TJF A;  1OWO A;  1FCH A;  4U0U A;  4ABN A;  4PDX A;  4GCN A;  2XRY A;  4C0E A;  4GML A;  2IF4 A;  4ANW A;  4WND A;  2AXZ A;  4LER A;  5J90 A;  3FUI A;  4I2W A;  2JLB A;  4UWG A;  5G04 J;  4L1B A;  3UT7 A;  3MO0 A;  3F9X A;  2NSZ A;  3GZ2 A;  3RU0 A;  4FMU A;  3QKY A;  4A55 A;  3UT8 A;  1HS6 A;  3OXG A;  3MEK A;  3NZU A;  4CGW A;  1HG5 A;  2VGY A;  3FU0 A;  5BT1 A;  3M57 A;  4XI0 A;  3D9O A;  5LSX A;  3JCK C;  4NUR A;  3ASD A;  4I1A A;  1SQM A;  3FU6 A;  4IN3 B;  2XQ0 A;  2PM7 A;  1HG2 A;  4PUC A;  5ANR A;  4N5C A;  2WM9 A;  2XGM A;  5AYW D;  2X6J A;  1E8Z A;  4KT6 B;  1JUQ A;  4BFR A;  5CPR B;  1NZN A;  2J4B A;  4CDN A;  2HO1 A;  3FFL A;  4R7L A;  4JHK A;  3LS8 A;  3QDN A;  1A17 A;  2WXN A;  4O30 A;  4U0S A;  4N3C A;  2XGS A;  3QJZ A;  3CVU A;  3FEX A;  3FTW A;  3RK6 A;  5EDS A;  3IEG A;  5TEG A;  5FQ6 A;  4J8E A;  3MKQ B;  3RO3 A;  2UWJ G;  4N2S A;  4PH4 B;  4MRU A;  3FU3 A;  3QK0 A;  4KYO B;  3U64 A;  3UT4 A;  2KZT B;  1N54 A;  3KMJ A;  3DB5 A;  1JPL A;  1OWM A;  3ZPJ A;  1UJJ A;  4YPE A;  1Y8M A;  3AU5 A;  3LDZ A;  3FU5 A;  4C9B B;  3S7J A;  2O8J A;  3KAE A;  5F6L A;  4IYP A;  1N6C A;  5LCW C;  1E8W A;  1SZA A;  3CHQ A;  3ESK A;  2I6H A;  3ONL A;  4K0R A;  5D0O D;  4F7A A;  1ZKK A;  1UN8 A;  3MGB A;  1FVF A;  2C0M A;  2M63 A;  3CVQ A;  3SZ7 A;  1NP7 A;  3OAW A;  4AP2 A;  4EZK A;  4U63 A;  4JLG A;  2CFZ A;  4GZD A;  3IHX A;  4APF A;  3CLJ A;  2VSY A;  1MQS A;  3CVP A;  3N71 A;  4J8F A;  3Q15 A;  4BSX A;  2I2O A;  4IJ8 A;  3L6A A;  2R5S A;  3ZYK A;  3F9W A;  1Z3X A;  2ZU6 B;  2P58 C;  3S7B A;  3ML9 A;  4BX9 A;  1OWP A;  5EX0 A;  2YIN A;  5E75 A;  4F1S A;  3FTS A;  5A6C A;  5DBK A;  3VTY A;  2JV0 A;  3SW9 A;  4GZ5 A;  4E6H A;  2PQR A;  2VGX A;  3OXL A;  2WXQ A;  5G2N A;  3CSF A;  4GA1 A;  2A5U A;  1HE8 A;  3I4G A;  1QZ2 A;  2Y4U A;  4U07 A;  4AV7 A;  3ZRH A;  1JWF A;  4JEU A;  3LPZ A;  4G23 A;  4Z4P A;  3WXX A;  4ILH B;  2VJ8 A;  1EYH A;  2BUG A;  3L54 A;  3FUK A;  5FTP A;  2A4Z A;  5ARG A;  2X6H A;  2NC9 A;  2JEK A;  3LXU X;  4I6G A;  3K5K A;  3K9I A;  2IJG X;  3ZEF A;  2VYI A;  3CBP A;  3CHM A;  2J4D A;  3EIJ A;  3AU4 A;  3M55 A;  3RAY A;  2XRZ A;  1UN9 A;  4Q94 A;  1MVH A;  5ARF A;  3B7T A;  3LY9 A;  3M58 A;  4BTB A;  4XKB A;  3FTZ A;  1H3I A;  3AS8 A;  3FP3 A;  5A23 A;  2WPV A;  3P1U A;  4KBQ A;  4NAC A;  3Q5M A;  3SGH A;  4FC8 A;  5A7D B;  1H0A A;  4LDG A;  3ESL A;  2EQX A;  2VSN A;  3S2A A;  1O9S A;  5JJ7 A;  3ASH A;  3EJN A;  3CEQ A;  3ZYM A;  2BQZ A;  2Y3A A;  3ZFW A;  2NXP A;  4CT0 A;  4EPZ A;  5CCL A;  4WNF A;  3OXF A;  5M72 A;  3U66 A;  1UG3 A;  3FH5 A;  3FUF A;  3KEZ A;  3RKV A;  4KZ0 A;  1EF1 C;  2J09 A;  3G2S A;  2F69 A;  4I9C A;  3MKQ A;  5EG2 A;  4Q96 A;  1OWN A;  3MA5 A;  4UWF A;  3CR3 A;  3FTU A;  3HHM A;  4GMJ A;  3CV0 A;  2WXK A;  4RSY A;  2HYZ A;  4GAA A;  1X5B A;  5BPP A;  3NQP A;  1HXI A;  2R59 A;  4JHJ A;  4WWN A;  2XCB A;  2WXG A;  3TAX A;  4LRZ A;  2VTB A;  1XNF A;  1SZ9 A;  3FHE A;  2R3A A;  4WWP A;  3FH8 A;  4EZJ A;  4OVU A;  4G1T A;  4Q69 A;  3CVX A;  5KJL A;  3CBM A;  3B7S A;  5JHB A;  3G2V A;  3VV0 A;  3MV3 B;  5G05 J;  3RQ4 A;  4AEZ C;  2VQ2 A;  3UQ3 A;  3VTX A;  2WXO A;  3FUJ A;  3ZXS A;  4IRU A;  3FDH A;  4HXI A;  4FJZ A;  3CK7 A;  2GRM A;  4HLE A;  3ML8 A;  2WXL A;  2CHW A;  3LVR E;  4AJW A;  2W5Y A;  1EPU A;  4JA9 A;  4KZC A;  2QFC A;  3VLD A;  3F9Z A;  4JHR A;  1E8X A;  5LOZ A;  3OS5 A;  2WXF A;  3QOU A;  2GW1 A;  4QEO A;  4EBA A;  4EEC A;  4E47 A;  5FZS A;  4BUP A;  2C2L A;  2PZI A;  3Q4A B;  4I6J A;  4JXT A;  4HOU A;  2IGQ A;  3JQ0 A;  4J8S A;  4FP7 A;  1IHG A;  5JIN A;  1P5Q A;  3FTV A;  2L0I A;  2V8S E;  2X6F A;  2AXV A;  4M3O A;  4XI9 A;  5KJN A;  2C0L A;  4XZ4 A;  2G46 A;  4PS8 A;  2J07 A;  3GZS A;  2ION A;  2RG8 A;  4ACL A;  1TEZ A;  4MI5 A;  1KLX A;  1WAO 1;  1HU3 A;  5AJL A;  2WB2 A;  3LKU A;  4N2Q A;  4Y6W A;  4A1S A;  5BV0 A;  1S0P A;  2WXM A;  4I1O B;  3KMT A;  3ONK A;  4EQF A;  3LJ3 A;  5C2Y A;  4OYS A;  3AS4 A;  5CMW A;  4ANV A;  3OOI A;  1HF8 A;  3SHF A;  3ZGQ A;  3D9M A;  1MVX A;  4J7I A;  3VLE A;  3U3W A;  4ILI A;  3CIA A;  1Z6T A;  3QWW A;  5HQ8 A;  3F9Y A;  5AYF A;  4QEP A;  4FLB A;  3ULQ A;  1YA0 A;  1HZ4 A;  3ASF A;  3FWV A;  3UMV A;  4CGV A;  2FEZ A;  2IQC A;  4TV3 A;  4C0M A;  1Y6I A;  3OTN A;  3QAR A;  4JDS A;  4W9R A;  2X6I A;  4DK5 A;  2WVI A;  3L13 A;  4XKC A;  4JVS A;  4J7F A;  2X6K A;  4YNM A;  1ML9 A;  1PAQ A;  2UY1 A;  4QFV A;  2BF0 X;  1IYG A;  3L17 A;  3IV0 A;  4UQY A;  5EKQ D;  4JZY A;  3URZ A;  1U3D A;  3HYM B;  3S7F A;  4E85 A;  5J08 A;  1H2U A;  4MI0 A;  2KZT A;  1KT0 A;  4JEH A;  1MT6 A;  2YHC A;  2IOL A;  3D9L A;  4GPK A;  2OOE A;  3T5X A;  3T5V A;  1ELR A;  4O6F A;  1N6A A;  2CG2 A;  4FUL A;  3BG1 B;  4BWR A;  4KMO A;  3PRZ A;  3UX4 A;  2KCL A;  3B13 A;  2YQ8 A;  2AXU A;  2FO7 A;  3JYS A;  1QQE A;  5G55 A;  3D3M A;  4MLP A;  3RRU A;  2KM4 A;  1ZU2 A;  4G25 A;  3LEW A;  4J0U A;  2WXP A;  4HOR A;  3EP0 A;  2QPW A;  5FZQ A;  4UI9 K;  4ANX A;  5LP0 A;  3KMA A;  3M5A A;  3ASG A;  2WXI A;  1QNF A;  2HR2 A;  1UJK A;  2KAT A;  1EDU A;  3PS6 A;  4FAD A;  2DIW A;  4G26 A;  1E8Y A;  3ENE A;  2VTB B;  3B7U X;  4GYO A;  4JL0 A;  2XPI A;  1VDY A;  4WUY A;  5TH7 A;  5CHE E;  5AJD A;  5KJM A;  4J83 A;  1B89 A;  5JIY A;  4KXK B;  3HIZ A;  1XQH A;  3MO5 A;  4H7Y A;  5F6K C;  4CEM A;  4J6I A;  4YPA A;  5G05 C;  3Q49 B;  3L22 A;  4I2Z A;  3MKR A;  3GZ1 A;  3LVQ E;  2OVF A;  4I43 A;  3R7R A;  3TG4 A;  4ANU A;  4N3B A;  4L23 A;  3FUD A;  3GW4 A;  4AVX A;  3CVL A;  4A3V A;  3D9N A;  2KCV A;  3ZN3 A;  4FHK A;  2GGF A;  3QWP A;  2X38 A;  1ELK A;  2AVP A;  3QNK A;  3IKO B;  3ZIM A;  4DJA A;  4J8O A;  5CCM A;  4DI3 A;  3CVN A;  5FWQ A;  5T4Y A;  1DNP A;  4AIF A;  5T0K A;  2I9C A;  3M54 A;  5FQ7 A;  2AW6 A;  2XEV A;  4JW1 A;  2IFU A;  2WQ6 A;  3CHP A;  3R9A B;  3CVY A;  5T3R A;  3SBT B;  4L2L A;  3QWV A;  3M59 A;  4GU5 A;  2X3M A;  4YVQ C;  4GB9 A;  4IJD A;  3CK8 A;  4ME2 A;  2LNI A;  3FY4 A;  2Y4T A;  3SBS A;  2PL2 A;  4PS3 A;  5AIJ A;  3RJV A;  3PUJ A;  3EHN A;  5LX8 A;  3FUN A;  3JUI A;  3PE3 A;  4TRQ A;  4URK A;  3G2W A;  3MX3 A;  2J08 A;  2VSO E;  2CFU A;  5DIZ A;  3DBS A;  5LSZ A;  4H12 A;  3VLF A;  3RJW A;  3IBE A;  4GA0 A;  3ZHE B;  3FH7 A;  4BX8 A;  4UWH A;  3MO2 A;  2PM6 A;  4FLH A;  3TGO A;  1H19 A;  3DPD A;  2L9B A;  3APD A;  3MCX A;  3PEU B;  3ZYL A;  2LAH A;  4APO A;  3CQG B;  4CDR A;  3APC A;  2IOS A;  3BO5 A;  4I9E A;  4QEN A;  4UWK A;  4CT4 A;  4C1Q A;  2XPY A;  2OND A;  5BUZ A;  2J9Q A;  3UPV A;  4EBA G;  5F59 A;  3CKC A;  1N52 A;  2FUL A;  4OVV A;  2AWI A;  3QAQ A;  3T8M A;  1NA0 A;  3HVE B;  4G11 A;  2VSX E;  2V5F A;  3JQ1 A;  3RIB A;  5BV1 A;  1E7U A;  1UW4 B;  4XIF A;  4G2V A;  2WQ7 A;  2WXR A;  1E96 B;  4CRW A;  2IU1 A;  4HOS A;  3FTX A;  3CVV A;  2V0P A;  1WM5 A;  2FI7 A;  4A1G A;  3L08 A;  3PZD A;  3FPD A;  3D9P A;  3EIQ C;  4UQX A;  5EX3 A;  4IUL A;  3AS5 A;  4K03 A;  1GW6 A;  3IHV A;  5BW8 C;  4B94 A;  4NQ0 A;  3FTY A;  3TJP A;  3CHO A;  3SI5 A;  3CHR A;  1HFA A;  4JPS A;  4AM9 A;  3CHS A;  5C1D A;  5LFA A;  4DLQ A;  2OVB A;  3FUE A;  2E0I A;  2LSV A;  3G2U A;  3D9I A;  3BEE A;  3KD7 A;  2HM8 A;  1HO8 A;  2I1J A;  2WXJ A;  3O4Z A;  4GA2 A;  4HS2 A;  4AY5 A;  5BNW A;  3APF A;  4NJ5 A;  4BTA A;  4LEU A;  3TG5 A;  5KCM A;  1L5J A;  4GYW A;  5CMY A;  4MS6 A;  1PEG A;  4BT8 A;  1N3J A;  5F5E A;  2W5Z A;  3RRM B;  3MV2 B;  1ZBP A;  2XHE A;  4I1M A;  3RO2 A;  4GCO A;  3PUK A;  3CVW A;  4DPR A;  4XE0 A;  4XX5 A;  3U9W A;  3QB2 A;  4KVO A;  4AU7 A;  1XGW A;  4UQZ A;  4LCT A;  3HDX A;  4UI9 C;  2VGX B;  2YNQ A;  4FA6 A;  4I51 A;  1PY1 A;  3I5P A;  3SNX A;  4B89 A;  2E2E A;  2WXH A;  1LF8 A;  1HH8 A;  4L7T A;  4F3V A;  5JJ0 A;  4GZ6 A;  4WWO A;  3PNT B;  4N3A A;  3EHM A;  3S8P A;  4UWL A;  1HX8 A;  3PVL A;  4UI9 J;  1TJC A;  3CST A;  2CHX A;  2I1K A;  2XPZ A;  3C98 A;  4RZ0 A;  4HOT A;  2XCC A;  3SWC A;  4B8C B;  1WY6 A;  4U8H A;  3BG0 B;  3M53 A;  5TTF A;  1NA3 A;  4HVB A;  5G04 C;  2LO6 A;  4FJY A;  4CCA A;  4P29 A;  5E76 A;  4FHJ A;  5AEN A;  3IHY A;  2ILR A;  3FUH A;  2MOW A;  2UY1 B;  2LSU A;  3FEY A;  3GYZ A;  2YHE A;  3CKB A;  3PH0 C;  4I6E A;  4AOF A;  4JC8 A;  4AY6 A;  4HOQ A;  3FUM A;  4N39 A;  1E7V A;  3Q47 B;  4Y6C A;  3TL5 A;  3D9K A;  5FZR A;  3L16 A;  2L6J A;  3P2B A;  2DCP A;  5HI7 A;  3RRN B;  3EDT B;  4NVQ A;  3FUL A;  1JWG A;  3SD5 A;  3LCA A;  3MZL B;  4YVO A;  4V3I A;  5LCW J;  3U4T A;  1E90 A;  4U04 A;  3CGH A;  2KC7 A;  2MHK A;  3CK9 A;  5FT9 A;  3O48 A;  3HVE A;  1H2V C;  1H2T C;  3LY8 A;  4I17 A;  4WNE A;  3PEV B;  2WMO A;  3PNL B;  5T5G A;  3B7R L;  3G2T A;  3LY7 A;  4GZ3 A;  1FVH A;  4ILG A;  3MJW A;  3UUX A;  2BTD A;  4A3T A;  1PC2 A;  3LYA A;  3TXN A;  4YNP A;  4U0Z A;  5T8I A;  4GYY A;  5JHA A;  2QY7 A;  4AXH A;  1W3B A;  3CBO A;  4YPU A;  1ELW A;  1Z3Y A;  4HFG A;  2OV8 A;  1KT1 A;  1OUV A;  2WQH A;  4G24 A;  3E4B A;  4L2Y A;  3ZVV A;  3HNA A;  4DI4 A;  2KCK A;  3ZHE A;  2RFI A;  4B8A A;  4LUN U;  3DAL A;  3I4R B;  4DLO A;  4WAF A;  4CDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...