3F9YA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20me1 / adohcy
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
SKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETD8
publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9yA00
3QWWA 3KMJA 5F5EA 5TEGA 1MT6A 4O30A 3M53A 3QWPA 1MVHA 5KJLA 3EP0A 5F59A 2G46A 1O9SA 4QEPA 3HNAA 4YNDA 4LDGA 3RQ4A 3MO5A 5JHNA 3N71A 3VV0A 5AYFA 2JV0A 1XQHA 3MEKA 5EX0A 2R3AA 3SW9A 5T0KA 5TTFA 3F9ZA 2W5ZA 3OXLA 4WUYA 2W5YA 4NVQA 5LSZA 4O6FA 5JIYA 5HQ8A 3F9YA 3OXFA 5ARFA 5KJKA 4NJ5A 3M57A 3IHXA 3M56A 4YPAA 1MVXA 3S7BA 5CCLA 3PDNA 3BO5A 5JINA 5TH7A 3S8PA 2QPWA 3S7FA 5T0MA 3S7JA 4J7IA 5EG2A 2O8JA 3DALA 4AU7A 5T5GA 3RU0A 3SWCA 3KMAA 3VUZA 4J7FA 3DB5A 4YPUA 2IGQA 3CBOA 2F69A 4IJ8A 3RJWA 2RFIA 4H12A 3M54A 4YNMA 3OXGA 5ARGA 3M58A 4JLGA 4MI0A 2BQZA 1N3JA 4QENA 3F9WA 3TG5A 3CBMA 4QEOA 3K5KA 3OOIA 4J8OA 3MO2A 4JDSA 4RZ0A 3QWVA 3KMTA 1H3IA 5CPRB 4MI5A 3OS5A 3M55A 5F6LA 3FPDA 1PEGA 1MUFA 3F9XA 5HI7A 4Z4PA 4J83A 4E47A 5KJMA 3RAYA 4BUPA 1ML9A 3S7DA 5F6KC 4YPEA 5JJ0A 1N6AA 1ZKKA 5CCMA 4C1QA 1N6CA 4FMUA 4I51A 5KJNA 5EX3A 4YNPA 3CBPA 4IJDA 3M5AA 3MO0A 5LSXA 3M59A 3OPEA 3TG4A 3RIBA
chains in the Genus database with same CATH superfamily
3QWWA 3KMJA 5F5EA 5TEGA 1MT6A 4O30A 3M53A 3QWPA 1MVHA 5KJLA 3EP0A 5F59A 2G46A 1O9SA 4QEPA 3HNAA 4YNDA 4LDGA 3RQ4A 3MO5A 5JHNA 3N71A 3VV0A 5AYFA 2JV0A 1XQHA 3MEKA 5EX0A 2R3AA 3SW9A 5T0KA 5TTFA 3F9ZA 2W5ZA 3OXLA 4WUYA 2W5YA 4NVQA 5LSZA 4O6FA 5JIYA 5HQ8A 3F9YA 3OXFA 5ARFA 5KJKA 4NJ5A 3M57A 3IHXA 3M56A 4YPAA 1MVXA 3S7BA 5CCLA 3PDNA 3BO5A 5JINA 5TH7A 3S8PA 2QPWA 3S7FA 5T0MA 3S7JA 4J7IA 5EG2A 2O8JA 3DALA 4AU7A 5T5GA 3RU0A 3SWCA 3KMAA 3VUZA 4J7FA 3DB5A 4YPUA 2IGQA 3CBOA 2F69A 4IJ8A 3RJWA 2RFIA 4H12A 3M54A 4YNMA 3OXGA 5ARGA 3M58A 4JLGA 4MI0A 2BQZA 1N3JA 4QENA 3F9WA 3TG5A 3CBMA 4QEOA 3K5KA 3OOIA 4J8OA 3MO2A 4JDSA 4RZ0A 3QWVA 3KMTA 1H3IA 5CPRB 4MI5A 3OS5A 3M55A 5F6LA 3FPDA 1PEGA 1MUFA 3F9XA 5HI7A 4Z4PA 4J83A 4E47A 5KJMA 3RAYA 4BUPA 1ML9A 3S7DA 5F6KC 4YPEA 5JJ0A 1N6AA 1ZKKA 5CCMA 4C1QA 1N6CA 4FMUA 4I51A 5KJNA 5EX3A 4YNPA 3CBPA 4IJDA 3M5AA 3MO0A 5LSXA 3M59A 3OPEA 3TG4A 3RIBA
chains in the Genus database with same CATH topology
3QWWA 3KMJA 5F5EA 5TEGA 1MT6A 4O30A 3M53A 3QWPA 1MVHA 5KJLA 3EP0A 5F59A 2G46A 1O9SA 4QEPA 3HNAA 4YNDA 4LDGA 3RQ4A 3MO5A 5JHNA 3N71A 3VV0A 5AYFA 2JV0A 1XQHA 3MEKA 5EX0A 2R3AA 3SW9A 5T0KA 5TTFA 3F9ZA 2W5ZA 3OXLA 4WUYA 2W5YA 4NVQA 5LSZA 4O6FA 5JIYA 5HQ8A 3F9YA 3OXFA 5ARFA 5KJKA 4NJ5A 3M57A 3IHXA 3M56A 4YPAA 1MVXA 3S7BA 5CCLA 3PDNA 3BO5A 5JINA 5TH7A 3S8PA 2QPWA 3S7FA 5T0MA 3S7JA 4J7IA 5EG2A 2O8JA 3DALA 4AU7A 5T5GA 3RU0A 3SWCA 3KMAA 3VUZA 4J7FA 3DB5A 4YPUA 2IGQA 3CBOA 2F69A 4IJ8A 3RJWA 2RFIA 4H12A 3M54A 4YNMA 3OXGA 5ARGA 3M58A 4JLGA 4MI0A 2BQZA 1N3JA 4QENA 3F9WA 3TG5A 3CBMA 4QEOA 3K5KA 3OOIA 4J8OA 3MO2A 4JDSA 4RZ0A 3QWVA 3KMTA 1H3IA 5CPRB 4MI5A 3OS5A 3M55A 5F6LA 3FPDA 1PEGA 1MUFA 3F9XA 5HI7A 4Z4PA 4J83A 4E47A 5KJMA 3RAYA 4BUPA 1ML9A 3S7DA 5F6KC 4YPEA 5JJ0A 1N6AA 1ZKKA 5CCMA 4C1QA 1N6CA 4FMUA 4I51A 5KJNA 5EX3A 4YNPA 3CBPA 4IJDA 3M5AA 3MO0A 5LSXA 3M59A 3OPEA 3TG4A 3RIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWW A;  3KMJ A;  5F5E A;  5TEG A;  1MT6 A;  4O30 A;  3M53 A;  3QWP A;  1MVH A;  5KJL A;  3EP0 A;  5F59 A;  2G46 A;  1O9S A;  4QEP A;  3HNA A;  4YND A;  4LDG A;  3RQ4 A;  3MO5 A;  5JHN A;  3N71 A;  3VV0 A;  5AYF A;  2JV0 A;  1XQH A;  3MEK A;  5EX0 A;  2R3A A;  3SW9 A;  5T0K A;  5TTF A;  3F9Z A;  2W5Z A;  3OXL A;  4WUY A;  2W5Y A;  4NVQ A;  5LSZ A;  4O6F A;  5JIY A;  5HQ8 A;  3F9Y A;  3OXF A;  5ARF A;  5KJK A;  4NJ5 A;  3M57 A;  3IHX A;  3M56 A;  4YPA A;  1MVX A;  3S7B A;  5CCL A;  3PDN A;  3BO5 A;  5JIN A;  5TH7 A;  3S8P A;  2QPW A;  3S7F A;  5T0M A;  3S7J A;  4J7I A;  5EG2 A;  2O8J A;  3DAL A;  4AU7 A;  5T5G A;  3RU0 A;  3SWC A;  3KMA A;  3VUZ A;  4J7F A;  3DB5 A;  4YPU A;  2IGQ A;  3CBO A;  2F69 A;  4IJ8 A;  3RJW A;  2RFI A;  4H12 A;  3M54 A;  4YNM A;  3OXG A;  5ARG A;  3M58 A;  4JLG A;  4MI0 A;  2BQZ A;  1N3J A;  4QEN A;  3F9W A;  3TG5 A;  3CBM A;  4QEO A;  3K5K A;  3OOI A;  4J8O A;  3MO2 A;  4JDS A;  4RZ0 A;  3QWV A;  3KMT A;  1H3I A;  5CPR B;  4MI5 A;  3OS5 A;  3M55 A;  5F6L A;  3FPD A;  1PEG A;  1MUF A;  3F9X A;  5HI7 A;  4Z4P A;  4J83 A;  4E47 A;  5KJM A;  3RAY A;  4BUP A;  1ML9 A;  3S7D A;  5F6K C;  4YPE A;  5JJ0 A;  1N6A A;  1ZKK A;  5CCM A;  4C1Q A;  1N6C A;  4FMU A;  4I51 A;  5KJN A;  5EX3 A;  4YNP A;  3CBP A;  4IJD A;  3M5A A;  3MO0 A;  5LSX A;  3M59 A;  3OPE A;  3TG4 A;  3RIB A; 
#chains in the Genus database with same CATH topology
 3QWW A;  3KMJ A;  5F5E A;  5TEG A;  1MT6 A;  4O30 A;  3M53 A;  3QWP A;  1MVH A;  5KJL A;  3EP0 A;  5F59 A;  2G46 A;  1O9S A;  4QEP A;  3HNA A;  4YND A;  4LDG A;  3RQ4 A;  3MO5 A;  5JHN A;  3N71 A;  3VV0 A;  5AYF A;  2JV0 A;  1XQH A;  3MEK A;  5EX0 A;  2R3A A;  3SW9 A;  5T0K A;  5TTF A;  3F9Z A;  2W5Z A;  3OXL A;  4WUY A;  2W5Y A;  4NVQ A;  5LSZ A;  4O6F A;  5JIY A;  5HQ8 A;  3F9Y A;  3OXF A;  5ARF A;  5KJK A;  4NJ5 A;  3M57 A;  3IHX A;  3M56 A;  4YPA A;  1MVX A;  3S7B A;  5CCL A;  3PDN A;  3BO5 A;  5JIN A;  5TH7 A;  3S8P A;  2QPW A;  3S7F A;  5T0M A;  3S7J A;  4J7I A;  5EG2 A;  2O8J A;  3DAL A;  4AU7 A;  5T5G A;  3RU0 A;  3SWC A;  3KMA A;  3VUZ A;  4J7F A;  3DB5 A;  4YPU A;  2IGQ A;  3CBO A;  2F69 A;  4IJ8 A;  3RJW A;  2RFI A;  4H12 A;  3M54 A;  4YNM A;  3OXG A;  5ARG A;  3M58 A;  4JLG A;  4MI0 A;  2BQZ A;  1N3J A;  4QEN A;  3F9W A;  3TG5 A;  3CBM A;  4QEO A;  3K5K A;  3OOI A;  4J8O A;  3MO2 A;  4JDS A;  4RZ0 A;  3QWV A;  3KMT A;  1H3I A;  5CPR B;  4MI5 A;  3OS5 A;  3M55 A;  5F6L A;  3FPD A;  1PEG A;  1MUF A;  3F9X A;  5HI7 A;  4Z4P A;  4J83 A;  4E47 A;  5KJM A;  3RAY A;  4BUP A;  1ML9 A;  3S7D A;  5F6K C;  4YPE A;  5JJ0 A;  1N6A A;  1ZKK A;  5CCM A;  4C1Q A;  1N6C A;  4FMU A;  4I51 A;  5KJN A;  5EX3 A;  4YNP A;  3CBP A;  4IJD A;  3M5A A;  3MO0 A;  5LSX A;  3M59 A;  3OPE A;  3TG4 A;  3RIB A; 
#chains in the Genus database with same CATH homology
 3QWW A;  3KMJ A;  5F5E A;  5TEG A;  1MT6 A;  4O30 A;  3M53 A;  3QWP A;  1MVH A;  5KJL A;  3EP0 A;  5F59 A;  2G46 A;  1O9S A;  4QEP A;  3HNA A;  4YND A;  4LDG A;  3RQ4 A;  3MO5 A;  5JHN A;  3N71 A;  3VV0 A;  5AYF A;  2JV0 A;  1XQH A;  3MEK A;  5EX0 A;  2R3A A;  3SW9 A;  5T0K A;  5TTF A;  3F9Z A;  2W5Z A;  3OXL A;  4WUY A;  2W5Y A;  4NVQ A;  5LSZ A;  4O6F A;  5JIY A;  5HQ8 A;  3F9Y A;  3OXF A;  5ARF A;  5KJK A;  4NJ5 A;  3M57 A;  3IHX A;  3M56 A;  4YPA A;  1MVX A;  3S7B A;  5CCL A;  3PDN A;  3BO5 A;  5JIN A;  5TH7 A;  3S8P A;  2QPW A;  3S7F A;  5T0M A;  3S7J A;  4J7I A;  5EG2 A;  2O8J A;  3DAL A;  4AU7 A;  5T5G A;  3RU0 A;  3SWC A;  3KMA A;  3VUZ A;  4J7F A;  3DB5 A;  4YPU A;  2IGQ A;  3CBO A;  2F69 A;  4IJ8 A;  3RJW A;  2RFI A;  4H12 A;  3M54 A;  4YNM A;  3OXG A;  5ARG A;  3M58 A;  4JLG A;  4MI0 A;  2BQZ A;  1N3J A;  4QEN A;  3F9W A;  3TG5 A;  3CBM A;  4QEO A;  3K5K A;  3OOI A;  4J8O A;  3MO2 A;  4JDS A;  4RZ0 A;  3QWV A;  3KMT A;  1H3I A;  5CPR B;  4MI5 A;  3OS5 A;  3M55 A;  5F6L A;  3FPD A;  1PEG A;  1MUF A;  3F9X A;  5HI7 A;  4Z4P A;  4J83 A;  4E47 A;  5KJM A;  3RAY A;  4BUP A;  1ML9 A;  3S7D A;  5F6K C;  4YPE A;  5JJ0 A;  1N6A A;  1ZKK A;  5CCM A;  4C1Q A;  1N6C A;  4FMU A;  4I51 A;  5KJN A;  5EX3 A;  4YNP A;  3CBP A;  4IJD A;  3M5A A;  3MO0 A;  5LSX A;  3M59 A;  3OPE A;  3TG4 A;  3RIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...