4WUYA

Crystal structure of protein lysine methyltransferase smyd2 in complex with lly-507, a cell-active, potent and selective inhibitor
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
429
structure length
414
Chain Sequence
GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKAEAIRDMVRYARNVIEEFRELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LLY-507, a Cell-active, Potent, and Selective Inhibitor of Protein-lysine Methyltransferase SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
total genus 145
structure length 414
sequence length 429
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4wuyA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4wuyA01
4G23A 2DBAA 1ELWA 1TJCA 4J8EA 2L6JA 5DBKA 1H3IA 2VYIA 4YVOA 4KXKB 3RQ4A 5CCLA 1MT6A 3LKUA 5DIZA 4NVQA 1KT0A 2MHKA 2O8JA 5F59A 3BEEA 4HOTA 4G1TA 3IHXA 3CEQA 3PE4A 3SZ7A 4LEUA 1QQEA 3MO2A 2R5SA 3S7BA 4I2WA 4JDSA 4WNEA 1N6AA 4JLGA 4AM9A 3M56A 1Y8MA 4CDRA 3EDTB 5EKQD 3TAXA 3M5AA 3AS8A 4E47A 4U0SA 3OXLA 2WPVA 3KMAA 3FP3A 2W5ZA 2KATA 5JJ7A 4BTAA 4NJ5A 2G46A 4UI9K 3QWVA 4YPAA 4HOSA 5D0QD 3O48A 2FBNA 3ZHEA 1ZBPA 4EQFA 2Y4UA 1OUVA 1B89A 3RKVA 3OOIA 3QWPA 3Q47B 4H12A 3Q5MA 4Y6CA 1IYGA 4UQZA 1PC2A 2BQZA 5C1DA 3HYMB 1IHGA 4BUPA 4GZ6A 3S7JA 5TEGA 5F6LA 1MUFA 3PDNA 4J8OA 2IGQA 4HOUA 3K9IA 2PZIA 4J83A 2PQNA 2KC7A 1NA0A 2JLBA 4G24A 5FZQA 3F9WA 5TH7A 2GW1A 4JL0A 5LCWC 4N3BA 2LSUA 4YNMA 4GCNA 4YNDA 1PEGA 3SWCA 3TG5A 3ASGA 5ARGA 1WAO1 3HNAA 5JJTA 4CGVA 4G26A 5TTFA 3MV3B 2C0LA 2UY1A 2C0MA 5D0OD 4BT9A 4RG6A 1QZ2A 2YQ8A 1O9SA 5T5GA 2HO1A 3EP0A 3ZPJA 4XI9A 2VGXB 2XEVA 2XGSA 3RJVA 4I17A 2WQHA 3CKBA 1E96B 3LY8A 3CVQA 2VSNA 4YPEA 2AVPA 4KYOB 5AYFA 3Q15A 3S7DA 4RZ0A 2E2EA 3OXGA 4WNDA 3MO5A 4YNPA 2I6HA 4HORA 5FJYA 3F9XA 3UUXA 4N5CA 3M58A 5G04C 5EX3A 1WM5A 4AIFA 3S7FA 3DALA 3MO0A 5BW8C 3RU0A 5HQ8A 3M54A 4U07A 4IJDA 2KCLA 3PE3A 3U3WA 4XI0A 3R9AB 3ESKA 3RJWA 4A1SA 2F69A 5EX0A 3KMTA 3M53A 4C1QA 3E4BA 3ZGQA 3AS5A 2QFCA 5KJKA 5EG2A 2XPIA 2KCVA 5AYWD 2HR2A 3FPDA 3VTYA 2VSYA 4LDGA 4AY5A 3NF1A 5CHEE 3RAYA 5LSXA 4MI5A 3CVNA 3M55A 5JJ0A 3QKYA 2BUGA 4N2QA 4UI9J 3LYAA 3M57A 5G05J 4WUYA 2UWJG 2OOEA 5A7DB 3SW9A 3ULQA 3ASFA 2HYZA 3SF4A 4UQYA 4N2SA 3UPVA 4BTBA 4J0UA 3CVPA 2YHCA 5HI7A 1NZNA 2QPWA 4GZ5A 4N3CA 2V5FA 4W9RA 4AY6A 1XQHA 1NA3A 3CBOA 4WNGA 1N3JA 2VGYA 2Q7FA 4J7IA 1ML9A 4Z4PA 1ZKKA 2PQRA 4JA7A 4UI9C 5G05C 5BT1A 3MV2B 2JV0A 4QEOA 3OPEA 4FMUA 4UQXA 3IEGA 4U0UA 4GYYA 4BT8A 4NRHB 3CV0A 5KJMA 4XIFA 2XGMA 2FEZA 5CPRB 3ASHA 4GCOA 3TG4A 3U4TA 5FZSA 5G04J 3AS4A 3VUZA 1YA0A 5F5EA 3OXFA 3ZFWA 4HOQA 1N6CA 3TGOA 4Y6WA 2R3AA 4G25A 3UQ3A 5T0MA 2RFIA 1ELRA 5M72A 3KS2A 3CBPA 4BWRA 3JYSA 3QOUA 3FWVA 5LSZA 3Q4AB 2W5YA 2LSVA 2PL2A 5CCMA 4O6FA 3ZN3A 3VV0A 4I1AA 1HH8A 1P5QA 3CBMA 4ABNA 4N3AA 4GYWA 4IJ8A 4CGWA 2J9QA 1MVHA 5FZRA 3F9YA 3CVLA 3S8PA 4J8DA 4F3VA 3K5KA 3QDNA 2XGOA 4GPKA 3ZHEB 5JHNA 3GZ2A 4J8FA 3GYZA 3RO3A 5FT9A 1KLXA 4IN3B 3CK7A 2P58C 3GZ1A 3BO5A 2UY1B 1ZU2A 4I9CA 1HZ4A 4O30A 3LY7A 1XNFA 4B94A 4NQ0A 2ONDA 3M59A 3F9ZA 2VGXA 3FFLA 2XCCA 3KD7A 4N39A 4WNFA 1A17A 3N71A 5KJNA 5BNWA 1HXIA 4APOA 2C2LA 4YVQC 5F6KC 5FTPA 2Y4TA 3CK9A 4H7XA 4JHRA 4GA2A 2LNIA 3DB5A 2IFUA 5T0KA 3ASDA 3WXXA 4U04A 5ARFA 2FI7A 2KCKA 5JIYA 3LCAA 3CK8A 4I9EA 5KJLA 2FO7A 3RIBA 3LPZA 2FF4A 4JA9A 3VTXA 2XCBA 4J7FA 3RO2A 4I51A 2NC9A 4H7YA 4MI0A 3KMJA 4GYOA 4ME2A 3MEKA 5A6CA 4QEPA 3MKRA 3LY9A 5JJ6A 1KT1A 4YPUA 1W3BA 4GA0A 3URZA 4GZ3A 4RG9A 4AU7A 4QENA 3Q49B 4I2ZA 4GA1A 4U0ZA 3OS5A 3KAEA 3CKCA 1MVXA 3MA5A 2VQ2A 4KBQA 1FCHA 5JINA 3GW4A 3QWWA 2IF4A 5LCWJ 4G2VA
chains in the Genus database with same CATH superfamily
3ZVVA 1E8XA 2LAIA 4YDEA 3TWRA 3CR3A 3G2TA 2L6JA 4PS3A 3UI2A 3TWQA 4YDYA 3DSWA 2WXQA 2NSZA 4C0EA 3SQVA 2MHKA 3FUHA 1NP7A 3BEEA 4G1TA 3B13A 4LEUA 3S7BA 3W9GA 3D9KA 4P29A 1SZAA 4FJYA 3F6QA 3EDTB 4CDRA 1N11A 4FC8A 5CECB 3D9NA 5AQ9A 1JCQA 3HHMA 5JJ7A 3BQOA 4N5QA 3ENEA 1JCRA 1SA5A 4HOSA 2FBNA 3MGBA 3EHNA 4EQFA 3FTUA 2Y4UA 1X5BA 1G3NB 3Q47B 2ZU6B 1U2VG 5ENRD 5HS0A 3D3MA 4UQZA 3D9OA 4AOFA 3S7JA 5JMND 1MUFA 1X81A 3X2QE 4UWLA 1HU3A 2XS1A 3MYVA 4GMLA 3K9IA 1NL4A 3UTMA 2PQNA 2JLBA 5ENPD 1H6KA 3IHYA 5T8IA 2FULA 5IY5E 4K0RA 4JL0A 1N9AA 2WMOA 3CHOA 3CIAA 2LSUA 5E75A 3HXCA 5CMYA 1WAO1 3AG1E 3CHRA 3G2WA 4CGVA 1EYHA 3D9LA 1N94A 2R59A 3ABLE 4LERA 2UY1A 2CHZA 5AQBA 2DWZA 2X6KA 5CRUA 4GTSA 2LXMA 2XENA 2X38A 4I17A 1TN6A 3TJPA 4DX7D 4MS6A 4F1PA 1O1RA 3T5XA 3EIJA 1DNPA 4YPEA 2AVPA 5AYFA 3EJNA 3UKUG 1TN8A 4U8VD 4ATGA 1Y6IA 4GU5A 2F8YA 4FADA 1FT1A 1H2TC 3FY4A 3KEZA 3UUXA 4M3OA 2Y0BG 3L17A 2L0TB 3CVYA 4IJDA 4U07A 4PS7A 1Z5SC 3PE3A 3WG7E 3APDA 5AJLA 3R9AB 2H6FA 2DZOA 3QNKA 2IONA 4A1SA 3RJWA 1H2VC 5EX0A 2KBXA 1KPSB 4C1QA 3U64A 2XPIA 2WQ6A 5AYWD 4J8SA 3VTYA 3P2BA 1Q2ZA 3QB2A 3UM3A 2DVWA 2VSYA 4LDGA 4ILHB 1UJJA 1SW6A 3NF1A 5CHEE 2F37A 4MI5A 3QKYA 2LO6A 3B95A 3APFA 3M57A 1D8DA 5G05J 5A7DB 4JW1A 2VSOE 3SF4A 4N2SA 3UPVA 1MQSA 4BTBA 4B8AA 3FTWA 4LRZA 4BESA 3HDXA 5EIBE 3DPYA 5EDSA 4N3CA 2V5FA 4U7EB 4HLLA 3LJ3A 3S2AA 2GRRB 3CBOA 3ZXSA 2VGYA 1MYOA 4Z4PA 4LNGA 4O1PA 4NURA 4UI9C 3FTVA 5BT1A 3CVVA 2WVIA 2OVFA 2JV0A 3IEGA 4KT6B 4GYYA 4U0UA 5G2NA 3TXNA 3DXKG 4NRHB 5B1AE 3R7RA 2WXIA 3TG4A 4TXPA 1OCOE 4AXHA 1YA0A 5F5EA 1N6CA 3QAQA 1OWPA 3TGOA 4IYPA 4Y6WA 5E76A 2R3AA 4G25A 3V31A 4JC8A 2J4DA 1ELRA 2GROB 5M72A 1UG3A 2X6HA 3CBPA 4BWRA 2IQCA 1L5JA 4O6FA 3ASOE 4K5CA 4I1AA 3RAUA 1P5QA 2P9LG 2EIKE 5AAOA 3Q73A 2J9QA 5CBNA 2QYJA 2DCPA 3UX4A 3SFZA 2WXNA 3CVLA 3FUDA 4BERA 2CG3A 5CRVA 4F3VA 1QBQA 4KZCA 3QDNA 4U8YD 2XGOA 4KVMA 4OVUA 3V2OA 3KSQA 4Q69A 5AN8A 3IBEA 4MRUA 2CFZA 3BO5A 1ZU2A 1H6PA 1YYHA 1TNOA 1XNFA 3AJIA 3PNTB 2L9BA 4I6GA 3MZLB 2ONDA 3FUKA 3FH8A 1MX6A 4UUCA 1EPUA 2R05A 4A3TA 5EYLA 2Y4TA 3CK9A 4H7XA 3L08A 4BX8A 3DB5A 5FQ4A 2FI7A 4BSXA 2FO7A 4UWFA 3V30A 3SHFA 2R17C 2B0OE 2QC9A 1JPLA 3PRZA 3ZEFA 5BUZA 1LD8A 3KMJA 4GYOA 1HG2A 4ME2A 5ENSD 1OWOA 1SZ9A 2KM4A 3URZA 3HRAA 4GZ3A 4RG9A 4ANVA 4I2ZA 4NIKA 2MOWA 3RRMB 3CKCA 4FLHA 1IXVA 3D9HA 1JWFA 4EPZA 2CHWA 4KBQA 3UMVA 3ZNGA 1FCHA 2IO2C 2IF4A 1N95A 2DYRE 4RLYA 4LG6A 2DBAA 4UWHA 1ELWA 3CSTA 1TJCA 1YMPA 3LVQE 2Y69E 2BTDA 4KXKB 5JA4D 1SQMA 4LCTA 1MT6A 3LKUA 4NVQA 2EINE 4U95D 1KT0A 2V5QC 4HXIA 3APCA 5CEDB 4GTMA 3IHXA 3CEQA 3SZ7A 3QJZA 1QQEA 3LJNA 3MO2A 4FULA 2KZTA 4JDSA 1H19A 4JLGA 4OAUC 4WWNA 1Y8MA 5EKQD 3TAXA 3AS8A 1AWCB 4WWPA 4E47A 4U0SA 3OXLA 5J90A 4TUMA 2EIJE 2PNNA 4AVXA 1S0PA 2J4BA 4NJ5A 2P9IG 4GTTA 5KCMA 5D0QD 1OWMA 3L82A 3CQGB 3CLJA 3OOIA 4FU3A 4K5AB 2WXRA 3UIOC 2BQZA 4IULA 5C1DA 3HYMB 1PAQA 1IHGA 2LXLA 2XHEA 4GZ6A 4MLPA 2PM6A 2EIME 4HOUA 1NA0A 4ACKA 4G24A 2WXGA 2P2CP 4A1GA 5CMWA 1HG5A 3FULA 2GW1A 2XRYA 4E85A 3C72A 4OYSA 4OVVA 1NI1A 4HNAD 2CFUA 4YNMA 4GCNA 4DX1A 3TG5A 3FUNA 5ENOD 1U3DA 4G26A 2C0LA 3ZKJA 4X8QA 2C0MA 4BT9A 2LAHA 1QZ2A 2J49A 5G55A 2HO1A 4R7LA 2XGSA 2XEVA 5A23A 3C3OA 3TWVA 4LUNU 5ANLA 5FQ6A 1E96B 1QYMA 2QY7A 1TJFA 3DPDA 3D9MA 3G2SA 3CVQA 3ULYA 3ASNE 2BKGA 4RZ0A 4F7AA 4WNDA 2P9PG 3FEYA 4YDOA 4HORA 5FJYA 2DIWA 5HKPA 2L6BA 1WDYA 5EX3A 3UINC 2RFAA 5T3RA 4AIFA 3TWWA 4TXRA 3MO0A 4HI9A 3RU0A 2XRZA 4EHMA 3NAWA 4HFGA 3E32A 3R9MA 3R7QA 2F69A 4ACLA 3ZGQA 3ZYQA 2WXKA 3E33A 2KCVA 3IKOB 3FPDA 4HRMB 4XZ4A 3ZIMA 1IQUA 3SNXA 4EZJA 5LX8A 3BU8A 5KWDA 4DLQA 2P9SG 3HXDA 4LNUD 2GGFA 4L1BA 2WXHA 3CVNA 4UWGA 5JJ0A 3PUJA 1UJKA 2BUGA 1N54A 3B7UX 4XKBA 1IKND 3ML9A 3LYAA 3C3RA 3SW9A 2OOEA 4C0MA 4GPMA 3ULQA 3ASFA 4UQYA 1TN7A 3ZW3A 3J5PA 3D9PA 2J8SD 2CHXA 5CEAA 1NZNA 2ZIRA 4FHKA 2V0PA 4W9RA 4J7WA 2Q7FA 4J7IA 3BG1B 2PQRA 3FDHA 4I43A 4JA7A 2I2OA 2R02A 2ETBA 5FQ8A 2XGMA 5CPRB 4PDXA 1BI8B 2GRMA 3AS4A 3ZFWA 4HOQA 1FVFA 3TXMA 4CZ2D 3L16A 4TV3A 1N4QA 4ATZD 3DSVA 4L9PA 3JYSA 5HRYA 3UT7A 2WMNA 4C9BB 2WB2A 3CQCB 2A4ZA 4RVBA 3QARA 5LSZA 2PL2A 2V8SE 5LOZA 3RK6A 3B7TA 2I1KA 1HH8A 3CBMA 4ABNA 4N3AA 4BETA 2MYOA 4DPRA 4IJ8A 4DRXE 3NOCD 3UXGA 4DX2A 3OTNA 5C2YA 3PH0C 1N52A 3JXIA 5BV0A 3F9YA 4UWKA 3NZUA 5BXOA 3EU9A 4J8DA 4E6HA 2JEKA 1MHQA 3MJWA 3FU5A 3JUIA 3AG4E 4GTRA 2CG2A 4GPKA 5JHNA 3GZ2A 3TWSA 1V55E 3GYZA 3RO3A 3SBSA 2X6IA 1HX8A 1KLXA 3EUVA 3VLFA 4I1MA 2WXOA 1K8KG 2P58C 3GZ1A 4I9CA 2WXLA 2F8XK 5AARA 3FU3A 3M59A 3FUJA 4LSZE 2LUHA 2VGXA 2XCCA 3KD7A 4N39A 3CHSA 1JUQA 4APOA 2L0IA 4DUIA 1HFAA 5F6KC 3FTZA 4GA2A 3CHPA 5T0KA 3LCAA 5KJLA 2KXPC 1MZCA 4JA9A 3JQ1A 5ENQD 2XCBA 3RO2A 4I51A 2NC9A 3CHMA 5B3SE 2DZNA 3UIPC 4L7TA 4QEPA 1S70B 5JJ6A 5AJDA 3PZDA 1KT1A 4JPSA 2BEDA 3RSEG 4QENA 4ZFHA 4U0ZA 2OVBA 5BPPA 4FA6A 4JD2G 4CYMD 5LCWJ 1E7VA 4G23A 4DX6D 1O1TA 1H3IA 2VJ8A 2VYIA 3E34A 3ZXPA 3GZSA 3RQ4A 4I1OB 4GAAA 4CCAA 3SGHA 5F59A 3FUIA 4HOTA 2BKKB 2F0YA 2ETAA 4U8HA 4I2WA 2GRLA 3Q79A 4WNEA 1A5EA 4KZ0A 4AM9A 2AXVA 3M5AA 1E8YA 4AJWA 1DVPA 3FP3A 2FO1E 1DCQA 2W5ZA 3ESLA 3AU4A 4BX9A 2G46A 4UI9K 3QWVA 4YPAA 1KZPA 2X6JA 3O48A 2XEEA 3ZHEA 1ZBPA 1OUVA 1B89A 3W9FA 4H12A 3FUFA 3Q5MA 3CVWA 3NZSA 5LFAA 4LNBA 3I5PA 1PC2A 5EYPF 4DJAA 5AQ7A 2V4LA 5LP0A 4GB9A 3DSUA 3PDNA 4J8OA 2IGQA 2Y1LE 2PZIA 1ZB1A 2EQXA 2KC7A 1N0QA 1LD7A 3Q7FA 3ML8A 4BFRA 2AJAA 2ETCA 4HBDA 2ZXWE 3IHVA 4PS8A 4XX5A 5LCWC 3SFXA 3FTYA 3HG0D 4N3BA 2XS8A 4MBGA 2IO3C 2PM7A 1N4SA 1OCRE 3LXUX 3E37A 3PREA 3SWCA 3CVXA 5ARGA 3HNAA 3D9IA 1HF8A 2BF0X 4DI3A 4MKTA 2RFMA 1MJ0A 2KZTB 2H6HA 3PVLA 4PH4B 2HE0A 1WY6A 2WXPA 5D0OD 3ONLA 4RG6A 2YQ8A 1O9SA 4F6RD 2V4HC 3ONKA 5T5GA 2IU1A 3EP0A 4PUCA 3ZPJA 4XI9A 2OEWA 4ILGA 2VSXE 1TNUA 2WQHA 3PZ4A 1EF1C 5CBOA 3LY8A 1S63A 3Q78A 1IQRA 4KYOB 3PUKA 3HXBA 1E8ZA 2I6HA 3C3QA 3F9XA 2Y3AA 4HRNA 4N5CA 3M58A 2I1JA 3NBNB 3OAWA 4HVBA 1OY3D 3IV0A 3JCKC 3S7FA 2RKKA 3Q9UC 4GTQA 5HQ8A 3M54A 2KCLA 3C5RA 3ZYLA 2RD0A 3FUEA 3U3WA 4XI0A 3VLEA 1BD8A 2QZAA 4D10C 5JHBA 4DX5D 3AS5A 1N4PA 5EG2A 2A5EA 3FTXA 3TWTA 3SI5A 4CT0A 2MRIA 1HE8A 3RAYA 2WXJA 5LSXA 3QC1A 4N2QA 1MX4A 4UI9J 1BLXB 4GTVA 2UWJG 1TNYA 3DBSA 5T4YA 2HYZA 4J0UA 3CVPA 1D9SA 5HI7A 3EHRA 1DC2A 4CRWA 4GZ5A 2OEVA 4BSZB 3ZUVB 3BUAA 2VTBA 4AY6A 1NA3A 3IXEA 1JCSA 3UM0A 1FT2A 4JXTA 4GZCA 4GMJA 1N3JA 3VLDA 1ML9A 3I4GA 4GMRA 4G11A 4FHJA 4QEOA 3OPEA 4FMUA 4BT8A 4HI8A 3CV0A 5KJMA 2J07A 4XIFA 2FEZA 3AU5A 3UT8A 3ASHA 1S64A 3U4TA 1YCSB 5G04J 1KZOA 2GRPB 5BV1A 3KS2A 1O1SA 1OWLA 4HS2A 2NXPA 3QOUA 1WG0A 3B7BA 3Q4AB 2W5YA 2OV8A 5CCMA 3FEXA 4QQIA 2R2LA 4RQIA 3ZN3A 3VV0A 1E8WA 4GYWA 4U96D 4JZYA 2XPZA 4CT4A 3Q7AA 3HXEA 3U9WA 2IJGX 5FZRA 2R03A 3MCXA 1LTXA 2DYSE 1H2UA 3ABME 3O4ZA 1K1AA 2H6IA 1U3CA 3DWLG 3PEVB 5D66A 2IOSA 1BU9A 3TWXA 3DEPA 3QK0A 5B1BE 2XQ0A 4IN3B 3CK7A 3PZ1A 5AIJA 2NYJA 4L2LA 1HZ4A 3V2XA 2B6CA 4JHKA 4NQ0A 3L9TA 3F9ZA 4ANUA 3CVUA 3N71A 2P9NG 3BG0B 5KJNA 5BNWA 2YINA 1HXIA 2C2LA 2XZDG 3EU5A 4DLOA 4JHRA 4FP7A 5CERB 3DSSA 3TWUA 3ASDA 4XKCA 4U04A 5ARFA 4I9EA 4NACA 2IOLA 4K5BA 3L13A 3VTXA 4J7FA 3HIZA 4A63B 3DXMG 1N0RA 1E7UA 2WXFA 4MI0A 5JHAA 1Z6TA 3MEKA 3UM1A 2IEJA 4YPUA 3C98A 4GA0A 5FWQA 5J08A 3KEAA 3Q49B 3LVRE 3ABKE 3L22A 3KAEA 3MKQA 1K3ZD 2GRNB 2VQ2A 4BEPA 1DCEA 5KNGA 5JINA 4G2VA 4EZKA 3JUEA 3D9JA 4B0ZA 4J8EA 5DBKA 4YVOA 4FJZA 5CCLA 5DIZA 5H7PA 4Q94A 2O8JA 1OT8A 3DEOA 1H6OA 1RW2A 3PE4A 1OWNA 4DI4A 3PZ3A 4HRLA 4JB8P 2R5SA 4QFVA 2HM8A 3HVEB 1N6AA 5KNHD 4B8CB 3M56A 1SA4A 3T9KA 3CSFA 2GRQB 2WM9A 2WPVA 3KMAA 3LEWA 1BPOA 2KATA 4BTAA 3FH7A 1FPPA 4CDMA 3RKVA 3QWPA 4AP2A 4Y6CA 1BI7B 1IYGA 2AWIA 3P1UA 1LF8A 4BUPA 2ILRA 3JXJA 5TEGA 5F6LA 3MKQB 3I4RB 4O60A 4J83A 3T8KA 5EN5D 5FZQA 3F9WA 1OCCE 1QNFA 3HXFA 5TH7A 3FU6A 2AXZA 4JVSA 4K03A 2XZTG 4F1SA 3JQ0A 4HQDA 4TRQA 4YNDA 1PEGA 3ASGA 1O5MA 4APFA 5D2MC 5JJTA 5FINA 3J5QB 3RRNB 4EBAG 3SFYA 3EHMA 2YHEA 2WXMA 5TTFA 3T8MA 3MV3B 1HO8A 1OCZE 2QYUA 3FH5A 3PNLB 3RJVA 2VGXB 2ZGDA 5KBAA 3CKBA 3Q9NC 3AAAC 4EBAA 3G2UA 3B7SA 2VSNA 4O1OA 3LS8A 4G8LA 3Q15A 3CHQA 3S7DA 1SVXA 2E2EA 3OXGA 5AENA 3DSXA 3MO5A 4YNPA 1UN8A 1EDUA 5BXUA 3DRAA 4L2YA 1UW4B 5G04C 1V54E 1WM5A 3I3NA 3SBTB 4AEZC 3DALA 1INZA 2YNQA 5BW8C 4I6EA 2X3MA 4EZLA 3ESKA 3KMTA 3M53A 5ENTD 2ZISA 3E4BA 2QFCA 4GTOA 5KJKA 1D8EA 1RZ4A 2HR2A 4TUUA 3MX3A 3SO8A 3TL5A 1FVHA 1AP7A 4L23A 5ANRA 4AY5A 1UOHA 3DSTA 5FQ7A 3M55A 3UM2A 4JHJA 4Q96A 1IHBA 4WUYA 1VDYA 4OAVB 4DK5A 1UN9A 4URKA 3PS6A 2YHCA 3T5VA 3FU0A 2QPWA 2H6GA 1GW6A 1ELKA 5FIOA 3KSLA 4XE0A 2OCCE 1XQHA 5ITZF 3SD5A 3SY2A 2VGEA 3CGHA 4WNGA 4KVOA 5EIDA 1Z3YA 1ZKKA 1TR4A 3Q75A 5G05C 3MV2B 3UT4A 4F53A 3U66A 3NB2A 4UQXA 1OXJA 3ISMC 4GCOA 4RSYA 3V79K 5FZSA 3VUZA 3OXFA 4B93B 3EIQC 3UQ3A 5T0MA 2RFIA 4CEMA 3FWVA 3PEUB 2LSVA 4U63A 3PZ2A 3FTSA 3ULEG 5ENNA 1E90A 2I9CA 4ILIA 1TNZA 4J8YA 3EHQA 4KMOA 3FUMA 4C48B 4GTPA 1K1BA 4WAFA 3ZRHA 4CGWA 2J08A 1MX2A 1MVHA 3NQPA 2WQ7A 3NOGD 1TYQG 4I6JA 1JWGA 4M7CA 3S8PA 4HB5A 4YDWA 3K5KA 4ZHBA 3ZHEB 4EECA 4GZDA 1TNBA 3E30A 4J8FA 5FT9A 2EILE 2P9UG 4ANXA 4CDNA 2UY1B 3UKRG 5EILA 2AW6A 4O30A 3LY7A 4Z68A 2IY0C 2M63A 4B89A 4B94A 2E0IA 4JEUA 3RRUA 4XEIG 3L6AA 3HVEA 2RG8A 4HLEA 3FFLA 2A5UA 4WNFA 1Z3XA 1A17A 4BY6A 4IRUA 1PY1A 4YVQC 5AQAA 5FTPA 3ZYMA 3ZYKA 2LNIA 2VTBB 2X6FA 2IFUA 2P9KG 3L54A 2XPYA 3WXXA 2KCKA 5JIYA 2ZGGA 3CK8A 4FLBA 3RIBA 4J6IA 4AV7A 3LPZA 2FF4A 2AXUA 3FHEA 2JABA 4G8KA 3LDZA 4H7YA 4JEHA 4A55A 5A6CA 1NFIE 3MKRA 4V3IA 1HS6A 1TEZA 3LY9A 1W3BA 3B7RL 4AU7A 3AG2E 3ZU7B 4ANWA 4GA1A 3OS5A 1H0AA 2XEHA 1MVXA 3MA5A 1XGWA 2J09A 4TXQA 4WWOA 4A3VA 3G2VA 3AG3E 3GW4A 3QWWA 1N4RA
chains in the Genus database with same CATH topology
3ZVVA 1E7VA 4G23A 5LSZA 1E8XA 2LAIA 4UWHA 2DBAA 4B0ZA 1ELWA 3CSTA 1TJCA 3LVQE 3CR3A 3G2TA 4J8EA 2L6JA 5DBKA 1H3IA 2BTDA 2VJ8A 2VYIA 4KXKB 4PS3A 4YVOA 1SQMA 3GZSA 4FJZA 4LCTA 3RQ4A 5CCLA 1MT6A 2WXQA 4I1OB 3LKUA 5DIZA 4NVQA 2NSZA 4Q94A 4GAAA 4C0EA 1KT0A 2MHKA 3SGHA 4CCAA 2O8JA 3FUHA 5F59A 1NP7A 3BEEA 3APCA 3FUIA 4HXIA 4G1TA 4HOTA 3IHXA 3CEQA 3PE4A 1OWNA 3SZ7A 4DI4A 3B13A 3QJZA 4LEUA 4U8HA 1QQEA 3MO2A 4FULA 2KZTA 2R5SA 4QFVA 2HM8A 4I2WA 3S7BA 2GRLA 4JDSA 4WNEA 1H19A 3HVEB 1N6AA 3D9KA 4P29A 4JLGA 1SZAA 4FJYA 4B8CB 4KZ0A 4WWNA 4AM9A 2AXVA 1Y8MA 3EDTB 4CDRA 3M56A 5EKQD 3TAXA 3M5AA 3AS8A 4WWPA 4E47A 4FC8A 1E8YA 3OXLA 4U0SA 5J90A 3CSFA 3D9NA 4AJWA 2WM9A 2WPVA 4AVXA 1DVPA 1S0PA 3FP3A 2W5ZA 3KMAA 3ESLA 3LEWA 2J4BA 1BPOA 2KATA 3HHMA 5JJ7A 4BTAA 3AU4A 4NJ5A 4BX9A 2G46A 3FH7A 3ENEA 4UI9K 3QWVA 5KCMA 4YPAA 2X6JA 4HOSA 5D0QD 3O48A 2FBNA 3MGBA 3ZHEA 1OWMA 1ZBPA 3EHNA 4EQFA 3FTUA 2Y4UA 4CDMA 1OUVA 3CQGB 1B89A 1X5BA 3CLJA 3RKVA 3QWPA 3OOIA 3Q47B 2ZU6B 4AP2A 4H12A 3FUFA 3Q5MA 4Y6CA 4FU3A 3CVWA 3NZSA 1IYGA 3D3MA 5LFAA 4UQZA 3I5PA 1PC2A 2AWIA 2WXRA 4DJAA 2BQZA 4IULA 3P1UA 3D9OA 4AOFA 3HYMB 5C1DA 1LF8A 1PAQA 2V4LA 1IHGA 4BUPA 2XHEA 5LP0A 4GZ6A 2ILRA 3S7JA 4MLPA 5TEGA 5F6LA 1MUFA 4GB9A 4UWLA 2PM6A 1HU3A 3MKQB 3PDNA 4J8OA 3MYVA 3I4RB 2IGQA 4GMLA 4HOUA 3K9IA 2PZIA 4J83A 2PQNA 2EQXA 2KC7A 1NA0A 2JLBA 4ACKA 4G24A 2WXGA 1H6KA 4A1GA 5FZQA 3F9WA 3IHYA 3ML8A 4BFRA 1QNFA 5CMWA 5T8IA 1HG5A 5TH7A 3FULA 2FULA 2GW1A 2XRYA 3FU6A 2AXZA 4E85A 4JVSA 4K0RA 4K03A 4OYSA 4JL0A 3IHVA 4OVVA 4PS8A 4F1SA 4XX5A 5LCWC 2WMOA 3FTYA 3JQ0A 3CHOA 4N3BA 3CIAA 2LSUA 5E75A 2CFUA 4TRQA 4YNMA 4GCNA 4YNDA 5CMYA 1PEGA 2PM7A 3LXUX 3SWCA 3PREA 3TG5A 3ASGA 3CVXA 5ARGA 1WAO1 3HNAA 4APFA 3D9IA 5JJTA 3FUNA 1U3DA 3RRNB 4EBAG 3CHRA 1HF8A 2BF0X 3EHMA 4MKTA 4DI3A 3G2WA 2KZTB 1EYHA 3D9LA 4G26A 2YHEA 4CGVA 2WXMA 3PVLA 4PH4B 5TTFA 3T8MA 2R59A 3MV3B 2C0LA 1HO8A 4LERA 2UY1A 1WY6A 2WXPA 2C0MA 2CHZA 2LAHA 3ONLA 4RG6A 5D0OD 1QZ2A 2YQ8A 4BT9A 1O9SA 3FH5A 2J49A 3PNLB 3ONKA 5T5GA 5G55A 2IU1A 2X6KA 2HO1A 3EP0A 4R7LA 4PUCA 3ZPJA 4XI9A 2VGXB 2XEVA 2XGSA 4ILGA 3RJVA 5A23A 2VSXE 2X38A 4I17A 2WQHA 4LUNU 3CKBA 5ANLA 3TJPA 5FQ6A 1E96B 1EF1C 4EBAA 4MS6A 2QY7A 3G2UA 1TJFA 3DPDA 3LY8A 3D9MA 3T5XA 3G2SA 3EIJA 1DNPA 2VSNA 3B7SA 3CVQA 3LS8A 4YPEA 2AVPA 1IQRA 4KYOB 5AYFA 3EJNA 3PUKA 3Q15A 3CHQA 3S7DA 4ATGA 4RZ0A 2E2EA 1Y6IA 3OXGA 4F7AA 5AENA 4WNDA 1E8ZA 4GU5A 3MO5A 3FEYA 4FADA 4YNPA 2I6HA 1H2TC 1UN8A 3FY4A 3KEZA 1EDUA 4HORA 5FJYA 3F9XA 2Y3AA 3UUXA 2DIWA 4N5CA 3M58A 2I1JA 3OAWA 4L2YA 1UW4B 4M3OA 5G04C 5EX3A 4HVBA 3IV0A 3JCKC 1WM5A 3I3NA 5T3RA 3L17A 3S7FA 3SBTB 4AEZC 4AIFA 3DALA 3MO0A 1INZA 2L0TB 2YNQA 5BW8C 3RU0A 5HQ8A 3CVYA 4U07A 3M54A 4IJDA 2KCLA 4I6EA 4PS7A 2XRZA 3ZYLA 2RD0A 4HLEA 3PE3A 2X3MA 4EZLA 3FUEA 4HFGA 4XI0A 3U3WA 3APDA 5AJLA 3R9AB 3VLEA 3ESKA 3R7QA 3QNKA 3RJWA 4A1SA 2IONA 2F69A 1H2VC 5EX0A 3KMTA 4ACLA 4D10C 3M53A 5JHBA 4C1QA 3E4BA 3U64A 3ZGQA 3AS5A 3ZYQA 2QFCA 2WXKA 5KJKA 5EG2A 2XPIA 2WQ6A 2KCVA 5AYWD 3IKOB 2HR2A 4J8SA 3FPDA 4TUUA 3VTYA 3MX3A 3P2BA 3QB2A 3FTXA 1FVHA 3TL5A 2VSYA 4XZ4A 3ZIMA 1IQUA 3SNXA 4EZJA 5LX8A 4LDGA 4L23A 5ANRA 4ILHB 1UJJA 3SI5A 4AY5A 4CT0A 2MRIA 3NF1A 1HE8A 5CHEE 4DLQA 3RAYA 2WXJA 2GGFA 5LSXA 5FQ7A 4L1BA 2WXHA 3CVNA 3M55A 4UWGA 4MI5A 3QKYA 5JJ0A 3QC1A 3PUJA 1UJKA 2BUGA 1N54A 4JHJA 4Q96A 3B7UX 4N2QA 4XKBA 3ML9A 2LO6A 3LYAA 4UI9J 3APFA 3M57A 5G05J 4WUYA 1VDYA 2OOEA 2UWJG 5A7DB 4C0MA 3SW9A 3ULQA 4JW1A 2VSOE 3DBSA 5T4YA 3ASFA 2HYZA 3SF4A 4UQYA 4N2SA 3UPVA 1MQSA 3ZW3A 4DK5A 4BTBA 4B8AA 3FTWA 1UN9A 3D9PA 4J0UA 4LRZA 3CVPA 4URKA 3PS6A 2CHXA 3HDXA 2YHCA 5HI7A 3T5VA 3FU0A 1NZNA 2QPWA 4FHKA 4CRWA 5EDSA 4GZ5A 1GW6A 1ELKA 2V0PA 2V5FA 4N3CA 4W9RA 4XE0A 2VTBA 4AY6A 1XQHA 1NA3A 3SD5A 3LJ3A 3S2AA 4JXTA 3CBOA 3ZXSA 4GZCA 3CGHA 4WNGA 4GMJA 1N3JA 3VLDA 2VGYA 2Q7FA 4KVOA 4J7IA 1ML9A 4Z4PA 1Z3YA 1ZKKA 3BG1B 4NURA 2PQRA 3FDHA 3FTVA 3I4GA 4I43A 4JA7A 4UI9C 5G05C 2I2OA 5BT1A 3CVVA 3MV2B 4G11A 3UT4A 2WVIA 2OVFA 4F53A 3U66A 4FHJA 2JV0A 5FQ8A 4QEOA 3OPEA 4FMUA 4UQXA 3IEGA 4KT6B 4GYYA 4U0UA 5G2NA 3TXNA 4BT8A 4NRHB 3CV0A 5KJMA 2J07A 4XIFA 2XGMA 2FEZA 3AU5A 3R7RA 3UT8A 3ASHA 4PDXA 2WXIA 4GCOA 4RSYA 3TG4A 3U4TA 5CPRB 5FZSA 5G04J 2GRMA 4AXHA 3AS4A 3VUZA 1YA0A 5F5EA 3OXFA 3ZFWA 4HOQA 3EIQC 3QAQA 1N6CA 1OWPA 1FVFA 3TGOA 4IYPA 4Y6WA 5E76A 3TXMA 2R3AA 4G25A 3UQ3A 5T0MA 2RFIA 4JC8A 2J4DA 1ELRA 5BV1A 3L16A 5M72A 4TV3A 3KS2A 1OWLA 1UG3A 4HS2A 4CEMA 2X6HA 3CBPA 4BWRA 3JYSA 2NXPA 2IQCA 3QOUA 2WMNA 3UT7A 4C9BB 3CQCB 2WB2A 1L5JA 3FWVA 2A4ZA 4RVBA 3Q4AB 3QARA 3PEUB 2LSVA 2PL2A 2OV8A 4U63A 2V8SE 5CCMA 2W5YA 3FEXA 5LOZA 3RK6A 3FTSA 5ENNA 4O6FA 1E90A 3B7TA 2I9CA 3ZN3A 2I1KA 3VV0A 4I1AA 4ILIA 1E8WA 1HH8A 1P5QA 3CBMA 4ABNA 4N3AA 4GYWA 4JZYA 2XPZA 4DPRA 4CT4A 4IJ8A 4KMOA 3FUMA 4WAFA 3ZRHA 4CGWA 2J08A 2J9QA 1MVHA 3OTNA 2DCPA 3NQPA 5C2YA 3U9WA 3PH0C 1N52A 2IJGX 5FZRA 3UX4A 3SFZA 2WQ7A 5BV0A 3F9YA 4UWKA 2WXNA 3CVLA 3FUDA 3NZUA 4I6JA 3MCXA 2CG3A 1JWGA 3S8PA 1H2UA 4J8DA 4E6HA 4F3VA 2JEKA 4KZCA 3K5KA 3O4ZA 1U3CA 1MHQA 3MJWA 3FU5A 3JUIA 3PEVB 3QDNA 2XGOA 2IOSA 4KVMA 4GPKA 2CG2A 3ZHEB 4EECA 5JHNA 3GZ2A 4GZDA 4OVUA 4J8FA 3GYZA 3RO3A 3SBSA 2X6IA 1HX8A 5FT9A 4Q69A 1KLXA 3IBEA 3QK0A 2XQ0A 4MRUA 3VLFA 4IN3B 3CK7A 4I1MA 4ANXA 2WXOA 5AIJA 2P58C 2CFZA 3GZ1A 4CDNA 3BO5A 2UY1B 4L2LA 1ZU2A 4I9CA 2AW6A 1HZ4A 4O30A 3LY7A 1XNFA 3PNTB 2M63A 4B89A 4B94A 2L9BA 2E0IA 4JEUA 3RRUA 4I6GA 2WXLA 3MZLB 3L6AA 3HVEA 4JHKA 4NQ0A 3FU3A 2ONDA 3FUKA 3M59A 3FUJA 3FH8A 3F9ZA 2RG8A 4ANUA 3CVUA 2VGXA 3FFLA 2A5UA 2XCCA 3KD7A 1Z3XA 3CHSA 4N39A 4WNFA 1A17A 3N71A 1JUQA 3BG0B 4BY6A 5KJNA 4IRUA 1PY1A 2YINA 5BNWA 1EPUA 1HXIA 4APOA 2L0IA 4A3TA 2C2LA 1HFAA 4YVQC 5F6KC 5FTPA 2Y4TA 4DLOA 3FTZA 3ZYMA 3CK9A 4H7XA 4JHRA 4GA2A 3ZYKA 4FP7A 2LNIA 3L08A 4BX8A 2X6FA 3CHPA 2VTBB 5FQ4A 2IFUA 3DB5A 5T0KA 3ASDA 3L54A 2XPYA 4U04A 4XKCA 5ARFA 3WXXA 2FI7A 2KCKA 4BSXA 5JIYA 3LCAA 3CK8A 4I9EA 5KJLA 4FLBA 2FO7A 3RIBA 4J6IA 4NACA 2IOLA 4AV7A 3LPZA 2FF4A 4UWFA 2AXUA 3L13A 4JA9A 3JQ1A 3VTXA 3SHFA 2R17C 3FHEA 2XCBA 4J7FA 3HIZA 1JPLA 3PRZA 3RO2A 3ZEFA 4I51A 5BUZA 3LDZA 2NC9A 3CHMA 4H7YA 4JEHA 1E7UA 2WXFA 4MI0A 5JHAA 3KMJA 4GYOA 1Z6TA 4A55A 1HG2A 4ME2A 3MEKA 4L7TA 5A6CA 4QEPA 3MKRA 4V3IA 1HS6A 1OWOA 1TEZA 1SZ9A 3LY9A 5JJ6A 5AJDA 3PZDA 1KT1A 4YPUA 3C98A 1W3BA 2KM4A 3B7RL 4GA0A 4JPSA 5FWQA 3URZA 4GZ3A 5J08A 4RG9A 4AU7A 4QENA 4ANVA 3Q49B 3LVRE 4I2ZA 4ANWA 4GA1A 4U0ZA 3OS5A 3L22A 2OVBA 2MOWA 5BPPA 1H0AA 3KAEA 3CKCA 3RRMB 3MKQA 4FA6A 4FLHA 1MVXA 3MA5A 1XGWA 2VQ2A 1JWFA 2J09A 2CHWA 4KBQA 4WWOA 4EPZA 3UMVA 1FCHA 3G2VA 4A3VA 3GW4A 3QWWA 5JINA 2IF4A 5LCWJ 4G2VA 4EZKA 3D9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G23 A;  2DBA A;  1ELW A;  1TJC A;  4J8E A;  2L6J A;  5DBK A;  1H3I A;  2VYI A;  4YVO A;  4KXK B;  3RQ4 A;  5CCL A;  1MT6 A;  3LKU A;  5DIZ A;  4NVQ A;  1KT0 A;  2MHK A;  2O8J A;  5F59 A;  3BEE A;  4HOT A;  4G1T A;  3IHX A;  3CEQ A;  3PE4 A;  3SZ7 A;  4LEU A;  1QQE A;  3MO2 A;  2R5S A;  3S7B A;  4I2W A;  4JDS A;  4WNE A;  1N6A A;  4JLG A;  4AM9 A;  3M56 A;  1Y8M A;  4CDR A;  3EDT B;  5EKQ D;  3TAX A;  3M5A A;  3AS8 A;  4E47 A;  4U0S A;  3OXL A;  2WPV A;  3KMA A;  3FP3 A;  2W5Z A;  2KAT A;  5JJ7 A;  4BTA A;  4NJ5 A;  2G46 A;  4UI9 K;  3QWV A;  4YPA A;  4HOS A;  5D0Q D;  3O48 A;  2FBN A;  3ZHE A;  1ZBP A;  4EQF A;  2Y4U A;  1OUV A;  1B89 A;  3RKV A;  3OOI A;  3QWP A;  3Q47 B;  4H12 A;  3Q5M A;  4Y6C A;  1IYG A;  4UQZ A;  1PC2 A;  2BQZ A;  5C1D A;  3HYM B;  1IHG A;  4BUP A;  4GZ6 A;  3S7J A;  5TEG A;  5F6L A;  1MUF A;  3PDN A;  4J8O A;  2IGQ A;  4HOU A;  3K9I A;  2PZI A;  4J83 A;  2PQN A;  2KC7 A;  1NA0 A;  2JLB A;  4G24 A;  5FZQ A;  3F9W A;  5TH7 A;  2GW1 A;  4JL0 A;  5LCW C;  4N3B A;  2LSU A;  4YNM A;  4GCN A;  4YND A;  1PEG A;  3SWC A;  3TG5 A;  3ASG A;  5ARG A;  1WAO 1;  3HNA A;  5JJT A;  4CGV A;  4G26 A;  5TTF A;  3MV3 B;  2C0L A;  2UY1 A;  2C0M A;  5D0O D;  4BT9 A;  4RG6 A;  1QZ2 A;  2YQ8 A;  1O9S A;  5T5G A;  2HO1 A;  3EP0 A;  3ZPJ A;  4XI9 A;  2VGX B;  2XEV A;  2XGS A;  3RJV A;  4I17 A;  2WQH A;  3CKB A;  1E96 B;  3LY8 A;  3CVQ A;  2VSN A;  4YPE A;  2AVP A;  4KYO B;  5AYF A;  3Q15 A;  3S7D A;  4RZ0 A;  2E2E A;  3OXG A;  4WND A;  3MO5 A;  4YNP A;  2I6H A;  4HOR A;  5FJY A;  3F9X A;  3UUX A;  4N5C A;  3M58 A;  5G04 C;  5EX3 A;  1WM5 A;  4AIF A;  3S7F A;  3DAL A;  3MO0 A;  5BW8 C;  3RU0 A;  5HQ8 A;  3M54 A;  4U07 A;  4IJD A;  2KCL A;  3PE3 A;  3U3W A;  4XI0 A;  3R9A B;  3ESK A;  3RJW A;  4A1S A;  2F69 A;  5EX0 A;  3KMT A;  3M53 A;  4C1Q A;  3E4B A;  3ZGQ A;  3AS5 A;  2QFC A;  5KJK A;  5EG2 A;  2XPI A;  2KCV A;  5AYW D;  2HR2 A;  3FPD A;  3VTY A;  2VSY A;  4LDG A;  4AY5 A;  3NF1 A;  5CHE E;  3RAY A;  5LSX A;  4MI5 A;  3CVN A;  3M55 A;  5JJ0 A;  3QKY A;  2BUG A;  4N2Q A;  4UI9 J;  3LYA A;  3M57 A;  5G05 J;  4WUY A;  2UWJ G;  2OOE A;  5A7D B;  3SW9 A;  3ULQ A;  3ASF A;  2HYZ A;  3SF4 A;  4UQY A;  4N2S A;  3UPV A;  4BTB A;  4J0U A;  3CVP A;  2YHC A;  5HI7 A;  1NZN A;  2QPW A;  4GZ5 A;  4N3C A;  2V5F A;  4W9R A;  4AY6 A;  1XQH A;  1NA3 A;  3CBO A;  4WNG A;  1N3J A;  2VGY A;  2Q7F A;  4J7I A;  1ML9 A;  4Z4P A;  1ZKK A;  2PQR A;  4JA7 A;  4UI9 C;  5G05 C;  5BT1 A;  3MV2 B;  2JV0 A;  4QEO A;  3OPE A;  4FMU A;  4UQX A;  3IEG A;  4U0U A;  4GYY A;  4BT8 A;  4NRH B;  3CV0 A;  5KJM A;  4XIF A;  2XGM A;  2FEZ A;  5CPR B;  3ASH A;  4GCO A;  3TG4 A;  3U4T A;  5FZS A;  5G04 J;  3AS4 A;  3VUZ A;  1YA0 A;  5F5E A;  3OXF A;  3ZFW A;  4HOQ A;  1N6C A;  3TGO A;  4Y6W A;  2R3A A;  4G25 A;  3UQ3 A;  5T0M A;  2RFI A;  1ELR A;  5M72 A;  3KS2 A;  3CBP A;  4BWR A;  3JYS A;  3QOU A;  3FWV A;  5LSZ A;  3Q4A B;  2W5Y A;  2LSV A;  2PL2 A;  5CCM A;  4O6F A;  3ZN3 A;  3VV0 A;  4I1A A;  1HH8 A;  1P5Q A;  3CBM A;  4ABN A;  4N3A A;  4GYW A;  4IJ8 A;  4CGW A;  2J9Q A;  1MVH A;  5FZR A;  3F9Y A;  3CVL A;  3S8P A;  4J8D A;  4F3V A;  3K5K A;  3QDN A;  2XGO A;  4GPK A;  3ZHE B;  5JHN A;  3GZ2 A;  4J8F A;  3GYZ A;  3RO3 A;  5FT9 A;  1KLX A;  4IN3 B;  3CK7 A;  2P58 C;  3GZ1 A;  3BO5 A;  2UY1 B;  1ZU2 A;  4I9C A;  1HZ4 A;  4O30 A;  3LY7 A;  1XNF A;  4B94 A;  4NQ0 A;  2OND A;  3M59 A;  3F9Z A;  2VGX A;  3FFL A;  2XCC A;  3KD7 A;  4N39 A;  4WNF A;  1A17 A;  3N71 A;  5KJN A;  5BNW A;  1HXI A;  4APO A;  2C2L A;  4YVQ C;  5F6K C;  5FTP A;  2Y4T A;  3CK9 A;  4H7X A;  4JHR A;  4GA2 A;  2LNI A;  3DB5 A;  2IFU A;  5T0K A;  3ASD A;  3WXX A;  4U04 A;  5ARF A;  2FI7 A;  2KCK A;  5JIY A;  3LCA A;  3CK8 A;  4I9E A;  5KJL A;  2FO7 A;  3RIB A;  3LPZ A;  2FF4 A;  4JA9 A;  3VTX A;  2XCB A;  4J7F A;  3RO2 A;  4I51 A;  2NC9 A;  4H7Y A;  4MI0 A;  3KMJ A;  4GYO A;  4ME2 A;  3MEK A;  5A6C A;  4QEP A;  3MKR A;  3LY9 A;  5JJ6 A;  1KT1 A;  4YPU A;  1W3B A;  4GA0 A;  3URZ A;  4GZ3 A;  4RG9 A;  4AU7 A;  4QEN A;  3Q49 B;  4I2Z A;  4GA1 A;  4U0Z A;  3OS5 A;  3KAE A;  3CKC A;  1MVX A;  3MA5 A;  2VQ2 A;  4KBQ A;  1FCH A;  5JIN A;  3GW4 A;  3QWW A;  2IF4 A;  5LCW J;  4G2V A; 
#chains in the Genus database with same CATH topology
 3ZVV A;  1E8X A;  2LAI A;  4YDE A;  3TWR A;  3CR3 A;  3G2T A;  2L6J A;  4PS3 A;  3UI2 A;  3TWQ A;  4YDY A;  3DSW A;  2WXQ A;  2NSZ A;  4C0E A;  3SQV A;  2MHK A;  3FUH A;  1NP7 A;  3BEE A;  4G1T A;  3B13 A;  4LEU A;  3S7B A;  3W9G A;  3D9K A;  4P29 A;  1SZA A;  4FJY A;  3F6Q A;  3EDT B;  4CDR A;  1N11 A;  4FC8 A;  5CEC B;  3D9N A;  5AQ9 A;  1JCQ A;  3HHM A;  5JJ7 A;  3BQO A;  4N5Q A;  3ENE A;  1JCR A;  1SA5 A;  4HOS A;  2FBN A;  3MGB A;  3EHN A;  4EQF A;  3FTU A;  2Y4U A;  1X5B A;  1G3N B;  3Q47 B;  2ZU6 B;  1U2V G;  5ENR D;  5HS0 A;  3D3M A;  4UQZ A;  3D9O A;  4AOF A;  3S7J A;  5JMN D;  1MUF A;  1X81 A;  3X2Q E;  4UWL A;  1HU3 A;  2XS1 A;  3MYV A;  4GML A;  3K9I A;  1NL4 A;  3UTM A;  2PQN A;  2JLB A;  5ENP D;  1H6K A;  3IHY A;  5T8I A;  2FUL A;  5IY5 E;  4K0R A;  4JL0 A;  1N9A A;  2WMO A;  3CHO A;  3CIA A;  2LSU A;  5E75 A;  3HXC A;  5CMY A;  1WAO 1;  3AG1 E;  3CHR A;  3G2W A;  4CGV A;  1EYH A;  3D9L A;  1N94 A;  2R59 A;  3ABL E;  4LER A;  2UY1 A;  2CHZ A;  5AQB A;  2DWZ A;  2X6K A;  5CRU A;  4GTS A;  2LXM A;  2XEN A;  2X38 A;  4I17 A;  1TN6 A;  3TJP A;  4DX7 D;  4MS6 A;  4F1P A;  1O1R A;  3T5X A;  3EIJ A;  1DNP A;  4YPE A;  2AVP A;  5AYF A;  3EJN A;  3UKU G;  1TN8 A;  4U8V D;  4ATG A;  1Y6I A;  4GU5 A;  2F8Y A;  4FAD A;  1FT1 A;  1H2T C;  3FY4 A;  3KEZ A;  3UUX A;  4M3O A;  2Y0B G;  3L17 A;  2L0T B;  3CVY A;  4IJD A;  4U07 A;  4PS7 A;  1Z5S C;  3PE3 A;  3WG7 E;  3APD A;  5AJL A;  3R9A B;  2H6F A;  2DZO A;  3QNK A;  2ION A;  4A1S A;  3RJW A;  1H2V C;  5EX0 A;  2KBX A;  1KPS B;  4C1Q A;  3U64 A;  2XPI A;  2WQ6 A;  5AYW D;  4J8S A;  3VTY A;  3P2B A;  1Q2Z A;  3QB2 A;  3UM3 A;  2DVW A;  2VSY A;  4LDG A;  4ILH B;  1UJJ A;  1SW6 A;  3NF1 A;  5CHE E;  2F37 A;  4MI5 A;  3QKY A;  2LO6 A;  3B95 A;  3APF A;  3M57 A;  1D8D A;  5G05 J;  5A7D B;  4JW1 A;  2VSO E;  3SF4 A;  4N2S A;  3UPV A;  1MQS A;  4BTB A;  4B8A A;  3FTW A;  4LRZ A;  4BES A;  3HDX A;  5EIB E;  3DPY A;  5EDS A;  4N3C A;  2V5F A;  4U7E B;  4HLL A;  3LJ3 A;  3S2A A;  2GRR B;  3CBO A;  3ZXS A;  2VGY A;  1MYO A;  4Z4P A;  4LNG A;  4O1P A;  4NUR A;  4UI9 C;  3FTV A;  5BT1 A;  3CVV A;  2WVI A;  2OVF A;  2JV0 A;  3IEG A;  4KT6 B;  4GYY A;  4U0U A;  5G2N A;  3TXN A;  3DXK G;  4NRH B;  5B1A E;  3R7R A;  2WXI A;  3TG4 A;  4TXP A;  1OCO E;  4AXH A;  1YA0 A;  5F5E A;  1N6C A;  3QAQ A;  1OWP A;  3TGO A;  4IYP A;  4Y6W A;  5E76 A;  2R3A A;  4G25 A;  3V31 A;  4JC8 A;  2J4D A;  1ELR A;  2GRO B;  5M72 A;  1UG3 A;  2X6H A;  3CBP A;  4BWR A;  2IQC A;  1L5J A;  4O6F A;  3ASO E;  4K5C A;  4I1A A;  3RAU A;  1P5Q A;  2P9L G;  2EIK E;  5AAO A;  3Q73 A;  2J9Q A;  5CBN A;  2QYJ A;  2DCP A;  3UX4 A;  3SFZ A;  2WXN A;  3CVL A;  3FUD A;  4BER A;  2CG3 A;  5CRV A;  4F3V A;  1QBQ A;  4KZC A;  3QDN A;  4U8Y D;  2XGO A;  4KVM A;  4OVU A;  3V2O A;  3KSQ A;  4Q69 A;  5AN8 A;  3IBE A;  4MRU A;  2CFZ A;  3BO5 A;  1ZU2 A;  1H6P A;  1YYH A;  1TNO A;  1XNF A;  3AJI A;  3PNT B;  2L9B A;  4I6G A;  3MZL B;  2OND A;  3FUK A;  3FH8 A;  1MX6 A;  4UUC A;  1EPU A;  2R05 A;  4A3T A;  5EYL A;  2Y4T A;  3CK9 A;  4H7X A;  3L08 A;  4BX8 A;  3DB5 A;  5FQ4 A;  2FI7 A;  4BSX A;  2FO7 A;  4UWF A;  3V30 A;  3SHF A;  2R17 C;  2B0O E;  2QC9 A;  1JPL A;  3PRZ A;  3ZEF A;  5BUZ A;  1LD8 A;  3KMJ A;  4GYO A;  1HG2 A;  4ME2 A;  5ENS D;  1OWO A;  1SZ9 A;  2KM4 A;  3URZ A;  3HRA A;  4GZ3 A;  4RG9 A;  4ANV A;  4I2Z A;  4NIK A;  2MOW A;  3RRM B;  3CKC A;  4FLH A;  1IXV A;  3D9H A;  1JWF A;  4EPZ A;  2CHW A;  4KBQ A;  3UMV A;  3ZNG A;  1FCH A;  2IO2 C;  2IF4 A;  1N95 A;  2DYR E;  4RLY A;  4LG6 A;  2DBA A;  4UWH A;  1ELW A;  3CST A;  1TJC A;  1YMP A;  3LVQ E;  2Y69 E;  2BTD A;  4KXK B;  5JA4 D;  1SQM A;  4LCT A;  1MT6 A;  3LKU A;  4NVQ A;  2EIN E;  4U95 D;  1KT0 A;  2V5Q C;  4HXI A;  3APC A;  5CED B;  4GTM A;  3IHX A;  3CEQ A;  3SZ7 A;  3QJZ A;  1QQE A;  3LJN A;  3MO2 A;  4FUL A;  2KZT A;  4JDS A;  1H19 A;  4JLG A;  4OAU C;  4WWN A;  1Y8M A;  5EKQ D;  3TAX A;  3AS8 A;  1AWC B;  4WWP A;  4E47 A;  4U0S A;  3OXL A;  5J90 A;  4TUM A;  2EIJ E;  2PNN A;  4AVX A;  1S0P A;  2J4B A;  4NJ5 A;  2P9I G;  4GTT A;  5KCM A;  5D0Q D;  1OWM A;  3L82 A;  3CQG B;  3CLJ A;  3OOI A;  4FU3 A;  4K5A B;  2WXR A;  3UIO C;  2BQZ A;  4IUL A;  5C1D A;  3HYM B;  1PAQ A;  1IHG A;  2LXL A;  2XHE A;  4GZ6 A;  4MLP A;  2PM6 A;  2EIM E;  4HOU A;  1NA0 A;  4ACK A;  4G24 A;  2WXG A;  2P2C P;  4A1G A;  5CMW A;  1HG5 A;  3FUL A;  2GW1 A;  2XRY A;  4E85 A;  3C72 A;  4OYS A;  4OVV A;  1NI1 A;  4HNA D;  2CFU A;  4YNM A;  4GCN A;  4DX1 A;  3TG5 A;  3FUN A;  5ENO D;  1U3D A;  4G26 A;  2C0L A;  3ZKJ A;  4X8Q A;  2C0M A;  4BT9 A;  2LAH A;  1QZ2 A;  2J49 A;  5G55 A;  2HO1 A;  4R7L A;  2XGS A;  2XEV A;  5A23 A;  3C3O A;  3TWV A;  4LUN U;  5ANL A;  5FQ6 A;  1E96 B;  1QYM A;  2QY7 A;  1TJF A;  3DPD A;  3D9M A;  3G2S A;  3CVQ A;  3ULY A;  3ASN E;  2BKG A;  4RZ0 A;  4F7A A;  4WND A;  2P9P G;  3FEY A;  4YDO A;  4HOR A;  5FJY A;  2DIW A;  5HKP A;  2L6B A;  1WDY A;  5EX3 A;  3UIN C;  2RFA A;  5T3R A;  4AIF A;  3TWW A;  4TXR A;  3MO0 A;  4HI9 A;  3RU0 A;  2XRZ A;  4EHM A;  3NAW A;  4HFG A;  3E32 A;  3R9M A;  3R7Q A;  2F69 A;  4ACL A;  3ZGQ A;  3ZYQ A;  2WXK A;  3E33 A;  2KCV A;  3IKO B;  3FPD A;  4HRM B;  4XZ4 A;  3ZIM A;  1IQU A;  3SNX A;  4EZJ A;  5LX8 A;  3BU8 A;  5KWD A;  4DLQ A;  2P9S G;  3HXD A;  4LNU D;  2GGF A;  4L1B A;  2WXH A;  3CVN A;  4UWG A;  5JJ0 A;  3PUJ A;  1UJK A;  2BUG A;  1N54 A;  3B7U X;  4XKB A;  1IKN D;  3ML9 A;  3LYA A;  3C3R A;  3SW9 A;  2OOE A;  4C0M A;  4GPM A;  3ULQ A;  3ASF A;  4UQY A;  1TN7 A;  3ZW3 A;  3J5P A;  3D9P A;  2J8S D;  2CHX A;  5CEA A;  1NZN A;  2ZIR A;  4FHK A;  2V0P A;  4W9R A;  4J7W A;  2Q7F A;  4J7I A;  3BG1 B;  2PQR A;  3FDH A;  4I43 A;  4JA7 A;  2I2O A;  2R02 A;  2ETB A;  5FQ8 A;  2XGM A;  5CPR B;  4PDX A;  1BI8 B;  2GRM A;  3AS4 A;  3ZFW A;  4HOQ A;  1FVF A;  3TXM A;  4CZ2 D;  3L16 A;  4TV3 A;  1N4Q A;  4ATZ D;  3DSV A;  4L9P A;  3JYS A;  5HRY A;  3UT7 A;  2WMN A;  4C9B B;  2WB2 A;  3CQC B;  2A4Z A;  4RVB A;  3QAR A;  5LSZ A;  2PL2 A;  2V8S E;  5LOZ A;  3RK6 A;  3B7T A;  2I1K A;  1HH8 A;  3CBM A;  4ABN A;  4N3A A;  4BET A;  2MYO A;  4DPR A;  4IJ8 A;  4DRX E;  3NOC D;  3UXG A;  4DX2 A;  3OTN A;  5C2Y A;  3PH0 C;  1N52 A;  3JXI A;  5BV0 A;  3F9Y A;  4UWK A;  3NZU A;  5BXO A;  3EU9 A;  4J8D A;  4E6H A;  2JEK A;  1MHQ A;  3MJW A;  3FU5 A;  3JUI A;  3AG4 E;  4GTR A;  2CG2 A;  4GPK A;  5JHN A;  3GZ2 A;  3TWS A;  1V55 E;  3GYZ A;  3RO3 A;  3SBS A;  2X6I A;  1HX8 A;  1KLX A;  3EUV A;  3VLF A;  4I1M A;  2WXO A;  1K8K G;  2P58 C;  3GZ1 A;  4I9C A;  2WXL A;  2F8X K;  5AAR A;  3FU3 A;  3M59 A;  3FUJ A;  4LSZ E;  2LUH A;  2VGX A;  2XCC A;  3KD7 A;  4N39 A;  3CHS A;  1JUQ A;  4APO A;  2L0I A;  4DUI A;  1HFA A;  5F6K C;  3FTZ A;  4GA2 A;  3CHP A;  5T0K A;  3LCA A;  5KJL A;  2KXP C;  1MZC A;  4JA9 A;  3JQ1 A;  5ENQ D;  2XCB A;  3RO2 A;  4I51 A;  2NC9 A;  3CHM A;  5B3S E;  2DZN A;  3UIP C;  4L7T A;  4QEP A;  1S70 B;  5JJ6 A;  5AJD A;  3PZD A;  1KT1 A;  4JPS A;  2BED A;  3RSE G;  4QEN A;  4ZFH A;  4U0Z A;  2OVB A;  5BPP A;  4FA6 A;  4JD2 G;  4CYM D;  5LCW J;  1E7V A;  4G23 A;  4DX6 D;  1O1T A;  1H3I A;  2VJ8 A;  2VYI A;  3E34 A;  3ZXP A;  3GZS A;  3RQ4 A;  4I1O B;  4GAA A;  4CCA A;  3SGH A;  5F59 A;  3FUI A;  4HOT A;  2BKK B;  2F0Y A;  2ETA A;  4U8H A;  4I2W A;  2GRL A;  3Q79 A;  4WNE A;  1A5E A;  4KZ0 A;  4AM9 A;  2AXV A;  3M5A A;  1E8Y A;  4AJW A;  1DVP A;  3FP3 A;  2FO1 E;  1DCQ A;  2W5Z A;  3ESL A;  3AU4 A;  4BX9 A;  2G46 A;  4UI9 K;  3QWV A;  4YPA A;  1KZP A;  2X6J A;  3O48 A;  2XEE A;  3ZHE A;  1ZBP A;  1OUV A;  1B89 A;  3W9F A;  4H12 A;  3FUF A;  3Q5M A;  3CVW A;  3NZS A;  5LFA A;  4LNB A;  3I5P A;  1PC2 A;  5EYP F;  4DJA A;  5AQ7 A;  2V4L A;  5LP0 A;  4GB9 A;  3DSU A;  3PDN A;  4J8O A;  2IGQ A;  2Y1L E;  2PZI A;  1ZB1 A;  2EQX A;  2KC7 A;  1N0Q A;  1LD7 A;  3Q7F A;  3ML8 A;  4BFR A;  2AJA A;  2ETC A;  4HBD A;  2ZXW E;  3IHV A;  4PS8 A;  4XX5 A;  5LCW C;  3SFX A;  3FTY A;  3HG0 D;  4N3B A;  2XS8 A;  4MBG A;  2IO3 C;  2PM7 A;  1N4S A;  1OCR E;  3LXU X;  3E37 A;  3PRE A;  3SWC A;  3CVX A;  5ARG A;  3HNA A;  3D9I A;  1HF8 A;  2BF0 X;  4DI3 A;  4MKT A;  2RFM A;  1MJ0 A;  2KZT B;  2H6H A;  3PVL A;  4PH4 B;  2HE0 A;  1WY6 A;  2WXP A;  5D0O D;  3ONL A;  4RG6 A;  2YQ8 A;  1O9S A;  4F6R D;  2V4H C;  3ONK A;  5T5G A;  2IU1 A;  3EP0 A;  4PUC A;  3ZPJ A;  4XI9 A;  2OEW A;  4ILG A;  2VSX E;  1TNU A;  2WQH A;  3PZ4 A;  1EF1 C;  5CBO A;  3LY8 A;  1S63 A;  3Q78 A;  1IQR A;  4KYO B;  3PUK A;  3HXB A;  1E8Z A;  2I6H A;  3C3Q A;  3F9X A;  2Y3A A;  4HRN A;  4N5C A;  3M58 A;  2I1J A;  3NBN B;  3OAW A;  4HVB A;  1OY3 D;  3IV0 A;  3JCK C;  3S7F A;  2RKK A;  3Q9U C;  4GTQ A;  5HQ8 A;  3M54 A;  2KCL A;  3C5R A;  3ZYL A;  2RD0 A;  3FUE A;  3U3W A;  4XI0 A;  3VLE A;  1BD8 A;  2QZA A;  4D10 C;  5JHB A;  4DX5 D;  3AS5 A;  1N4P A;  5EG2 A;  2A5E A;  3FTX A;  3TWT A;  3SI5 A;  4CT0 A;  2MRI A;  1HE8 A;  3RAY A;  2WXJ A;  5LSX A;  3QC1 A;  4N2Q A;  1MX4 A;  4UI9 J;  1BLX B;  4GTV A;  2UWJ G;  1TNY A;  3DBS A;  5T4Y A;  2HYZ A;  4J0U A;  3CVP A;  1D9S A;  5HI7 A;  3EHR A;  1DC2 A;  4CRW A;  4GZ5 A;  2OEV A;  4BSZ B;  3ZUV B;  3BUA A;  2VTB A;  4AY6 A;  1NA3 A;  3IXE A;  1JCS A;  3UM0 A;  1FT2 A;  4JXT A;  4GZC A;  4GMJ A;  1N3J A;  3VLD A;  1ML9 A;  3I4G A;  4GMR A;  4G11 A;  4FHJ A;  4QEO A;  3OPE A;  4FMU A;  4BT8 A;  4HI8 A;  3CV0 A;  5KJM A;  2J07 A;  4XIF A;  2FEZ A;  3AU5 A;  3UT8 A;  3ASH A;  1S64 A;  3U4T A;  1YCS B;  5G04 J;  1KZO A;  2GRP B;  5BV1 A;  3KS2 A;  1O1S A;  1OWL A;  4HS2 A;  2NXP A;  3QOU A;  1WG0 A;  3B7B A;  3Q4A B;  2W5Y A;  2OV8 A;  5CCM A;  3FEX A;  4QQI A;  2R2L A;  4RQI A;  3ZN3 A;  3VV0 A;  1E8W A;  4GYW A;  4U96 D;  4JZY A;  2XPZ A;  4CT4 A;  3Q7A A;  3HXE A;  3U9W A;  2IJG X;  5FZR A;  2R03 A;  3MCX A;  1LTX A;  2DYS E;  1H2U A;  3ABM E;  3O4Z A;  1K1A A;  2H6I A;  1U3C A;  3DWL G;  3PEV B;  5D66 A;  2IOS A;  1BU9 A;  3TWX A;  3DEP A;  3QK0 A;  5B1B E;  2XQ0 A;  4IN3 B;  3CK7 A;  3PZ1 A;  5AIJ A;  2NYJ A;  4L2L A;  1HZ4 A;  3V2X A;  2B6C A;  4JHK A;  4NQ0 A;  3L9T A;  3F9Z A;  4ANU A;  3CVU A;  3N71 A;  2P9N G;  3BG0 B;  5KJN A;  5BNW A;  2YIN A;  1HXI A;  2C2L A;  2XZD G;  3EU5 A;  4DLO A;  4JHR A;  4FP7 A;  5CER B;  3DSS A;  3TWU A;  3ASD A;  4XKC A;  4U04 A;  5ARF A;  4I9E A;  4NAC A;  2IOL A;  4K5B A;  3L13 A;  3VTX A;  4J7F A;  3HIZ A;  4A63 B;  3DXM G;  1N0R A;  1E7U A;  2WXF A;  4MI0 A;  5JHA A;  1Z6T A;  3MEK A;  3UM1 A;  2IEJ A;  4YPU A;  3C98 A;  4GA0 A;  5FWQ A;  5J08 A;  3KEA A;  3Q49 B;  3LVR E;  3ABK E;  3L22 A;  3KAE A;  3MKQ A;  1K3Z D;  2GRN B;  2VQ2 A;  4BEP A;  1DCE A;  5KNG A;  5JIN A;  4G2V A;  4EZK A;  3JUE A;  3D9J A;  4B0Z A;  4J8E A;  5DBK A;  4YVO A;  4FJZ A;  5CCL A;  5DIZ A;  5H7P A;  4Q94 A;  2O8J A;  1OT8 A;  3DEO A;  1H6O A;  1RW2 A;  3PE4 A;  1OWN A;  4DI4 A;  3PZ3 A;  4HRL A;  4JB8 P;  2R5S A;  4QFV A;  2HM8 A;  3HVE B;  1N6A A;  5KNH D;  4B8C B;  3M56 A;  1SA4 A;  3T9K A;  3CSF A;  2GRQ B;  2WM9 A;  2WPV A;  3KMA A;  3LEW A;  1BPO A;  2KAT A;  4BTA A;  3FH7 A;  1FPP A;  4CDM A;  3RKV A;  3QWP A;  4AP2 A;  4Y6C A;  1BI7 B;  1IYG A;  2AWI A;  3P1U A;  1LF8 A;  4BUP A;  2ILR A;  3JXJ A;  5TEG A;  5F6L A;  3MKQ B;  3I4R B;  4O60 A;  4J83 A;  3T8K A;  5EN5 D;  5FZQ A;  3F9W A;  1OCC E;  1QNF A;  3HXF A;  5TH7 A;  3FU6 A;  2AXZ A;  4JVS A;  4K03 A;  2XZT G;  4F1S A;  3JQ0 A;  4HQD A;  4TRQ A;  4YND A;  1PEG A;  3ASG A;  1O5M A;  4APF A;  5D2M C;  5JJT A;  5FIN A;  3J5Q B;  3RRN B;  4EBA G;  3SFY A;  3EHM A;  2YHE A;  2WXM A;  5TTF A;  3T8M A;  3MV3 B;  1HO8 A;  1OCZ E;  2QYU A;  3FH5 A;  3PNL B;  3RJV A;  2VGX B;  2ZGD A;  5KBA A;  3CKB A;  3Q9N C;  3AAA C;  4EBA A;  3G2U A;  3B7S A;  2VSN A;  4O1O A;  3LS8 A;  4G8L A;  3Q15 A;  3CHQ A;  3S7D A;  1SVX A;  2E2E A;  3OXG A;  5AEN A;  3DSX A;  3MO5 A;  4YNP A;  1UN8 A;  1EDU A;  5BXU A;  3DRA A;  4L2Y A;  1UW4 B;  5G04 C;  1V54 E;  1WM5 A;  3I3N A;  3SBT B;  4AEZ C;  3DAL A;  1INZ A;  2YNQ A;  5BW8 C;  4I6E A;  2X3M A;  4EZL A;  3ESK A;  3KMT A;  3M53 A;  5ENT D;  2ZIS A;  3E4B A;  2QFC A;  4GTO A;  5KJK A;  1D8E A;  1RZ4 A;  2HR2 A;  4TUU A;  3MX3 A;  3SO8 A;  3TL5 A;  1FVH A;  1AP7 A;  4L23 A;  5ANR A;  4AY5 A;  1UOH A;  3DST A;  5FQ7 A;  3M55 A;  3UM2 A;  4JHJ A;  4Q96 A;  1IHB A;  4WUY A;  1VDY A;  4OAV B;  4DK5 A;  1UN9 A;  4URK A;  3PS6 A;  2YHC A;  3T5V A;  3FU0 A;  2QPW A;  2H6G A;  1GW6 A;  1ELK A;  5FIO A;  3KSL A;  4XE0 A;  2OCC E;  1XQH A;  5ITZ F;  3SD5 A;  3SY2 A;  2VGE A;  3CGH A;  4WNG A;  4KVO A;  5EID A;  1Z3Y A;  1ZKK A;  1TR4 A;  3Q75 A;  5G05 C;  3MV2 B;  3UT4 A;  4F53 A;  3U66 A;  3NB2 A;  4UQX A;  1OXJ A;  3ISM C;  4GCO A;  4RSY A;  3V79 K;  5FZS A;  3VUZ A;  3OXF A;  4B93 B;  3EIQ C;  3UQ3 A;  5T0M A;  2RFI A;  4CEM A;  3FWV A;  3PEU B;  2LSV A;  4U63 A;  3PZ2 A;  3FTS A;  3ULE G;  5ENN A;  1E90 A;  2I9C A;  4ILI A;  1TNZ A;  4J8Y A;  3EHQ A;  4KMO A;  3FUM A;  4C48 B;  4GTP A;  1K1B A;  4WAF A;  3ZRH A;  4CGW A;  2J08 A;  1MX2 A;  1MVH A;  3NQP A;  2WQ7 A;  3NOG D;  1TYQ G;  4I6J A;  1JWG A;  4M7C A;  3S8P A;  4HB5 A;  4YDW A;  3K5K A;  4ZHB A;  3ZHE B;  4EEC A;  4GZD A;  1TNB A;  3E30 A;  4J8F A;  5FT9 A;  2EIL E;  2P9U G;  4ANX A;  4CDN A;  2UY1 B;  3UKR G;  5EIL A;  2AW6 A;  4O30 A;  3LY7 A;  4Z68 A;  2IY0 C;  2M63 A;  4B89 A;  4B94 A;  2E0I A;  4JEU A;  3RRU A;  4XEI G;  3L6A A;  3HVE A;  2RG8 A;  4HLE A;  3FFL A;  2A5U A;  4WNF A;  1Z3X A;  1A17 A;  4BY6 A;  4IRU A;  1PY1 A;  4YVQ C;  5AQA A;  5FTP A;  3ZYM A;  3ZYK A;  2LNI A;  2VTB B;  2X6F A;  2IFU A;  2P9K G;  3L54 A;  2XPY A;  3WXX A;  2KCK A;  5JIY A;  2ZGG A;  3CK8 A;  4FLB A;  3RIB A;  4J6I A;  4AV7 A;  3LPZ A;  2FF4 A;  2AXU A;  3FHE A;  2JAB A;  4G8K A;  3LDZ A;  4H7Y A;  4JEH A;  4A55 A;  5A6C A;  1NFI E;  3MKR A;  4V3I A;  1HS6 A;  1TEZ A;  3LY9 A;  1W3B A;  3B7R L;  4AU7 A;  3AG2 E;  3ZU7 B;  4ANW A;  4GA1 A;  3OS5 A;  1H0A A;  2XEH A;  1MVX A;  3MA5 A;  1XGW A;  2J09 A;  4TXQ A;  4WWO A;  4A3V A;  3G2V A;  3AG3 E;  3GW4 A;  3QWW A;  1N4R A; 
#chains in the Genus database with same CATH homology
 3ZVV A;  1E7V A;  4G23 A;  5LSZ A;  1E8X A;  2LAI A;  4UWH A;  2DBA A;  4B0Z A;  1ELW A;  3CST A;  1TJC A;  3LVQ E;  3CR3 A;  3G2T A;  4J8E A;  2L6J A;  5DBK A;  1H3I A;  2BTD A;  2VJ8 A;  2VYI A;  4KXK B;  4PS3 A;  4YVO A;  1SQM A;  3GZS A;  4FJZ A;  4LCT A;  3RQ4 A;  5CCL A;  1MT6 A;  2WXQ A;  4I1O B;  3LKU A;  5DIZ A;  4NVQ A;  2NSZ A;  4Q94 A;  4GAA A;  4C0E A;  1KT0 A;  2MHK A;  3SGH A;  4CCA A;  2O8J A;  3FUH A;  5F59 A;  1NP7 A;  3BEE A;  3APC A;  3FUI A;  4HXI A;  4G1T A;  4HOT A;  3IHX A;  3CEQ A;  3PE4 A;  1OWN A;  3SZ7 A;  4DI4 A;  3B13 A;  3QJZ A;  4LEU A;  4U8H A;  1QQE A;  3MO2 A;  4FUL A;  2KZT A;  2R5S A;  4QFV A;  2HM8 A;  4I2W A;  3S7B A;  2GRL A;  4JDS A;  4WNE A;  1H19 A;  3HVE B;  1N6A A;  3D9K A;  4P29 A;  4JLG A;  1SZA A;  4FJY A;  4B8C B;  4KZ0 A;  4WWN A;  4AM9 A;  2AXV A;  1Y8M A;  3EDT B;  4CDR A;  3M56 A;  5EKQ D;  3TAX A;  3M5A A;  3AS8 A;  4WWP A;  4E47 A;  4FC8 A;  1E8Y A;  3OXL A;  4U0S A;  5J90 A;  3CSF A;  3D9N A;  4AJW A;  2WM9 A;  2WPV A;  4AVX A;  1DVP A;  1S0P A;  3FP3 A;  2W5Z A;  3KMA A;  3ESL A;  3LEW A;  2J4B A;  1BPO A;  2KAT A;  3HHM A;  5JJ7 A;  4BTA A;  3AU4 A;  4NJ5 A;  4BX9 A;  2G46 A;  3FH7 A;  3ENE A;  4UI9 K;  3QWV A;  5KCM A;  4YPA A;  2X6J A;  4HOS A;  5D0Q D;  3O48 A;  2FBN A;  3MGB A;  3ZHE A;  1OWM A;  1ZBP A;  3EHN A;  4EQF A;  3FTU A;  2Y4U A;  4CDM A;  1OUV A;  3CQG B;  1B89 A;  1X5B A;  3CLJ A;  3RKV A;  3QWP A;  3OOI A;  3Q47 B;  2ZU6 B;  4AP2 A;  4H12 A;  3FUF A;  3Q5M A;  4Y6C A;  4FU3 A;  3CVW A;  3NZS A;  1IYG A;  3D3M A;  5LFA A;  4UQZ A;  3I5P A;  1PC2 A;  2AWI A;  2WXR A;  4DJA A;  2BQZ A;  4IUL A;  3P1U A;  3D9O A;  4AOF A;  3HYM B;  5C1D A;  1LF8 A;  1PAQ A;  2V4L A;  1IHG A;  4BUP A;  2XHE A;  5LP0 A;  4GZ6 A;  2ILR A;  3S7J A;  4MLP A;  5TEG A;  5F6L A;  1MUF A;  4GB9 A;  4UWL A;  2PM6 A;  1HU3 A;  3MKQ B;  3PDN A;  4J8O A;  3MYV A;  3I4R B;  2IGQ A;  4GML A;  4HOU A;  3K9I A;  2PZI A;  4J83 A;  2PQN A;  2EQX A;  2KC7 A;  1NA0 A;  2JLB A;  4ACK A;  4G24 A;  2WXG A;  1H6K A;  4A1G A;  5FZQ A;  3F9W A;  3IHY A;  3ML8 A;  4BFR A;  1QNF A;  5CMW A;  5T8I A;  1HG5 A;  5TH7 A;  3FUL A;  2FUL A;  2GW1 A;  2XRY A;  3FU6 A;  2AXZ A;  4E85 A;  4JVS A;  4K0R A;  4K03 A;  4OYS A;  4JL0 A;  3IHV A;  4OVV A;  4PS8 A;  4F1S A;  4XX5 A;  5LCW C;  2WMO A;  3FTY A;  3JQ0 A;  3CHO A;  4N3B A;  3CIA A;  2LSU A;  5E75 A;  2CFU A;  4TRQ A;  4YNM A;  4GCN A;  4YND A;  5CMY A;  1PEG A;  2PM7 A;  3LXU X;  3SWC A;  3PRE A;  3TG5 A;  3ASG A;  3CVX A;  5ARG A;  1WAO 1;  3HNA A;  4APF A;  3D9I A;  5JJT A;  3FUN A;  1U3D A;  3RRN B;  4EBA G;  3CHR A;  1HF8 A;  2BF0 X;  3EHM A;  4MKT A;  4DI3 A;  3G2W A;  2KZT B;  1EYH A;  3D9L A;  4G26 A;  2YHE A;  4CGV A;  2WXM A;  3PVL A;  4PH4 B;  5TTF A;  3T8M A;  2R59 A;  3MV3 B;  2C0L A;  1HO8 A;  4LER A;  2UY1 A;  1WY6 A;  2WXP A;  2C0M A;  2CHZ A;  2LAH A;  3ONL A;  4RG6 A;  5D0O D;  1QZ2 A;  2YQ8 A;  4BT9 A;  1O9S A;  3FH5 A;  2J49 A;  3PNL B;  3ONK A;  5T5G A;  5G55 A;  2IU1 A;  2X6K A;  2HO1 A;  3EP0 A;  4R7L A;  4PUC A;  3ZPJ A;  4XI9 A;  2VGX B;  2XEV A;  2XGS A;  4ILG A;  3RJV A;  5A23 A;  2VSX E;  2X38 A;  4I17 A;  2WQH A;  4LUN U;  3CKB A;  5ANL A;  3TJP A;  5FQ6 A;  1E96 B;  1EF1 C;  4EBA A;  4MS6 A;  2QY7 A;  3G2U A;  1TJF A;  3DPD A;  3LY8 A;  3D9M A;  3T5X A;  3G2S A;  3EIJ A;  1DNP A;  2VSN A;  3B7S A;  3CVQ A;  3LS8 A;  4YPE A;  2AVP A;  1IQR A;  4KYO B;  5AYF A;  3EJN A;  3PUK A;  3Q15 A;  3CHQ A;  3S7D A;  4ATG A;  4RZ0 A;  2E2E A;  1Y6I A;  3OXG A;  4F7A A;  5AEN A;  4WND A;  1E8Z A;  4GU5 A;  3MO5 A;  3FEY A;  4FAD A;  4YNP A;  2I6H A;  1H2T C;  1UN8 A;  3FY4 A;  3KEZ A;  1EDU A;  4HOR A;  5FJY A;  3F9X A;  2Y3A A;  3UUX A;  2DIW A;  4N5C A;  3M58 A;  2I1J A;  3OAW A;  4L2Y A;  1UW4 B;  4M3O A;  5G04 C;  5EX3 A;  4HVB A;  3IV0 A;  3JCK C;  1WM5 A;  3I3N A;  5T3R A;  3L17 A;  3S7F A;  3SBT B;  4AEZ C;  4AIF A;  3DAL A;  3MO0 A;  1INZ A;  2L0T B;  2YNQ A;  5BW8 C;  3RU0 A;  5HQ8 A;  3CVY A;  4U07 A;  3M54 A;  4IJD A;  2KCL A;  4I6E A;  4PS7 A;  2XRZ A;  3ZYL A;  2RD0 A;  4HLE A;  3PE3 A;  2X3M A;  4EZL A;  3FUE A;  4HFG A;  4XI0 A;  3U3W A;  3APD A;  5AJL A;  3R9A B;  3VLE A;  3ESK A;  3R7Q A;  3QNK A;  3RJW A;  4A1S A;  2ION A;  2F69 A;  1H2V C;  5EX0 A;  3KMT A;  4ACL A;  4D10 C;  3M53 A;  5JHB A;  4C1Q A;  3E4B A;  3U64 A;  3ZGQ A;  3AS5 A;  3ZYQ A;  2QFC A;  2WXK A;  5KJK A;  5EG2 A;  2XPI A;  2WQ6 A;  2KCV A;  5AYW D;  3IKO B;  2HR2 A;  4J8S A;  3FPD A;  4TUU A;  3VTY A;  3MX3 A;  3P2B A;  3QB2 A;  3FTX A;  1FVH A;  3TL5 A;  2VSY A;  4XZ4 A;  3ZIM A;  1IQU A;  3SNX A;  4EZJ A;  5LX8 A;  4LDG A;  4L23 A;  5ANR A;  4ILH B;  1UJJ A;  3SI5 A;  4AY5 A;  4CT0 A;  2MRI A;  3NF1 A;  1HE8 A;  5CHE E;  4DLQ A;  3RAY A;  2WXJ A;  2GGF A;  5LSX A;  5FQ7 A;  4L1B A;  2WXH A;  3CVN A;  3M55 A;  4UWG A;  4MI5 A;  3QKY A;  5JJ0 A;  3QC1 A;  3PUJ A;  1UJK A;  2BUG A;  1N54 A;  4JHJ A;  4Q96 A;  3B7U X;  4N2Q A;  4XKB A;  3ML9 A;  2LO6 A;  3LYA A;  4UI9 J;  3APF A;  3M57 A;  5G05 J;  4WUY A;  1VDY A;  2OOE A;  2UWJ G;  5A7D B;  4C0M A;  3SW9 A;  3ULQ A;  4JW1 A;  2VSO E;  3DBS A;  5T4Y A;  3ASF A;  2HYZ A;  3SF4 A;  4UQY A;  4N2S A;  3UPV A;  1MQS A;  3ZW3 A;  4DK5 A;  4BTB A;  4B8A A;  3FTW A;  1UN9 A;  3D9P A;  4J0U A;  4LRZ A;  3CVP A;  4URK A;  3PS6 A;  2CHX A;  3HDX A;  2YHC A;  5HI7 A;  3T5V A;  3FU0 A;  1NZN A;  2QPW A;  4FHK A;  4CRW A;  5EDS A;  4GZ5 A;  1GW6 A;  1ELK A;  2V0P A;  2V5F A;  4N3C A;  4W9R A;  4XE0 A;  2VTB A;  4AY6 A;  1XQH A;  1NA3 A;  3SD5 A;  3LJ3 A;  3S2A A;  4JXT A;  3CBO A;  3ZXS A;  4GZC A;  3CGH A;  4WNG A;  4GMJ A;  1N3J A;  3VLD A;  2VGY A;  2Q7F A;  4KVO A;  4J7I A;  1ML9 A;  4Z4P A;  1Z3Y A;  1ZKK A;  3BG1 B;  4NUR A;  2PQR A;  3FDH A;  3FTV A;  3I4G A;  4I43 A;  4JA7 A;  4UI9 C;  5G05 C;  2I2O A;  5BT1 A;  3CVV A;  3MV2 B;  4G11 A;  3UT4 A;  2WVI A;  2OVF A;  4F53 A;  3U66 A;  4FHJ A;  2JV0 A;  5FQ8 A;  4QEO A;  3OPE A;  4FMU A;  4UQX A;  3IEG A;  4KT6 B;  4GYY A;  4U0U A;  5G2N A;  3TXN A;  4BT8 A;  4NRH B;  3CV0 A;  5KJM A;  2J07 A;  4XIF A;  2XGM A;  2FEZ A;  3AU5 A;  3R7R A;  3UT8 A;  3ASH A;  4PDX A;  2WXI A;  4GCO A;  4RSY A;  3TG4 A;  3U4T A;  5CPR B;  5FZS A;  5G04 J;  2GRM A;  4AXH A;  3AS4 A;  3VUZ A;  1YA0 A;  5F5E A;  3OXF A;  3ZFW A;  4HOQ A;  3EIQ C;  3QAQ A;  1N6C A;  1OWP A;  1FVF A;  3TGO A;  4IYP A;  4Y6W A;  5E76 A;  3TXM A;  2R3A A;  4G25 A;  3UQ3 A;  5T0M A;  2RFI A;  4JC8 A;  2J4D A;  1ELR A;  5BV1 A;  3L16 A;  5M72 A;  4TV3 A;  3KS2 A;  1OWL A;  1UG3 A;  4HS2 A;  4CEM A;  2X6H A;  3CBP A;  4BWR A;  3JYS A;  2NXP A;  2IQC A;  3QOU A;  2WMN A;  3UT7 A;  4C9B B;  3CQC B;  2WB2 A;  1L5J A;  3FWV A;  2A4Z A;  4RVB A;  3Q4A B;  3QAR A;  3PEU B;  2LSV A;  2PL2 A;  2OV8 A;  4U63 A;  2V8S E;  5CCM A;  2W5Y A;  3FEX A;  5LOZ A;  3RK6 A;  3FTS A;  5ENN A;  4O6F A;  1E90 A;  3B7T A;  2I9C A;  3ZN3 A;  2I1K A;  3VV0 A;  4I1A A;  4ILI A;  1E8W A;  1HH8 A;  1P5Q A;  3CBM A;  4ABN A;  4N3A A;  4GYW A;  4JZY A;  2XPZ A;  4DPR A;  4CT4 A;  4IJ8 A;  4KMO A;  3FUM A;  4WAF A;  3ZRH A;  4CGW A;  2J08 A;  2J9Q A;  1MVH A;  3OTN A;  2DCP A;  3NQP A;  5C2Y A;  3U9W A;  3PH0 C;  1N52 A;  2IJG X;  5FZR A;  3UX4 A;  3SFZ A;  2WQ7 A;  5BV0 A;  3F9Y A;  4UWK A;  2WXN A;  3CVL A;  3FUD A;  3NZU A;  4I6J A;  3MCX A;  2CG3 A;  1JWG A;  3S8P A;  1H2U A;  4J8D A;  4E6H A;  4F3V A;  2JEK A;  4KZC A;  3K5K A;  3O4Z A;  1U3C A;  1MHQ A;  3MJW A;  3FU5 A;  3JUI A;  3PEV B;  3QDN A;  2XGO A;  2IOS A;  4KVM A;  4GPK A;  2CG2 A;  3ZHE B;  4EEC A;  5JHN A;  3GZ2 A;  4GZD A;  4OVU A;  4J8F A;  3GYZ A;  3RO3 A;  3SBS A;  2X6I A;  1HX8 A;  5FT9 A;  4Q69 A;  1KLX A;  3IBE A;  3QK0 A;  2XQ0 A;  4MRU A;  3VLF A;  4IN3 B;  3CK7 A;  4I1M A;  4ANX A;  2WXO A;  5AIJ A;  2P58 C;  2CFZ A;  3GZ1 A;  4CDN A;  3BO5 A;  2UY1 B;  4L2L A;  1ZU2 A;  4I9C A;  2AW6 A;  1HZ4 A;  4O30 A;  3LY7 A;  1XNF A;  3PNT B;  2M63 A;  4B89 A;  4B94 A;  2L9B A;  2E0I A;  4JEU A;  3RRU A;  4I6G A;  2WXL A;  3MZL B;  3L6A A;  3HVE A;  4JHK A;  4NQ0 A;  3FU3 A;  2OND A;  3FUK A;  3M59 A;  3FUJ A;  3FH8 A;  3F9Z A;  2RG8 A;  4ANU A;  3CVU A;  2VGX A;  3FFL A;  2A5U A;  2XCC A;  3KD7 A;  1Z3X A;  3CHS A;  4N39 A;  4WNF A;  1A17 A;  3N71 A;  1JUQ A;  3BG0 B;  4BY6 A;  5KJN A;  4IRU A;  1PY1 A;  2YIN A;  5BNW A;  1EPU A;  1HXI A;  4APO A;  2L0I A;  4A3T A;  2C2L A;  1HFA A;  4YVQ C;  5F6K C;  5FTP A;  2Y4T A;  4DLO A;  3FTZ A;  3ZYM A;  3CK9 A;  4H7X A;  4JHR A;  4GA2 A;  3ZYK A;  4FP7 A;  2LNI A;  3L08 A;  4BX8 A;  2X6F A;  3CHP A;  2VTB B;  5FQ4 A;  2IFU A;  3DB5 A;  5T0K A;  3ASD A;  3L54 A;  2XPY A;  4U04 A;  4XKC A;  5ARF A;  3WXX A;  2FI7 A;  2KCK A;  4BSX A;  5JIY A;  3LCA A;  3CK8 A;  4I9E A;  5KJL A;  4FLB A;  2FO7 A;  3RIB A;  4J6I A;  4NAC A;  2IOL A;  4AV7 A;  3LPZ A;  2FF4 A;  4UWF A;  2AXU A;  3L13 A;  4JA9 A;  3JQ1 A;  3VTX A;  3SHF A;  2R17 C;  3FHE A;  2XCB A;  4J7F A;  3HIZ A;  1JPL A;  3PRZ A;  3RO2 A;  3ZEF A;  4I51 A;  5BUZ A;  3LDZ A;  2NC9 A;  3CHM A;  4H7Y A;  4JEH A;  1E7U A;  2WXF A;  4MI0 A;  5JHA A;  3KMJ A;  4GYO A;  1Z6T A;  4A55 A;  1HG2 A;  4ME2 A;  3MEK A;  4L7T A;  5A6C A;  4QEP A;  3MKR A;  4V3I A;  1HS6 A;  1OWO A;  1TEZ A;  1SZ9 A;  3LY9 A;  5JJ6 A;  5AJD A;  3PZD A;  1KT1 A;  4YPU A;  3C98 A;  1W3B A;  2KM4 A;  3B7R L;  4GA0 A;  4JPS A;  5FWQ A;  3URZ A;  4GZ3 A;  5J08 A;  4RG9 A;  4AU7 A;  4QEN A;  4ANV A;  3Q49 B;  3LVR E;  4I2Z A;  4ANW A;  4GA1 A;  4U0Z A;  3OS5 A;  3L22 A;  2OVB A;  2MOW A;  5BPP A;  1H0A A;  3KAE A;  3CKC A;  3RRM B;  3MKQ A;  4FA6 A;  4FLH A;  1MVX A;  3MA5 A;  1XGW A;  2VQ2 A;  1JWF A;  2J09 A;  2CHW A;  4KBQ A;  4WWO A;  4EPZ A;  3UMV A;  1FCH A;  3G2V A;  4A3V A;  3GW4 A;  3QWW A;  5JIN A;  2IF4 A;  5LCW J;  4G2V A;  4EZK A;  3D9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...