3F9YA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20me1 / adohcy
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
SKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9yA00
3S7FA 5AYFA 1N6CA 4QEPA 3CBMA 3RIBA 4MI0A 5JIYA 3QWPA 3RAYA 5T0MA 3MO0A 3OPEA 5JINA 3EP0A 4Z4PA 3OS5A 2IGQA 4AU7A 2W5YA 1MUFA 3M54A 3S7BA 3F9XA 1XQHA 4WUYA 2RFIA 5HI7A 3OOIA 3OXGA 5LSZA 5TTFA 3M58A 4YPEA 5CCLA 1ZKKA 3OXFA 5F6KC 4J83A 1N3JA 4LDGA 4QENA 3KMTA 5KJKA 4J7IA 3M53A 3RU0A 3OXLA 4FMUA 4JDSA 4YNDA 3M5AA 4H12A 5EG2A 4J7FA 5TEGA 4C1QA 5T0KA 1ML9A 5T5GA 2QPWA 4QEOA 5LSXA 5CPRB 4NVQA 3N71A 1MVHA 2W5ZA 3TG4A 3VV0A 4YPUA 3F9WA 3KMAA 4JLGA 3S7JA 4IJDA 4O6FA 3RJWA 5HQ8A 5F5EA 3DB5A 3DALA 3SWCA 3F9YA 3F9ZA 2R3AA 3CBPA 5JJ0A 3M59A 2BQZA 3S7DA 4J8OA 5TH7A 3FPDA 3QWVA 3BO5A 1H3IA 3RQ4A 5F59A 4E47A 5CCMA 2O8JA 3M56A 4I51A 1MT6A 3HNAA 3MO2A 1O9SA 3MO5A 3KMJA 5ARFA 3S8PA 4YNMA 3MEKA 4O30A 4NJ5A 2JV0A 1MVXA 4RZ0A 3M57A 1PEGA 1N6AA 4BUPA 5KJNA 5KJLA 3K5KA 3PDNA 4IJ8A 3IHXA 5JHNA 3CBOA 4YNPA 5EX0A 3VUZA 3M55A 5ARGA 2F69A 5KJMA 3SW9A 3TG5A 2G46A 5F6LA 4YPAA 4MI5A 3QWWA 5EX3A
chains in the Genus database with same CATH superfamily
3S7FA 5AYFA 1N6CA 4QEPA 3CBMA 3RIBA 4MI0A 5JIYA 3QWPA 3RAYA 5T0MA 3MO0A 3OPEA 5JINA 3EP0A 4Z4PA 3OS5A 2IGQA 4AU7A 2W5YA 1MUFA 3M54A 3S7BA 3F9XA 1XQHA 4WUYA 2RFIA 5HI7A 3OOIA 3OXGA 5LSZA 5TTFA 3M58A 4YPEA 5CCLA 1ZKKA 3OXFA 5F6KC 4J83A 1N3JA 4LDGA 4QENA 3KMTA 5KJKA 4J7IA 3M53A 3RU0A 3OXLA 4FMUA 4JDSA 4YNDA 3M5AA 4H12A 5EG2A 4J7FA 5TEGA 4C1QA 5T0KA 1ML9A 5T5GA 2QPWA 4QEOA 5LSXA 5CPRB 4NVQA 3N71A 1MVHA 2W5ZA 3TG4A 3VV0A 4YPUA 3F9WA 3KMAA 4JLGA 3S7JA 4IJDA 4O6FA 3RJWA 5HQ8A 5F5EA 3DB5A 3DALA 3SWCA 3F9YA 3F9ZA 2R3AA 3CBPA 5JJ0A 3M59A 2BQZA 3S7DA 4J8OA 5TH7A 3FPDA 3QWVA 3BO5A 1H3IA 3RQ4A 5F59A 4E47A 5CCMA 2O8JA 3M56A 4I51A 1MT6A 3HNAA 3MO2A 1O9SA 3MO5A 3KMJA 5ARFA 3S8PA 4YNMA 3MEKA 4O30A 4NJ5A 2JV0A 1MVXA 4RZ0A 3M57A 1PEGA 1N6AA 4BUPA 5KJNA 5KJLA 3K5KA 3PDNA 4IJ8A 3IHXA 5JHNA 3CBOA 4YNPA 5EX0A 3VUZA 3M55A 5ARGA 2F69A 5KJMA 3SW9A 3TG5A 2G46A 5F6LA 4YPAA 4MI5A 3QWWA 5EX3A
chains in the Genus database with same CATH topology
3S7FA 5AYFA 1N6CA 4QEPA 3CBMA 3RIBA 4MI0A 5JIYA 3QWPA 3RAYA 5T0MA 3MO0A 3OPEA 5JINA 3EP0A 4Z4PA 3OS5A 2IGQA 4AU7A 2W5YA 1MUFA 3M54A 3S7BA 3F9XA 1XQHA 4WUYA 2RFIA 5HI7A 3OOIA 3OXGA 5LSZA 5TTFA 3M58A 4YPEA 5CCLA 1ZKKA 3OXFA 5F6KC 4J83A 1N3JA 4LDGA 4QENA 3KMTA 5KJKA 4J7IA 3M53A 3RU0A 3OXLA 4FMUA 4JDSA 4YNDA 3M5AA 4H12A 5EG2A 4J7FA 5TEGA 4C1QA 5T0KA 1ML9A 5T5GA 2QPWA 4QEOA 5LSXA 5CPRB 4NVQA 3N71A 1MVHA 2W5ZA 3TG4A 3VV0A 4YPUA 3F9WA 3KMAA 4JLGA 3S7JA 4IJDA 4O6FA 3RJWA 5HQ8A 5F5EA 3DB5A 3DALA 3SWCA 3F9YA 3F9ZA 2R3AA 3CBPA 5JJ0A 3M59A 2BQZA 3S7DA 4J8OA 5TH7A 3FPDA 3QWVA 3BO5A 1H3IA 3RQ4A 5F59A 4E47A 5CCMA 2O8JA 3M56A 4I51A 1MT6A 3HNAA 3MO2A 1O9SA 3MO5A 3KMJA 5ARFA 3S8PA 4YNMA 3MEKA 4O30A 4NJ5A 2JV0A 1MVXA 4RZ0A 3M57A 1PEGA 1N6AA 4BUPA 5KJNA 5KJLA 3K5KA 3PDNA 4IJ8A 3IHXA 5JHNA 3CBOA 4YNPA 5EX0A 3VUZA 3M55A 5ARGA 2F69A 5KJMA 3SW9A 3TG5A 2G46A 5F6LA 4YPAA 4MI5A 3QWWA 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7F A;  5AYF A;  1N6C A;  4QEP A;  3CBM A;  3RIB A;  4MI0 A;  5JIY A;  3QWP A;  3RAY A;  5T0M A;  3MO0 A;  3OPE A;  5JIN A;  3EP0 A;  4Z4P A;  3OS5 A;  2IGQ A;  4AU7 A;  2W5Y A;  1MUF A;  3M54 A;  3S7B A;  3F9X A;  1XQH A;  4WUY A;  2RFI A;  5HI7 A;  3OOI A;  3OXG A;  5LSZ A;  5TTF A;  3M58 A;  4YPE A;  5CCL A;  1ZKK A;  3OXF A;  5F6K C;  4J83 A;  1N3J A;  4LDG A;  4QEN A;  3KMT A;  5KJK A;  4J7I A;  3M53 A;  3RU0 A;  3OXL A;  4FMU A;  4JDS A;  4YND A;  3M5A A;  4H12 A;  5EG2 A;  4J7F A;  5TEG A;  4C1Q A;  5T0K A;  1ML9 A;  5T5G A;  2QPW A;  4QEO A;  5LSX A;  5CPR B;  4NVQ A;  3N71 A;  1MVH A;  2W5Z A;  3TG4 A;  3VV0 A;  4YPU A;  3F9W A;  3KMA A;  4JLG A;  3S7J A;  4IJD A;  4O6F A;  3RJW A;  5HQ8 A;  5F5E A;  3DB5 A;  3DAL A;  3SWC A;  3F9Y A;  3F9Z A;  2R3A A;  3CBP A;  5JJ0 A;  3M59 A;  2BQZ A;  3S7D A;  4J8O A;  5TH7 A;  3FPD A;  3QWV A;  3BO5 A;  1H3I A;  3RQ4 A;  5F59 A;  4E47 A;  5CCM A;  2O8J A;  3M56 A;  4I51 A;  1MT6 A;  3HNA A;  3MO2 A;  1O9S A;  3MO5 A;  3KMJ A;  5ARF A;  3S8P A;  4YNM A;  3MEK A;  4O30 A;  4NJ5 A;  2JV0 A;  1MVX A;  4RZ0 A;  3M57 A;  1PEG A;  1N6A A;  4BUP A;  5KJN A;  5KJL A;  3K5K A;  3PDN A;  4IJ8 A;  3IHX A;  5JHN A;  3CBO A;  4YNP A;  5EX0 A;  3VUZ A;  3M55 A;  5ARG A;  2F69 A;  5KJM A;  3SW9 A;  3TG5 A;  2G46 A;  5F6L A;  4YPA A;  4MI5 A;  3QWW A;  5EX3 A; 
#chains in the Genus database with same CATH topology
 3S7F A;  5AYF A;  1N6C A;  4QEP A;  3CBM A;  3RIB A;  4MI0 A;  5JIY A;  3QWP A;  3RAY A;  5T0M A;  3MO0 A;  3OPE A;  5JIN A;  3EP0 A;  4Z4P A;  3OS5 A;  2IGQ A;  4AU7 A;  2W5Y A;  1MUF A;  3M54 A;  3S7B A;  3F9X A;  1XQH A;  4WUY A;  2RFI A;  5HI7 A;  3OOI A;  3OXG A;  5LSZ A;  5TTF A;  3M58 A;  4YPE A;  5CCL A;  1ZKK A;  3OXF A;  5F6K C;  4J83 A;  1N3J A;  4LDG A;  4QEN A;  3KMT A;  5KJK A;  4J7I A;  3M53 A;  3RU0 A;  3OXL A;  4FMU A;  4JDS A;  4YND A;  3M5A A;  4H12 A;  5EG2 A;  4J7F A;  5TEG A;  4C1Q A;  5T0K A;  1ML9 A;  5T5G A;  2QPW A;  4QEO A;  5LSX A;  5CPR B;  4NVQ A;  3N71 A;  1MVH A;  2W5Z A;  3TG4 A;  3VV0 A;  4YPU A;  3F9W A;  3KMA A;  4JLG A;  3S7J A;  4IJD A;  4O6F A;  3RJW A;  5HQ8 A;  5F5E A;  3DB5 A;  3DAL A;  3SWC A;  3F9Y A;  3F9Z A;  2R3A A;  3CBP A;  5JJ0 A;  3M59 A;  2BQZ A;  3S7D A;  4J8O A;  5TH7 A;  3FPD A;  3QWV A;  3BO5 A;  1H3I A;  3RQ4 A;  5F59 A;  4E47 A;  5CCM A;  2O8J A;  3M56 A;  4I51 A;  1MT6 A;  3HNA A;  3MO2 A;  1O9S A;  3MO5 A;  3KMJ A;  5ARF A;  3S8P A;  4YNM A;  3MEK A;  4O30 A;  4NJ5 A;  2JV0 A;  1MVX A;  4RZ0 A;  3M57 A;  1PEG A;  1N6A A;  4BUP A;  5KJN A;  5KJL A;  3K5K A;  3PDN A;  4IJ8 A;  3IHX A;  5JHN A;  3CBO A;  4YNP A;  5EX0 A;  3VUZ A;  3M55 A;  5ARG A;  2F69 A;  5KJM A;  3SW9 A;  3TG5 A;  2G46 A;  5F6L A;  4YPA A;  4MI5 A;  3QWW A;  5EX3 A; 
#chains in the Genus database with same CATH homology
 3S7F A;  5AYF A;  1N6C A;  4QEP A;  3CBM A;  3RIB A;  4MI0 A;  5JIY A;  3QWP A;  3RAY A;  5T0M A;  3MO0 A;  3OPE A;  5JIN A;  3EP0 A;  4Z4P A;  3OS5 A;  2IGQ A;  4AU7 A;  2W5Y A;  1MUF A;  3M54 A;  3S7B A;  3F9X A;  1XQH A;  4WUY A;  2RFI A;  5HI7 A;  3OOI A;  3OXG A;  5LSZ A;  5TTF A;  3M58 A;  4YPE A;  5CCL A;  1ZKK A;  3OXF A;  5F6K C;  4J83 A;  1N3J A;  4LDG A;  4QEN A;  3KMT A;  5KJK A;  4J7I A;  3M53 A;  3RU0 A;  3OXL A;  4FMU A;  4JDS A;  4YND A;  3M5A A;  4H12 A;  5EG2 A;  4J7F A;  5TEG A;  4C1Q A;  5T0K A;  1ML9 A;  5T5G A;  2QPW A;  4QEO A;  5LSX A;  5CPR B;  4NVQ A;  3N71 A;  1MVH A;  2W5Z A;  3TG4 A;  3VV0 A;  4YPU A;  3F9W A;  3KMA A;  4JLG A;  3S7J A;  4IJD A;  4O6F A;  3RJW A;  5HQ8 A;  5F5E A;  3DB5 A;  3DAL A;  3SWC A;  3F9Y A;  3F9Z A;  2R3A A;  3CBP A;  5JJ0 A;  3M59 A;  2BQZ A;  3S7D A;  4J8O A;  5TH7 A;  3FPD A;  3QWV A;  3BO5 A;  1H3I A;  3RQ4 A;  5F59 A;  4E47 A;  5CCM A;  2O8J A;  3M56 A;  4I51 A;  1MT6 A;  3HNA A;  3MO2 A;  1O9S A;  3MO5 A;  3KMJ A;  5ARF A;  3S8P A;  4YNM A;  3MEK A;  4O30 A;  4NJ5 A;  2JV0 A;  1MVX A;  4RZ0 A;  3M57 A;  1PEG A;  1N6A A;  4BUP A;  5KJN A;  5KJL A;  3K5K A;  3PDN A;  4IJ8 A;  3IHX A;  5JHN A;  3CBO A;  4YNP A;  5EX0 A;  3VUZ A;  3M55 A;  5ARG A;  2F69 A;  5KJM A;  3SW9 A;  3TG5 A;  2G46 A;  5F6L A;  4YPA A;  4MI5 A;  3QWW A;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...