3F9YA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20me1 / adohcy
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
b'SKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9yA00
3MO5A 3SW9A 1O9SA 4Z4PA 4J83A 5HQ8A 3VV0A 5LSXA 1ML9A 3QWWA 3OS5A 4J7IA 4C1QA 2QPWA 3DALA 3F9XA 3OXFA 5F59A 3M58A 1MUFA 1PEGA 3S8PA 3OPEA 3CBPA 3OXLA 5F5EA 4YNMA 4MI5A 1N3JA 3TG4A 4NJ5A 4QEPA 2G46A 3MEKA 2W5ZA 4J7FA 2O8JA 4AU7A 5JHNA 1MT6A 3M54A 5TEGA 4IJ8A 1N6AA 4BUPA 4I51A 4O30A 5T0KA 3VUZA 3F9YA 3KMJA 3MO0A 3QWPA 5F6KC 3SWCA 2W5YA 3FPDA 3M57A 4FMUA 4QENA 3RAYA 3F9ZA 5TH7A 5EX3A 5T0MA 4H12A 3TG5A 2IGQA 3BO5A 3RU0A 4YNPA 3KMTA 4YPUA 5CCMA 1MVHA 3EP0A 1ZKKA 3CBOA 3S7FA 2BQZA 3HNAA 3RQ4A 3M53A 5F6LA 4J8OA 5AYFA 5LSZA 5EX0A 4WUYA 3PDNA 3S7JA 5JINA 3M59A 3QWVA 1N6CA 3OXGA 4JLGA 2RFIA 4YNDA 5CCLA 3RJWA 5ARFA 3K5KA 5ARGA 1MVXA 1XQHA 3M5AA 2R3AA 3M56A 4NVQA 3N71A 4QEOA 4YPEA 5JJ0A 3MO2A 5KJMA 3DB5A 4RZ0A 4IJDA 5TTFA 3OOIA 5T5GA 5KJLA 1H3IA 5KJNA 5KJKA 3KMAA 4MI0A 3CBMA 4E47A 4JDSA 5EG2A 3F9WA 4YPAA 3RIBA 3S7BA 3IHXA 5HI7A 4LDGA 4O6FA 3M55A 5JIYA 2JV0A 2F69A 3S7DA 5CPRB
chains in the Genus database with same CATH superfamily
3MO5A 3SW9A 1O9SA 4Z4PA 4J83A 5HQ8A 3VV0A 5LSXA 1ML9A 3QWWA 3OS5A 4J7IA 4C1QA 2QPWA 3DALA 3F9XA 3OXFA 5F59A 3M58A 1MUFA 1PEGA 3S8PA 3OPEA 3CBPA 3OXLA 5F5EA 4YNMA 4MI5A 1N3JA 3TG4A 4NJ5A 4QEPA 2G46A 3MEKA 2W5ZA 4J7FA 2O8JA 4AU7A 5JHNA 1MT6A 3M54A 5TEGA 4IJ8A 1N6AA 4BUPA 4I51A 4O30A 5T0KA 3VUZA 3F9YA 3KMJA 3MO0A 3QWPA 5F6KC 3SWCA 2W5YA 3FPDA 3M57A 4FMUA 4QENA 3RAYA 3F9ZA 5TH7A 5EX3A 5T0MA 4H12A 3TG5A 2IGQA 3BO5A 3RU0A 4YNPA 3KMTA 4YPUA 5CCMA 1MVHA 3EP0A 1ZKKA 3CBOA 3S7FA 2BQZA 3HNAA 3RQ4A 3M53A 5F6LA 4J8OA 5AYFA 5LSZA 5EX0A 4WUYA 3PDNA 3S7JA 5JINA 3M59A 3QWVA 1N6CA 3OXGA 4JLGA 2RFIA 4YNDA 5CCLA 3RJWA 5ARFA 3K5KA 5ARGA 1MVXA 1XQHA 3M5AA 2R3AA 3M56A 4NVQA 3N71A 4QEOA 4YPEA 5JJ0A 3MO2A 5KJMA 3DB5A 4RZ0A 4IJDA 5TTFA 3OOIA 5T5GA 5KJLA 1H3IA 5KJNA 5KJKA 3KMAA 4MI0A 3CBMA 4E47A 4JDSA 5EG2A 3F9WA 4YPAA 3RIBA 3S7BA 3IHXA 5HI7A 4LDGA 4O6FA 3M55A 5JIYA 2JV0A 2F69A 3S7DA 5CPRB
chains in the Genus database with same CATH topology
3MO5A 3SW9A 1O9SA 4Z4PA 4J83A 5HQ8A 3VV0A 5LSXA 1ML9A 3QWWA 3OS5A 4J7IA 4C1QA 2QPWA 3DALA 3F9XA 3OXFA 5F59A 3M58A 1MUFA 1PEGA 3S8PA 3OPEA 3CBPA 3OXLA 5F5EA 4YNMA 4MI5A 1N3JA 3TG4A 4NJ5A 4QEPA 2G46A 3MEKA 2W5ZA 4J7FA 2O8JA 4AU7A 5JHNA 1MT6A 3M54A 5TEGA 4IJ8A 1N6AA 4BUPA 4I51A 4O30A 5T0KA 3VUZA 3F9YA 3KMJA 3MO0A 3QWPA 5F6KC 3SWCA 2W5YA 3FPDA 3M57A 4FMUA 4QENA 3RAYA 3F9ZA 5TH7A 5EX3A 5T0MA 4H12A 3TG5A 2IGQA 3BO5A 3RU0A 4YNPA 3KMTA 4YPUA 5CCMA 1MVHA 3EP0A 1ZKKA 3CBOA 3S7FA 2BQZA 3HNAA 3RQ4A 3M53A 5F6LA 4J8OA 5AYFA 5LSZA 5EX0A 4WUYA 3PDNA 3S7JA 5JINA 3M59A 3QWVA 1N6CA 3OXGA 4JLGA 2RFIA 4YNDA 5CCLA 3RJWA 5ARFA 3K5KA 5ARGA 1MVXA 1XQHA 3M5AA 2R3AA 3M56A 4NVQA 3N71A 4QEOA 4YPEA 5JJ0A 3MO2A 5KJMA 3DB5A 4RZ0A 4IJDA 5TTFA 3OOIA 5T5GA 5KJLA 1H3IA 5KJNA 5KJKA 3KMAA 4MI0A 3CBMA 4E47A 4JDSA 5EG2A 3F9WA 4YPAA 3RIBA 3S7BA 3IHXA 5HI7A 4LDGA 4O6FA 3M55A 5JIYA 2JV0A 2F69A 3S7DA 5CPRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MO5 A;  3SW9 A;  1O9S A;  4Z4P A;  4J83 A;  5HQ8 A;  3VV0 A;  5LSX A;  1ML9 A;  3QWW A;  3OS5 A;  4J7I A;  4C1Q A;  2QPW A;  3DAL A;  3F9X A;  3OXF A;  5F59 A;  3M58 A;  1MUF A;  1PEG A;  3S8P A;  3OPE A;  3CBP A;  3OXL A;  5F5E A;  4YNM A;  4MI5 A;  1N3J A;  3TG4 A;  4NJ5 A;  4QEP A;  2G46 A;  3MEK A;  2W5Z A;  4J7F A;  2O8J A;  4AU7 A;  5JHN A;  1MT6 A;  3M54 A;  5TEG A;  4IJ8 A;  1N6A A;  4BUP A;  4I51 A;  4O30 A;  5T0K A;  3VUZ A;  3F9Y A;  3KMJ A;  3MO0 A;  3QWP A;  5F6K C;  3SWC A;  2W5Y A;  3FPD A;  3M57 A;  4FMU A;  4QEN A;  3RAY A;  3F9Z A;  5TH7 A;  5EX3 A;  5T0M A;  4H12 A;  3TG5 A;  2IGQ A;  3BO5 A;  3RU0 A;  4YNP A;  3KMT A;  4YPU A;  5CCM A;  1MVH A;  3EP0 A;  1ZKK A;  3CBO A;  3S7F A;  2BQZ A;  3HNA A;  3RQ4 A;  3M53 A;  5F6L A;  4J8O A;  5AYF A;  5LSZ A;  5EX0 A;  4WUY A;  3PDN A;  3S7J A;  5JIN A;  3M59 A;  3QWV A;  1N6C A;  3OXG A;  4JLG A;  2RFI A;  4YND A;  5CCL A;  3RJW A;  5ARF A;  3K5K A;  5ARG A;  1MVX A;  1XQH A;  3M5A A;  2R3A A;  3M56 A;  4NVQ A;  3N71 A;  4QEO A;  4YPE A;  5JJ0 A;  3MO2 A;  5KJM A;  3DB5 A;  4RZ0 A;  4IJD A;  5TTF A;  3OOI A;  5T5G A;  5KJL A;  1H3I A;  5KJN A;  5KJK A;  3KMA A;  4MI0 A;  3CBM A;  4E47 A;  4JDS A;  5EG2 A;  3F9W A;  4YPA A;  3RIB A;  3S7B A;  3IHX A;  5HI7 A;  4LDG A;  4O6F A;  3M55 A;  5JIY A;  2JV0 A;  2F69 A;  3S7D A;  5CPR B; 
#chains in the Genus database with same CATH topology
 3MO5 A;  3SW9 A;  1O9S A;  4Z4P A;  4J83 A;  5HQ8 A;  3VV0 A;  5LSX A;  1ML9 A;  3QWW A;  3OS5 A;  4J7I A;  4C1Q A;  2QPW A;  3DAL A;  3F9X A;  3OXF A;  5F59 A;  3M58 A;  1MUF A;  1PEG A;  3S8P A;  3OPE A;  3CBP A;  3OXL A;  5F5E A;  4YNM A;  4MI5 A;  1N3J A;  3TG4 A;  4NJ5 A;  4QEP A;  2G46 A;  3MEK A;  2W5Z A;  4J7F A;  2O8J A;  4AU7 A;  5JHN A;  1MT6 A;  3M54 A;  5TEG A;  4IJ8 A;  1N6A A;  4BUP A;  4I51 A;  4O30 A;  5T0K A;  3VUZ A;  3F9Y A;  3KMJ A;  3MO0 A;  3QWP A;  5F6K C;  3SWC A;  2W5Y A;  3FPD A;  3M57 A;  4FMU A;  4QEN A;  3RAY A;  3F9Z A;  5TH7 A;  5EX3 A;  5T0M A;  4H12 A;  3TG5 A;  2IGQ A;  3BO5 A;  3RU0 A;  4YNP A;  3KMT A;  4YPU A;  5CCM A;  1MVH A;  3EP0 A;  1ZKK A;  3CBO A;  3S7F A;  2BQZ A;  3HNA A;  3RQ4 A;  3M53 A;  5F6L A;  4J8O A;  5AYF A;  5LSZ A;  5EX0 A;  4WUY A;  3PDN A;  3S7J A;  5JIN A;  3M59 A;  3QWV A;  1N6C A;  3OXG A;  4JLG A;  2RFI A;  4YND A;  5CCL A;  3RJW A;  5ARF A;  3K5K A;  5ARG A;  1MVX A;  1XQH A;  3M5A A;  2R3A A;  3M56 A;  4NVQ A;  3N71 A;  4QEO A;  4YPE A;  5JJ0 A;  3MO2 A;  5KJM A;  3DB5 A;  4RZ0 A;  4IJD A;  5TTF A;  3OOI A;  5T5G A;  5KJL A;  1H3I A;  5KJN A;  5KJK A;  3KMA A;  4MI0 A;  3CBM A;  4E47 A;  4JDS A;  5EG2 A;  3F9W A;  4YPA A;  3RIB A;  3S7B A;  3IHX A;  5HI7 A;  4LDG A;  4O6F A;  3M55 A;  5JIY A;  2JV0 A;  2F69 A;  3S7D A;  5CPR B; 
#chains in the Genus database with same CATH homology
 3MO5 A;  3SW9 A;  1O9S A;  4Z4P A;  4J83 A;  5HQ8 A;  3VV0 A;  5LSX A;  1ML9 A;  3QWW A;  3OS5 A;  4J7I A;  4C1Q A;  2QPW A;  3DAL A;  3F9X A;  3OXF A;  5F59 A;  3M58 A;  1MUF A;  1PEG A;  3S8P A;  3OPE A;  3CBP A;  3OXL A;  5F5E A;  4YNM A;  4MI5 A;  1N3J A;  3TG4 A;  4NJ5 A;  4QEP A;  2G46 A;  3MEK A;  2W5Z A;  4J7F A;  2O8J A;  4AU7 A;  5JHN A;  1MT6 A;  3M54 A;  5TEG A;  4IJ8 A;  1N6A A;  4BUP A;  4I51 A;  4O30 A;  5T0K A;  3VUZ A;  3F9Y A;  3KMJ A;  3MO0 A;  3QWP A;  5F6K C;  3SWC A;  2W5Y A;  3FPD A;  3M57 A;  4FMU A;  4QEN A;  3RAY A;  3F9Z A;  5TH7 A;  5EX3 A;  5T0M A;  4H12 A;  3TG5 A;  2IGQ A;  3BO5 A;  3RU0 A;  4YNP A;  3KMT A;  4YPU A;  5CCM A;  1MVH A;  3EP0 A;  1ZKK A;  3CBO A;  3S7F A;  2BQZ A;  3HNA A;  3RQ4 A;  3M53 A;  5F6L A;  4J8O A;  5AYF A;  5LSZ A;  5EX0 A;  4WUY A;  3PDN A;  3S7J A;  5JIN A;  3M59 A;  3QWV A;  1N6C A;  3OXG A;  4JLG A;  2RFI A;  4YND A;  5CCL A;  3RJW A;  5ARF A;  3K5K A;  5ARG A;  1MVX A;  1XQH A;  3M5A A;  2R3A A;  3M56 A;  4NVQ A;  3N71 A;  4QEO A;  4YPE A;  5JJ0 A;  3MO2 A;  5KJM A;  3DB5 A;  4RZ0 A;  4IJD A;  5TTF A;  3OOI A;  5T5G A;  5KJL A;  1H3I A;  5KJN A;  5KJK A;  3KMA A;  4MI0 A;  3CBM A;  4E47 A;  4JDS A;  5EG2 A;  3F9W A;  4YPA A;  3RIB A;  3S7B A;  3IHX A;  5HI7 A;  4LDG A;  4O6F A;  3M55 A;  5JIY A;  2JV0 A;  2F69 A;  3S7D A;  5CPR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...