4WUYA

Crystal structure of protein lysine methyltransferase smyd2 in complex with lly-507, a cell-active, potent and selective inhibitor
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
414
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKAEAIRDMVRYARNVIEEFRELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
publication title LLY-507, a Cell-active, Potent, and Selective Inhibitor of Protein-lysine Methyltransferase SMYD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 145
structure length 414
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4wuyA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4wuyA01
2E2EA 2F69A 2XCBA 3Q47B 3VUZA 3MA5A 3OPEA 3RU0A 3E4BA 3VTYA 3FPDA 5CCMA 5KJNA 4N5CA 4YPEA 5JJ6A 2GW1A 3CKBA 4U04A 1WAO1 2BUGA 3CK7A 1PEGA 5HQ8A 3CEQA 3QWWA 3F9ZA 3KS2A 2G46A 3K5KA 4G26A 4BTAA 2VSNA 5BT1A 5LSZA 2P58C 3S7FA 4J7IA 4NRHB 3GZ2A 4I2WA 3MO0A 3AS4A 4GPKA 1XQHA 2XGSA 4I9EA 3M55A 4I51A 2C0MA 4N2QA 1MVHA 3JYSA 3OOIA 1HH8A 4WUYA 4BWRA 4HORA 3KD7A 4YNDA 2C0LA 3QDNA 4KBQA 4XI9A 3Q4AB 4U07A 3QOUA 4J7FA 5A6CA 3TAXA 2VGXB 3RIBA 1N3JA 4EQFA 2XCCA 3FWVA 1NZNA 2XPIA 1HXIA 4Z4PA 3OXLA 4HOSA 3ZHEA 2AVPA 4IJDA 3SF4A 5JJ7A 4U0ZA 2UY1A 4U0UA 2W5ZA 3SW9A 3CKCA 4E47A 5FT9A 4I17A 3MV3B 3OS5A 5EX0A 3HNAA 2KCVA 2JV0A 3F9YA 5G05J 3R9AB 5LSXA 3QWVA 1MVXA 3QKYA 4KYOB 5F6KC 3TG4A 3KAEA 4HOTA 2UWJG 3U4TA 2DBAA 4JA9A 4QEOA 3M53A 3LKUA 1QQEA 3F9WA 5ARFA 4G1TA 5D0OD 2XGOA 5BW8C 5JJTA 3AS5A 3WXXA 4U0SA 3ZGQA 5D0QD 4BT9A 4N3CA 3PE4A 4AY6A 2I6HA 1XNFA 5LCWJ 5FZQA 2R5SA 5FZSA 3NF1A 4GYYA 5LCWC 2IFUA 2WQHA 5HI7A 2W5YA 1N6AA 3RQ4A 4GCNA 3M59A 3ESKA 1N6CA 1P5QA 2HO1A 2Q7FA 5AYWD 1FCHA 1ELRA 2YQ8A 3M57A 3RO2A 2XGMA 4WNGA 3OXFA 3Q5MA 4JL0A 2IGQA 3ULQA 3IEGA 4Y6CA 4YNPA 2FI7A 1PC2A 4N3AA 5EKQD 4B94A 5AYFA 5EX3A 1H3IA 2C2LA 4XIFA 3CVPA 4YPAA 1KT1A 4CGVA 2FO7A 4JA7A 4WNFA 5TTFA 4UI9C 4H12A 4N2SA 3M56A 3K9IA 2YHCA 4JDSA 5G04C 2PQRA 1NA0A 4JHRA 2VGYA 5JHNA 2OOEA 3VV0A 4GZ6A 2BQZA 5F5EA 5CHEE 4BT8A 2VQ2A 2V5FA 2LNIA 3ASHA 4O6FA 4LDGA 3GYZA 3ZN3A 3ZPJA 3O48A 4LEUA 5FTPA 3BO5A 5JJ0A 4BTBA 4GCOA 5FJYA 1MT6A 4YNMA 5T0KA 2UY1B 3ASFA 2KCLA 1HZ4A 4GYOA 4CDRA 3MO5A 4AM9A 4ME2A 3MV2B 4UQYA 5F59A 1OUVA 3CVQA 3KMAA 3S8PA 4I1AA 3LCAA 3CV0A 1QZ2A 2R3AA 2VYIA 3TG5A 3CBOA 3ZFWA 4F3VA 4WNEA 4WNDA 5TEGA 1IYGA 2QFCA 4H7YA 3S7DA 2RFIA 2LSUA 4Y6WA 4FMUA 1NA3A 2IF4A 4GYWA 3LY9A 4O30A 3EDTB 5DBKA 1IHGA 1Y8MA 4RG9A 4YVOA 5EG2A 4APOA 4RG6A 2PL2A 3LYAA 5T0MA 3N71A 3CK8A 4I2ZA 4GZ3A 3CVNA 5T5GA 4J8DA 3URZA 3IHXA 3RKVA 3KMTA 4BUPA 4J8OA 4CGWA 4J83A 1ZU2A 2HYZA 1MUFA 5TH7A 3S7JA 2PQNA 4GA2A 4QENA 1A17A 3FP3A 3AS8A 4YPUA 5FZRA 5CPRB 4MI0A 3PE3A 1W3BA 4GZ5A 2WPVA 4G23A 3DALA 3RJWA 1TJCA 5KJMA 4G25A 2KC7A 4H7XA 4XI0A 2FEZA 4UI9J 2PZIA 3CBPA 3ASGA 4JLGA 4NVQA 2KCKA 2HR2A 1E96B 5G04J 3MKRA 2Y4TA 4RZ0A 3UQ3A 3M58A 2FBNA 5CCLA 3TGOA 2VSYA 2QPWA 2ONDA 1ELWA 3LY8A 4IJ8A 2Y4UA 3CBMA 2JLBA 5DIZA 3M5AA 4IN3B 5JINA 3Q49B 3S7BA 5ARGA 5M72A 3ASDA 4G2VA 4I9CA 4J0UA 2LSVA 3RJVA 4NQ0A 2VGXA 4G24A 3FFLA 3VTXA 4QEPA 3LY7A 3GZ1A 1ZKKA 2NC9A 3ZHEB 4W9RA 5KJLA 2MHKA 5KJKA 3UPVA 2KATA 4UI9K 4HOUA 5C1DA 4UQXA 3U3WA 4AU7A 3KMJA 3LPZA 3MEKA 4UQZA 4N39A 1B89A 1YA0A 5BNWA 4HOQA 3UUXA 3RO3A 3SWCA 3HYMB 3SZ7A 4AY5A 4NJ5A 4KXKB 1ML9A 1O9SA 3M54A 5JIYA 3BEEA 4AIFA 2L6JA 1WM5A 4YVQC 4MI5A 3RAYA 3GW4A 4A1SA 3PDNA 3DB5A 4N3BA 3EP0A 4GA1A 2J9QA 3OXGA 1KT0A 1ZBPA 1KLXA 2FF4A 4J8EA 5G05C 3Q15A 3CK9A 3F9XA 3QWPA 3MO2A 4J8FA 5A7DB 4ABNA 2XEVA 2O8JA 3CVLA 5F6LA 4C1QA 4GA0A
chains in the Genus database with same CATH superfamily
1UJKA 2E2EA 2F69A 3AU4A 1XGWA 2GRNB 2YNQA 2ZISA 3E4BA 3CHMA 4DPRA 3DSSA 4N5CA 5EDSA 4U04A 1WAO1 4JZYA 1PEGA 2CFZA 5HQ8A 5T4YA 3QWWA 3F9ZA 3ULEG 3UM2A 2DWZA 2VSNA 2P58C 3TWUA 4JHKA 1LD8A 2RD0A 4HLLA 4JEUA 1ZB1A 3HXCA 5CBOA 4N2QA 2RFAA 1JWFA 3JYSA 3OOIA 4O60A 4BWRA 3G2SA 1Z5SC 4FHKA 4MKTA 5AARA 4HB5A 3QDNA 4LUNU 3Q4AB 4EHMA 3E32A 2XZDG 4J7FA 2AJAA 3Q9NC 4HQDA 3ULYA 3ZYMA 4ANXA 4CCAA 4EQFA 1D8EA 1NZNA 2XPIA 5AIJA 3T5XA 2AVPA 1BI7B 3RK6A 4U0ZA 4KZCA 1DVPA 4U0UA 2F8YA 2W5ZA 2A4ZA 4XKCA 3SW9A 5B1BE 3HDXA 4F53A 4E47A 2HE0A 3Q75A 4ZFHA 3LJ3A 3OS5A 2BKGA 3EU9A 4GTQA 3UKRG 1X81A 2ETBA 3U9WA 3WG7E 5G05J 3R9AB 3NOCD 4AVXA 3QWVA 1MVXA 3PZ1A 2DVWA 5F6KC 1EF1C 3SO8A 4DK5A 1V54E 3C3QA 3KAEA 2L6BA 3FH7A 4G1TA 3AS5A 3LDZA 3SNXA 2VTBA 5AQ7A 4N3CA 4PS7A 4AY6A 2WXPA 4I43A 2X6IA 2X6FA 5ANLA 4TRQA 1K3ZD 2LXLA 1V55E 1WDYA 5CEDB 3E37A 5KWDA 2H6FA 3UT7A 2Q7FA 2YQ8A 4PS8A 3Q5MA 3Q9UC 1OCCE 3S2AA 3LVQE 3JXIA 3T8MA 3FTYA 1E7VA 2J08A 2H6GA 3FUEA 2FI7A 3VLDA 5ENOD 1IXVA 4HXIA 5EX3A 2C2LA 4XIFA 4PH4B 4YPAA 3E30A 4CGVA 1BLXB 2P9UG 1H0AA 3M56A 3K9IA 2WMOA 5BV0A 5G04C 1U3CA 3APCA 1NA0A 2VGYA 5JHNA 2JEKA 2OOEA 3TXMA 1S70B 4I6EA 2VSOE 4JB8P 2XEEA 4U63A 2BQZA 1DCQA 2LNIA 3ASHA 4O6FA 4LDGA 3FEXA 3GYZA 3UT4A 2OEVA 5ENQD 4G8LA 4HRNA 5T0KA 2XENA 4GYOA 3MV2B 3PZ4A 4I1MA 5F59A 3CVQA 3CV0A 4CEMA 5AQBA 2V8SE 3CSTA 3ZFWA 4WNDA 5TEGA 3AG1E 2J4BA 2QFCA 2RFIA 4JPSA 3LVRE 4UWHA 4B93B 4QFVA 2OVBA 2IY0C 3IBEA 1OCZE 4JEHA 3Q73A 1HF8A 4RG6A 5T0MA 3N71A 4I2ZA 2WXGA 2EIKE 3PVLA 4EBAA 2LO6A 1N4QA 4J8DA 1RZ4A 2AW6A 3RKVA 4OVUA 1JCRA 4J8OA 4FHJA 4J83A 3KEZA 3C98A 5CERB 3DSTA 1Z6TA 4XZ4A 3FH5A 4L7TA 4OYSA 3B95A 3ZNGA 1W3BA 4G23A 3B7SA 3RJWA 4AV7A 2BTDA 4G25A 2KC7A 3FUMA 3DXKG 4H7XA 2LXMA 4CYMD 4JLGA 4AEZC 2ZU6B 1E96B 3MKRA 2Y4TA 4Z68A 2B6CA 2V4HC 3TGOA 5FQ6A 2ONDA 4ILHB 3FUKA 2JLBA 4IN3B 3TJPA 3Q49B 5ARGA 4G2VA 3UTMA 2ZGGA 4NQ0A 3GZSA 4Q96A 2VGXA 1YCSB 3GZ1A 3ZHEB 2R2LA 4W9RA 4UI9K 3EUVA 4JXTA 4NIKA 4AU7A 3D9HA 3KMJA 3IXEA 3MEKA 3L6AA 1B89A 3W9GA 3CIAA 2NSZA 1MZCA 4HBDA 2GRRB 3Q7AA 1X5BA 3HYMB 4L1BA 1D8DA 4AY5A 3EU5A 4L23A 3PRZA 3FU6A 2E0IA 3BEEA 3HXEA 5BV1A 4YVQC 3SI5A 2WXRA 3AAAC 3GW4A 3PDNA 3DB5A 4N3BA 2GRMA 5KBAA 4IULA 3RRMB 4K5CA 3C5RA 1MX4A 4NURA 1N95A 3IHVA 2XRZA 3QWPA 2WXOA 4J8FA 3MO2A 3PZ3A 2O8JA 4WAFA 2QZAA 3CVLA 3ASNE 4C1QA 2R02A 3R7RA 1FPPA 4AJWA 2XCBA 3L9TA 2ZXWE 3ZYLA 3D9MA 3FPDA 4FP7A 4YPEA 1O1RA 5JJ6A 4ANUA 2GW1A 1N4SA 2BUGA 4G8KA 4KT6B 3DSWA 2L0IA 4D10C 3D3MA 3UM0A 4UWFA 4OAVB 3CQCB 5BT1A 2CG3A 5LSZA 2ZGDA 3S7FA 3MZLB 1IQRA 4GMLA 3ISMC 3AS4A 4GPKA 2A5UA 4XKBA 3D9JA 4I9EA 2C0MA 4U8HA 3MJWA 1HH8A 4WUYA 5A23A 5BXUA 4V3IA 4HORA 3DSUA 4YNDA 4ATGA 1E90A 5A6CA 3DRAA 3TAXA 1OT8A 1UN9A 3UKUG 3TXNA 1N3JA 3LEWA 3SHFA 4Z4PA 4HOSA 3ZHEA 4YDOA 4IJDA 1H6OA 3SF4A 4OVVA 2UY1A 3E34A 1BPOA 3FU3A 1L5JA 1FVFA 5LX8A 2BF0X 3FTWA 3MYVA 4JD2G 3L17A 3B7TA 4I17A 3MV3B 3HNAA 2KCVA 1PAQA 4RLYA 3ML8A 1H2UA 5LSXA 3QKYA 4KYOB 4B8AA 4F1SA 4GTOA 4HS2A 3EJNA 3V2XA 2DBAA 4QEOA 1QQEA 1E8YA 5D2MC 2V4LA 3CHPA 5ARFA 1H6PA 3ZGQA 5D0QD 3QJZA 3UIOC 4BT9A 1Z3XA 3PE4A 4DUIA 3DEOA 3EHMA 2GRLA 4XE0A 3NF1A 2KBXA 4GYYA 2ETAA 2IFUA 3RRUA 1N6AA 3RQ4A 4EZJA 5ENSD 3FUIA 3M59A 1EYHA 4E6HA 2HO1A 4MRUA 4IYPA 5AYWD 3FU5A 1FCHA 1ELRA 3ZRHA 2R17C 3V2OA 5AAOA 3ZYKA 2IGQA 3FTVA 4Y6CA 2WMNA 4YNPA 2V5QC 4BX9A 2QYUA 1H3IA 2DYSE 1UW4B 4LERA 2AXVA 3TWWA 3CLJA 3ABME 1JWGA 1HE8A 5FQ4A 4JA7A 4FJYA 5TTFA 4QQIA 4UI9C 4DX6D 4H12A 3DBSA 4N2SA 1SW6A 3CVVA 2YHCA 4JDSA 2DZNA 4DX5D 2PQRA 4FADA 1Q2ZA 3C72A 2QY7A 1SZAA 5AQ9A 2VQ2A 5CEAA 3L22A 4HVBA 3HIZA 3B7BA 3ZN3A 3ZPJA 1Z3YA 5FTPA 5JJ0A 2P9SG 1MT6A 1HZ4A 4CDMA 1KZPA 2WXLA 3DPDA 1OUVA 3S8PA 3NOGD 5JA4D 2L0TB 5ENPD 2R3AA 5HRYA 3TG5A 4EZLA 2IEJA 3SFZA 2ETCA 5CMYA 3QK0A 3UMVA 2KXPC 3FTUA 4H7YA 3FY4A 4FMUA 1N0RA 1S0PA 4JVSA 4C0MA 3SFYA 3LS8A 5DBKA 4RVBA 2Y0BG 3NZUA 3ZKJA 4RG9A 4YVOA 3CHOA 1LD7A 3CK8A 4DI4A 3CVNA 5T5GA 2F8XK 2DCPA 4P29A 3URZA 3HHMA 4BETA 2PM7A 4WWOA 4BUPA 4JHJA 4QENA 3ZXSA 3EIJA 3FUJA 5FZRA 1KPSB 4EPZA 4GZ5A 2WPVA 2WXJA 4YDWA 3NZSA 5KJMA 1TN8A 3FEYA 4GTVA 3ASGA 1KZOA 4GPMA 5G04J 1D9SA 1A5EA 3UQ3A 2J4DA 1SZ9A 4K5BA 4TUMA 2FBNA 2VSYA 3C3RA 4EZKA 3LY8A 5DIZA 2PNNA 1HO8A 3V30A 5M72A 1OWOA 2LAIA 2LSVA 3RJVA 5ANRA 3VTXA 3LY7A 3TWRA 1HS6A 1N11A 2NC9A 5KJLA 3ABKE 3UPVA 2KATA 3KSQA 1IKND 4UQXA 3U3WA 5AQAA 2FULA 3QAQA 4KVMA 2YHEA 4I1OB 3I5PA 3OTNA 3RO3A 3CHRA 3SZ7A 2AXUA 3UINC 4AIFA 4DX2A 4TXQA 4Q69A 1WM5A 4R7LA 2ILRA 1MX6A 1SVXA 4MI5A 3RAYA 3UXGA 3CVWA 4A1SA 1LTXA 2J9QA 4J8EA 5EYLA 5IY5E 3MKQB 2J49A 4J7WA 3DWLG 4ABNA 5A7DB 2XEVA 1OXJA 5KNGA 2WXFA 5F6LA 3CGHA 2GGFA 1TNUA 3CSFA 2Y1LE 1K1BA 3RSEG 4RSYA 2WVIA 1S64A 3MA5A 2V0PA 3FUHA 3ZW3A 2F37A 4TV3A 1OWNA 5KJNA 3JUIA 3PH0C 3CKBA 2EIJE 3CK7A 3SGHA 3CEQA 3G2WA 4BSZB 1YMPA 3PNTB 3KS2A 4F6RD 3G2TA 5CBNA 2G46A 3K5KA 3APDA 4G26A 4U95D 3SD5A 4J7IA 4NRHB 5D66A 2XPZA 3GZ2A 4I2WA 3MO0A 3NAWA 4A55A 4IRUA 1JPLA 2IOSA 3UIPC 2XGSA 3M55A 4I51A 4DJAA 4C48B 4DX7D 4GMJA 2RG8A 2YINA 2C0LA 4KBQA 4BESA 1LF8A 4L2YA 4A3TA 4U07A 3QOUA 3T9KA 3FUFA 2A5EA 1RW2A 4JC8A 1O1TA 5FQ8A 1H6KA 1O1SA 1E8ZA 3L13A 2XCCA 4FULA 4GTMA 1HXIA 3PS6A 3KSLA 3OXLA 2IQCA 5JJ7A 2HM8A 2VSXE 3CKCA 3IV0A 5G2NA 1ELKA 4FLBA 5J90A 5EX0A 1UOHA 4A3VA 2JV0A 1S63A 3F9YA 3TWTA 2WQ7A 3IKOB 4DLQA 2XS8A 3SY2A 4HOTA 2UWJG 3ZYQA 4JA9A 3M53A 1PY1A 1YYHA 3LKUA 1MHQA 1MJ0A 4GAAA 3UM3A 2CHXA 4UUCA 3F9WA 1U2VG 3DSVA 2MOWA 1E8WA 5D0OD 2XGOA 5BW8C 5JJTA 5T3RA 4NACA 3MKQA 2I6HA 2EILE 4A1GA 4CT0A 4HFGA 2Y3AA 3G2VA 3C3OA 2CHWA 5FZSA 3ONLA 4G11A 2KM4A 4J8YA 5KCMA 5HI7A 4TXRA 5EIDA 2GRPB 5CMWA 2XRYA 5HS0A 3AG4E 1N6CA 3DSXA 3X2QE 3CVUA 4ILIA 3M57A 3FH8A 3RO2A 2XGMA 4WNGA 3OXFA 3ULQA 3IEGA 2H6HA 3HXDA 3ZIMA 5EKQD 4AXHA 5AYFA 3TWVA 2EIME 3CHSA 4UWGA 4L9PA 3D9KA 4BFRA 1KT1A 1TR4A 2FO7A 5CRVA 5ENNA 4WNFA 4AP2A 3FUDA 2XPYA 4GTPA 5EILA 3SBTB 4WWPA 2IONA 4O1PA 3ZEFA 4U7EB 4UWKA 4JHRA 4XEIG 2JABA 3CR3A 3BQOA 3VV0A 4GZ6A 3J5PA 3FUNA 1N94A 5JHAA 3SFXA 5ENRD 2V5FA 2DIWA 2P9LG 3RRNB 4FLHA 2P9IG 1NFIE 2R59A 4K03A 1IQUA 3O48A 4LEUA 4DI3A 4EECA 4GB9A 4AOFA 4BTBA 3SBSA 1NP7A 4GCOA 4CDNA 4B0ZA 4YNMA 2DZOA 1EDUA 3ASFA 4CDRA 3MO5A 3V31A 4AM9A 4ME2A 3KMAA 2I9CA 1HG2A 4I1AA 3D9IA 3LCAA 2IU1A 2WXMA 4ILGA 1QZ2A 2VYIA 3ESLA 1HFAA 4BSXA 1N52A 3AG2E 1IYGA 4Y6WA 2ZIRA 4UWLA 4GYWA 5LP0A 5CRUA 3UX4A 1Y8MA 1UN8A 2RKKA 5EG2A 4BEPA 2PL2A 3D9LA 3LYAA 4APFA 3TWQA 4GZ3A 1WG0A 3I4GA 3VLFA 4U8VD 3IHXA 1QBQA 2XHEA 1INZA 3KMTA 1N4RA 1ZU2A 4LG6A 2BKKB 2HYZA 4C9BB 1MUFA 3S7JA 1SQMA 1TNOA 4GA2A 1A17A 4FU3A 3FP3A 3FTXA 3AS8A 2P2CP 4K0RA 2CFUA 4HI9A 4MI0A 1E8XA 1SA4A 3P2BA 3PE3A 3EHRA 4F7AA 3DALA 2J8SD 3JQ1A 1OCRE 2FEZA 1GW6A 4UI9J 4YDYA 2H6IA 2KCKA 1OY3D 2HR2A 1Y6IA 2X6HA 3HXBA 1TNZA 3NB2A 3VLEA 3AG3E 4O1OA 3CHQA 5CCLA 2QPWA 1O5MA 3V79K 3B13A 4IJ8A 2L9BA 2Y4UA 2MRIA 3M5AA 3L54A 3S7BA 4GZCA 4I9CA 4J0UA 4B8CB 3FFLA 4N5QA 4DX1A 5KJKA 1OWLA 1DCEA 1JCSA 5C1DA 3FDHA 4UQZA 4N39A 1YA0A 4FC8A 5BNWA 2P9KG 5C2YA 2QYJA 3UUXA 2IO2C 3SWCA 4NJ5A 4KXKB 2WXKA 2EQXA 3PZ2A 4LSZE 4LNBA 2I1JA 3FHEA 5AJDA 1NI1A 3ZVVA 3ZU7B 2WB2A 5JHBA 4HRMB 4BX8A 2XZTG 5E76A 3PEUB 3E33A 2RFMA 2IOLA 1KT0A 4BY6A 1ZBPA 1KLXA 4DRXE 5G05C 3Q15A 4U8YD 3CK9A 3AU5A 4M3OA 5AN8A 5H7PA 3J5QB 4GU5A 4GA0A 1JCQA 4LNUD 3Q47B 3NBNB 3VUZA 3B7UX 3OPEA 4PUCA 3RU0A 3VTYA 5CCMA 2AWIA 2I1KA 5FWQA 1N54A 4LRZA 2WQ6A 1OWMA 4ACLA 3ASOE 3T5VA 2EINE 3ABLE 4BTAA 4J8SA 5BPPA 3L82A 5E75A 1XQHA 3MX3A 1OWPA 3D9PA 1MVHA 3UI2A 1MX2A 2PM6A 1TJFA 3I3NA 3P1UA 4CRWA 3KD7A 4HRLA 4XI9A 3U66A 2VGXB 4Q94A 3RIBA 3BU8A 2OCCE 2Y69E 3FWVA 1U3DA 1UG3A 3Q78A 5ITZF 5J08A 1FT1A 3HRAA 5AJLA 2WXHA 2R05A 1AP7A 3PEVB 5JMND 3ZUVB 3OAWA 5EYPF 3O4ZA 1TN6A 4GTTA 2WXNA 4CZ2D 3PUJA 4I6GA 5EIBE 5FT9A 2LAHA 2VGEA 4URKA 1BI8B 3NQPA 5HKPA 3JQ0A 4GTSA 5FINA 3Q7FA 3B7RL 3TG4A 3KEAA 2XEHA 3U4TA 2J09A 3D9OA 4MS6A 3TWXA 4U96D 1TNYA 2R03A 1VDYA 3BUAA 4FJZA 5ENTD 2DYRE 2BEDA 5AENA 4MLPA 3WXXA 4U0SA 2J07A 1MQSA 1XNFA 2KZTB 5FZQA 5LCWJ 2IO3C 2X6JA 2R5SA 1BD8A 5LCWC 2WQHA 2W5YA 4GCNA 3ENEA 3ONKA 4CT4A 3CVYA 3DPYA 3ESKA 2XS1A 1P5QA 1DC2A 2B0OE 3R7QA 3LJNA 2NXPA 3L16A 1UJJA 4JL0A 1QYMA 3FU0A 1PC2A 4N3AA 4ATZD 4B94A 2LUHA 3RAUA 5G55A 1G3NB 3CVPA 2P9PG 1SA5A 3TWSA 4RQIA 3MCXA 3QNKA 4M7CA 3SQVA 2GRQB 2AXZA 4A63B 1MYOA 3D9NA 4FA6A 2IJGX 4JW1A 4KZ0A 4ZHBA 5F5EA 5CHEE 4BT8A 4X8QA 3CQGB 4J6IA 3JXJA 4KVOA 3G2UA 3BO5A 3HVEB 4LNGA 5FJYA 5B3SE 3EIQC 3EHNA 4I6JA 2UY1B 2KCLA 3PREA 4XX5A 4UQYA 1K8KG 3R9MA 3Q79A 2MYOA 1TN7A 2I2OA 4PDXA 4DLOA 3FULA 3PZDA 3CBOA 4F3VA 4WNEA 4LCTA 5FQ7A 4L2LA 5FIOA 2X3MA 1WY6A 3FTSA 1E7UA 3QC1A 1NL4A 3QB2A 4TUUA 3S7DA 2LSUA 3PUKA 2CG2A 1NA3A 4EBAG 3HXFA 2IF4A 4B89A 3LY9A 2VJ8A 3I4RB 1AWCB 4O30A 3EDTB 1IHGA 3DXMG 4GTRA 4APOA 2P9NG 1OCOE 3IHYA 2OEWA 3EHQA 2X38A 4TXPA 4WWNA 3UT8A 2KZTA 4CGWA 4ANVA 1DNPA 5TH7A 1EPUA 3LXUX 2PQNA 4F1PA 3BG0B 3UM1A 4BERA 4YPUA 5CPRB 3HG0D 1TJCA 4HLEA 4MBGA 2XQ0A 2QC9A 3CVXA 3PNLB 4XI0A 2PZIA 3CBPA 1H19A 4NVQA 5KNHD 4RZ0A 3M58A 1TNBA 4HNAD 5BUZA 2OV8A 1ELWA 4GMRA 3CBMA 3BG1B 5BXOA 3ML9A 5JINA 1K1AA 4E85A 5LFAA 3DEPA 2NYJA 3W9FA 4K5AB 1N0QA 3ASDA 3JCKC 3QARA 4KMOA 3L08A 4G24A 2X6KA 3U64A 4QEPA 1ZKKA 2CHZA 2MHKA 3APFA 3AJIA 4HOUA 3T8KA 1TYQG 3LPZA 5T8IA 5CECB 2WXIA 3HVEA 4HOQA 1H2VC 4OAUC 2WM9A 2F0YA 4PS3A 3F6QA 1ML9A 1O9SA 3M54A 5JIYA 1TEZA 1FT2A 4ANWA 2L6JA 2FO1E 1JUQA 1FVHA 1N9AA 3FTZA 4ACKA 5EN5D 5LOZA 3TL5A 4GZDA 1HU3A 1HG5A 4GA1A 4YDEA 3EP0A 3OXGA 3JUEA 2M63A 2FF4A 3ZXPA 2VTBB 4HI8A 3F9XA 4C0EA 2GROB 1IHBA 1N4PA 3MGBA 1BU9A 1HX8A 2WXQA 5B1AE 1QNFA 2OVFA 1H2TC
chains in the Genus database with same CATH topology
3CSFA 1UJKA 3R7RA 4AJWA 2E2EA 2F69A 4RSYA 2XCBA 2WVIA 3AU4A 1XGWA 3Q47B 3VUZA 3MA5A 2V0PA 3B7UX 3FUHA 2YNQA 3OPEA 4PUCA 3RU0A 3ZYLA 3ZW3A 3E4BA 3D9MA 3VTYA 4TV3A 3FPDA 3CHMA 4DPRA 1OWNA 5CCMA 5KJNA 2AWIA 2I1KA 3JUIA 4FP7A 4N5CA 3PH0C 5FWQA 2GW1A 5JJ6A 3CKBA 4U04A 4ANUA 5EDSA 1WAO1 1N54A 4JZYA 4LRZA 2BUGA 2WQ6A 3CK7A 1PEGA 2CFZA 3SGHA 4KT6B 5HQ8A 5T4YA 3CEQA 3G2WA 3QWWA 3F9ZA 3PNTB 1OWMA 3KS2A 3G2TA 4ACLA 2L0IA 3T5VA 4D10C 3D3MA 2G46A 3K5KA 3APDA 4G26A 4BTAA 2VSNA 4J8SA 4UWFA 3CQCB 5BT1A 2CG3A 5LSZA 2P58C 5BPPA 3SD5A 3S7FA 4J7IA 3MZLB 4NRHB 4JHKA 2XPZA 3GZ2A 4I2WA 1IQRA 4GMLA 3MO0A 4A55A 3AS4A 2RD0A 4GPKA 4IRUA 4JEUA 5E75A 2A5UA 1JPLA 2IOSA 4XKBA 1XQHA 3MX3A 2XGSA 1OWPA 3D9JA 4I9EA 3D9PA 3M55A 4I51A 4DJAA 2C0MA 4U8HA 4N2QA 1MVHA 1JWFA 3JYSA 1HH8A 3MJWA 4GMJA 4WUYA 5A23A 3OOIA 2PM6A 1TJFA 4BWRA 4V3IA 3G2SA 2RG8A 4HORA 4FHKA 2YINA 3I3NA 3P1UA 4MKTA 4CRWA 3KD7A 4YNDA 2C0LA 3QDNA 4KBQA 4XI9A 4LUNU 1LF8A 4L2YA 3Q4AB 4A3TA 4U07A 3QOUA 4ATGA 3U66A 1E90A 3FUFA 4J7FA 5A6CA 3TAXA 4JC8A 1UN9A 2VGXB 5FQ8A 1H6KA 4Q94A 3TXNA 3ZYMA 1E8ZA 4ANXA 3RIBA 4CCAA 1N3JA 3LEWA 3L13A 4EQFA 3SHFA 2XCCA 3FWVA 1U3DA 4FULA 1NZNA 1UG3A 2XPIA 5AIJA 1HXIA 3PS6A 4Z4PA 5J08A 3OXLA 4HOSA 3ZHEA 2IQCA 3T5XA 5AJLA 2AVPA 2WXHA 4IJDA 3SF4A 3RK6A 4OVVA 5JJ7A 3PEVB 3OAWA 3O4ZA 4U0ZA 2UY1A 4KZCA 2HM8A 1DVPA 4U0UA 1BPOA 2VSXE 2WXNA 3FU3A 1L5JA 2W5ZA 1FVFA 2A4ZA 5LX8A 4XKCA 3PUJA 3SW9A 3CKCA 2BF0X 3FTWA 3IV0A 3MYVA 1ELKA 4I6GA 4FLBA 3HDXA 5G2NA 4F53A 5J90A 4E47A 3L17A 3B7TA 5FT9A 4I17A 3MV3B 3OS5A 3LJ3A 2LAHA 4URKA 5EX0A 3HNAA 4A3VA 2KCVA 1PAQA 3NQPA 2JV0A 3F9YA 3U9WA 3ML8A 5G05J 3JQ0A 1H2UA 3R9AB 5LSXA 4AVXA 3QWVA 2WQ7A 3QKYA 1MVXA 4KYOB 4B8AA 5F6KC 1EF1C 3IKOB 4F1SA 4DLQA 4DK5A 3B7RL 3TG4A 3KAEA 4HS2A 4HOTA 3EJNA 2UWJG 3U4TA 2J09A 3ZYQA 2DBAA 3D9OA 4JA9A 4MS6A 4QEOA 3M53A 1PY1A 3LKUA 1MHQA 1QQEA 1E8YA 4GAAA 2CHXA 2V4LA 3CHPA 3F9WA 1VDYA 4FJZA 3FH7A 2MOWA 1E8WA 5ARFA 4G1TA 5D0OD 2XGOA 5BW8C 5JJTA 5AENA 3AS5A 5T3RA 3LDZA 4MLPA 4NACA 3SNXA 3WXXA 2VTBA 4U0SA 3ZGQA 5D0QD 3QJZA 3MKQA 4BT9A 2J07A 1Z3XA 4N3CA 3PE4A 4PS7A 2I6HA 4AY6A 1MQSA 1XNFA 2KZTB 2WXPA 4I43A 5FZQA 4A1GA 4CT0A 4HFGA 2X6IA 2Y3AA 3G2VA 2X6JA 2R5SA 2X6FA 2CHWA 5FZSA 5ANLA 3EHMA 2GRLA 4TRQA 4XE0A 3ONLA 3NF1A 4G11A 2KM4A 4GYYA 5LCWC 2IFUA 2WQHA 5HI7A 5KCMA 3RRUA 1N6AA 2W5YA 4GCNA 3RQ4A 3ENEA 3ONKA 4CT4A 4EZJA 3CVYA 3FUIA 3M59A 5CMWA 2XRYA 1EYHA 3ESKA 4E6HA 1N6CA 1P5QA 2HO1A 4MRUA 3R7QA 3UT7A 4IYPA 2Q7FA 5AYWD 2NXPA 1FCHA 3FU5A 3CVUA 1ELRA 2YQ8A 3ZRHA 4ILIA 2R17C 3L16A 3FH8A 3M57A 3RO2A 2XGMA 4WNGA 4PS8A 3OXFA 3Q5MA 3ZYKA 1UJJA 3S2AA 5JIYA 4JL0A 2IGQA 3LVQE 3ULQA 3FTVA 3IEGA 3FU0A 4Y6CA 2WMNA 4YNPA 3T8MA 4BX9A 3FTYA 1E7VA 2J08A 3FUEA 2FI7A 3VLDA 1PC2A 4N3AA 3ZIMA 5EKQD 4B94A 4HXIA 5EX3A 4AXHA 1H3IA 5AYFA 2C2LA 4XIFA 5G55A 3CVPA 4PH4B 4YPAA 1UW4B 4LERA 3CHSA 2AXVA 4UWGA 3D9KA 4BFRA 3CLJA 1KT1A 1JWGA 4CGVA 1HE8A 2FO7A 5FQ4A 5ENNA 4JA7A 4FJYA 4WNFA 4AP2A 5TTFA 3FUDA 2XPYA 4UI9C 1H0AA 4H12A 3SBTB 3DBSA 3MCXA 3K9IA 3QNKA 4N2SA 2WMOA 3M56A 4WWPA 3CVVA 2YHCA 2IONA 4JDSA 3ZEFA 2AXZA 5BV0A 5G04C 1U3CA 2PQRA 3APCA 1NA0A 4UWKA 3D9NA 4FADA 4JHRA 2VGYA 3CR3A 5JHNA 2JEKA 2OOEA 4FA6A 3TXMA 3VV0A 4GZ6A 2IJGX 4I6EA 4JW1A 2VSOE 4KZ0A 4U63A 2BQZA 3FUNA 2QY7A 5JHAA 1SZAA 5F5EA 5CHEE 4BT8A 2VQ2A 3L22A 4HVBA 2V5FA 2DIWA 3HIZA 2LNIA 3ASHA 4O6FA 3RRNB 4FLHA 4LDGA 4K03A 2R59A 3FEXA 3GYZA 3ZN3A 3ZPJA 3CQGB 4J6IA 1IQUA 3O48A 1Z3YA 4LEUA 4KVOA 4DI3A 3UT4A 4EECA 5FTPA 3G2UA 3BO5A 4GB9A 4AOFA 3HVEB 4BTBA 5JJ0A 3SBSA 1NP7A 4GCOA 5FJYA 4CDNA 4B0ZA 3EIQC 3EHNA 1MT6A 4YNMA 5T0KA 1EDUA 4I6JA 2UY1B 3ASFA 2KCLA 1HZ4A 4GYOA 4CDRA 4CDMA 3MO5A 3PREA 4AM9A 4ME2A 3MV2B 4I1MA 4XX5A 2WXLA 4UQYA 3DPDA 1OUVA 5F59A 3CVQA 3KMAA 2I9CA 1HG2A 2I2OA 4YPEA 3S8PA 4I1AA 3D9IA 3LCAA 2L0TB 2IU1A 3CV0A 2WXMA 4PDXA 4ILGA 4DLOA 1QZ2A 3FULA 2R3AA 4CEMA 2VYIA 3ESLA 3PZDA 2V8SE 1HFAA 3CSTA 3TG5A 3CBOA 4EZLA 4BSXA 3ZFWA 3SFZA 4F3VA 1N52A 4WNEA 4WNDA 5CMYA 3QK0A 5TEGA 4LCTA 5FQ7A 4L2LA 1IYGA 3UMVA 2X3MA 1WY6A 3FTSA 1E7UA 3QC1A 2J4BA 2QFCA 3FTUA 3QB2A 4H7YA 4TUUA 3S7DA 5LCWJ 2LSUA 2RFIA 3FY4A 4JPSA 3PUKA 4Y6WA 3LVRE 4UWHA 4FMUA 2CG2A 1NA3A 1S0PA 4EBAG 4JVSA 4C0MA 2IF4A 4UWLA 4GYWA 4QFVA 2OVBA 4B89A 3LY9A 2VJ8A 3IBEA 3I4RB 4O30A 3EDTB 3LS8A 5DBKA 4RVBA 4JEHA 3NZUA 5LP0A 1IHGA 3UX4A 1Y8MA 1UN8A 4RG9A 4YVOA 5EG2A 3CHOA 4APOA 1HF8A 4RG6A 2PL2A 3D9LA 3LYAA 3IHYA 3N71A 4APFA 3CK8A 4I2ZA 4GZ3A 2WXGA 3PVLA 3I4GA 4DI4A 3CVNA 2LO6A 2X38A 3VLFA 4EBAA 5T5GA 2DCPA 4J8DA 4P29A 3URZA 3IHXA 2AW6A 3RKVA 3HHMA 4OVUA 4WWNA 2PM7A 2XHEA 4WWOA 1INZA 3KMTA 4BUPA 4J8OA 3UT8A 2KZTA 4FHJA 4CGWA 4J83A 1ZU2A 2HYZA 1DNPA 4ANVA 3KEZA 1EPUA 3S7JA 4C9BB 1SQMA 1MUFA 5TH7A 3LXUX 2PQNA 4JHJA 4GA2A 3C98A 4QENA 1A17A 3BG0B 3ZXSA 4FU3A 3EIJA 1Z6TA 3FP3A 3FTXA 3AS8A 3FUJA 4K0RA 4XZ4A 4YPUA 3FH5A 4L7TA 2CFUA 4OYSA 5FZRA 4MI0A 5CPRB 1E8XA 3P2BA 4EPZA 3PE3A 1W3BA 4GZ5A 2WPVA 4G23A 4F7AA 3DALA 3B7SA 2WXJA 3RJWA 4AV7A 2BTDA 3NZSA 1TJCA 4HLEA 5KJMA 4G25A 2XQ0A 3JQ1A 2KC7A 3CVXA 3FUMA 3PNLB 4H7XA 4XI0A 2FEZA 1GW6A 3FEYA 4UI9J 2PZIA 3CBPA 3ASGA 1H19A 4JLGA 4AEZC 4NVQA 2KCKA 2ZU6B 2HR2A 1E96B 5G04J 3MKRA 2Y4TA 4RZ0A 1Y6IA 2X6HA 3UQ3A 3M58A 2J4DA 3VLEA 1SZ9A 3CHQA 5BUZA 2FBNA 5CCLA 2OV8A 3TGOA 2VSYA 2QPWA 5FQ6A 2ONDA 4ILHB 4EZKA 1ELWA 3LY8A 3B13A 4IJ8A 2L9BA 2Y4UA 3CBMA 3BG1B 2MRIA 3FUKA 2JLBA 3ML9A 5DIZA 3M5AA 4IN3B 1HO8A 5JINA 3TJPA 3L54A 3Q49B 3S7BA 4E85A 4GZCA 5LFAA 5ARGA 5M72A 3ASDA 3JCKC 3QARA 4G2VA 4I9CA 4J0UA 1OWOA 2LAIA 2LSVA 3RJVA 4NQ0A 4KMOA 3GZSA 3L08A 4Q96A 4B8CB 2VGXA 5ANRA 4G24A 2X6KA 3U64A 3FFLA 3VTXA 4QEPA 3LY7A 1HS6A 3GZ1A 1ZKKA 2CHZA 2NC9A 3ZHEB 4W9RA 5KJLA 2MHKA 3APFA 5KJKA 3UPVA 2KATA 4UI9K 1OWLA 4HOUA 5C1DA 4JXTA 4UQXA 3U3WA 4AU7A 3KMJA 2FULA 3FDHA 3LPZA 3MEKA 4UQZA 3L6AA 2WXIA 4N39A 3QAQA 1B89A 5T8IA 3CIAA 4KVMA 1YA0A 3HVEA 2YHEA 4FC8A 5BNWA 5C2YA 2NSZA 4HOQA 4I1OB 3I5PA 3OTNA 5T0MA 1H2VC 3UUXA 3RO3A 1X5BA 3SWCA 2WM9A 3CHRA 3HYMB 4L1BA 3SZ7A 2AXUA 4AY5A 4NJ5A 4KXKB 4PS3A 4L23A 2WXKA 3PRZA 2EQXA 3FU6A 2I1JA 3FHEA 5AJDA 3ZVVA 2E0IA 1ML9A 1TEZA 1O9SA 3M54A 3BEEA 4AIFA 2L6JA 4ANWA 2WB2A 4Q69A 1WM5A 5BV1A 4R7LA 1JUQA 5JHBA 1FVHA 2ILRA 4YVQC 4MI5A 3RAYA 3SI5A 2WXRA 4BX8A 3FTZA 3GW4A 3CVWA 4ACKA 4A1SA 3PDNA 5LOZA 3DB5A 3TL5A 4N3BA 4GZDA 1HU3A 1HG5A 4GA1A 3PEUB 5E76A 3EP0A 2IOLA 2J9QA 3OXGA 2GRMA 1KT0A 4BY6A 1ZBPA 2M63A 1KLXA 2FF4A 4IULA 4J8EA 3RRMB 2VTBB 5G05C 3Q15A 4NURA 3MKQB 2J49A 3IHVA 3CK9A 2XRZA 3F9XA 3QWPA 3AU5A 4M3OA 4C0EA 2WXOA 4J8FA 5A7DB 4ABNA 2XEVA 3MO2A 3MGBA 1HX8A 2O8JA 4WAFA 3CVLA 2WXFA 5F6LA 4C1QA 2WXQA 1QNFA 2OVFA 4GU5A 3CGHA 4GA0A 1H2TC 2GGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2E A;  2F69 A;  2XCB A;  3Q47 B;  3VUZ A;  3MA5 A;  3OPE A;  3RU0 A;  3E4B A;  3VTY A;  3FPD A;  5CCM A;  5KJN A;  4N5C A;  4YPE A;  5JJ6 A;  2GW1 A;  3CKB A;  4U04 A;  1WAO 1;  2BUG A;  3CK7 A;  1PEG A;  5HQ8 A;  3CEQ A;  3QWW A;  3F9Z A;  3KS2 A;  2G46 A;  3K5K A;  4G26 A;  4BTA A;  2VSN A;  5BT1 A;  5LSZ A;  2P58 C;  3S7F A;  4J7I A;  4NRH B;  3GZ2 A;  4I2W A;  3MO0 A;  3AS4 A;  4GPK A;  1XQH A;  2XGS A;  4I9E A;  3M55 A;  4I51 A;  2C0M A;  4N2Q A;  1MVH A;  3JYS A;  3OOI A;  1HH8 A;  4WUY A;  4BWR A;  4HOR A;  3KD7 A;  4YND A;  2C0L A;  3QDN A;  4KBQ A;  4XI9 A;  3Q4A B;  4U07 A;  3QOU A;  4J7F A;  5A6C A;  3TAX A;  2VGX B;  3RIB A;  1N3J A;  4EQF A;  2XCC A;  3FWV A;  1NZN A;  2XPI A;  1HXI A;  4Z4P A;  3OXL A;  4HOS A;  3ZHE A;  2AVP A;  4IJD A;  3SF4 A;  5JJ7 A;  4U0Z A;  2UY1 A;  4U0U A;  2W5Z A;  3SW9 A;  3CKC A;  4E47 A;  5FT9 A;  4I17 A;  3MV3 B;  3OS5 A;  5EX0 A;  3HNA A;  2KCV A;  2JV0 A;  3F9Y A;  5G05 J;  3R9A B;  5LSX A;  3QWV A;  1MVX A;  3QKY A;  4KYO B;  5F6K C;  3TG4 A;  3KAE A;  4HOT A;  2UWJ G;  3U4T A;  2DBA A;  4JA9 A;  4QEO A;  3M53 A;  3LKU A;  1QQE A;  3F9W A;  5ARF A;  4G1T A;  5D0O D;  2XGO A;  5BW8 C;  5JJT A;  3AS5 A;  3WXX A;  4U0S A;  3ZGQ A;  5D0Q D;  4BT9 A;  4N3C A;  3PE4 A;  4AY6 A;  2I6H A;  1XNF A;  5LCW J;  5FZQ A;  2R5S A;  5FZS A;  3NF1 A;  4GYY A;  5LCW C;  2IFU A;  2WQH A;  5HI7 A;  2W5Y A;  1N6A A;  3RQ4 A;  4GCN A;  3M59 A;  3ESK A;  1N6C A;  1P5Q A;  2HO1 A;  2Q7F A;  5AYW D;  1FCH A;  1ELR A;  2YQ8 A;  3M57 A;  3RO2 A;  2XGM A;  4WNG A;  3OXF A;  3Q5M A;  4JL0 A;  2IGQ A;  3ULQ A;  3IEG A;  4Y6C A;  4YNP A;  2FI7 A;  1PC2 A;  4N3A A;  5EKQ D;  4B94 A;  5AYF A;  5EX3 A;  1H3I A;  2C2L A;  4XIF A;  3CVP A;  4YPA A;  1KT1 A;  4CGV A;  2FO7 A;  4JA7 A;  4WNF A;  5TTF A;  4UI9 C;  4H12 A;  4N2S A;  3M56 A;  3K9I A;  2YHC A;  4JDS A;  5G04 C;  2PQR A;  1NA0 A;  4JHR A;  2VGY A;  5JHN A;  2OOE A;  3VV0 A;  4GZ6 A;  2BQZ A;  5F5E A;  5CHE E;  4BT8 A;  2VQ2 A;  2V5F A;  2LNI A;  3ASH A;  4O6F A;  4LDG A;  3GYZ A;  3ZN3 A;  3ZPJ A;  3O48 A;  4LEU A;  5FTP A;  3BO5 A;  5JJ0 A;  4BTB A;  4GCO A;  5FJY A;  1MT6 A;  4YNM A;  5T0K A;  2UY1 B;  3ASF A;  2KCL A;  1HZ4 A;  4GYO A;  4CDR A;  3MO5 A;  4AM9 A;  4ME2 A;  3MV2 B;  4UQY A;  5F59 A;  1OUV A;  3CVQ A;  3KMA A;  3S8P A;  4I1A A;  3LCA A;  3CV0 A;  1QZ2 A;  2R3A A;  2VYI A;  3TG5 A;  3CBO A;  3ZFW A;  4F3V A;  4WNE A;  4WND A;  5TEG A;  1IYG A;  2QFC A;  4H7Y A;  3S7D A;  2RFI A;  2LSU A;  4Y6W A;  4FMU A;  1NA3 A;  2IF4 A;  4GYW A;  3LY9 A;  4O30 A;  3EDT B;  5DBK A;  1IHG A;  1Y8M A;  4RG9 A;  4YVO A;  5EG2 A;  4APO A;  4RG6 A;  2PL2 A;  3LYA A;  5T0M A;  3N71 A;  3CK8 A;  4I2Z A;  4GZ3 A;  3CVN A;  5T5G A;  4J8D A;  3URZ A;  3IHX A;  3RKV A;  3KMT A;  4BUP A;  4J8O A;  4CGW A;  4J83 A;  1ZU2 A;  2HYZ A;  1MUF A;  5TH7 A;  3S7J A;  2PQN A;  4GA2 A;  4QEN A;  1A17 A;  3FP3 A;  3AS8 A;  4YPU A;  5FZR A;  5CPR B;  4MI0 A;  3PE3 A;  1W3B A;  4GZ5 A;  2WPV A;  4G23 A;  3DAL A;  3RJW A;  1TJC A;  5KJM A;  4G25 A;  2KC7 A;  4H7X A;  4XI0 A;  2FEZ A;  4UI9 J;  2PZI A;  3CBP A;  3ASG A;  4JLG A;  4NVQ A;  2KCK A;  2HR2 A;  1E96 B;  5G04 J;  3MKR A;  2Y4T A;  4RZ0 A;  3UQ3 A;  3M58 A;  2FBN A;  5CCL A;  3TGO A;  2VSY A;  2QPW A;  2OND A;  1ELW A;  3LY8 A;  4IJ8 A;  2Y4U A;  3CBM A;  2JLB A;  5DIZ A;  3M5A A;  4IN3 B;  5JIN A;  3Q49 B;  3S7B A;  5ARG A;  5M72 A;  3ASD A;  4G2V A;  4I9C A;  4J0U A;  2LSV A;  3RJV A;  4NQ0 A;  2VGX A;  4G24 A;  3FFL A;  3VTX A;  4QEP A;  3LY7 A;  3GZ1 A;  1ZKK A;  2NC9 A;  3ZHE B;  4W9R A;  5KJL A;  2MHK A;  5KJK A;  3UPV A;  2KAT A;  4UI9 K;  4HOU A;  5C1D A;  4UQX A;  3U3W A;  4AU7 A;  3KMJ A;  3LPZ A;  3MEK A;  4UQZ A;  4N39 A;  1B89 A;  1YA0 A;  5BNW A;  4HOQ A;  3UUX A;  3RO3 A;  3SWC A;  3HYM B;  3SZ7 A;  4AY5 A;  4NJ5 A;  4KXK B;  1ML9 A;  1O9S A;  3M54 A;  5JIY A;  3BEE A;  4AIF A;  2L6J A;  1WM5 A;  4YVQ C;  4MI5 A;  3RAY A;  3GW4 A;  4A1S A;  3PDN A;  3DB5 A;  4N3B A;  3EP0 A;  4GA1 A;  2J9Q A;  3OXG A;  1KT0 A;  1ZBP A;  1KLX A;  2FF4 A;  4J8E A;  5G05 C;  3Q15 A;  3CK9 A;  3F9X A;  3QWP A;  3MO2 A;  4J8F A;  5A7D B;  4ABN A;  2XEV A;  2O8J A;  3CVL A;  5F6L A;  4C1Q A;  4GA0 A; 
#chains in the Genus database with same CATH topology
 1UJK A;  2E2E A;  2F69 A;  3AU4 A;  1XGW A;  2GRN B;  2YNQ A;  2ZIS A;  3E4B A;  3CHM A;  4DPR A;  3DSS A;  4N5C A;  5EDS A;  4U04 A;  1WAO 1;  4JZY A;  1PEG A;  2CFZ A;  5HQ8 A;  5T4Y A;  3QWW A;  3F9Z A;  3ULE G;  3UM2 A;  2DWZ A;  2VSN A;  2P58 C;  3TWU A;  4JHK A;  1LD8 A;  2RD0 A;  4HLL A;  4JEU A;  1ZB1 A;  3HXC A;  5CBO A;  4N2Q A;  2RFA A;  1JWF A;  3JYS A;  3OOI A;  4O60 A;  4BWR A;  3G2S A;  1Z5S C;  4FHK A;  4MKT A;  5AAR A;  4HB5 A;  3QDN A;  4LUN U;  3Q4A B;  4EHM A;  3E32 A;  2XZD G;  4J7F A;  2AJA A;  3Q9N C;  4HQD A;  3ULY A;  3ZYM A;  4ANX A;  4CCA A;  4EQF A;  1D8E A;  1NZN A;  2XPI A;  5AIJ A;  3T5X A;  2AVP A;  1BI7 B;  3RK6 A;  4U0Z A;  4KZC A;  1DVP A;  4U0U A;  2F8Y A;  2W5Z A;  2A4Z A;  4XKC A;  3SW9 A;  5B1B E;  3HDX A;  4F53 A;  4E47 A;  2HE0 A;  3Q75 A;  4ZFH A;  3LJ3 A;  3OS5 A;  2BKG A;  3EU9 A;  4GTQ A;  3UKR G;  1X81 A;  2ETB A;  3U9W A;  3WG7 E;  5G05 J;  3R9A B;  3NOC D;  4AVX A;  3QWV A;  1MVX A;  3PZ1 A;  2DVW A;  5F6K C;  1EF1 C;  3SO8 A;  4DK5 A;  1V54 E;  3C3Q A;  3KAE A;  2L6B A;  3FH7 A;  4G1T A;  3AS5 A;  3LDZ A;  3SNX A;  2VTB A;  5AQ7 A;  4N3C A;  4PS7 A;  4AY6 A;  2WXP A;  4I43 A;  2X6I A;  2X6F A;  5ANL A;  4TRQ A;  1K3Z D;  2LXL A;  1V55 E;  1WDY A;  5CED B;  3E37 A;  5KWD A;  2H6F A;  3UT7 A;  2Q7F A;  2YQ8 A;  4PS8 A;  3Q5M A;  3Q9U C;  1OCC E;  3S2A A;  3LVQ E;  3JXI A;  3T8M A;  3FTY A;  1E7V A;  2J08 A;  2H6G A;  3FUE A;  2FI7 A;  3VLD A;  5ENO D;  1IXV A;  4HXI A;  5EX3 A;  2C2L A;  4XIF A;  4PH4 B;  4YPA A;  3E30 A;  4CGV A;  1BLX B;  2P9U G;  1H0A A;  3M56 A;  3K9I A;  2WMO A;  5BV0 A;  5G04 C;  1U3C A;  3APC A;  1NA0 A;  2VGY A;  5JHN A;  2JEK A;  2OOE A;  3TXM A;  1S70 B;  4I6E A;  2VSO E;  4JB8 P;  2XEE A;  4U63 A;  2BQZ A;  1DCQ A;  2LNI A;  3ASH A;  4O6F A;  4LDG A;  3FEX A;  3GYZ A;  3UT4 A;  2OEV A;  5ENQ D;  4G8L A;  4HRN A;  5T0K A;  2XEN A;  4GYO A;  3MV2 B;  3PZ4 A;  4I1M A;  5F59 A;  3CVQ A;  3CV0 A;  4CEM A;  5AQB A;  2V8S E;  3CST A;  3ZFW A;  4WND A;  5TEG A;  3AG1 E;  2J4B A;  2QFC A;  2RFI A;  4JPS A;  3LVR E;  4UWH A;  4B93 B;  4QFV A;  2OVB A;  2IY0 C;  3IBE A;  1OCZ E;  4JEH A;  3Q73 A;  1HF8 A;  4RG6 A;  5T0M A;  3N71 A;  4I2Z A;  2WXG A;  2EIK E;  3PVL A;  4EBA A;  2LO6 A;  1N4Q A;  4J8D A;  1RZ4 A;  2AW6 A;  3RKV A;  4OVU A;  1JCR A;  4J8O A;  4FHJ A;  4J83 A;  3KEZ A;  3C98 A;  5CER B;  3DST A;  1Z6T A;  4XZ4 A;  3FH5 A;  4L7T A;  4OYS A;  3B95 A;  3ZNG A;  1W3B A;  4G23 A;  3B7S A;  3RJW A;  4AV7 A;  2BTD A;  4G25 A;  2KC7 A;  3FUM A;  3DXK G;  4H7X A;  2LXM A;  4CYM D;  4JLG A;  4AEZ C;  2ZU6 B;  1E96 B;  3MKR A;  2Y4T A;  4Z68 A;  2B6C A;  2V4H C;  3TGO A;  5FQ6 A;  2OND A;  4ILH B;  3FUK A;  2JLB A;  4IN3 B;  3TJP A;  3Q49 B;  5ARG A;  4G2V A;  3UTM A;  2ZGG A;  4NQ0 A;  3GZS A;  4Q96 A;  2VGX A;  1YCS B;  3GZ1 A;  3ZHE B;  2R2L A;  4W9R A;  4UI9 K;  3EUV A;  4JXT A;  4NIK A;  4AU7 A;  3D9H A;  3KMJ A;  3IXE A;  3MEK A;  3L6A A;  1B89 A;  3W9G A;  3CIA A;  2NSZ A;  1MZC A;  4HBD A;  2GRR B;  3Q7A A;  1X5B A;  3HYM B;  4L1B A;  1D8D A;  4AY5 A;  3EU5 A;  4L23 A;  3PRZ A;  3FU6 A;  2E0I A;  3BEE A;  3HXE A;  5BV1 A;  4YVQ C;  3SI5 A;  2WXR A;  3AAA C;  3GW4 A;  3PDN A;  3DB5 A;  4N3B A;  2GRM A;  5KBA A;  4IUL A;  3RRM B;  4K5C A;  3C5R A;  1MX4 A;  4NUR A;  1N95 A;  3IHV A;  2XRZ A;  3QWP A;  2WXO A;  4J8F A;  3MO2 A;  3PZ3 A;  2O8J A;  4WAF A;  2QZA A;  3CVL A;  3ASN E;  4C1Q A;  2R02 A;  3R7R A;  1FPP A;  4AJW A;  2XCB A;  3L9T A;  2ZXW E;  3ZYL A;  3D9M A;  3FPD A;  4FP7 A;  4YPE A;  1O1R A;  5JJ6 A;  4ANU A;  2GW1 A;  1N4S A;  2BUG A;  4G8K A;  4KT6 B;  3DSW A;  2L0I A;  4D10 C;  3D3M A;  3UM0 A;  4UWF A;  4OAV B;  3CQC B;  5BT1 A;  2CG3 A;  5LSZ A;  2ZGD A;  3S7F A;  3MZL B;  1IQR A;  4GML A;  3ISM C;  3AS4 A;  4GPK A;  2A5U A;  4XKB A;  3D9J A;  4I9E A;  2C0M A;  4U8H A;  3MJW A;  1HH8 A;  4WUY A;  5A23 A;  5BXU A;  4V3I A;  4HOR A;  3DSU A;  4YND A;  4ATG A;  1E90 A;  5A6C A;  3DRA A;  3TAX A;  1OT8 A;  1UN9 A;  3UKU G;  3TXN A;  1N3J A;  3LEW A;  3SHF A;  4Z4P A;  4HOS A;  3ZHE A;  4YDO A;  4IJD A;  1H6O A;  3SF4 A;  4OVV A;  2UY1 A;  3E34 A;  1BPO A;  3FU3 A;  1L5J A;  1FVF A;  5LX8 A;  2BF0 X;  3FTW A;  3MYV A;  4JD2 G;  3L17 A;  3B7T A;  4I17 A;  3MV3 B;  3HNA A;  2KCV A;  1PAQ A;  4RLY A;  3ML8 A;  1H2U A;  5LSX A;  3QKY A;  4KYO B;  4B8A A;  4F1S A;  4GTO A;  4HS2 A;  3EJN A;  3V2X A;  2DBA A;  4QEO A;  1QQE A;  1E8Y A;  5D2M C;  2V4L A;  3CHP A;  5ARF A;  1H6P A;  3ZGQ A;  5D0Q D;  3QJZ A;  3UIO C;  4BT9 A;  1Z3X A;  3PE4 A;  4DUI A;  3DEO A;  3EHM A;  2GRL A;  4XE0 A;  3NF1 A;  2KBX A;  4GYY A;  2ETA A;  2IFU A;  3RRU A;  1N6A A;  3RQ4 A;  4EZJ A;  5ENS D;  3FUI A;  3M59 A;  1EYH A;  4E6H A;  2HO1 A;  4MRU A;  4IYP A;  5AYW D;  3FU5 A;  1FCH A;  1ELR A;  3ZRH A;  2R17 C;  3V2O A;  5AAO A;  3ZYK A;  2IGQ A;  3FTV A;  4Y6C A;  2WMN A;  4YNP A;  2V5Q C;  4BX9 A;  2QYU A;  1H3I A;  2DYS E;  1UW4 B;  4LER A;  2AXV A;  3TWW A;  3CLJ A;  3ABM E;  1JWG A;  1HE8 A;  5FQ4 A;  4JA7 A;  4FJY A;  5TTF A;  4QQI A;  4UI9 C;  4DX6 D;  4H12 A;  3DBS A;  4N2S A;  1SW6 A;  3CVV A;  2YHC A;  4JDS A;  2DZN A;  4DX5 D;  2PQR A;  4FAD A;  1Q2Z A;  3C72 A;  2QY7 A;  1SZA A;  5AQ9 A;  2VQ2 A;  5CEA A;  3L22 A;  4HVB A;  3HIZ A;  3B7B A;  3ZN3 A;  3ZPJ A;  1Z3Y A;  5FTP A;  5JJ0 A;  2P9S G;  1MT6 A;  1HZ4 A;  4CDM A;  1KZP A;  2WXL A;  3DPD A;  1OUV A;  3S8P A;  3NOG D;  5JA4 D;  2L0T B;  5ENP D;  2R3A A;  5HRY A;  3TG5 A;  4EZL A;  2IEJ A;  3SFZ A;  2ETC A;  5CMY A;  3QK0 A;  3UMV A;  2KXP C;  3FTU A;  4H7Y A;  3FY4 A;  4FMU A;  1N0R A;  1S0P A;  4JVS A;  4C0M A;  3SFY A;  3LS8 A;  5DBK A;  4RVB A;  2Y0B G;  3NZU A;  3ZKJ A;  4RG9 A;  4YVO A;  3CHO A;  1LD7 A;  3CK8 A;  4DI4 A;  3CVN A;  5T5G A;  2F8X K;  2DCP A;  4P29 A;  3URZ A;  3HHM A;  4BET A;  2PM7 A;  4WWO A;  4BUP A;  4JHJ A;  4QEN A;  3ZXS A;  3EIJ A;  3FUJ A;  5FZR A;  1KPS B;  4EPZ A;  4GZ5 A;  2WPV A;  2WXJ A;  4YDW A;  3NZS A;  5KJM A;  1TN8 A;  3FEY A;  4GTV A;  3ASG A;  1KZO A;  4GPM A;  5G04 J;  1D9S A;  1A5E A;  3UQ3 A;  2J4D A;  1SZ9 A;  4K5B A;  4TUM A;  2FBN A;  2VSY A;  3C3R A;  4EZK A;  3LY8 A;  5DIZ A;  2PNN A;  1HO8 A;  3V30 A;  5M72 A;  1OWO A;  2LAI A;  2LSV A;  3RJV A;  5ANR A;  3VTX A;  3LY7 A;  3TWR A;  1HS6 A;  1N11 A;  2NC9 A;  5KJL A;  3ABK E;  3UPV A;  2KAT A;  3KSQ A;  1IKN D;  4UQX A;  3U3W A;  5AQA A;  2FUL A;  3QAQ A;  4KVM A;  2YHE A;  4I1O B;  3I5P A;  3OTN A;  3RO3 A;  3CHR A;  3SZ7 A;  2AXU A;  3UIN C;  4AIF A;  4DX2 A;  4TXQ A;  4Q69 A;  1WM5 A;  4R7L A;  2ILR A;  1MX6 A;  1SVX A;  4MI5 A;  3RAY A;  3UXG A;  3CVW A;  4A1S A;  1LTX A;  2J9Q A;  4J8E A;  5EYL A;  5IY5 E;  3MKQ B;  2J49 A;  4J7W A;  3DWL G;  4ABN A;  5A7D B;  2XEV A;  1OXJ A;  5KNG A;  2WXF A;  5F6L A;  3CGH A;  2GGF A;  1TNU A;  3CSF A;  2Y1L E;  1K1B A;  3RSE G;  4RSY A;  2WVI A;  1S64 A;  3MA5 A;  2V0P A;  3FUH A;  3ZW3 A;  2F37 A;  4TV3 A;  1OWN A;  5KJN A;  3JUI A;  3PH0 C;  3CKB A;  2EIJ E;  3CK7 A;  3SGH A;  3CEQ A;  3G2W A;  4BSZ B;  1YMP A;  3PNT B;  3KS2 A;  4F6R D;  3G2T A;  5CBN A;  2G46 A;  3K5K A;  3APD A;  4G26 A;  4U95 D;  3SD5 A;  4J7I A;  4NRH B;  5D66 A;  2XPZ A;  3GZ2 A;  4I2W A;  3MO0 A;  3NAW A;  4A55 A;  4IRU A;  1JPL A;  2IOS A;  3UIP C;  2XGS A;  3M55 A;  4I51 A;  4DJA A;  4C48 B;  4DX7 D;  4GMJ A;  2RG8 A;  2YIN A;  2C0L A;  4KBQ A;  4BES A;  1LF8 A;  4L2Y A;  4A3T A;  4U07 A;  3QOU A;  3T9K A;  3FUF A;  2A5E A;  1RW2 A;  4JC8 A;  1O1T A;  5FQ8 A;  1H6K A;  1O1S A;  1E8Z A;  3L13 A;  2XCC A;  4FUL A;  4GTM A;  1HXI A;  3PS6 A;  3KSL A;  3OXL A;  2IQC A;  5JJ7 A;  2HM8 A;  2VSX E;  3CKC A;  3IV0 A;  5G2N A;  1ELK A;  4FLB A;  5J90 A;  5EX0 A;  1UOH A;  4A3V A;  2JV0 A;  1S63 A;  3F9Y A;  3TWT A;  2WQ7 A;  3IKO B;  4DLQ A;  2XS8 A;  3SY2 A;  4HOT A;  2UWJ G;  3ZYQ A;  4JA9 A;  3M53 A;  1PY1 A;  1YYH A;  3LKU A;  1MHQ A;  1MJ0 A;  4GAA A;  3UM3 A;  2CHX A;  4UUC A;  3F9W A;  1U2V G;  3DSV A;  2MOW A;  1E8W A;  5D0O D;  2XGO A;  5BW8 C;  5JJT A;  5T3R A;  4NAC A;  3MKQ A;  2I6H A;  2EIL E;  4A1G A;  4CT0 A;  4HFG A;  2Y3A A;  3G2V A;  3C3O A;  2CHW A;  5FZS A;  3ONL A;  4G11 A;  2KM4 A;  4J8Y A;  5KCM A;  5HI7 A;  4TXR A;  5EID A;  2GRP B;  5CMW A;  2XRY A;  5HS0 A;  3AG4 E;  1N6C A;  3DSX A;  3X2Q E;  3CVU A;  4ILI A;  3M57 A;  3FH8 A;  3RO2 A;  2XGM A;  4WNG A;  3OXF A;  3ULQ A;  3IEG A;  2H6H A;  3HXD A;  3ZIM A;  5EKQ D;  4AXH A;  5AYF A;  3TWV A;  2EIM E;  3CHS A;  4UWG A;  4L9P A;  3D9K A;  4BFR A;  1KT1 A;  1TR4 A;  2FO7 A;  5CRV A;  5ENN A;  4WNF A;  4AP2 A;  3FUD A;  2XPY A;  4GTP A;  5EIL A;  3SBT B;  4WWP A;  2ION A;  4O1P A;  3ZEF A;  4U7E B;  4UWK A;  4JHR A;  4XEI G;  2JAB A;  3CR3 A;  3BQO A;  3VV0 A;  4GZ6 A;  3J5P A;  3FUN A;  1N94 A;  5JHA A;  3SFX A;  5ENR D;  2V5F A;  2DIW A;  2P9L G;  3RRN B;  4FLH A;  2P9I G;  1NFI E;  2R59 A;  4K03 A;  1IQU A;  3O48 A;  4LEU A;  4DI3 A;  4EEC A;  4GB9 A;  4AOF A;  4BTB A;  3SBS A;  1NP7 A;  4GCO A;  4CDN A;  4B0Z A;  4YNM A;  2DZO A;  1EDU A;  3ASF A;  4CDR A;  3MO5 A;  3V31 A;  4AM9 A;  4ME2 A;  3KMA A;  2I9C A;  1HG2 A;  4I1A A;  3D9I A;  3LCA A;  2IU1 A;  2WXM A;  4ILG A;  1QZ2 A;  2VYI A;  3ESL A;  1HFA A;  4BSX A;  1N52 A;  3AG2 E;  1IYG A;  4Y6W A;  2ZIR A;  4UWL A;  4GYW A;  5LP0 A;  5CRU A;  3UX4 A;  1Y8M A;  1UN8 A;  2RKK A;  5EG2 A;  4BEP A;  2PL2 A;  3D9L A;  3LYA A;  4APF A;  3TWQ A;  4GZ3 A;  1WG0 A;  3I4G A;  3VLF A;  4U8V D;  3IHX A;  1QBQ A;  2XHE A;  1INZ A;  3KMT A;  1N4R A;  1ZU2 A;  4LG6 A;  2BKK B;  2HYZ A;  4C9B B;  1MUF A;  3S7J A;  1SQM A;  1TNO A;  4GA2 A;  1A17 A;  4FU3 A;  3FP3 A;  3FTX A;  3AS8 A;  2P2C P;  4K0R A;  2CFU A;  4HI9 A;  4MI0 A;  1E8X A;  1SA4 A;  3P2B A;  3PE3 A;  3EHR A;  4F7A A;  3DAL A;  2J8S D;  3JQ1 A;  1OCR E;  2FEZ A;  1GW6 A;  4UI9 J;  4YDY A;  2H6I A;  2KCK A;  1OY3 D;  2HR2 A;  1Y6I A;  2X6H A;  3HXB A;  1TNZ A;  3NB2 A;  3VLE A;  3AG3 E;  4O1O A;  3CHQ A;  5CCL A;  2QPW A;  1O5M A;  3V79 K;  3B13 A;  4IJ8 A;  2L9B A;  2Y4U A;  2MRI A;  3M5A A;  3L54 A;  3S7B A;  4GZC A;  4I9C A;  4J0U A;  4B8C B;  3FFL A;  4N5Q A;  4DX1 A;  5KJK A;  1OWL A;  1DCE A;  1JCS A;  5C1D A;  3FDH A;  4UQZ A;  4N39 A;  1YA0 A;  4FC8 A;  5BNW A;  2P9K G;  5C2Y A;  2QYJ A;  3UUX A;  2IO2 C;  3SWC A;  4NJ5 A;  4KXK B;  2WXK A;  2EQX A;  3PZ2 A;  4LSZ E;  4LNB A;  2I1J A;  3FHE A;  5AJD A;  1NI1 A;  3ZVV A;  3ZU7 B;  2WB2 A;  5JHB A;  4HRM B;  4BX8 A;  2XZT G;  5E76 A;  3PEU B;  3E33 A;  2RFM A;  2IOL A;  1KT0 A;  4BY6 A;  1ZBP A;  1KLX A;  4DRX E;  5G05 C;  3Q15 A;  4U8Y D;  3CK9 A;  3AU5 A;  4M3O A;  5AN8 A;  5H7P A;  3J5Q B;  4GU5 A;  4GA0 A;  1JCQ A;  4LNU D;  3Q47 B;  3NBN B;  3VUZ A;  3B7U X;  3OPE A;  4PUC A;  3RU0 A;  3VTY A;  5CCM A;  2AWI A;  2I1K A;  5FWQ A;  1N54 A;  4LRZ A;  2WQ6 A;  1OWM A;  4ACL A;  3ASO E;  3T5V A;  2EIN E;  3ABL E;  4BTA A;  4J8S A;  5BPP A;  3L82 A;  5E75 A;  1XQH A;  3MX3 A;  1OWP A;  3D9P A;  1MVH A;  3UI2 A;  1MX2 A;  2PM6 A;  1TJF A;  3I3N A;  3P1U A;  4CRW A;  3KD7 A;  4HRL A;  4XI9 A;  3U66 A;  2VGX B;  4Q94 A;  3RIB A;  3BU8 A;  2OCC E;  2Y69 E;  3FWV A;  1U3D A;  1UG3 A;  3Q78 A;  5ITZ F;  5J08 A;  1FT1 A;  3HRA A;  5AJL A;  2WXH A;  2R05 A;  1AP7 A;  3PEV B;  5JMN D;  3ZUV B;  3OAW A;  5EYP F;  3O4Z A;  1TN6 A;  4GTT A;  2WXN A;  4CZ2 D;  3PUJ A;  4I6G A;  5EIB E;  5FT9 A;  2LAH A;  2VGE A;  4URK A;  1BI8 B;  3NQP A;  5HKP A;  3JQ0 A;  4GTS A;  5FIN A;  3Q7F A;  3B7R L;  3TG4 A;  3KEA A;  2XEH A;  3U4T A;  2J09 A;  3D9O A;  4MS6 A;  3TWX A;  4U96 D;  1TNY A;  2R03 A;  1VDY A;  3BUA A;  4FJZ A;  5ENT D;  2DYR E;  2BED A;  5AEN A;  4MLP A;  3WXX A;  4U0S A;  2J07 A;  1MQS A;  1XNF A;  2KZT B;  5FZQ A;  5LCW J;  2IO3 C;  2X6J A;  2R5S A;  1BD8 A;  5LCW C;  2WQH A;  2W5Y A;  4GCN A;  3ENE A;  3ONK A;  4CT4 A;  3CVY A;  3DPY A;  3ESK A;  2XS1 A;  1P5Q A;  1DC2 A;  2B0O E;  3R7Q A;  3LJN A;  2NXP A;  3L16 A;  1UJJ A;  4JL0 A;  1QYM A;  3FU0 A;  1PC2 A;  4N3A A;  4ATZ D;  4B94 A;  2LUH A;  3RAU A;  5G55 A;  1G3N B;  3CVP A;  2P9P G;  1SA5 A;  3TWS A;  4RQI A;  3MCX A;  3QNK A;  4M7C A;  3SQV A;  2GRQ B;  2AXZ A;  4A63 B;  1MYO A;  3D9N A;  4FA6 A;  2IJG X;  4JW1 A;  4KZ0 A;  4ZHB A;  5F5E A;  5CHE E;  4BT8 A;  4X8Q A;  3CQG B;  4J6I A;  3JXJ A;  4KVO A;  3G2U A;  3BO5 A;  3HVE B;  4LNG A;  5FJY A;  5B3S E;  3EIQ C;  3EHN A;  4I6J A;  2UY1 B;  2KCL A;  3PRE A;  4XX5 A;  4UQY A;  1K8K G;  3R9M A;  3Q79 A;  2MYO A;  1TN7 A;  2I2O A;  4PDX A;  4DLO A;  3FUL A;  3PZD A;  3CBO A;  4F3V A;  4WNE A;  4LCT A;  5FQ7 A;  4L2L A;  5FIO A;  2X3M A;  1WY6 A;  3FTS A;  1E7U A;  3QC1 A;  1NL4 A;  3QB2 A;  4TUU A;  3S7D A;  2LSU A;  3PUK A;  2CG2 A;  1NA3 A;  4EBA G;  3HXF A;  2IF4 A;  4B89 A;  3LY9 A;  2VJ8 A;  3I4R B;  1AWC B;  4O30 A;  3EDT B;  1IHG A;  3DXM G;  4GTR A;  4APO A;  2P9N G;  1OCO E;  3IHY A;  2OEW A;  3EHQ A;  2X38 A;  4TXP A;  4WWN A;  3UT8 A;  2KZT A;  4CGW A;  4ANV A;  1DNP A;  5TH7 A;  1EPU A;  3LXU X;  2PQN A;  4F1P A;  3BG0 B;  3UM1 A;  4BER A;  4YPU A;  5CPR B;  3HG0 D;  1TJC A;  4HLE A;  4MBG A;  2XQ0 A;  2QC9 A;  3CVX A;  3PNL B;  4XI0 A;  2PZI A;  3CBP A;  1H19 A;  4NVQ A;  5KNH D;  4RZ0 A;  3M58 A;  1TNB A;  4HNA D;  5BUZ A;  2OV8 A;  1ELW A;  4GMR A;  3CBM A;  3BG1 B;  5BXO A;  3ML9 A;  5JIN A;  1K1A A;  4E85 A;  5LFA A;  3DEP A;  2NYJ A;  3W9F A;  4K5A B;  1N0Q A;  3ASD A;  3JCK C;  3QAR A;  4KMO A;  3L08 A;  4G24 A;  2X6K A;  3U64 A;  4QEP A;  1ZKK A;  2CHZ A;  2MHK A;  3APF A;  3AJI A;  4HOU A;  3T8K A;  1TYQ G;  3LPZ A;  5T8I A;  5CEC B;  2WXI A;  3HVE A;  4HOQ A;  1H2V C;  4OAU C;  2WM9 A;  2F0Y A;  4PS3 A;  3F6Q A;  1ML9 A;  1O9S A;  3M54 A;  5JIY A;  1TEZ A;  1FT2 A;  4ANW A;  2L6J A;  2FO1 E;  1JUQ A;  1FVH A;  1N9A A;  3FTZ A;  4ACK A;  5EN5 D;  5LOZ A;  3TL5 A;  4GZD A;  1HU3 A;  1HG5 A;  4GA1 A;  4YDE A;  3EP0 A;  3OXG A;  3JUE A;  2M63 A;  2FF4 A;  3ZXP A;  2VTB B;  4HI8 A;  3F9X A;  4C0E A;  2GRO B;  1IHB A;  1N4P A;  3MGB A;  1BU9 A;  1HX8 A;  2WXQ A;  5B1A E;  1QNF A;  2OVF A;  1H2T C; 
#chains in the Genus database with same CATH homology
 3CSF A;  1UJK A;  3R7R A;  4AJW A;  2E2E A;  2F69 A;  4RSY A;  2XCB A;  2WVI A;  3AU4 A;  1XGW A;  3Q47 B;  3VUZ A;  3MA5 A;  2V0P A;  3B7U X;  3FUH A;  2YNQ A;  3OPE A;  4PUC A;  3RU0 A;  3ZYL A;  3ZW3 A;  3E4B A;  3D9M A;  3VTY A;  4TV3 A;  3FPD A;  3CHM A;  4DPR A;  1OWN A;  5CCM A;  5KJN A;  2AWI A;  2I1K A;  3JUI A;  4FP7 A;  4N5C A;  3PH0 C;  5FWQ A;  2GW1 A;  5JJ6 A;  3CKB A;  4U04 A;  4ANU A;  5EDS A;  1WAO 1;  1N54 A;  4JZY A;  4LRZ A;  2BUG A;  2WQ6 A;  3CK7 A;  1PEG A;  2CFZ A;  3SGH A;  4KT6 B;  5HQ8 A;  5T4Y A;  3CEQ A;  3G2W A;  3QWW A;  3F9Z A;  3PNT B;  1OWM A;  3KS2 A;  3G2T A;  4ACL A;  2L0I A;  3T5V A;  4D10 C;  3D3M A;  2G46 A;  3K5K A;  3APD A;  4G26 A;  4BTA A;  2VSN A;  4J8S A;  4UWF A;  3CQC B;  5BT1 A;  2CG3 A;  5LSZ A;  2P58 C;  5BPP A;  3SD5 A;  3S7F A;  4J7I A;  3MZL B;  4NRH B;  4JHK A;  2XPZ A;  3GZ2 A;  4I2W A;  1IQR A;  4GML A;  3MO0 A;  4A55 A;  3AS4 A;  2RD0 A;  4GPK A;  4IRU A;  4JEU A;  5E75 A;  2A5U A;  1JPL A;  2IOS A;  4XKB A;  1XQH A;  3MX3 A;  2XGS A;  1OWP A;  3D9J A;  4I9E A;  3D9P A;  3M55 A;  4I51 A;  4DJA A;  2C0M A;  4U8H A;  4N2Q A;  1MVH A;  1JWF A;  3JYS A;  1HH8 A;  3MJW A;  4GMJ A;  4WUY A;  5A23 A;  3OOI A;  2PM6 A;  1TJF A;  4BWR A;  4V3I A;  3G2S A;  2RG8 A;  4HOR A;  4FHK A;  2YIN A;  3I3N A;  3P1U A;  4MKT A;  4CRW A;  3KD7 A;  4YND A;  2C0L A;  3QDN A;  4KBQ A;  4XI9 A;  4LUN U;  1LF8 A;  4L2Y A;  3Q4A B;  4A3T A;  4U07 A;  3QOU A;  4ATG A;  3U66 A;  1E90 A;  3FUF A;  4J7F A;  5A6C A;  3TAX A;  4JC8 A;  1UN9 A;  2VGX B;  5FQ8 A;  1H6K A;  4Q94 A;  3TXN A;  3ZYM A;  1E8Z A;  4ANX A;  3RIB A;  4CCA A;  1N3J A;  3LEW A;  3L13 A;  4EQF A;  3SHF A;  2XCC A;  3FWV A;  1U3D A;  4FUL A;  1NZN A;  1UG3 A;  2XPI A;  5AIJ A;  1HXI A;  3PS6 A;  4Z4P A;  5J08 A;  3OXL A;  4HOS A;  3ZHE A;  2IQC A;  3T5X A;  5AJL A;  2AVP A;  2WXH A;  4IJD A;  3SF4 A;  3RK6 A;  4OVV A;  5JJ7 A;  3PEV B;  3OAW A;  3O4Z A;  4U0Z A;  2UY1 A;  4KZC A;  2HM8 A;  1DVP A;  4U0U A;  1BPO A;  2VSX E;  2WXN A;  3FU3 A;  1L5J A;  2W5Z A;  1FVF A;  2A4Z A;  5LX8 A;  4XKC A;  3PUJ A;  3SW9 A;  3CKC A;  2BF0 X;  3FTW A;  3IV0 A;  3MYV A;  1ELK A;  4I6G A;  4FLB A;  3HDX A;  5G2N A;  4F53 A;  5J90 A;  4E47 A;  3L17 A;  3B7T A;  5FT9 A;  4I17 A;  3MV3 B;  3OS5 A;  3LJ3 A;  2LAH A;  4URK A;  5EX0 A;  3HNA A;  4A3V A;  2KCV A;  1PAQ A;  3NQP A;  2JV0 A;  3F9Y A;  3U9W A;  3ML8 A;  5G05 J;  3JQ0 A;  1H2U A;  3R9A B;  5LSX A;  4AVX A;  3QWV A;  2WQ7 A;  3QKY A;  1MVX A;  4KYO B;  4B8A A;  5F6K C;  1EF1 C;  3IKO B;  4F1S A;  4DLQ A;  4DK5 A;  3B7R L;  3TG4 A;  3KAE A;  4HS2 A;  4HOT A;  3EJN A;  2UWJ G;  3U4T A;  2J09 A;  3ZYQ A;  2DBA A;  3D9O A;  4JA9 A;  4MS6 A;  4QEO A;  3M53 A;  1PY1 A;  3LKU A;  1MHQ A;  1QQE A;  1E8Y A;  4GAA A;  2CHX A;  2V4L A;  3CHP A;  3F9W A;  1VDY A;  4FJZ A;  3FH7 A;  2MOW A;  1E8W A;  5ARF A;  4G1T A;  5D0O D;  2XGO A;  5BW8 C;  5JJT A;  5AEN A;  3AS5 A;  5T3R A;  3LDZ A;  4MLP A;  4NAC A;  3SNX A;  3WXX A;  2VTB A;  4U0S A;  3ZGQ A;  5D0Q D;  3QJZ A;  3MKQ A;  4BT9 A;  2J07 A;  1Z3X A;  4N3C A;  3PE4 A;  4PS7 A;  2I6H A;  4AY6 A;  1MQS A;  1XNF A;  2KZT B;  2WXP A;  4I43 A;  5FZQ A;  4A1G A;  4CT0 A;  4HFG A;  2X6I A;  2Y3A A;  3G2V A;  2X6J A;  2R5S A;  2X6F A;  2CHW A;  5FZS A;  5ANL A;  3EHM A;  2GRL A;  4TRQ A;  4XE0 A;  3ONL A;  3NF1 A;  4G11 A;  2KM4 A;  4GYY A;  5LCW C;  2IFU A;  2WQH A;  5HI7 A;  5KCM A;  3RRU A;  1N6A A;  2W5Y A;  4GCN A;  3RQ4 A;  3ENE A;  3ONK A;  4CT4 A;  4EZJ A;  3CVY A;  3FUI A;  3M59 A;  5CMW A;  2XRY A;  1EYH A;  3ESK A;  4E6H A;  1N6C A;  1P5Q A;  2HO1 A;  4MRU A;  3R7Q A;  3UT7 A;  4IYP A;  2Q7F A;  5AYW D;  2NXP A;  1FCH A;  3FU5 A;  3CVU A;  1ELR A;  2YQ8 A;  3ZRH A;  4ILI A;  2R17 C;  3L16 A;  3FH8 A;  3M57 A;  3RO2 A;  2XGM A;  4WNG A;  4PS8 A;  3OXF A;  3Q5M A;  3ZYK A;  1UJJ A;  3S2A A;  5JIY A;  4JL0 A;  2IGQ A;  3LVQ E;  3ULQ A;  3FTV A;  3IEG A;  3FU0 A;  4Y6C A;  2WMN A;  4YNP A;  3T8M A;  4BX9 A;  3FTY A;  1E7V A;  2J08 A;  3FUE A;  2FI7 A;  3VLD A;  1PC2 A;  4N3A A;  3ZIM A;  5EKQ D;  4B94 A;  4HXI A;  5EX3 A;  4AXH A;  1H3I A;  5AYF A;  2C2L A;  4XIF A;  5G55 A;  3CVP A;  4PH4 B;  4YPA A;  1UW4 B;  4LER A;  3CHS A;  2AXV A;  4UWG A;  3D9K A;  4BFR A;  3CLJ A;  1KT1 A;  1JWG A;  4CGV A;  1HE8 A;  2FO7 A;  5FQ4 A;  5ENN A;  4JA7 A;  4FJY A;  4WNF A;  4AP2 A;  5TTF A;  3FUD A;  2XPY A;  4UI9 C;  1H0A A;  4H12 A;  3SBT B;  3DBS A;  3MCX A;  3K9I A;  3QNK A;  4N2S A;  2WMO A;  3M56 A;  4WWP A;  3CVV A;  2YHC A;  2ION A;  4JDS A;  3ZEF A;  2AXZ A;  5BV0 A;  5G04 C;  1U3C A;  2PQR A;  3APC A;  1NA0 A;  4UWK A;  3D9N A;  4FAD A;  4JHR A;  2VGY A;  3CR3 A;  5JHN A;  2JEK A;  2OOE A;  4FA6 A;  3TXM A;  3VV0 A;  4GZ6 A;  2IJG X;  4I6E A;  4JW1 A;  2VSO E;  4KZ0 A;  4U63 A;  2BQZ A;  3FUN A;  2QY7 A;  5JHA A;  1SZA A;  5F5E A;  5CHE E;  4BT8 A;  2VQ2 A;  3L22 A;  4HVB A;  2V5F A;  2DIW A;  3HIZ A;  2LNI A;  3ASH A;  4O6F A;  3RRN B;  4FLH A;  4LDG A;  4K03 A;  2R59 A;  3FEX A;  3GYZ A;  3ZN3 A;  3ZPJ A;  3CQG B;  4J6I A;  1IQU A;  3O48 A;  1Z3Y A;  4LEU A;  4KVO A;  4DI3 A;  3UT4 A;  4EEC A;  5FTP A;  3G2U A;  3BO5 A;  4GB9 A;  4AOF A;  3HVE B;  4BTB A;  5JJ0 A;  3SBS A;  1NP7 A;  4GCO A;  5FJY A;  4CDN A;  4B0Z A;  3EIQ C;  3EHN A;  1MT6 A;  4YNM A;  5T0K A;  1EDU A;  4I6J A;  2UY1 B;  3ASF A;  2KCL A;  1HZ4 A;  4GYO A;  4CDR A;  4CDM A;  3MO5 A;  3PRE A;  4AM9 A;  4ME2 A;  3MV2 B;  4I1M A;  4XX5 A;  2WXL A;  4UQY A;  3DPD A;  1OUV A;  5F59 A;  3CVQ A;  3KMA A;  2I9C A;  1HG2 A;  2I2O A;  4YPE A;  3S8P A;  4I1A A;  3D9I A;  3LCA A;  2L0T B;  2IU1 A;  3CV0 A;  2WXM A;  4PDX A;  4ILG A;  4DLO A;  1QZ2 A;  3FUL A;  2R3A A;  4CEM A;  2VYI A;  3ESL A;  3PZD A;  2V8S E;  1HFA A;  3CST A;  3TG5 A;  3CBO A;  4EZL A;  4BSX A;  3ZFW A;  3SFZ A;  4F3V A;  1N52 A;  4WNE A;  4WND A;  5CMY A;  3QK0 A;  5TEG A;  4LCT A;  5FQ7 A;  4L2L A;  1IYG A;  3UMV A;  2X3M A;  1WY6 A;  3FTS A;  1E7U A;  3QC1 A;  2J4B A;  2QFC A;  3FTU A;  3QB2 A;  4H7Y A;  4TUU A;  3S7D A;  5LCW J;  2LSU A;  2RFI A;  3FY4 A;  4JPS A;  3PUK A;  4Y6W A;  3LVR E;  4UWH A;  4FMU A;  2CG2 A;  1NA3 A;  1S0P A;  4EBA G;  4JVS A;  4C0M A;  2IF4 A;  4UWL A;  4GYW A;  4QFV A;  2OVB A;  4B89 A;  3LY9 A;  2VJ8 A;  3IBE A;  3I4R B;  4O30 A;  3EDT B;  3LS8 A;  5DBK A;  4RVB A;  4JEH A;  3NZU A;  5LP0 A;  1IHG A;  3UX4 A;  1Y8M A;  1UN8 A;  4RG9 A;  4YVO A;  5EG2 A;  3CHO A;  4APO A;  1HF8 A;  4RG6 A;  2PL2 A;  3D9L A;  3LYA A;  3IHY A;  3N71 A;  4APF A;  3CK8 A;  4I2Z A;  4GZ3 A;  2WXG A;  3PVL A;  3I4G A;  4DI4 A;  3CVN A;  2LO6 A;  2X38 A;  3VLF A;  4EBA A;  5T5G A;  2DCP A;  4J8D A;  4P29 A;  3URZ A;  3IHX A;  2AW6 A;  3RKV A;  3HHM A;  4OVU A;  4WWN A;  2PM7 A;  2XHE A;  4WWO A;  1INZ A;  3KMT A;  4BUP A;  4J8O A;  3UT8 A;  2KZT A;  4FHJ A;  4CGW A;  4J83 A;  1ZU2 A;  2HYZ A;  1DNP A;  4ANV A;  3KEZ A;  1EPU A;  3S7J A;  4C9B B;  1SQM A;  1MUF A;  5TH7 A;  3LXU X;  2PQN A;  4JHJ A;  4GA2 A;  3C98 A;  4QEN A;  1A17 A;  3BG0 B;  3ZXS A;  4FU3 A;  3EIJ A;  1Z6T A;  3FP3 A;  3FTX A;  3AS8 A;  3FUJ A;  4K0R A;  4XZ4 A;  4YPU A;  3FH5 A;  4L7T A;  2CFU A;  4OYS A;  5FZR A;  4MI0 A;  5CPR B;  1E8X A;  3P2B A;  4EPZ A;  3PE3 A;  1W3B A;  4GZ5 A;  2WPV A;  4G23 A;  4F7A A;  3DAL A;  3B7S A;  2WXJ A;  3RJW A;  4AV7 A;  2BTD A;  3NZS A;  1TJC A;  4HLE A;  5KJM A;  4G25 A;  2XQ0 A;  3JQ1 A;  2KC7 A;  3CVX A;  3FUM A;  3PNL B;  4H7X A;  4XI0 A;  2FEZ A;  1GW6 A;  3FEY A;  4UI9 J;  2PZI A;  3CBP A;  3ASG A;  1H19 A;  4JLG A;  4AEZ C;  4NVQ A;  2KCK A;  2ZU6 B;  2HR2 A;  1E96 B;  5G04 J;  3MKR A;  2Y4T A;  4RZ0 A;  1Y6I A;  2X6H A;  3UQ3 A;  3M58 A;  2J4D A;  3VLE A;  1SZ9 A;  3CHQ A;  5BUZ A;  2FBN A;  5CCL A;  2OV8 A;  3TGO A;  2VSY A;  2QPW A;  5FQ6 A;  2OND A;  4ILH B;  4EZK A;  1ELW A;  3LY8 A;  3B13 A;  4IJ8 A;  2L9B A;  2Y4U A;  3CBM A;  3BG1 B;  2MRI A;  3FUK A;  2JLB A;  3ML9 A;  5DIZ A;  3M5A A;  4IN3 B;  1HO8 A;  5JIN A;  3TJP A;  3L54 A;  3Q49 B;  3S7B A;  4E85 A;  4GZC A;  5LFA A;  5ARG A;  5M72 A;  3ASD A;  3JCK C;  3QAR A;  4G2V A;  4I9C A;  4J0U A;  1OWO A;  2LAI A;  2LSV A;  3RJV A;  4NQ0 A;  4KMO A;  3GZS A;  3L08 A;  4Q96 A;  4B8C B;  2VGX A;  5ANR A;  4G24 A;  2X6K A;  3U64 A;  3FFL A;  3VTX A;  4QEP A;  3LY7 A;  1HS6 A;  3GZ1 A;  1ZKK A;  2CHZ A;  2NC9 A;  3ZHE B;  4W9R A;  5KJL A;  2MHK A;  3APF A;  5KJK A;  3UPV A;  2KAT A;  4UI9 K;  1OWL A;  4HOU A;  5C1D A;  4JXT A;  4UQX A;  3U3W A;  4AU7 A;  3KMJ A;  2FUL A;  3FDH A;  3LPZ A;  3MEK A;  4UQZ A;  3L6A A;  2WXI A;  4N39 A;  3QAQ A;  1B89 A;  5T8I A;  3CIA A;  4KVM A;  1YA0 A;  3HVE A;  2YHE A;  4FC8 A;  5BNW A;  5C2Y A;  2NSZ A;  4HOQ A;  4I1O B;  3I5P A;  3OTN A;  5T0M A;  1H2V C;  3UUX A;  3RO3 A;  1X5B A;  3SWC A;  2WM9 A;  3CHR A;  3HYM B;  4L1B A;  3SZ7 A;  2AXU A;  4AY5 A;  4NJ5 A;  4KXK B;  4PS3 A;  4L23 A;  2WXK A;  3PRZ A;  2EQX A;  3FU6 A;  2I1J A;  3FHE A;  5AJD A;  3ZVV A;  2E0I A;  1ML9 A;  1TEZ A;  1O9S A;  3M54 A;  3BEE A;  4AIF A;  2L6J A;  4ANW A;  2WB2 A;  4Q69 A;  1WM5 A;  5BV1 A;  4R7L A;  1JUQ A;  5JHB A;  1FVH A;  2ILR A;  4YVQ C;  4MI5 A;  3RAY A;  3SI5 A;  2WXR A;  4BX8 A;  3FTZ A;  3GW4 A;  3CVW A;  4ACK A;  4A1S A;  3PDN A;  5LOZ A;  3DB5 A;  3TL5 A;  4N3B A;  4GZD A;  1HU3 A;  1HG5 A;  4GA1 A;  3PEU B;  5E76 A;  3EP0 A;  2IOL A;  2J9Q A;  3OXG A;  2GRM A;  1KT0 A;  4BY6 A;  1ZBP A;  2M63 A;  1KLX A;  2FF4 A;  4IUL A;  4J8E A;  3RRM B;  2VTB B;  5G05 C;  3Q15 A;  4NUR A;  3MKQ B;  2J49 A;  3IHV A;  3CK9 A;  2XRZ A;  3F9X A;  3QWP A;  3AU5 A;  4M3O A;  4C0E A;  2WXO A;  4J8F A;  5A7D B;  4ABN A;  2XEV A;  3MO2 A;  3MGB A;  1HX8 A;  2O8J A;  4WAF A;  3CVL A;  2WXF A;  5F6L A;  4C1Q A;  2WXQ A;  1QNF A;  2OVF A;  4GU5 A;  3CGH A;  4GA0 A;  1H2T C;  2GGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...