4WUYA

Crystal structure of protein lysine methyltransferase smyd2 in complex with lly-507, a cell-active, potent and selective inhibitor
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
414
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKAEAIRDMVRYARNVIEEFRELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title LLY-507, a Cell-active, Potent, and Selective Inhibitor of Protein-lysine Methyltransferase SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 145
structure length 414
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4wuyA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4wuyA01
1N3JA 2PQRA 4WNFA 4E47A 1W3BA 5JHNA 3Q4AB 4YPAA 3U3WA 3LYAA 4F3VA 2Y4TA 4YVOA 3MO5A 4YNMA 3Q49B 4G1TA 3TAXA 4EQFA 3MA5A 5JJ0A 4CDRA 4ME2A 5M72A 3ASHA 3QKYA 2XGMA 5CCLA 3CBPA 5EG2A 4N2SA 5D0QD 4B94A 2GW1A 2VGXA 2BUGA 2VYIA 2VQ2A 2PL2A 2G46A 4IN3B 4LDGA 3LY9A 2LNIA 3GZ2A 4J0UA 5KJKA 3S7JA 1XQHA 5AYFA 5CHEE 3AS5A 4I2WA 3EP0A 2XGSA 3S7DA 4HOTA 3K5KA 2Q7FA 3CKCA 3RIBA 2UY1A 3ESKA 5CCMA 3TGOA 5FZSA 3CV0A 5LCWJ 3CK8A 5LSXA 4WNDA 3KMJA 2IGQA 2FF4A 3RAYA 3S7FA 4GCNA 5G05J 3M59A 3GW4A 3Q5MA 4J8DA 3QDNA 4N3CA 5A6CA 4YNDA 5ARGA 4N39A 2YQ8A 3RQ4A 3BO5A 1IYGA 5F59A 2XEVA 3LKUA 4J8EA 4J8OA 5FZQA 2VGXB 3CVPA 1KT0A 3M56A 3RJVA 4JA9A 4N3AA 2L6JA 3M5AA 1O9SA 4G24A 4Y6CA 2HR2A 3QWVA 4UI9K 1ELWA 5EX3A 1ML9A 2KC7A 3CEQA 1P5QA 3MV3B 5DBKA 2XPIA 3M53A 4O30A 3LY8A 2UWJG 2UY1B 1MT6A 3EDTB 1H3IA 3O48A 4GZ5A 1PEGA 4XIFA 4YPUA 1WM5A 4AU7A 4HOSA 2C2LA 3LY7A 3URZA 3ZHEA 3QOUA 4KYOB 4JA7A 5F6KC 4WNGA 3SF4A 3UQ3A 3TG5A 3PE3A 4QEOA 2WQHA 4UI9C 2FBNA 5FJYA 5HI7A 4GYYA 1QQEA 3Q15A 3QWWA 5G04C 3TG4A 4XI0A 2KCLA 3ZGQA 3GYZA 1N6AA 1XNFA 3MV2B 3RU0A 3CK9A 4RG9A 4BT8A 1PC2A 5KJMA 3RO2A 4GA1A 5FTPA 3M54A 1OUVA 3KS2A 5T0KA 4C1QA 3JYSA 2FO7A 2IF4A 2KATA 5LSZA 1Y8MA 4J7IA 1HZ4A 2E2EA 4U04A 2XGOA 2HO1A 3F9WA 3NF1A 4GCOA 2JV0A 2RFIA 4MI5A 4NJ5A 2LSVA 4KXKB 4J7FA 4KBQA 4GZ6A 3IHXA 4YPEA 1FCHA 3ZHEB 2OOEA 2VSYA 3OPEA 5BW8C 3VTYA 5KJNA 3SWCA 1ELRA 4G25A 2J9QA 4I1AA 5CPRB 4JHRA 1KLXA 1E96B 4BWRA 3MO2A 5JIYA 4BT9A 3LCAA 3E4BA 3CK7A 1NA3A 3ASDA 3MO0A 4I51A 4UI9J 3CVQA 4J8FA 4CGVA 3KMAA 2JLBA 3RJWA 2MHKA 4G26A 4YNPA 5G04J 2XCBA 4N2QA 1IHGA 2R3AA 1HXIA 3M55A 4UQYA 5A7DB 3IEGA 5T0MA 2YHCA 4Y6WA 2QPWA 3MKRA 3OXFA 3CBOA 4UQXA 3VV0A 1NA0A 2QFCA 5BT1A 5JJ6A 4U0UA 2WPVA 2HYZA 1HH8A 3OXGA 2NC9A 3S7BA 5TTFA 4IJ8A 4WUYA 5LCWC 2XCCA 5JJTA 3FP3A 3RKVA 3CBMA 2PQNA 3ZN3A 3FFLA 4I9CA 3WXXA 2KCVA 2VGYA 4XI9A 4I2ZA 5AYWD 4NRHB 3U4TA 4BTAA 3OOIA 3SW9A 4YVQC 3F9ZA 3M58A 4AY6A 1NZNA 1WAO1 4CGWA 3RO3A 1A17A 3PDNA 3AS8A 3ZPJA 3F9XA 4G2VA 1N6CA 2W5YA 4JL0A 4ABNA 4WNEA 4GZ3A 3M57A 2LSUA 1TJCA 5C1DA 3HNAA 3VTXA 5JJ7A 3CVLA 5DIZA 4AIFA 4AM9A 4U07A 3BEEA 2ONDA 4JLGA 5JINA 4GA0A 5EX0A 3LPZA 5BNWA 3K9IA 3FPDA 2DBAA 1ZBPA 4GPKA 2IFUA 4JDSA 4GYOA 2W5ZA 4NVQA 3GZ1A 2VSNA 3ULQA 5HQ8A 1QZ2A 2BQZA 1MVHA 3Q47B 4U0ZA 4W9RA 3PE4A 1KT1A 2R5SA 5FZRA 3UPVA 3MEKA 4QENA 2FEZA 4HORA 5F5EA 2PZIA 4H7YA 1ZKKA 2P58C 2V5FA 3UUXA 1ZU2A 3ZFWA 1MUFA 4AY5A 4HOQA 3KAEA 4LEUA 4BTBA 4H12A 3DALA 4RZ0A 4HOUA 3AS4A 2KCKA 3CKBA 4N5CA 3ASFA 2F69A 4BUPA 5TEGA 2O8JA 5T5GA 3N71A 5ARFA 3KMTA 2AVPA 4Z4PA 5TH7A 3FWVA 4G23A 4A1SA 3OXLA 2Y4UA 2C0LA 4GA2A 5EKQD 3DB5A 1B89A 5F6LA 3KD7A 4UQZA 3HYMB 2C0MA 1MVXA 4GYWA 5FT9A 3OS5A 3R9AB 5D0OD 4IJDA 4H7XA 3QWPA 4MI0A 4NQ0A 4FMUA 4I9EA 2I6HA 4N3BA 5G05C 4QEPA 3F9YA 4RG6A 4APOA 5KJLA 4U0SA 2FI7A 3S8PA 4O6FA 4J83A 1YA0A 4I17A 3CVNA 3ASGA 3VUZA 3SZ7A
chains in the Genus database with same CATH superfamily
1N3JA 5BXUA 1W3BA 5JHNA 2YINA 3NOGD 3FTZA 3MO5A 3HVEB 3MA5A 3VLDA 3Q78A 2I1KA 4CDRA 3UKRG 4FJYA 1O5MA 3DSTA 3CBPA 5EG2A 1S0PA 1MYOA 2VSXE 4B94A 2J4BA 2BUGA 1YMPA 4AOFA 5AQBA 3JCKC 3LY9A 5B1AE 3I4GA 4J0UA 3D9LA 2E0IA 2XGSA 2RKKA 3S7DA 2Q7FA 3CKCA 3PZDA 1SQMA 4OVVA 5J08A 5CCMA 3TGOA 3SD5A 4IYPA 3CVYA 4U8VD 3KMJA 2XS8A 2IGQA 4J8YA 1HS6A 5T8IA 3J5PA 3QARA 4GTTA 3AG2E 4RVBA 3S7FA 3VLEA 2AXZA 3PZ3A 5G05J 2XHEA 4GTSA 2WXRA 4EZKA 4HBDA 3DXKG 2P9PG 5A6CA 3R7QA 2EINE 2BKKB 5ENOD 2YQ8A 4RLYA 4A55A 4J8EA 2VGXB 2F8YA 2WXNA 2L6JA 4UWHA 4Y6CA 2HR2A 4A3TA 1E8WA 5EX3A 2M63A 3JUIA 2EIKE 2VTBB 2LXMA 2OEVA 2XPIA 3JQ0A 4O30A 1MT6A 4CCAA 3ZYKA 4GZ5A 3ISMC 4B0ZA 3MX3A 1TNBA 4Q69A 4JA7A 5F6KC 4JPSA 4YDYA 1SZ9A 4UI9C 3G2VA 1MJ0A 5FJYA 2V8SE 1QQEA 3FY4A 3D9JA 5G04C 2NYJA 2KCLA 3HG0D 3GYZA 2I2OA 2QC9A 3IBEA 3FEXA 3Q9NC 4BT8A 2DYRE 4RQIA 4JHJA 3R7RA 5LFAA 2IOSA 5T0KA 4C1QA 4OAVB 1Y8MA 2CG3A 3AG3E 4ANUA 3FUFA 4DX2A 2HO1A 3C72A 3W9GA 3F6QA 3O4ZA 3ZW3A 5ANLA 2R2LA 1N9AA 3P2BA 1WY6A 3IHXA 1Z3XA 5D2MC 4XKCA 2L0IA 3ZHEB 1ZB1A 1N4QA 2ZISA 2HM8A 2VSYA 4TUMA 3VTYA 3UM2A 1BD8A 3SWCA 3PS6A 5ENSD 3PRZA 5ITZF 4BY6A 1KLXA 4APFA 3MO2A 4BT9A 4MLPA 4M7CA 1NA3A 1EF1C 3TWTA 4DX5D 3KMAA 3FH5A 2JLBA 3D3MA 4YNPA 4HLLA 4V3IA 2DCPA 3D9HA 1DVPA 5T0MA 4Y6WA 3MKRA 3OXFA 2IOLA 3IXEA 2PM6A 4D10C 2QFCA 1HH8A 3TWVA 5TTFA 2WXJA 3PREA 3DSVA 4C48B 3DRAA 4NIKA 2VGYA 5AYWD 4NRHB 4FLBA 3HXBA 3TWUA 4PS7A 3OOIA 3MYVA 4YVQC 3F9ZA 3EIQC 1ELKA 5ENPD 3RO3A 2XRYA 4ATZD 2XEHA 3ZYMA 3APCA 5AENA 1N6CA 4LNBA 4BEPA 4UWGA 1TNOA 2P9SG 3MKQB 2LSUA 5C1DA 2ETBA 4A1GA 4LNUD 4C9BB 3CVLA 3G2SA 5DIZA 4TXQA 4TV3A 4I1OB 4HFGA 1QNFA 2IFUA 3CVVA 4DRXE 2KZTB 2RD0A 3ZUVB 5HQ8A 1QZ2A 4JD2G 5CBOA 4ILIA 3MEKA 4QENA 4EPZA 4HORA 2GRLA 5AARA 3ENEA 4B89A 2V5FA 3TL5A 1JWFA 1ZU2A 4AY5A 4HOQA 3FTUA 1PAQA 5ENNA 3DALA 4RZ0A 1X81A 2X6JA 4CRWA 1OWOA 3ASFA 2F69A 2I1JA 1OCRE 3N71A 4UWFA 2P9KG 4PH4B 5ARFA 1OCCE 4L2LA 3KMTA 2AVPA 4HVBA 1BI7B 3RK6A 4B8CB 4HRMB 5CRUA 4DPRA 5B3SE 5EKQD 3DB5A 3EU9A 4UQZA 3NOCD 4IJDA 5AQ9A 4KVOA 1Z5SC 4B93B 4DI3A 3CQCB 3DSUA 2CHXA 3TWWA 3PZ1A 4KMOA 4N3BA 4APOA 5KJLA 2FI7A 3LVQE 4O6FA 2GRNB 4HI9A 3FUDA 3SZ7A 3FU6A 1S70B 2PQRA 4A63B 3SNXA 2ZGGA 4HQDA 4E47A 2WXIA 2GRQB 3SGHA 4F3VA 2Y4TA 1Z6TA 4YVOA 4G1TA 3C5RA 4EQFA 3PEVB 2FO1E 2ZGDA 3MCXA 4ME2A 5EIBE 3QB2A 3JQ1A 4YDEA 2A5UA 1N0QA 4JW1A 4N2SA 2YNQA 4JVSA 3UXGA 3LS8A 2PL2A 4EZJA 2G46A 4IN3B 4GTVA 2WQ7A 3S7JA 3UIOC 5AYFA 4F6RD 3AS5A 3EP0A 1Y6IA 3DPYA 4HOTA 3G2WA 2UY1A 3SY2A 1JCRA 1H2VC 3CV0A 2AXUA 4AVXA 1NI1A 2FF4A 4BFRA 1TEZA 3RAYA 3G2UA 3ZYQA 4DUIA 3V30A 1K8KG 3SBTB 3BU8A 2VSOE 3FUHA 5A23A 3MJWA 4N3CA 3UIPC 2H6HA 5ARGA 1N54A 4NURA 5E75A 3B13A 3RQ4A 3CHMA 3BO5A 1TJFA 2XEVA 4XKBA 3LKUA 4E85A 3M56A 2P9IG 3RJVA 4JA9A 1MX4A 4F1SA 4QFVA 3Q7AA 1ELWA 5B1BE 3CEQA 4GTPA 4CT4A 1IQRA 1P5QA 3E34A 3LY8A 2UWJG 4JC8A 2J09A 5FQ6A 3EDTB 2LAIA 1H3IA 2BF0X 4XIFA 1WM5A 4DK5A 3LEWA 4F1PA 3D9IA 2R02A 3QOUA 5EIDA 4BERA 2PM7A 3UQ3A 3AG1E 2WQHA 4ZFHA 3TWQA 4ILGA 5EYLA 2WVIA 4AP2A 3TG4A 4LSZE 1E8ZA 4F53A 4CDMA 3CK9A 3EHRA 3Q73A 3B7TA 1PC2A 1OCOE 3FUMA 4J8SA 4GMJA 4KZCA 2NXPA 3Q9UC 1UJKA 2AWIA 3I3NA 4GTOA 5AIJA 3NBNB 1JCQA 1E7UA 3CIAA 1HZ4A 3DEOA 2XGOA 2R03A 3F9WA 3NF1A 2GRMA 4U8HA 3FUIA 3FTWA 4MI5A 4NJ5A 2LSVA 3CR3A 3AU5A 4J7FA 1YYHA 2WB2A 2J8SD 3ABME 3UX4A 3CHSA 3ABLE 4EHMA 1BU9A 3FTSA 2J9QA 4FJZA 2L6BA 3DSXA 5FQ4A 4I1AA 3UKUG 2R05A 3RRMB 4JHRA 5T3RA 3QNKA 3LCAA 1LTXA 1E7VA 4BSZB 1TN7A 3ASDA 4I51A 4UI9J 4J8FA 5ANRA 4FC8A 4WAFA 5JMND 2EIJE 1DCQA 5G04J 3ML8A 2ETCA 4HS2A 2HE0A 3DBSA 3UTMA 4FHJA 3M55A 5LP0A 2RFMA 1WDYA 4YDOA 2MYOA 3T9KA 4UQYA 5CMYA 5A7DB 5FQ8A 2QPWA 1NA0A 4LCTA 1OWNA 4U0UA 2WPVA 2HYZA 1OWMA 3OXGA 3C98A 4WUYA 1DCEA 2XCCA 4OAUC 4FLHA 4HRNA 3CBMA 2PQNA 3FFLA 3WXXA 1FT1A 3PUJA 3ZYLA 4I2ZA 3U4TA 1KPSB 1TN8A 3FHEA 3SW9A 3KEAA 4GMLA 3IHVA 3V31A 4AY6A 1NZNA 2P9LG 1E90A 2WXMA 3ZIMA 3F9XA 3PZ4A 3CSTA 2W5YA 4JL0A 1INZA 2KM4A 3IKOB 3U64A 4WNEA 1SVXA 5FIOA 4BX8A 5C2YA 2JABA 1TJCA 2V5QC 3VTXA 3ONKA 3ZU7B 1V54E 4DX7D 4AM9A 4U07A 1TR4A 5JINA 2WXHA 5EX0A 1MQSA 3ZVVA 3L6AA 2DBAA 1ZBPA 4GB9A 2W5ZA 5ENRD 3GZ1A 3NQPA 3V2OA 3VLFA 3D9KA 4U0ZA 1KT1A 3BUAA 2CFUA 2KXPC 3BG1B 4K0RA 1SA4A 1MX2A 4H7YA 5CBNA 3APFA 4ZHBA 4U7EB 3UUXA 5BXOA 3PZ2A 3QAQA 3KAEA 4LEUA 2DIWA 3NB2A 4H12A 2WXKA 1KZOA 2V0PA 5TEGA 1N4PA 5T5GA 4XX5A 5TH7A 1TNYA 4G23A 4YDWA 4GU5A 2L9BA 3OXLA 1QBQA 1B89A 1UJJA 1TNZA 1MZCA 1OT8A 3HRAA 3SFXA 2C0MA 1K1BA 3C3RA 3JXIA 4GYWA 5FT9A 3GZSA 2F37A 1DC2A 3R9AB 1U2VG 1IHBA 1AP7A 4KVMA 4UUCA 3SHFA 3EHMA 3QWPA 4U63A 2JEKA 1UN9A 3QC1A 2V4LA 3AG4E 2AXVA 3R9MA 3F9YA 4RG6A 1O1TA 4U0SA 2OV8A 2IONA 3ULEG 4KZ0A 1OWLA 2F8XK 4J83A 2LO6A 1YA0A 3C3QA 4I17A 2H6GA 5KNGA 3W9FA 1E8XA 3ZXSA 3ASGA 4A3VA 4WNFA 3I5PA 4TXPA 4YPAA 2GRPB 3EU5A 4HNAD 2J4DA 3NZUA 3Q49B 5ENQD 4URKA 5M72A 3ASHA 3QKYA 5T4YA 2XGMA 4AV7A 2XS1A 4XZ4A 2WMNA 2VQ2A 3OTNA 3ULYA 2LNIA 4U96D 1NP7A 2FULA 2CG2A 1SW6A 3UM0A 3TWRA 4AEZC 2RFAA 4XEIG 1SA5A 2VJ8A 5LCWJ 5LSXA 1HE8A 3FULA 3CHQA 3FH7A 4GCNA 3GW4A 4WWOA 5HKPA 3RAUA 3Q5MA 4J8DA 3HDXA 5BV0A 3QDNA 3OAWA 3QJZA 1FVFA 3AAAC 1K3ZD 1WG0A 2J08A 5FWQA 1HG5A 3B7RL 3CVXA 4J8OA 1KT0A 2XPYA 4DLQA 4GTMA 4HXIA 3M5AA 1O9SA 4LG6A 4UWLA 4G24A 1AWCB 5JHBA 1BPOA 2KC7A 1G3NB 3MV3B 1V55E 5DBKA 3UT8A 5CMWA 3M53A 2UY1B 4Q94A 3O48A 4YPUA 1VDYA 4K5BA 4HOSA 1O1SA 2C2LA 3LY7A 4JHKA 2B0OE 2Y0BG 3ZKJA 4KYOB 4WNGA 3SF4A 3PE3A 4N5QA 3DSWA 2FBNA 4GAAA 1YCSB 1H2UA 3QWWA 2I9CA 3EHNA 2XEEA 3QK0A 5EN5D 1XNFA 3MV2B 4RG9A 3ZRHA 2CFZA 2J49A 1N4RA 4WWPA 3RO2A 3M54A 1FT2A 3UM3A 4L1BA 2FO7A 3IV0A 2KATA 5LSZA 1S64A 4I1MA 2DVWA 4J7IA 2IU1A 1D8DA 1XGWA 4GCOA 2JV0A 2RFIA 3TXMA 5AQAA 1A5EA 4KXKB 4KBQA 4GZ6A 1H6PA 1EYHA 4YPEA 4TUUA 4L23A 3L16A 2XENA 2OOEA 3DWLG 3B95A 1S63A 2OEWA 3SQVA 3S2AA 4G25A 3SFZA 1N0RA 3UI2A 1OCZE 3CGHA 1E96B 1SZAA 2ETAA 4BWRA 4RSYA 5JIYA 4FHKA 5BUZA 3P1UA 3CK7A 3V79K 2GROB 5AJDA 3CVQA 4R7LA 2X38A 2AJAA 3RJWA 2MHKA 4G26A 1H0AA 3B7BA 4M3OA 3LJNA 2R3AA 1HXIA 2XZTG 2A5EA 2XQ0A 2BKGA 4HB5A 3CBOA 4UQXA 2WXFA 4ANWA 4I6JA 3ONLA 5JJ6A 1TNUA 4KT6B 4G8KA 4IJ8A 1MX6A 5AQ7A 1JUQA 3FP3A 3ZN3A 4I9CA 2KCVA 4IRUA 3FU3A 3PH0C 4PUCA 1EPUA 2DZNA 3CHPA 3HHMA 4BTAA 2ZIRA 3T8KA 3APDA 1FVHA 1O1RA 3Q75A 4I6EA 4ATGA 3CVWA 3PDNA 3AS8A 2IEJA 4G2VA 3D9NA 1IXVA 4IULA 4ABNA 4F7AA 3M57A 4CT0A 3PNLB 4ANVA 3BQOA 3HNAA 2IJGX 4O1OA 3L54A 1UN8A 3EIJA 4AIFA 3BEEA 3FUEA 2Y1LE 4GA0A 2BEDA 5BNWA 3TWXA 3ML9A 3IHYA 3ASNE 4JDSA 4GYOA 4MBGA 5G55A 4NVQA 2WXGA 2VSNA 3TWSA 1UW4B 5CERB 1MVHA 4W9RA 3RRNB 3PE4A 2GGFA 2R5SA 1BLXB 3UPVA 3ZXPA 5EILA 3FTYA 2FEZA 3UT4A 2NSZA 4J6IA 2P58C 5E76A 1KZPA 1MUFA 4BTBA 2QYUA 4HOUA 3CKBA 3KSQA 1N52A 3LJ3A 3BG0B 3RSEG 4ILHB 3HXEA 3FWVA 3TXNA 4FA6A 4FU3A 4EBAA 3UT7A 4GTRA 2EILE 4JEUA 3HVEA 4CYMD 2Y4UA 2EIME 3X2QE 2C0LA 4GA2A 4PS8A 3ESLA 5FQ7A 5F6LA 2P2CP 3KD7A 3HYMB 2EQXA 3FUKA 5D0OD 1D8EA 5G2NA 2L0TB 4NQ0A 2WXOA 4FMUA 2F0YA 3WG7E 4I9EA 1TN6A 2I6HA 2IO3C 5G05C 4OVUA 1H6KA 4CZ2D 2YHEA 2X6KA 4I43A 3L13A 3L17A 4GZCA 1N94A 1X5BA 3HXCA 4I6GA 3Q4AB 4Q96A 3SBSA 3U3WA 4FP7A 3LYAA 3DSSA 4DX1A 4YNMA 3Q79A 3TAXA 2AW6A 1QYMA 4UWKA 5JJ0A 3E37A 4XE0A 2ZU6B 5AAOA 4EZLA 4AXHA 5CCLA 3E33A 4HRLA 5D0QD 2X3MA 5LOZA 4LNGA 4ACLA 3E30A 2GW1A 2VGXA 2VYIA 5IY5E 3CHOA 4C0EA 3L9TA 3KSLA 3UMVA 5KCMA 2GRRB 3B7SA 1N11A 2H6FA 4PS3A 4LDGA 3GZ2A 3UINC 4DLOA 5KJKA 1XQHA 1DNPA 4GMRA 4L2YA 5H7PA 5CHEE 2VTBA 4I2WA 3K5KA 1D9SA 3RIBA 3B7UX 3CSFA 4NACA 3ESKA 1HF8A 5FZSA 3CK8A 1BI8B 2PNNA 4WNDA 4QQIA 2VGEA 4TXRA 1JPLA 3M59A 2IY0C 4CEMA 4LRZA 3JXJA 5CEAA 1NFIE 2BTDA 4YNDA 2LAHA 4BETA 3SFYA 4DX6D 5BV1A 4PDXA 4N39A 1IQUA 5EYPF 1IYGA 5F59A 2DZOA 4L7TA 2CHWA 2MRIA 5FZQA 4G8LA 3CVPA 1HG2A 4N3AA 1OWPA 3PNTB 5BPPA 3QWVA 4UI9K 3I4RB 1ML9A 1RZ4A 4K5CA 4GZDA 3LVRE 3TJPA 3LDZA 3FU5A 3DPDA 5AJLA 1PEGA 4AU7A 1PY1A 3CVUA 2RG8A 4MRUA 3URZA 1L5JA 1EDUA 3ZHEA 1U3CA 3NZSA 2ILRA 5HS0A 3TG5A 1MHQA 4QEOA 2OVFA 5J90A 3PEUB 3HXDA 3C3OA 4GYYA 5HI7A 4FADA 3E32A 1NL4A 3Q15A 3DXMG 5AN8A 3SO8A 4XI0A 3ZGQA 1N6AA 3RU0A 2J07A 2X6IA 5KJMA 3FUJA 4GA1A 5FTPA 4BSXA 1OUVA 2H6IA 2WM9A 3KS2A 4Z68A 4K03A 1Z3YA 3JYSA 2R17C 4P29A 1K1AA 2LXLA 2IF4A 2QY7A 2E2EA 3ZNGA 3J5QB 4WWNA 4U04A 1HX8A 3ABKE 4LUNU 4O1PA 4J7WA 2A4ZA 2Y69E 2XRZA 2R59A 2B6CA 1FCHA 5D66A 3OPEA 4OYSA 4LERA 5JA4D 1OY3D 5BW8C 5KJNA 1U3DA 1ELRA 3D9PA 3FUNA 2IQCA 4JXTA 5CPRB 1HO8A 4MS6A 4GTQA 3FDHA 2XZDG 3E4BA 3FU0A 5KWDA 3MO0A 3MGBA 4DI4A 1RW2A 4CGVA 4EECA 4GPMA 4CDNA 4ACKA 2LUHA 2XCBA 3D9OA 3ASOE 4N2QA 1IHGA 4BX9A 3MKQA 2QZAA 1H2TC 1LD8A 2WXLA 3IEGA 5JHAA 5EDSA 2YHCA 4K5AB 2WQ6A 3VV0A 3CLJA 2OCCE 5BT1A 5CECB 3HIZA 2KBXA 5FINA 3S7BA 3L08A 2NC9A 5LCWC 3T8MA 2ZXWE 5JJTA 3RKVA 2KZTA 3CHRA 4XI9A 4JB8P 1N4SA 1E8YA 2CHZA 2IO2C 4MKTA 3UM1A 4JZYA 4BESA 3AU4A 2WXQA 3M58A 1TYQG 3EJNA 3U66A 5ENTD 1WAO1 4CGWA 1A17A 4TRQA 3EHQA 3ZPJA 5KBAA 5CRVA 3ZEFA 3FH8A 2X6HA 2Y3AA 4GZ3A 2WXPA 3V2XA 1LD7A 1OXJA 5JJ7A 3HXFA 3RRUA 2ONDA 4JLGA 1UOHA 3PUKA 4FULA 3LPZA 3PVLA 4U95D 3K9IA 1Q2ZA 2XPZA 3FPDA 4HI8A 4GPKA 2P9NG 4E6HA 3ULQA 3L82A 4C0MA 2BQZA 3Q47B 3EUVA 3SI5A 5FZRA 3AJIA 5KNHD 5F5EA 4DJAA 4G11A 2PZIA 1ZKKA 4L9PA 3MZLB 3ZFWA 4ANXA 3D9MA 3L22A 3DEPA 2P9UG 4EBAG 3AS4A 1HFAA 2KCKA 3CQGB 4N5CA 4BUPA 2MOWA 4HLEA 2O8JA 1GW6A 1UG3A 3U9WA 4B8AA 3T5XA 4Z4PA 3KEZA 1IKND 2QYJA 4A1SA 1LF8A 1H19A 3LXUX 1JCSA 3Q7FA 4X8QA 5LX8A 1HU3A 1H6OA 1MVXA 5HRYA 3OS5A 1N95A 1FPPA 3T5VA 2OVBA 2WMOA 3FTXA 4H7XA 4MI0A 3NAWA 2V4HC 4O60A 4U8YD 4QEPA 1JWGA 5CEDB 3JUEA 3S8PA 2DWZA 3FEYA 3G2TA 4JEHA 2DYSE 3CVNA 2X6FA 4AJWA 3FTVA 3VUZA
chains in the Genus database with same CATH topology
3FU6A 1N3JA 2PQRA 4WNFA 3SNXA 1X5BA 3I5PA 4E47A 1W3BA 4I6GA 5JHNA 2WXIA 2YINA 3Q4AB 4Q96A 4YPAA 3SBSA 3SGHA 3U3WA 4FP7A 2J4DA 3LYAA 4F3VA 2Y4TA 1Z6TA 3FTZA 4YVOA 3NZUA 3MO5A 4YNMA 3Q49B 4G1TA 3TAXA 4EQFA 2AW6A 3HVEB 3MA5A 3PEVB 4UWKA 3VLDA 5JJ0A 2I1KA 4CDRA 3MCXA 4ME2A 4XE0A 3QB2A 4URKA 5M72A 2ZU6B 3JQ1A 3ASHA 4FJYA 2A5UA 3QKYA 5T4YA 4EZLA 4AXHA 2XGMA 5CCLA 4AV7A 3CBPA 5EG2A 1S0PA 4JW1A 5D0QD 4N2SA 4B94A 2VSXE 2X3MA 2YNQA 5LOZA 2J4BA 4XZ4A 4JVSA 4ACLA 2GW1A 2VGXA 3LS8A 2BUGA 2VYIA 2WMNA 2VQ2A 3CHOA 2PL2A 4C0EA 4EZJA 2G46A 4AOFA 3OTNA 3UMVA 5KCMA 4PS3A 3B7SA 4IN3B 4LDGA 3JCKC 3LY9A 2LNIA 3GZ2A 3I4GA 4J0UA 1NP7A 4DLOA 2FULA 5KJKA 2WQ7A 2CG2A 3D9LA 3S7JA 2E0IA 1XQHA 5AYFA 1DNPA 4L2YA 5CHEE 2VTBA 3AS5A 4I2WA 4AEZC 3EP0A 1Y6IA 2XGSA 3S7DA 4HOTA 3K5KA 2Q7FA 3CKCA 3PZDA 3RIBA 1SQMA 3B7UX 3CSFA 2UY1A 3G2WA 4NACA 4OVVA 5J08A 2VJ8A 1H2VC 3ESKA 5CCMA 3TGOA 1HF8A 3CV0A 5FZSA 5LCWJ 2AXUA 3CK8A 3SD5A 5LSXA 4IYPA 4AVXA 3CVYA 4WNDA 1HE8A 3FULA 3KMJA 2IGQA 5T8IA 1HS6A 2FF4A 4BFRA 1TEZA 3QARA 3CHQA 3G2UA 3RAYA 4RVBA 3S7FA 1JPLA 3FH7A 3VLEA 3ZYQA 2AXZA 4GCNA 5G05J 3M59A 3GW4A 4WWOA 3Q5MA 2XHEA 4J8DA 2WXRA 3HDXA 5BV0A 3QDNA 4CEMA 4EZKA 3OAWA 3SBTB 4LRZA 2VSOE 3FUHA 3QJZA 5A23A 3MJWA 4N3CA 1FVFA 2BTDA 5A6CA 4YNDA 2LAHA 5ARGA 3R7QA 1N54A 4NURA 5BV1A 2J08A 4PDXA 4N39A 3B13A 2YQ8A 3CHMA 5E75A 1IQUA 3BO5A 3RQ4A 5FWQA 1IYGA 5F59A 4L7TA 1TJFA 1HG5A 2CHWA 2XEVA 2MRIA 3B7RL 4XKBA 4A55A 3LKUA 4J8EA 3CVXA 4J8OA 5FZQA 2VGXB 3CVPA 1HG2A 1KT0A 2XPYA 4E85A 4DLQA 3M56A 3RJVA 2WXNA 4JA9A 4N3AA 4HXIA 4F1SA 2L6JA 4UWHA 1O9SA 3M5AA 4UWLA 1OWPA 4QFVA 3PNTB 4G24A 4Y6CA 2HR2A 4A3TA 3QWVA 5BPPA 4UI9K 3I4RB 1ELWA 1E8WA 5JHBA 5EX3A 2M63A 3JUIA 1ML9A 1BPOA 2KC7A 3CEQA 4CT4A 1IQRA 1P5QA 2VTBB 4AU7A 4GZDA 3MV3B 5DBKA 3LVRE 3UT8A 2XPIA 3JQ0A 5CMWA 3M53A 3TJPA 3LY8A 4O30A 2UWJG 4JC8A 2UY1B 3LDZA 1MT6A 2J09A 3FU5A 4Q94A 5FQ6A 4CCAA 3EDTB 2LAIA 3DPDA 1H3IA 5AJLA 2BF0X 3O48A 4GZ5A 4XIFA 3ZYKA 1PY1A 1WM5A 4DK5A 4B0ZA 1VDYA 2RG8A 3CVUA 4YPUA 4HOSA 2C2LA 4MRUA 3LEWA 3MX3A 3LY7A 4JHKA 4HORA 3URZA 3D9IA 1L5JA 1EDUA 3ZHEA 3QOUA 4KYOB 4Q69A 1U3CA 4JA7A 5F6KC 3NZSA 4WNGA 2ILRA 4JPSA 3SF4A 2PM7A 3UQ3A 3TG5A 3PE3A 1MHQA 1SZ9A 4QEOA 2OVFA 5J90A 3PEUB 2WQHA 4UI9C 3G2VA 2FBNA 5FJYA 4GAAA 2V8SE 5HI7A 4GYYA 1H2UA 4ILGA 4FADA 1QQEA 3FY4A 2WVIA 3Q15A 4AP2A 3D9JA 3QWWA 5G04C 3TG4A 4XI0A 2I9CA 2KCLA 3EHNA 1E8ZA 4F53A 3ZGQA 3GYZA 3QK0A 2I2OA 1N6AA 1XNFA 3IBEA 3MV2B 3FEXA 3RU0A 4CDMA 3CK9A 4RG9A 2J07A 4BT8A 3ZRHA 2CFZA 2J49A 2X6IA 3B7TA 1PC2A 5KJMA 3FUJA 4JHJA 4WWPA 3RO2A 3FUMA 4GA1A 4J8SA 5FTPA 3R7RA 4BSXA 4GMJA 3M54A 1OUVA 2WM9A 3KS2A 4KZCA 5LFAA 2IOSA 5T0KA 4C1QA 2NXPA 4K03A 1Z3YA 4L1BA 1UJKA 2AWIA 3JYSA 2FO7A 3I3NA 3IV0A 2R17C 4P29A 5AIJA 2IF4A 1E7UA 2KATA 5LSZA 2QY7A 1Y8MA 2CG3A 4J7IA 4I1MA 3CIAA 1HZ4A 2E2EA 2IU1A 4WWNA 4U04A 4ANUA 3FUFA 1HX8A 4LUNU 2XGOA 1XGWA 2HO1A 3F9WA 3NF1A 4GCOA 2A4ZA 2GRMA 4U8HA 3O4ZA 3ZW3A 3FUIA 5ANLA 2JV0A 2RFIA 3FTWA 4MI5A 3TXMA 4NJ5A 2LSVA 3CR3A 4KXKB 3AU5A 3P2BA 4KBQA 4J7FA 2XRZA 2R59A 4GZ6A 1WY6A 1EYHA 3IHXA 2WB2A 4YPEA 4TUUA 4L23A 1Z3XA 4XKCA 2L0IA 3L16A 1FCHA 3ZHEB 2OOEA 2HM8A 2VSYA 4OYSA 3OPEA 4LERA 3UX4A 3CHSA 5BW8C 3VTYA 5KJNA 3SWCA 1U3DA 3PS6A 3S2AA 1ELRA 4G25A 3SFZA 3FTSA 2J9QA 4FJZA 3PRZA 5FQ4A 3D9PA 3FUNA 2IQCA 4I1AA 4JXTA 5CPRB 1HO8A 4MS6A 3RRMB 3FDHA 3CGHA 4JHRA 4BY6A 5T3RA 3QNKA 1KLXA 4APFA 1E96B 1SZAA 4BWRA 4RSYA 3MO2A 5JIYA 4BT9A 3LCAA 4FHKA 5BUZA 3P1UA 3E4BA 4MLPA 3CK7A 1NA3A 1EF1C 3FU0A 1E7VA 3ASDA 3MO0A 3MGBA 4I51A 4UI9J 4DI4A 5AJDA 3CVQA 4J8FA 4R7LA 4CGVA 5ANRA 4FC8A 3KMAA 4EECA 3FH5A 4WAFA 2X38A 2JLBA 3RJWA 2MHKA 4G26A 4CDNA 3D3MA 1H0AA 5G04J 4YNPA 4ACKA 2XCBA 3D9OA 3ML8A 4M3OA 4V3IA 4N2QA 1IHGA 2DCPA 4HS2A 3MKQA 4BX9A 2R3AA 3DBSA 1HXIA 4FHJA 3M55A 5LP0A 1DVPA 1H2TC 4UQYA 5CMYA 5A7DB 2WXLA 3IEGA 5T0MA 5JHAA 5EDSA 2YHCA 4Y6WA 2XQ0A 5FQ8A 2QPWA 3MKRA 2WQ6A 3OXFA 3CBOA 2IOLA 4UQXA 2WXFA 2PM6A 4ANWA 4D10C 3CLJA 4I6JA 3VV0A 1NA0A 2QFCA 4LCTA 3ONLA 5BT1A 1OWNA 3HIZA 5JJ6A 4U0UA 2WPVA 2HYZA 1OWMA 1HH8A 3L08A 2NC9A 3C98A 3OXGA 4KT6B 3S7BA 5TTFA 4IJ8A 4WUYA 5LCWC 2XCCA 3T8MA 2WXJA 4FLHA 1JUQA 5JJTA 3FP3A 3RKVA 3PREA 3CBMA 2KZTA 2PQNA 3ZN3A 3CHRA 3FFLA 4I9CA 3WXXA 2KCVA 2VGYA 4IRUA 3PUJA 4XI9A 3FU3A 3PH0C 3ZYLA 1E8YA 4I2ZA 2CHZA 4PUCA 4MKTA 1EPUA 4NRHB 5AYWD 3U4TA 3CHPA 4FLBA 4JZYA 3HHMA 4BTAA 4PS7A 3FHEA 3OOIA 3APDA 3MYVA 3SW9A 1FVHA 4YVQC 3AU4A 3F9ZA 3EIQC 2WXQA 3M58A 4GMLA 3IHVA 3EJNA 3U66A 4AY6A 1NZNA 1WAO1 4I6EA 1ELKA 4CGWA 3RO3A 1A17A 4ATGA 1E90A 2WXMA 4TRQA 3CVWA 3PDNA 3AS8A 3ZIMA 2XRYA 3ZPJA 3F9XA 4G2VA 3D9NA 3ZEFA 3CSTA 3FH8A 3ZYMA 3APCA 2X6HA 4IULA 5AENA 4JL0A 1INZA 2Y3AA 1N6CA 2KM4A 2W5YA 3IKOB 3U64A 4UWGA 4WNEA 4GZ3A 4ABNA 4F7AA 3M57A 2WXPA 4CT0A 3MKQB 4BX8A 5C2YA 2LSUA 3PNLB 4ANVA 1TJCA 5C1DA 4A1GA 3HNAA 2IJGX 3VTXA 5JJ7A 3L54A 4C9BB 3CVLA 3G2SA 3ONKA 5DIZA 1UN8A 3EIJA 4AIFA 4AM9A 4U07A 3RRUA 3BEEA 2ONDA 3FUEA 4JLGA 5JINA 4GA0A 2WXHA 3PUKA 3LPZA 4FULA 4TV3A 1MQSA 3PVLA 5EX0A 3ZVVA 5BNWA 3K9IA 4I1OB 2XPZA 3L6AA 1QNFA 4HFGA 3ML9A 3FPDA 2DBAA 3IHYA 1ZBPA 4GPKA 2IFUA 4JDSA 4GYOA 4GB9A 5G55A 3CVVA 2W5ZA 5F5EA 4NVQA 2WXGA 3GZ1A 2KZTB 2RD0A 4E6HA 2VSNA 3ULQA 3NQPA 5HQ8A 1QZ2A 1UW4B 4C0MA 2BQZA 1MVHA 3Q47B 3VLFA 3D9KA 4U0ZA 3PE4A 4W9RA 1KT1A 3RRNB 2CFUA 3SI5A 2GGFA 2R5SA 5FZRA 4ILIA 3UPVA 3MEKA 4QENA 3BG1B 2FEZA 3FTYA 3UT4A 4EPZA 4DJAA 4G11A 2NSZA 4K0RA 2GRLA 2PZIA 4J6IA 4H7YA 1ZKKA 2P58C 3APFA 3ENEA 5E76A 4B89A 2V5FA 3TL5A 3UUXA 1JWFA 1ZU2A 3MZLB 3ZFWA 4AY5A 1MUFA 4HOQA 4ANXA 3D9MA 1PAQA 3FTUA 3QAQA 3L22A 3KAEA 4LEUA 5ENNA 4BTBA 4EBAG 2DIWA 4H12A 3DALA 2WXKA 4RZ0A 2V0PA 4HOUA 3AS4A 1HFAA 2KCKA 3CKBA 2X6JA 1N52A 3CQGB 1OWOA 3ASFA 3LJ3A 4N5CA 2I1JA 4CRWA 2F69A 5TEGA 3BG0B 2MOWA 4HLEA 4BUPA 2O8JA 1GW6A 1UG3A 4ILHB 5T5GA 3N71A 4UWFA 3U9WA 4B8AA 4PH4B 5ARFA 4L2LA 3T5XA 4XX5A 3KMTA 2AVPA 4Z4PA 5TH7A 3FWVA 4G23A 3TXNA 4HVBA 4FA6A 4FU3A 3KEZA 4EBAA 4GU5A 3UT7A 4JEUA 2L9BA 3HVEA 3RK6A 4B8CB 4A1SA 1LF8A 3OXLA 1PEGA 2Y4UA 1H19A 3LXUX 4DPRA 2C0LA 4GA2A 4PS8A 3ESLA 5EKQD 3DB5A 5FQ7A 1B89A 5F6LA 1UJJA 3KD7A 4UQZA 3HYMB 2EQXA 2C0MA 3FUKA 5LX8A 1HU3A 1MVXA 4GYWA 5FT9A 3GZSA 3OS5A 3R9AB 5D0OD 4IJDA 4KVMA 3T5VA 2OVBA 4KVOA 2WMOA 3FTXA 4H7XA 3SHFA 5G2NA 2L0TB 3EHMA 3QWPA 4NQ0A 2WXOA 4FMUA 4DI3A 4MI0A 3CQCB 4U63A 2JEKA 4I9EA 2CHXA 1UN9A 2I6HA 3QC1A 4KMOA 4N3BA 2V4LA 5G05C 4QEPA 2AXVA 4OVUA 1H6KA 3F9YA 4RG6A 4APOA 5KJLA 4U0SA 2OV8A 1JWGA 2YHEA 2X6KA 2IONA 2FI7A 4I43A 3S8PA 4KZ0A 3FEYA 1OWLA 3G2TA 3L13A 4JEHA 3LVQE 4O6FA 4J83A 3L17A 2LO6A 1YA0A 4I17A 1E8XA 3ZXSA 3CVNA 2X6FA 3ASGA 4AJWA 3FTVA 4GZCA 4A3VA 3VUZA 3FUDA 3SZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3J A;  2PQR A;  4WNF A;  4E47 A;  1W3B A;  5JHN A;  3Q4A B;  4YPA A;  3U3W A;  3LYA A;  4F3V A;  2Y4T A;  4YVO A;  3MO5 A;  4YNM A;  3Q49 B;  4G1T A;  3TAX A;  4EQF A;  3MA5 A;  5JJ0 A;  4CDR A;  4ME2 A;  5M72 A;  3ASH A;  3QKY A;  2XGM A;  5CCL A;  3CBP A;  5EG2 A;  4N2S A;  5D0Q D;  4B94 A;  2GW1 A;  2VGX A;  2BUG A;  2VYI A;  2VQ2 A;  2PL2 A;  2G46 A;  4IN3 B;  4LDG A;  3LY9 A;  2LNI A;  3GZ2 A;  4J0U A;  5KJK A;  3S7J A;  1XQH A;  5AYF A;  5CHE E;  3AS5 A;  4I2W A;  3EP0 A;  2XGS A;  3S7D A;  4HOT A;  3K5K A;  2Q7F A;  3CKC A;  3RIB A;  2UY1 A;  3ESK A;  5CCM A;  3TGO A;  5FZS A;  3CV0 A;  5LCW J;  3CK8 A;  5LSX A;  4WND A;  3KMJ A;  2IGQ A;  2FF4 A;  3RAY A;  3S7F A;  4GCN A;  5G05 J;  3M59 A;  3GW4 A;  3Q5M A;  4J8D A;  3QDN A;  4N3C A;  5A6C A;  4YND A;  5ARG A;  4N39 A;  2YQ8 A;  3RQ4 A;  3BO5 A;  1IYG A;  5F59 A;  2XEV A;  3LKU A;  4J8E A;  4J8O A;  5FZQ A;  2VGX B;  3CVP A;  1KT0 A;  3M56 A;  3RJV A;  4JA9 A;  4N3A A;  2L6J A;  3M5A A;  1O9S A;  4G24 A;  4Y6C A;  2HR2 A;  3QWV A;  4UI9 K;  1ELW A;  5EX3 A;  1ML9 A;  2KC7 A;  3CEQ A;  1P5Q A;  3MV3 B;  5DBK A;  2XPI A;  3M53 A;  4O30 A;  3LY8 A;  2UWJ G;  2UY1 B;  1MT6 A;  3EDT B;  1H3I A;  3O48 A;  4GZ5 A;  1PEG A;  4XIF A;  4YPU A;  1WM5 A;  4AU7 A;  4HOS A;  2C2L A;  3LY7 A;  3URZ A;  3ZHE A;  3QOU A;  4KYO B;  4JA7 A;  5F6K C;  4WNG A;  3SF4 A;  3UQ3 A;  3TG5 A;  3PE3 A;  4QEO A;  2WQH A;  4UI9 C;  2FBN A;  5FJY A;  5HI7 A;  4GYY A;  1QQE A;  3Q15 A;  3QWW A;  5G04 C;  3TG4 A;  4XI0 A;  2KCL A;  3ZGQ A;  3GYZ A;  1N6A A;  1XNF A;  3MV2 B;  3RU0 A;  3CK9 A;  4RG9 A;  4BT8 A;  1PC2 A;  5KJM A;  3RO2 A;  4GA1 A;  5FTP A;  3M54 A;  1OUV A;  3KS2 A;  5T0K A;  4C1Q A;  3JYS A;  2FO7 A;  2IF4 A;  2KAT A;  5LSZ A;  1Y8M A;  4J7I A;  1HZ4 A;  2E2E A;  4U04 A;  2XGO A;  2HO1 A;  3F9W A;  3NF1 A;  4GCO A;  2JV0 A;  2RFI A;  4MI5 A;  4NJ5 A;  2LSV A;  4KXK B;  4J7F A;  4KBQ A;  4GZ6 A;  3IHX A;  4YPE A;  1FCH A;  3ZHE B;  2OOE A;  2VSY A;  3OPE A;  5BW8 C;  3VTY A;  5KJN A;  3SWC A;  1ELR A;  4G25 A;  2J9Q A;  4I1A A;  5CPR B;  4JHR A;  1KLX A;  1E96 B;  4BWR A;  3MO2 A;  5JIY A;  4BT9 A;  3LCA A;  3E4B A;  3CK7 A;  1NA3 A;  3ASD A;  3MO0 A;  4I51 A;  4UI9 J;  3CVQ A;  4J8F A;  4CGV A;  3KMA A;  2JLB A;  3RJW A;  2MHK A;  4G26 A;  4YNP A;  5G04 J;  2XCB A;  4N2Q A;  1IHG A;  2R3A A;  1HXI A;  3M55 A;  4UQY A;  5A7D B;  3IEG A;  5T0M A;  2YHC A;  4Y6W A;  2QPW A;  3MKR A;  3OXF A;  3CBO A;  4UQX A;  3VV0 A;  1NA0 A;  2QFC A;  5BT1 A;  5JJ6 A;  4U0U A;  2WPV A;  2HYZ A;  1HH8 A;  3OXG A;  2NC9 A;  3S7B A;  5TTF A;  4IJ8 A;  4WUY A;  5LCW C;  2XCC A;  5JJT A;  3FP3 A;  3RKV A;  3CBM A;  2PQN A;  3ZN3 A;  3FFL A;  4I9C A;  3WXX A;  2KCV A;  2VGY A;  4XI9 A;  4I2Z A;  5AYW D;  4NRH B;  3U4T A;  4BTA A;  3OOI A;  3SW9 A;  4YVQ C;  3F9Z A;  3M58 A;  4AY6 A;  1NZN A;  1WAO 1;  4CGW A;  3RO3 A;  1A17 A;  3PDN A;  3AS8 A;  3ZPJ A;  3F9X A;  4G2V A;  1N6C A;  2W5Y A;  4JL0 A;  4ABN A;  4WNE A;  4GZ3 A;  3M57 A;  2LSU A;  1TJC A;  5C1D A;  3HNA A;  3VTX A;  5JJ7 A;  3CVL A;  5DIZ A;  4AIF A;  4AM9 A;  4U07 A;  3BEE A;  2OND A;  4JLG A;  5JIN A;  4GA0 A;  5EX0 A;  3LPZ A;  5BNW A;  3K9I A;  3FPD A;  2DBA A;  1ZBP A;  4GPK A;  2IFU A;  4JDS A;  4GYO A;  2W5Z A;  4NVQ A;  3GZ1 A;  2VSN A;  3ULQ A;  5HQ8 A;  1QZ2 A;  2BQZ A;  1MVH A;  3Q47 B;  4U0Z A;  4W9R A;  3PE4 A;  1KT1 A;  2R5S A;  5FZR A;  3UPV A;  3MEK A;  4QEN A;  2FEZ A;  4HOR A;  5F5E A;  2PZI A;  4H7Y A;  1ZKK A;  2P58 C;  2V5F A;  3UUX A;  1ZU2 A;  3ZFW A;  1MUF A;  4AY5 A;  4HOQ A;  3KAE A;  4LEU A;  4BTB A;  4H12 A;  3DAL A;  4RZ0 A;  4HOU A;  3AS4 A;  2KCK A;  3CKB A;  4N5C A;  3ASF A;  2F69 A;  4BUP A;  5TEG A;  2O8J A;  5T5G A;  3N71 A;  5ARF A;  3KMT A;  2AVP A;  4Z4P A;  5TH7 A;  3FWV A;  4G23 A;  4A1S A;  3OXL A;  2Y4U A;  2C0L A;  4GA2 A;  5EKQ D;  3DB5 A;  1B89 A;  5F6L A;  3KD7 A;  4UQZ A;  3HYM B;  2C0M A;  1MVX A;  4GYW A;  5FT9 A;  3OS5 A;  3R9A B;  5D0O D;  4IJD A;  4H7X A;  3QWP A;  4MI0 A;  4NQ0 A;  4FMU A;  4I9E A;  2I6H A;  4N3B A;  5G05 C;  4QEP A;  3F9Y A;  4RG6 A;  4APO A;  5KJL A;  4U0S A;  2FI7 A;  3S8P A;  4O6F A;  4J83 A;  1YA0 A;  4I17 A;  3CVN A;  3ASG A;  3VUZ A;  3SZ7 A; 
#chains in the Genus database with same CATH topology
 1N3J A;  5BXU A;  1W3B A;  5JHN A;  2YIN A;  3NOG D;  3FTZ A;  3MO5 A;  3HVE B;  3MA5 A;  3VLD A;  3Q78 A;  2I1K A;  4CDR A;  3UKR G;  4FJY A;  1O5M A;  3DST A;  3CBP A;  5EG2 A;  1S0P A;  1MYO A;  2VSX E;  4B94 A;  2J4B A;  2BUG A;  1YMP A;  4AOF A;  5AQB A;  3JCK C;  3LY9 A;  5B1A E;  3I4G A;  4J0U A;  3D9L A;  2E0I A;  2XGS A;  2RKK A;  3S7D A;  2Q7F A;  3CKC A;  3PZD A;  1SQM A;  4OVV A;  5J08 A;  5CCM A;  3TGO A;  3SD5 A;  4IYP A;  3CVY A;  4U8V D;  3KMJ A;  2XS8 A;  2IGQ A;  4J8Y A;  1HS6 A;  5T8I A;  3J5P A;  3QAR A;  4GTT A;  3AG2 E;  4RVB A;  3S7F A;  3VLE A;  2AXZ A;  3PZ3 A;  5G05 J;  2XHE A;  4GTS A;  2WXR A;  4EZK A;  4HBD A;  3DXK G;  2P9P G;  5A6C A;  3R7Q A;  2EIN E;  2BKK B;  5ENO D;  2YQ8 A;  4RLY A;  4A55 A;  4J8E A;  2VGX B;  2F8Y A;  2WXN A;  2L6J A;  4UWH A;  4Y6C A;  2HR2 A;  4A3T A;  1E8W A;  5EX3 A;  2M63 A;  3JUI A;  2EIK E;  2VTB B;  2LXM A;  2OEV A;  2XPI A;  3JQ0 A;  4O30 A;  1MT6 A;  4CCA A;  3ZYK A;  4GZ5 A;  3ISM C;  4B0Z A;  3MX3 A;  1TNB A;  4Q69 A;  4JA7 A;  5F6K C;  4JPS A;  4YDY A;  1SZ9 A;  4UI9 C;  3G2V A;  1MJ0 A;  5FJY A;  2V8S E;  1QQE A;  3FY4 A;  3D9J A;  5G04 C;  2NYJ A;  2KCL A;  3HG0 D;  3GYZ A;  2I2O A;  2QC9 A;  3IBE A;  3FEX A;  3Q9N C;  4BT8 A;  2DYR E;  4RQI A;  4JHJ A;  3R7R A;  5LFA A;  2IOS A;  5T0K A;  4C1Q A;  4OAV B;  1Y8M A;  2CG3 A;  3AG3 E;  4ANU A;  3FUF A;  4DX2 A;  2HO1 A;  3C72 A;  3W9G A;  3F6Q A;  3O4Z A;  3ZW3 A;  5ANL A;  2R2L A;  1N9A A;  3P2B A;  1WY6 A;  3IHX A;  1Z3X A;  5D2M C;  4XKC A;  2L0I A;  3ZHE B;  1ZB1 A;  1N4Q A;  2ZIS A;  2HM8 A;  2VSY A;  4TUM A;  3VTY A;  3UM2 A;  1BD8 A;  3SWC A;  3PS6 A;  5ENS D;  3PRZ A;  5ITZ F;  4BY6 A;  1KLX A;  4APF A;  3MO2 A;  4BT9 A;  4MLP A;  4M7C A;  1NA3 A;  1EF1 C;  3TWT A;  4DX5 D;  3KMA A;  3FH5 A;  2JLB A;  3D3M A;  4YNP A;  4HLL A;  4V3I A;  2DCP A;  3D9H A;  1DVP A;  5T0M A;  4Y6W A;  3MKR A;  3OXF A;  2IOL A;  3IXE A;  2PM6 A;  4D10 C;  2QFC A;  1HH8 A;  3TWV A;  5TTF A;  2WXJ A;  3PRE A;  3DSV A;  4C48 B;  3DRA A;  4NIK A;  2VGY A;  5AYW D;  4NRH B;  4FLB A;  3HXB A;  3TWU A;  4PS7 A;  3OOI A;  3MYV A;  4YVQ C;  3F9Z A;  3EIQ C;  1ELK A;  5ENP D;  3RO3 A;  2XRY A;  4ATZ D;  2XEH A;  3ZYM A;  3APC A;  5AEN A;  1N6C A;  4LNB A;  4BEP A;  4UWG A;  1TNO A;  2P9S G;  3MKQ B;  2LSU A;  5C1D A;  2ETB A;  4A1G A;  4LNU D;  4C9B B;  3CVL A;  3G2S A;  5DIZ A;  4TXQ A;  4TV3 A;  4I1O B;  4HFG A;  1QNF A;  2IFU A;  3CVV A;  4DRX E;  2KZT B;  2RD0 A;  3ZUV B;  5HQ8 A;  1QZ2 A;  4JD2 G;  5CBO A;  4ILI A;  3MEK A;  4QEN A;  4EPZ A;  4HOR A;  2GRL A;  5AAR A;  3ENE A;  4B89 A;  2V5F A;  3TL5 A;  1JWF A;  1ZU2 A;  4AY5 A;  4HOQ A;  3FTU A;  1PAQ A;  5ENN A;  3DAL A;  4RZ0 A;  1X81 A;  2X6J A;  4CRW A;  1OWO A;  3ASF A;  2F69 A;  2I1J A;  1OCR E;  3N71 A;  4UWF A;  2P9K G;  4PH4 B;  5ARF A;  1OCC E;  4L2L A;  3KMT A;  2AVP A;  4HVB A;  1BI7 B;  3RK6 A;  4B8C B;  4HRM B;  5CRU A;  4DPR A;  5B3S E;  5EKQ D;  3DB5 A;  3EU9 A;  4UQZ A;  3NOC D;  4IJD A;  5AQ9 A;  4KVO A;  1Z5S C;  4B93 B;  4DI3 A;  3CQC B;  3DSU A;  2CHX A;  3TWW A;  3PZ1 A;  4KMO A;  4N3B A;  4APO A;  5KJL A;  2FI7 A;  3LVQ E;  4O6F A;  2GRN B;  4HI9 A;  3FUD A;  3SZ7 A;  3FU6 A;  1S70 B;  2PQR A;  4A63 B;  3SNX A;  2ZGG A;  4HQD A;  4E47 A;  2WXI A;  2GRQ B;  3SGH A;  4F3V A;  2Y4T A;  1Z6T A;  4YVO A;  4G1T A;  3C5R A;  4EQF A;  3PEV B;  2FO1 E;  2ZGD A;  3MCX A;  4ME2 A;  5EIB E;  3QB2 A;  3JQ1 A;  4YDE A;  2A5U A;  1N0Q A;  4JW1 A;  4N2S A;  2YNQ A;  4JVS A;  3UXG A;  3LS8 A;  2PL2 A;  4EZJ A;  2G46 A;  4IN3 B;  4GTV A;  2WQ7 A;  3S7J A;  3UIO C;  5AYF A;  4F6R D;  3AS5 A;  3EP0 A;  1Y6I A;  3DPY A;  4HOT A;  3G2W A;  2UY1 A;  3SY2 A;  1JCR A;  1H2V C;  3CV0 A;  2AXU A;  4AVX A;  1NI1 A;  2FF4 A;  4BFR A;  1TEZ A;  3RAY A;  3G2U A;  3ZYQ A;  4DUI A;  3V30 A;  1K8K G;  3SBT B;  3BU8 A;  2VSO E;  3FUH A;  5A23 A;  3MJW A;  4N3C A;  3UIP C;  2H6H A;  5ARG A;  1N54 A;  4NUR A;  5E75 A;  3B13 A;  3RQ4 A;  3CHM A;  3BO5 A;  1TJF A;  2XEV A;  4XKB A;  3LKU A;  4E85 A;  3M56 A;  2P9I G;  3RJV A;  4JA9 A;  1MX4 A;  4F1S A;  4QFV A;  3Q7A A;  1ELW A;  5B1B E;  3CEQ A;  4GTP A;  4CT4 A;  1IQR A;  1P5Q A;  3E34 A;  3LY8 A;  2UWJ G;  4JC8 A;  2J09 A;  5FQ6 A;  3EDT B;  2LAI A;  1H3I A;  2BF0 X;  4XIF A;  1WM5 A;  4DK5 A;  3LEW A;  4F1P A;  3D9I A;  2R02 A;  3QOU A;  5EID A;  4BER A;  2PM7 A;  3UQ3 A;  3AG1 E;  2WQH A;  4ZFH A;  3TWQ A;  4ILG A;  5EYL A;  2WVI A;  4AP2 A;  3TG4 A;  4LSZ E;  1E8Z A;  4F53 A;  4CDM A;  3CK9 A;  3EHR A;  3Q73 A;  3B7T A;  1PC2 A;  1OCO E;  3FUM A;  4J8S A;  4GMJ A;  4KZC A;  2NXP A;  3Q9U C;  1UJK A;  2AWI A;  3I3N A;  4GTO A;  5AIJ A;  3NBN B;  1JCQ A;  1E7U A;  3CIA A;  1HZ4 A;  3DEO A;  2XGO A;  2R03 A;  3F9W A;  3NF1 A;  2GRM A;  4U8H A;  3FUI A;  3FTW A;  4MI5 A;  4NJ5 A;  2LSV A;  3CR3 A;  3AU5 A;  4J7F A;  1YYH A;  2WB2 A;  2J8S D;  3ABM E;  3UX4 A;  3CHS A;  3ABL E;  4EHM A;  1BU9 A;  3FTS A;  2J9Q A;  4FJZ A;  2L6B A;  3DSX A;  5FQ4 A;  4I1A A;  3UKU G;  2R05 A;  3RRM B;  4JHR A;  5T3R A;  3QNK A;  3LCA A;  1LTX A;  1E7V A;  4BSZ B;  1TN7 A;  3ASD A;  4I51 A;  4UI9 J;  4J8F A;  5ANR A;  4FC8 A;  4WAF A;  5JMN D;  2EIJ E;  1DCQ A;  5G04 J;  3ML8 A;  2ETC A;  4HS2 A;  2HE0 A;  3DBS A;  3UTM A;  4FHJ A;  3M55 A;  5LP0 A;  2RFM A;  1WDY A;  4YDO A;  2MYO A;  3T9K A;  4UQY A;  5CMY A;  5A7D B;  5FQ8 A;  2QPW A;  1NA0 A;  4LCT A;  1OWN A;  4U0U A;  2WPV A;  2HYZ A;  1OWM A;  3OXG A;  3C98 A;  4WUY A;  1DCE A;  2XCC A;  4OAU C;  4FLH A;  4HRN A;  3CBM A;  2PQN A;  3FFL A;  3WXX A;  1FT1 A;  3PUJ A;  3ZYL A;  4I2Z A;  3U4T A;  1KPS B;  1TN8 A;  3FHE A;  3SW9 A;  3KEA A;  4GML A;  3IHV A;  3V31 A;  4AY6 A;  1NZN A;  2P9L G;  1E90 A;  2WXM A;  3ZIM A;  3F9X A;  3PZ4 A;  3CST A;  2W5Y A;  4JL0 A;  1INZ A;  2KM4 A;  3IKO B;  3U64 A;  4WNE A;  1SVX A;  5FIO A;  4BX8 A;  5C2Y A;  2JAB A;  1TJC A;  2V5Q C;  3VTX A;  3ONK A;  3ZU7 B;  1V54 E;  4DX7 D;  4AM9 A;  4U07 A;  1TR4 A;  5JIN A;  2WXH A;  5EX0 A;  1MQS A;  3ZVV A;  3L6A A;  2DBA A;  1ZBP A;  4GB9 A;  2W5Z A;  5ENR D;  3GZ1 A;  3NQP A;  3V2O A;  3VLF A;  3D9K A;  4U0Z A;  1KT1 A;  3BUA A;  2CFU A;  2KXP C;  3BG1 B;  4K0R A;  1SA4 A;  1MX2 A;  4H7Y A;  5CBN A;  3APF A;  4ZHB A;  4U7E B;  3UUX A;  5BXO A;  3PZ2 A;  3QAQ A;  3KAE A;  4LEU A;  2DIW A;  3NB2 A;  4H12 A;  2WXK A;  1KZO A;  2V0P A;  5TEG A;  1N4P A;  5T5G A;  4XX5 A;  5TH7 A;  1TNY A;  4G23 A;  4YDW A;  4GU5 A;  2L9B A;  3OXL A;  1QBQ A;  1B89 A;  1UJJ A;  1TNZ A;  1MZC A;  1OT8 A;  3HRA A;  3SFX A;  2C0M A;  1K1B A;  3C3R A;  3JXI A;  4GYW A;  5FT9 A;  3GZS A;  2F37 A;  1DC2 A;  3R9A B;  1U2V G;  1IHB A;  1AP7 A;  4KVM A;  4UUC A;  3SHF A;  3EHM A;  3QWP A;  4U63 A;  2JEK A;  1UN9 A;  3QC1 A;  2V4L A;  3AG4 E;  2AXV A;  3R9M A;  3F9Y A;  4RG6 A;  1O1T A;  4U0S A;  2OV8 A;  2ION A;  3ULE G;  4KZ0 A;  1OWL A;  2F8X K;  4J83 A;  2LO6 A;  1YA0 A;  3C3Q A;  4I17 A;  2H6G A;  5KNG A;  3W9F A;  1E8X A;  3ZXS A;  3ASG A;  4A3V A;  4WNF A;  3I5P A;  4TXP A;  4YPA A;  2GRP B;  3EU5 A;  4HNA D;  2J4D A;  3NZU A;  3Q49 B;  5ENQ D;  4URK A;  5M72 A;  3ASH A;  3QKY A;  5T4Y A;  2XGM A;  4AV7 A;  2XS1 A;  4XZ4 A;  2WMN A;  2VQ2 A;  3OTN A;  3ULY A;  2LNI A;  4U96 D;  1NP7 A;  2FUL A;  2CG2 A;  1SW6 A;  3UM0 A;  3TWR A;  4AEZ C;  2RFA A;  4XEI G;  1SA5 A;  2VJ8 A;  5LCW J;  5LSX A;  1HE8 A;  3FUL A;  3CHQ A;  3FH7 A;  4GCN A;  3GW4 A;  4WWO A;  5HKP A;  3RAU A;  3Q5M A;  4J8D A;  3HDX A;  5BV0 A;  3QDN A;  3OAW A;  3QJZ A;  1FVF A;  3AAA C;  1K3Z D;  1WG0 A;  2J08 A;  5FWQ A;  1HG5 A;  3B7R L;  3CVX A;  4J8O A;  1KT0 A;  2XPY A;  4DLQ A;  4GTM A;  4HXI A;  3M5A A;  1O9S A;  4LG6 A;  4UWL A;  4G24 A;  1AWC B;  5JHB A;  1BPO A;  2KC7 A;  1G3N B;  3MV3 B;  1V55 E;  5DBK A;  3UT8 A;  5CMW A;  3M53 A;  2UY1 B;  4Q94 A;  3O48 A;  4YPU A;  1VDY A;  4K5B A;  4HOS A;  1O1S A;  2C2L A;  3LY7 A;  4JHK A;  2B0O E;  2Y0B G;  3ZKJ A;  4KYO B;  4WNG A;  3SF4 A;  3PE3 A;  4N5Q A;  3DSW A;  2FBN A;  4GAA A;  1YCS B;  1H2U A;  3QWW A;  2I9C A;  3EHN A;  2XEE A;  3QK0 A;  5EN5 D;  1XNF A;  3MV2 B;  4RG9 A;  3ZRH A;  2CFZ A;  2J49 A;  1N4R A;  4WWP A;  3RO2 A;  3M54 A;  1FT2 A;  3UM3 A;  4L1B A;  2FO7 A;  3IV0 A;  2KAT A;  5LSZ A;  1S64 A;  4I1M A;  2DVW A;  4J7I A;  2IU1 A;  1D8D A;  1XGW A;  4GCO A;  2JV0 A;  2RFI A;  3TXM A;  5AQA A;  1A5E A;  4KXK B;  4KBQ A;  4GZ6 A;  1H6P A;  1EYH A;  4YPE A;  4TUU A;  4L23 A;  3L16 A;  2XEN A;  2OOE A;  3DWL G;  3B95 A;  1S63 A;  2OEW A;  3SQV A;  3S2A A;  4G25 A;  3SFZ A;  1N0R A;  3UI2 A;  1OCZ E;  3CGH A;  1E96 B;  1SZA A;  2ETA A;  4BWR A;  4RSY A;  5JIY A;  4FHK A;  5BUZ A;  3P1U A;  3CK7 A;  3V79 K;  2GRO B;  5AJD A;  3CVQ A;  4R7L A;  2X38 A;  2AJA A;  3RJW A;  2MHK A;  4G26 A;  1H0A A;  3B7B A;  4M3O A;  3LJN A;  2R3A A;  1HXI A;  2XZT G;  2A5E A;  2XQ0 A;  2BKG A;  4HB5 A;  3CBO A;  4UQX A;  2WXF A;  4ANW A;  4I6J A;  3ONL A;  5JJ6 A;  1TNU A;  4KT6 B;  4G8K A;  4IJ8 A;  1MX6 A;  5AQ7 A;  1JUQ A;  3FP3 A;  3ZN3 A;  4I9C A;  2KCV A;  4IRU A;  3FU3 A;  3PH0 C;  4PUC A;  1EPU A;  2DZN A;  3CHP A;  3HHM A;  4BTA A;  2ZIR A;  3T8K A;  3APD A;  1FVH A;  1O1R A;  3Q75 A;  4I6E A;  4ATG A;  3CVW A;  3PDN A;  3AS8 A;  2IEJ A;  4G2V A;  3D9N A;  1IXV A;  4IUL A;  4ABN A;  4F7A A;  3M57 A;  4CT0 A;  3PNL B;  4ANV A;  3BQO A;  3HNA A;  2IJG X;  4O1O A;  3L54 A;  1UN8 A;  3EIJ A;  4AIF A;  3BEE A;  3FUE A;  2Y1L E;  4GA0 A;  2BED A;  5BNW A;  3TWX A;  3ML9 A;  3IHY A;  3ASN E;  4JDS A;  4GYO A;  4MBG A;  5G55 A;  4NVQ A;  2WXG A;  2VSN A;  3TWS A;  1UW4 B;  5CER B;  1MVH A;  4W9R A;  3RRN B;  3PE4 A;  2GGF A;  2R5S A;  1BLX B;  3UPV A;  3ZXP A;  5EIL A;  3FTY A;  2FEZ A;  3UT4 A;  2NSZ A;  4J6I A;  2P58 C;  5E76 A;  1KZP A;  1MUF A;  4BTB A;  2QYU A;  4HOU A;  3CKB A;  3KSQ A;  1N52 A;  3LJ3 A;  3BG0 B;  3RSE G;  4ILH B;  3HXE A;  3FWV A;  3TXN A;  4FA6 A;  4FU3 A;  4EBA A;  3UT7 A;  4GTR A;  2EIL E;  4JEU A;  3HVE A;  4CYM D;  2Y4U A;  2EIM E;  3X2Q E;  2C0L A;  4GA2 A;  4PS8 A;  3ESL A;  5FQ7 A;  5F6L A;  2P2C P;  3KD7 A;  3HYM B;  2EQX A;  3FUK A;  5D0O D;  1D8E A;  5G2N A;  2L0T B;  4NQ0 A;  2WXO A;  4FMU A;  2F0Y A;  3WG7 E;  4I9E A;  1TN6 A;  2I6H A;  2IO3 C;  5G05 C;  4OVU A;  1H6K A;  4CZ2 D;  2YHE A;  2X6K A;  4I43 A;  3L13 A;  3L17 A;  4GZC A;  1N94 A;  1X5B A;  3HXC A;  4I6G A;  3Q4A B;  4Q96 A;  3SBS A;  3U3W A;  4FP7 A;  3LYA A;  3DSS A;  4DX1 A;  4YNM A;  3Q79 A;  3TAX A;  2AW6 A;  1QYM A;  4UWK A;  5JJ0 A;  3E37 A;  4XE0 A;  2ZU6 B;  5AAO A;  4EZL A;  4AXH A;  5CCL A;  3E33 A;  4HRL A;  5D0Q D;  2X3M A;  5LOZ A;  4LNG A;  4ACL A;  3E30 A;  2GW1 A;  2VGX A;  2VYI A;  5IY5 E;  3CHO A;  4C0E A;  3L9T A;  3KSL A;  3UMV A;  5KCM A;  2GRR B;  3B7S A;  1N11 A;  2H6F A;  4PS3 A;  4LDG A;  3GZ2 A;  3UIN C;  4DLO A;  5KJK A;  1XQH A;  1DNP A;  4GMR A;  4L2Y A;  5H7P A;  5CHE E;  2VTB A;  4I2W A;  3K5K A;  1D9S A;  3RIB A;  3B7U X;  3CSF A;  4NAC A;  3ESK A;  1HF8 A;  5FZS A;  3CK8 A;  1BI8 B;  2PNN A;  4WND A;  4QQI A;  2VGE A;  4TXR A;  1JPL A;  3M59 A;  2IY0 C;  4CEM A;  4LRZ A;  3JXJ A;  5CEA A;  1NFI E;  2BTD A;  4YND A;  2LAH A;  4BET A;  3SFY A;  4DX6 D;  5BV1 A;  4PDX A;  4N39 A;  1IQU A;  5EYP F;  1IYG A;  5F59 A;  2DZO A;  4L7T A;  2CHW A;  2MRI A;  5FZQ A;  4G8L A;  3CVP A;  1HG2 A;  4N3A A;  1OWP A;  3PNT B;  5BPP A;  3QWV A;  4UI9 K;  3I4R B;  1ML9 A;  1RZ4 A;  4K5C A;  4GZD A;  3LVR E;  3TJP A;  3LDZ A;  3FU5 A;  3DPD A;  5AJL A;  1PEG A;  4AU7 A;  1PY1 A;  3CVU A;  2RG8 A;  4MRU A;  3URZ A;  1L5J A;  1EDU A;  3ZHE A;  1U3C A;  3NZS A;  2ILR A;  5HS0 A;  3TG5 A;  1MHQ A;  4QEO A;  2OVF A;  5J90 A;  3PEU B;  3HXD A;  3C3O A;  4GYY A;  5HI7 A;  4FAD A;  3E32 A;  1NL4 A;  3Q15 A;  3DXM G;  5AN8 A;  3SO8 A;  4XI0 A;  3ZGQ A;  1N6A A;  3RU0 A;  2J07 A;  2X6I A;  5KJM A;  3FUJ A;  4GA1 A;  5FTP A;  4BSX A;  1OUV A;  2H6I A;  2WM9 A;  3KS2 A;  4Z68 A;  4K03 A;  1Z3Y A;  3JYS A;  2R17 C;  4P29 A;  1K1A A;  2LXL A;  2IF4 A;  2QY7 A;  2E2E A;  3ZNG A;  3J5Q B;  4WWN A;  4U04 A;  1HX8 A;  3ABK E;  4LUN U;  4O1P A;  4J7W A;  2A4Z A;  2Y69 E;  2XRZ A;  2R59 A;  2B6C A;  1FCH A;  5D66 A;  3OPE A;  4OYS A;  4LER A;  5JA4 D;  1OY3 D;  5BW8 C;  5KJN A;  1U3D A;  1ELR A;  3D9P A;  3FUN A;  2IQC A;  4JXT A;  5CPR B;  1HO8 A;  4MS6 A;  4GTQ A;  3FDH A;  2XZD G;  3E4B A;  3FU0 A;  5KWD A;  3MO0 A;  3MGB A;  4DI4 A;  1RW2 A;  4CGV A;  4EEC A;  4GPM A;  4CDN A;  4ACK A;  2LUH A;  2XCB A;  3D9O A;  3ASO E;  4N2Q A;  1IHG A;  4BX9 A;  3MKQ A;  2QZA A;  1H2T C;  1LD8 A;  2WXL A;  3IEG A;  5JHA A;  5EDS A;  2YHC A;  4K5A B;  2WQ6 A;  3VV0 A;  3CLJ A;  2OCC E;  5BT1 A;  5CEC B;  3HIZ A;  2KBX A;  5FIN A;  3S7B A;  3L08 A;  2NC9 A;  5LCW C;  3T8M A;  2ZXW E;  5JJT A;  3RKV A;  2KZT A;  3CHR A;  4XI9 A;  4JB8 P;  1N4S A;  1E8Y A;  2CHZ A;  2IO2 C;  4MKT A;  3UM1 A;  4JZY A;  4BES A;  3AU4 A;  2WXQ A;  3M58 A;  1TYQ G;  3EJN A;  3U66 A;  5ENT D;  1WAO 1;  4CGW A;  1A17 A;  4TRQ A;  3EHQ A;  3ZPJ A;  5KBA A;  5CRV A;  3ZEF A;  3FH8 A;  2X6H A;  2Y3A A;  4GZ3 A;  2WXP A;  3V2X A;  1LD7 A;  1OXJ A;  5JJ7 A;  3HXF A;  3RRU A;  2OND A;  4JLG A;  1UOH A;  3PUK A;  4FUL A;  3LPZ A;  3PVL A;  4U95 D;  3K9I A;  1Q2Z A;  2XPZ A;  3FPD A;  4HI8 A;  4GPK A;  2P9N G;  4E6H A;  3ULQ A;  3L82 A;  4C0M A;  2BQZ A;  3Q47 B;  3EUV A;  3SI5 A;  5FZR A;  3AJI A;  5KNH D;  5F5E A;  4DJA A;  4G11 A;  2PZI A;  1ZKK A;  4L9P A;  3MZL B;  3ZFW A;  4ANX A;  3D9M A;  3L22 A;  3DEP A;  2P9U G;  4EBA G;  3AS4 A;  1HFA A;  2KCK A;  3CQG B;  4N5C A;  4BUP A;  2MOW A;  4HLE A;  2O8J A;  1GW6 A;  1UG3 A;  3U9W A;  4B8A A;  3T5X A;  4Z4P A;  3KEZ A;  1IKN D;  2QYJ A;  4A1S A;  1LF8 A;  1H19 A;  3LXU X;  1JCS A;  3Q7F A;  4X8Q A;  5LX8 A;  1HU3 A;  1H6O A;  1MVX A;  5HRY A;  3OS5 A;  1N95 A;  1FPP A;  3T5V A;  2OVB A;  2WMO A;  3FTX A;  4H7X A;  4MI0 A;  3NAW A;  2V4H C;  4O60 A;  4U8Y D;  4QEP A;  1JWG A;  5CED B;  3JUE A;  3S8P A;  2DWZ A;  3FEY A;  3G2T A;  4JEH A;  2DYS E;  3CVN A;  2X6F A;  4AJW A;  3FTV A;  3VUZ A; 
#chains in the Genus database with same CATH homology
 3FU6 A;  1N3J A;  2PQR A;  4WNF A;  3SNX A;  1X5B A;  3I5P A;  4E47 A;  1W3B A;  4I6G A;  5JHN A;  2WXI A;  2YIN A;  3Q4A B;  4Q96 A;  4YPA A;  3SBS A;  3SGH A;  3U3W A;  4FP7 A;  2J4D A;  3LYA A;  4F3V A;  2Y4T A;  1Z6T A;  3FTZ A;  4YVO A;  3NZU A;  3MO5 A;  4YNM A;  3Q49 B;  4G1T A;  3TAX A;  4EQF A;  2AW6 A;  3HVE B;  3MA5 A;  3PEV B;  4UWK A;  3VLD A;  5JJ0 A;  2I1K A;  4CDR A;  3MCX A;  4ME2 A;  4XE0 A;  3QB2 A;  4URK A;  5M72 A;  2ZU6 B;  3JQ1 A;  3ASH A;  4FJY A;  2A5U A;  3QKY A;  5T4Y A;  4EZL A;  4AXH A;  2XGM A;  5CCL A;  4AV7 A;  3CBP A;  5EG2 A;  1S0P A;  4JW1 A;  5D0Q D;  4N2S A;  4B94 A;  2VSX E;  2X3M A;  2YNQ A;  5LOZ A;  2J4B A;  4XZ4 A;  4JVS A;  4ACL A;  2GW1 A;  2VGX A;  3LS8 A;  2BUG A;  2VYI A;  2WMN A;  2VQ2 A;  3CHO A;  2PL2 A;  4C0E A;  4EZJ A;  2G46 A;  4AOF A;  3OTN A;  3UMV A;  5KCM A;  4PS3 A;  3B7S A;  4IN3 B;  4LDG A;  3JCK C;  3LY9 A;  2LNI A;  3GZ2 A;  3I4G A;  4J0U A;  1NP7 A;  4DLO A;  2FUL A;  5KJK A;  2WQ7 A;  2CG2 A;  3D9L A;  3S7J A;  2E0I A;  1XQH A;  5AYF A;  1DNP A;  4L2Y A;  5CHE E;  2VTB A;  3AS5 A;  4I2W A;  4AEZ C;  3EP0 A;  1Y6I A;  2XGS A;  3S7D A;  4HOT A;  3K5K A;  2Q7F A;  3CKC A;  3PZD A;  3RIB A;  1SQM A;  3B7U X;  3CSF A;  2UY1 A;  3G2W A;  4NAC A;  4OVV A;  5J08 A;  2VJ8 A;  1H2V C;  3ESK A;  5CCM A;  3TGO A;  1HF8 A;  3CV0 A;  5FZS A;  5LCW J;  2AXU A;  3CK8 A;  3SD5 A;  5LSX A;  4IYP A;  4AVX A;  3CVY A;  4WND A;  1HE8 A;  3FUL A;  3KMJ A;  2IGQ A;  5T8I A;  1HS6 A;  2FF4 A;  4BFR A;  1TEZ A;  3QAR A;  3CHQ A;  3G2U A;  3RAY A;  4RVB A;  3S7F A;  1JPL A;  3FH7 A;  3VLE A;  3ZYQ A;  2AXZ A;  4GCN A;  5G05 J;  3M59 A;  3GW4 A;  4WWO A;  3Q5M A;  2XHE A;  4J8D A;  2WXR A;  3HDX A;  5BV0 A;  3QDN A;  4CEM A;  4EZK A;  3OAW A;  3SBT B;  4LRZ A;  2VSO E;  3FUH A;  3QJZ A;  5A23 A;  3MJW A;  4N3C A;  1FVF A;  2BTD A;  5A6C A;  4YND A;  2LAH A;  5ARG A;  3R7Q A;  1N54 A;  4NUR A;  5BV1 A;  2J08 A;  4PDX A;  4N39 A;  3B13 A;  2YQ8 A;  3CHM A;  5E75 A;  1IQU A;  3BO5 A;  3RQ4 A;  5FWQ A;  1IYG A;  5F59 A;  4L7T A;  1TJF A;  1HG5 A;  2CHW A;  2XEV A;  2MRI A;  3B7R L;  4XKB A;  4A55 A;  3LKU A;  4J8E A;  3CVX A;  4J8O A;  5FZQ A;  2VGX B;  3CVP A;  1HG2 A;  1KT0 A;  2XPY A;  4E85 A;  4DLQ A;  3M56 A;  3RJV A;  2WXN A;  4JA9 A;  4N3A A;  4HXI A;  4F1S A;  2L6J A;  4UWH A;  1O9S A;  3M5A A;  4UWL A;  1OWP A;  4QFV A;  3PNT B;  4G24 A;  4Y6C A;  2HR2 A;  4A3T A;  3QWV A;  5BPP A;  4UI9 K;  3I4R B;  1ELW A;  1E8W A;  5JHB A;  5EX3 A;  2M63 A;  3JUI A;  1ML9 A;  1BPO A;  2KC7 A;  3CEQ A;  4CT4 A;  1IQR A;  1P5Q A;  2VTB B;  4AU7 A;  4GZD A;  3MV3 B;  5DBK A;  3LVR E;  3UT8 A;  2XPI A;  3JQ0 A;  5CMW A;  3M53 A;  3TJP A;  3LY8 A;  4O30 A;  2UWJ G;  4JC8 A;  2UY1 B;  3LDZ A;  1MT6 A;  2J09 A;  3FU5 A;  4Q94 A;  5FQ6 A;  4CCA A;  3EDT B;  2LAI A;  3DPD A;  1H3I A;  5AJL A;  2BF0 X;  3O48 A;  4GZ5 A;  4XIF A;  3ZYK A;  1PY1 A;  1WM5 A;  4DK5 A;  4B0Z A;  1VDY A;  2RG8 A;  3CVU A;  4YPU A;  4HOS A;  2C2L A;  4MRU A;  3LEW A;  3MX3 A;  3LY7 A;  4JHK A;  4HOR A;  3URZ A;  3D9I A;  1L5J A;  1EDU A;  3ZHE A;  3QOU A;  4KYO B;  4Q69 A;  1U3C A;  4JA7 A;  5F6K C;  3NZS A;  4WNG A;  2ILR A;  4JPS A;  3SF4 A;  2PM7 A;  3UQ3 A;  3TG5 A;  3PE3 A;  1MHQ A;  1SZ9 A;  4QEO A;  2OVF A;  5J90 A;  3PEU B;  2WQH A;  4UI9 C;  3G2V A;  2FBN A;  5FJY A;  4GAA A;  2V8S E;  5HI7 A;  4GYY A;  1H2U A;  4ILG A;  4FAD A;  1QQE A;  3FY4 A;  2WVI A;  3Q15 A;  4AP2 A;  3D9J A;  3QWW A;  5G04 C;  3TG4 A;  4XI0 A;  2I9C A;  2KCL A;  3EHN A;  1E8Z A;  4F53 A;  3ZGQ A;  3GYZ A;  3QK0 A;  2I2O A;  1N6A A;  1XNF A;  3IBE A;  3MV2 B;  3FEX A;  3RU0 A;  4CDM A;  3CK9 A;  4RG9 A;  2J07 A;  4BT8 A;  3ZRH A;  2CFZ A;  2J49 A;  2X6I A;  3B7T A;  1PC2 A;  5KJM A;  3FUJ A;  4JHJ A;  4WWP A;  3RO2 A;  3FUM A;  4GA1 A;  4J8S A;  5FTP A;  3R7R A;  4BSX A;  4GMJ A;  3M54 A;  1OUV A;  2WM9 A;  3KS2 A;  4KZC A;  5LFA A;  2IOS A;  5T0K A;  4C1Q A;  2NXP A;  4K03 A;  1Z3Y A;  4L1B A;  1UJK A;  2AWI A;  3JYS A;  2FO7 A;  3I3N A;  3IV0 A;  2R17 C;  4P29 A;  5AIJ A;  2IF4 A;  1E7U A;  2KAT A;  5LSZ A;  2QY7 A;  1Y8M A;  2CG3 A;  4J7I A;  4I1M A;  3CIA A;  1HZ4 A;  2E2E A;  2IU1 A;  4WWN A;  4U04 A;  4ANU A;  3FUF A;  1HX8 A;  4LUN U;  2XGO A;  1XGW A;  2HO1 A;  3F9W A;  3NF1 A;  4GCO A;  2A4Z A;  2GRM A;  4U8H A;  3O4Z A;  3ZW3 A;  3FUI A;  5ANL A;  2JV0 A;  2RFI A;  3FTW A;  4MI5 A;  3TXM A;  4NJ5 A;  2LSV A;  3CR3 A;  4KXK B;  3AU5 A;  3P2B A;  4KBQ A;  4J7F A;  2XRZ A;  2R59 A;  4GZ6 A;  1WY6 A;  1EYH A;  3IHX A;  2WB2 A;  4YPE A;  4TUU A;  4L23 A;  1Z3X A;  4XKC A;  2L0I A;  3L16 A;  1FCH A;  3ZHE B;  2OOE A;  2HM8 A;  2VSY A;  4OYS A;  3OPE A;  4LER A;  3UX4 A;  3CHS A;  5BW8 C;  3VTY A;  5KJN A;  3SWC A;  1U3D A;  3PS6 A;  3S2A A;  1ELR A;  4G25 A;  3SFZ A;  3FTS A;  2J9Q A;  4FJZ A;  3PRZ A;  5FQ4 A;  3D9P A;  3FUN A;  2IQC A;  4I1A A;  4JXT A;  5CPR B;  1HO8 A;  4MS6 A;  3RRM B;  3FDH A;  3CGH A;  4JHR A;  4BY6 A;  5T3R A;  3QNK A;  1KLX A;  4APF A;  1E96 B;  1SZA A;  4BWR A;  4RSY A;  3MO2 A;  5JIY A;  4BT9 A;  3LCA A;  4FHK A;  5BUZ A;  3P1U A;  3E4B A;  4MLP A;  3CK7 A;  1NA3 A;  1EF1 C;  3FU0 A;  1E7V A;  3ASD A;  3MO0 A;  3MGB A;  4I51 A;  4UI9 J;  4DI4 A;  5AJD A;  3CVQ A;  4J8F A;  4R7L A;  4CGV A;  5ANR A;  4FC8 A;  3KMA A;  4EEC A;  3FH5 A;  4WAF A;  2X38 A;  2JLB A;  3RJW A;  2MHK A;  4G26 A;  4CDN A;  3D3M A;  1H0A A;  5G04 J;  4YNP A;  4ACK A;  2XCB A;  3D9O A;  3ML8 A;  4M3O A;  4V3I A;  4N2Q A;  1IHG A;  2DCP A;  4HS2 A;  3MKQ A;  4BX9 A;  2R3A A;  3DBS A;  1HXI A;  4FHJ A;  3M55 A;  5LP0 A;  1DVP A;  1H2T C;  4UQY A;  5CMY A;  5A7D B;  2WXL A;  3IEG A;  5T0M A;  5JHA A;  5EDS A;  2YHC A;  4Y6W A;  2XQ0 A;  5FQ8 A;  2QPW A;  3MKR A;  2WQ6 A;  3OXF A;  3CBO A;  2IOL A;  4UQX A;  2WXF A;  2PM6 A;  4ANW A;  4D10 C;  3CLJ A;  4I6J A;  3VV0 A;  1NA0 A;  2QFC A;  4LCT A;  3ONL A;  5BT1 A;  1OWN A;  3HIZ A;  5JJ6 A;  4U0U A;  2WPV A;  2HYZ A;  1OWM A;  1HH8 A;  3L08 A;  2NC9 A;  3C98 A;  3OXG A;  4KT6 B;  3S7B A;  5TTF A;  4IJ8 A;  4WUY A;  5LCW C;  2XCC A;  3T8M A;  2WXJ A;  4FLH A;  1JUQ A;  5JJT A;  3FP3 A;  3RKV A;  3PRE A;  3CBM A;  2KZT A;  2PQN A;  3ZN3 A;  3CHR A;  3FFL A;  4I9C A;  3WXX A;  2KCV A;  2VGY A;  4IRU A;  3PUJ A;  4XI9 A;  3FU3 A;  3PH0 C;  3ZYL A;  1E8Y A;  4I2Z A;  2CHZ A;  4PUC A;  4MKT A;  1EPU A;  4NRH B;  5AYW D;  3U4T A;  3CHP A;  4FLB A;  4JZY A;  3HHM A;  4BTA A;  4PS7 A;  3FHE A;  3OOI A;  3APD A;  3MYV A;  3SW9 A;  1FVH A;  4YVQ C;  3AU4 A;  3F9Z A;  3EIQ C;  2WXQ A;  3M58 A;  4GML A;  3IHV A;  3EJN A;  3U66 A;  4AY6 A;  1NZN A;  1WAO 1;  4I6E A;  1ELK A;  4CGW A;  3RO3 A;  1A17 A;  4ATG A;  1E90 A;  2WXM A;  4TRQ A;  3CVW A;  3PDN A;  3AS8 A;  3ZIM A;  2XRY A;  3ZPJ A;  3F9X A;  4G2V A;  3D9N A;  3ZEF A;  3CST A;  3FH8 A;  3ZYM A;  3APC A;  2X6H A;  4IUL A;  5AEN A;  4JL0 A;  1INZ A;  2Y3A A;  1N6C A;  2KM4 A;  2W5Y A;  3IKO B;  3U64 A;  4UWG A;  4WNE A;  4GZ3 A;  4ABN A;  4F7A A;  3M57 A;  2WXP A;  4CT0 A;  3MKQ B;  4BX8 A;  5C2Y A;  2LSU A;  3PNL B;  4ANV A;  1TJC A;  5C1D A;  4A1G A;  3HNA A;  2IJG X;  3VTX A;  5JJ7 A;  3L54 A;  4C9B B;  3CVL A;  3G2S A;  3ONK A;  5DIZ A;  1UN8 A;  3EIJ A;  4AIF A;  4AM9 A;  4U07 A;  3RRU A;  3BEE A;  2OND A;  3FUE A;  4JLG A;  5JIN A;  4GA0 A;  2WXH A;  3PUK A;  3LPZ A;  4FUL A;  4TV3 A;  1MQS A;  3PVL A;  5EX0 A;  3ZVV A;  5BNW A;  3K9I A;  4I1O B;  2XPZ A;  3L6A A;  1QNF A;  4HFG A;  3ML9 A;  3FPD A;  2DBA A;  3IHY A;  1ZBP A;  4GPK A;  2IFU A;  4JDS A;  4GYO A;  4GB9 A;  5G55 A;  3CVV A;  2W5Z A;  5F5E A;  4NVQ A;  2WXG A;  3GZ1 A;  2KZT B;  2RD0 A;  4E6H A;  2VSN A;  3ULQ A;  3NQP A;  5HQ8 A;  1QZ2 A;  1UW4 B;  4C0M A;  2BQZ A;  1MVH A;  3Q47 B;  3VLF A;  3D9K A;  4U0Z A;  3PE4 A;  4W9R A;  1KT1 A;  3RRN B;  2CFU A;  3SI5 A;  2GGF A;  2R5S A;  5FZR A;  4ILI A;  3UPV A;  3MEK A;  4QEN A;  3BG1 B;  2FEZ A;  3FTY A;  3UT4 A;  4EPZ A;  4DJA A;  4G11 A;  2NSZ A;  4K0R A;  2GRL A;  2PZI A;  4J6I A;  4H7Y A;  1ZKK A;  2P58 C;  3APF A;  3ENE A;  5E76 A;  4B89 A;  2V5F A;  3TL5 A;  3UUX A;  1JWF A;  1ZU2 A;  3MZL B;  3ZFW A;  4AY5 A;  1MUF A;  4HOQ A;  4ANX A;  3D9M A;  1PAQ A;  3FTU A;  3QAQ A;  3L22 A;  3KAE A;  4LEU A;  5ENN A;  4BTB A;  4EBA G;  2DIW A;  4H12 A;  3DAL A;  2WXK A;  4RZ0 A;  2V0P A;  4HOU A;  3AS4 A;  1HFA A;  2KCK A;  3CKB A;  2X6J A;  1N52 A;  3CQG B;  1OWO A;  3ASF A;  3LJ3 A;  4N5C A;  2I1J A;  4CRW A;  2F69 A;  5TEG A;  3BG0 B;  2MOW A;  4HLE A;  4BUP A;  2O8J A;  1GW6 A;  1UG3 A;  4ILH B;  5T5G A;  3N71 A;  4UWF A;  3U9W A;  4B8A A;  4PH4 B;  5ARF A;  4L2L A;  3T5X A;  4XX5 A;  3KMT A;  2AVP A;  4Z4P A;  5TH7 A;  3FWV A;  4G23 A;  3TXN A;  4HVB A;  4FA6 A;  4FU3 A;  3KEZ A;  4EBA A;  4GU5 A;  3UT7 A;  4JEU A;  2L9B A;  3HVE A;  3RK6 A;  4B8C B;  4A1S A;  1LF8 A;  3OXL A;  1PEG A;  2Y4U A;  1H19 A;  3LXU X;  4DPR A;  2C0L A;  4GA2 A;  4PS8 A;  3ESL A;  5EKQ D;  3DB5 A;  5FQ7 A;  1B89 A;  5F6L A;  1UJJ A;  3KD7 A;  4UQZ A;  3HYM B;  2EQX A;  2C0M A;  3FUK A;  5LX8 A;  1HU3 A;  1MVX A;  4GYW A;  5FT9 A;  3GZS A;  3OS5 A;  3R9A B;  5D0O D;  4IJD A;  4KVM A;  3T5V A;  2OVB A;  4KVO A;  2WMO A;  3FTX A;  4H7X A;  3SHF A;  5G2N A;  2L0T B;  3EHM A;  3QWP A;  4NQ0 A;  2WXO A;  4FMU A;  4DI3 A;  4MI0 A;  3CQC B;  4U63 A;  2JEK A;  4I9E A;  2CHX A;  1UN9 A;  2I6H A;  3QC1 A;  4KMO A;  4N3B A;  2V4L A;  5G05 C;  4QEP A;  2AXV A;  4OVU A;  1H6K A;  3F9Y A;  4RG6 A;  4APO A;  5KJL A;  4U0S A;  2OV8 A;  1JWG A;  2YHE A;  2X6K A;  2ION A;  2FI7 A;  4I43 A;  3S8P A;  4KZ0 A;  3FEY A;  1OWL A;  3G2T A;  3L13 A;  4JEH A;  3LVQ E;  4O6F A;  4J83 A;  3L17 A;  2LO6 A;  1YA0 A;  4I17 A;  1E8X A;  3ZXS A;  3CVN A;  2X6F A;  3ASG A;  4AJW A;  3FTV A;  4GZC A;  4A3V A;  3VUZ A;  3FUD A;  3SZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...