3F9YA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20me1 / adohcy
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
SKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD8
total genus 48
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9yA00
3TG5A 3KMJA 4JLGA 4I51A 4E47A 3CBPA 3RU0A 3M58A 4NVQA 3M57A 3FPDA 3M54A 1ML9A 4FMUA 5ARFA 3HNAA 3F9XA 3S7JA 4IJDA 3QWPA 4O30A 5JINA 1XQHA 3S7DA 4YPEA 3M59A 3MO5A 5CPRB 5ARGA 4LDGA 3CBOA 5AYFA 5F5EA 2IGQA 5T0KA 1H3IA 3RJWA 4J7FA 1MVXA 4QEOA 3VUZA 4WUYA 1MT6A 1N6CA 4YPAA 3IHXA 5T5GA 5JHNA 3OS5A 5F59A 4MI5A 3MEKA 5KJMA 5LSZA 3EP0A 3M55A 4H12A 5JJ0A 1MUFA 1N3JA 3MO2A 4O6FA 5HI7A 3TG4A 4QENA 3CBMA 2BQZA 4YNDA 4RZ0A 1O9SA 4AU7A 5EX0A 3SWCA 1PEGA 5T0MA 5CCLA 5KJNA 4MI0A 3S7BA 2F69A 3BO5A 5KJLA 2O8JA 3QWWA 3F9WA 3QWVA 2G46A 3KMAA 4J7IA 3DALA 3OOIA 2RFIA 5F6KC 3S7FA 5KJKA 3RAYA 3PDNA 4J8OA 5TTFA 5HQ8A 5TEGA 3M5AA 5F6LA 4NJ5A 2JV0A 3DB5A 3SW9A 5EX3A 4Z4PA 2W5ZA 2QPWA 2R3AA 3VV0A 3RQ4A 3M53A 3S8PA 3OPEA 1N6AA 4J83A 1MVHA 3KMTA 3RIBA 4YPUA 4JDSA 4QEPA 3OXLA 3K5KA 3OXGA 5JIYA 4IJ8A 5CCMA 3F9ZA 4YNPA 5LSXA 3M56A 4BUPA 3OXFA 3MO0A 3N71A 4C1QA 2W5YA 1ZKKA 4YNMA 3F9YA 5TH7A 5EG2A
chains in the Genus database with same CATH superfamily
3TG5A 3KMJA 4JLGA 4I51A 4E47A 3CBPA 3RU0A 3M58A 4NVQA 3M57A 3FPDA 3M54A 1ML9A 4FMUA 5ARFA 3HNAA 3F9XA 3S7JA 4IJDA 3QWPA 4O30A 5JINA 1XQHA 3S7DA 4YPEA 3M59A 3MO5A 5CPRB 5ARGA 4LDGA 3CBOA 5AYFA 5F5EA 2IGQA 5T0KA 1H3IA 3RJWA 4J7FA 1MVXA 4QEOA 3VUZA 4WUYA 1MT6A 1N6CA 4YPAA 3IHXA 5T5GA 5JHNA 3OS5A 5F59A 4MI5A 3MEKA 5KJMA 5LSZA 3EP0A 3M55A 4H12A 5JJ0A 1MUFA 1N3JA 3MO2A 4O6FA 5HI7A 3TG4A 4QENA 3CBMA 2BQZA 4YNDA 4RZ0A 1O9SA 4AU7A 5EX0A 3SWCA 1PEGA 5T0MA 5CCLA 5KJNA 4MI0A 3S7BA 2F69A 3BO5A 5KJLA 2O8JA 3QWWA 3F9WA 3QWVA 2G46A 3KMAA 4J7IA 3DALA 3OOIA 2RFIA 5F6KC 3S7FA 5KJKA 3RAYA 3PDNA 4J8OA 5TTFA 5HQ8A 5TEGA 3M5AA 5F6LA 4NJ5A 2JV0A 3DB5A 3SW9A 5EX3A 4Z4PA 2W5ZA 2QPWA 2R3AA 3VV0A 3RQ4A 3M53A 3S8PA 3OPEA 1N6AA 4J83A 1MVHA 3KMTA 3RIBA 4YPUA 4JDSA 4QEPA 3OXLA 3K5KA 3OXGA 5JIYA 4IJ8A 5CCMA 3F9ZA 4YNPA 5LSXA 3M56A 4BUPA 3OXFA 3MO0A 3N71A 4C1QA 2W5YA 1ZKKA 4YNMA 3F9YA 5TH7A 5EG2A
chains in the Genus database with same CATH topology
3TG5A 3KMJA 4JLGA 4I51A 4E47A 3CBPA 3RU0A 3M58A 4NVQA 3M57A 3FPDA 3M54A 1ML9A 4FMUA 5ARFA 3HNAA 3F9XA 3S7JA 4IJDA 3QWPA 4O30A 5JINA 1XQHA 3S7DA 4YPEA 3M59A 3MO5A 5CPRB 5ARGA 4LDGA 3CBOA 5AYFA 5F5EA 2IGQA 5T0KA 1H3IA 3RJWA 4J7FA 1MVXA 4QEOA 3VUZA 4WUYA 1MT6A 1N6CA 4YPAA 3IHXA 5T5GA 5JHNA 3OS5A 5F59A 4MI5A 3MEKA 5KJMA 5LSZA 3EP0A 3M55A 4H12A 5JJ0A 1MUFA 1N3JA 3MO2A 4O6FA 5HI7A 3TG4A 4QENA 3CBMA 2BQZA 4YNDA 4RZ0A 1O9SA 4AU7A 5EX0A 3SWCA 1PEGA 5T0MA 5CCLA 5KJNA 4MI0A 3S7BA 2F69A 3BO5A 5KJLA 2O8JA 3QWWA 3F9WA 3QWVA 2G46A 3KMAA 4J7IA 3DALA 3OOIA 2RFIA 5F6KC 3S7FA 5KJKA 3RAYA 3PDNA 4J8OA 5TTFA 5HQ8A 5TEGA 3M5AA 5F6LA 4NJ5A 2JV0A 3DB5A 3SW9A 5EX3A 4Z4PA 2W5ZA 2QPWA 2R3AA 3VV0A 3RQ4A 3M53A 3S8PA 3OPEA 1N6AA 4J83A 1MVHA 3KMTA 3RIBA 4YPUA 4JDSA 4QEPA 3OXLA 3K5KA 3OXGA 5JIYA 4IJ8A 5CCMA 3F9ZA 4YNPA 5LSXA 3M56A 4BUPA 3OXFA 3MO0A 3N71A 4C1QA 2W5YA 1ZKKA 4YNMA 3F9YA 5TH7A 5EG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TG5 A;  3KMJ A;  4JLG A;  4I51 A;  4E47 A;  3CBP A;  3RU0 A;  3M58 A;  4NVQ A;  3M57 A;  3FPD A;  3M54 A;  1ML9 A;  4FMU A;  5ARF A;  3HNA A;  3F9X A;  3S7J A;  4IJD A;  3QWP A;  4O30 A;  5JIN A;  1XQH A;  3S7D A;  4YPE A;  3M59 A;  3MO5 A;  5CPR B;  5ARG A;  4LDG A;  3CBO A;  5AYF A;  5F5E A;  2IGQ A;  5T0K A;  1H3I A;  3RJW A;  4J7F A;  1MVX A;  4QEO A;  3VUZ A;  4WUY A;  1MT6 A;  1N6C A;  4YPA A;  3IHX A;  5T5G A;  5JHN A;  3OS5 A;  5F59 A;  4MI5 A;  3MEK A;  5KJM A;  5LSZ A;  3EP0 A;  3M55 A;  4H12 A;  5JJ0 A;  1MUF A;  1N3J A;  3MO2 A;  4O6F A;  5HI7 A;  3TG4 A;  4QEN A;  3CBM A;  2BQZ A;  4YND A;  4RZ0 A;  1O9S A;  4AU7 A;  5EX0 A;  3SWC A;  1PEG A;  5T0M A;  5CCL A;  5KJN A;  4MI0 A;  3S7B A;  2F69 A;  3BO5 A;  5KJL A;  2O8J A;  3QWW A;  3F9W A;  3QWV A;  2G46 A;  3KMA A;  4J7I A;  3DAL A;  3OOI A;  2RFI A;  5F6K C;  3S7F A;  5KJK A;  3RAY A;  3PDN A;  4J8O A;  5TTF A;  5HQ8 A;  5TEG A;  3M5A A;  5F6L A;  4NJ5 A;  2JV0 A;  3DB5 A;  3SW9 A;  5EX3 A;  4Z4P A;  2W5Z A;  2QPW A;  2R3A A;  3VV0 A;  3RQ4 A;  3M53 A;  3S8P A;  3OPE A;  1N6A A;  4J83 A;  1MVH A;  3KMT A;  3RIB A;  4YPU A;  4JDS A;  4QEP A;  3OXL A;  3K5K A;  3OXG A;  5JIY A;  4IJ8 A;  5CCM A;  3F9Z A;  4YNP A;  5LSX A;  3M56 A;  4BUP A;  3OXF A;  3MO0 A;  3N71 A;  4C1Q A;  2W5Y A;  1ZKK A;  4YNM A;  3F9Y A;  5TH7 A;  5EG2 A; 
#chains in the Genus database with same CATH topology
 3TG5 A;  3KMJ A;  4JLG A;  4I51 A;  4E47 A;  3CBP A;  3RU0 A;  3M58 A;  4NVQ A;  3M57 A;  3FPD A;  3M54 A;  1ML9 A;  4FMU A;  5ARF A;  3HNA A;  3F9X A;  3S7J A;  4IJD A;  3QWP A;  4O30 A;  5JIN A;  1XQH A;  3S7D A;  4YPE A;  3M59 A;  3MO5 A;  5CPR B;  5ARG A;  4LDG A;  3CBO A;  5AYF A;  5F5E A;  2IGQ A;  5T0K A;  1H3I A;  3RJW A;  4J7F A;  1MVX A;  4QEO A;  3VUZ A;  4WUY A;  1MT6 A;  1N6C A;  4YPA A;  3IHX A;  5T5G A;  5JHN A;  3OS5 A;  5F59 A;  4MI5 A;  3MEK A;  5KJM A;  5LSZ A;  3EP0 A;  3M55 A;  4H12 A;  5JJ0 A;  1MUF A;  1N3J A;  3MO2 A;  4O6F A;  5HI7 A;  3TG4 A;  4QEN A;  3CBM A;  2BQZ A;  4YND A;  4RZ0 A;  1O9S A;  4AU7 A;  5EX0 A;  3SWC A;  1PEG A;  5T0M A;  5CCL A;  5KJN A;  4MI0 A;  3S7B A;  2F69 A;  3BO5 A;  5KJL A;  2O8J A;  3QWW A;  3F9W A;  3QWV A;  2G46 A;  3KMA A;  4J7I A;  3DAL A;  3OOI A;  2RFI A;  5F6K C;  3S7F A;  5KJK A;  3RAY A;  3PDN A;  4J8O A;  5TTF A;  5HQ8 A;  5TEG A;  3M5A A;  5F6L A;  4NJ5 A;  2JV0 A;  3DB5 A;  3SW9 A;  5EX3 A;  4Z4P A;  2W5Z A;  2QPW A;  2R3A A;  3VV0 A;  3RQ4 A;  3M53 A;  3S8P A;  3OPE A;  1N6A A;  4J83 A;  1MVH A;  3KMT A;  3RIB A;  4YPU A;  4JDS A;  4QEP A;  3OXL A;  3K5K A;  3OXG A;  5JIY A;  4IJ8 A;  5CCM A;  3F9Z A;  4YNP A;  5LSX A;  3M56 A;  4BUP A;  3OXF A;  3MO0 A;  3N71 A;  4C1Q A;  2W5Y A;  1ZKK A;  4YNM A;  3F9Y A;  5TH7 A;  5EG2 A; 
#chains in the Genus database with same CATH homology
 3TG5 A;  3KMJ A;  4JLG A;  4I51 A;  4E47 A;  3CBP A;  3RU0 A;  3M58 A;  4NVQ A;  3M57 A;  3FPD A;  3M54 A;  1ML9 A;  4FMU A;  5ARF A;  3HNA A;  3F9X A;  3S7J A;  4IJD A;  3QWP A;  4O30 A;  5JIN A;  1XQH A;  3S7D A;  4YPE A;  3M59 A;  3MO5 A;  5CPR B;  5ARG A;  4LDG A;  3CBO A;  5AYF A;  5F5E A;  2IGQ A;  5T0K A;  1H3I A;  3RJW A;  4J7F A;  1MVX A;  4QEO A;  3VUZ A;  4WUY A;  1MT6 A;  1N6C A;  4YPA A;  3IHX A;  5T5G A;  5JHN A;  3OS5 A;  5F59 A;  4MI5 A;  3MEK A;  5KJM A;  5LSZ A;  3EP0 A;  3M55 A;  4H12 A;  5JJ0 A;  1MUF A;  1N3J A;  3MO2 A;  4O6F A;  5HI7 A;  3TG4 A;  4QEN A;  3CBM A;  2BQZ A;  4YND A;  4RZ0 A;  1O9S A;  4AU7 A;  5EX0 A;  3SWC A;  1PEG A;  5T0M A;  5CCL A;  5KJN A;  4MI0 A;  3S7B A;  2F69 A;  3BO5 A;  5KJL A;  2O8J A;  3QWW A;  3F9W A;  3QWV A;  2G46 A;  3KMA A;  4J7I A;  3DAL A;  3OOI A;  2RFI A;  5F6K C;  3S7F A;  5KJK A;  3RAY A;  3PDN A;  4J8O A;  5TTF A;  5HQ8 A;  5TEG A;  3M5A A;  5F6L A;  4NJ5 A;  2JV0 A;  3DB5 A;  3SW9 A;  5EX3 A;  4Z4P A;  2W5Z A;  2QPW A;  2R3A A;  3VV0 A;  3RQ4 A;  3M53 A;  3S8P A;  3OPE A;  1N6A A;  4J83 A;  1MVH A;  3KMT A;  3RIB A;  4YPU A;  4JDS A;  4QEP A;  3OXL A;  3K5K A;  3OXG A;  5JIY A;  4IJ8 A;  5CCM A;  3F9Z A;  4YNP A;  5LSX A;  3M56 A;  4BUP A;  3OXF A;  3MO0 A;  3N71 A;  4C1Q A;  2W5Y A;  1ZKK A;  4YNM A;  3F9Y A;  5TH7 A;  5EG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...