3F9YA

Structural insights into lysine multiple methylation by set domain methyltransferases, set8-y334f / h4-lys20me1 / adohcy
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
SKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural origins for the product specificity of SET domain protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD8
total genus 48
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3f9yA00
3RJWA 1ZKKA 3F9WA 3OXGA 2IGQA 4MI0A 3DB5A 4WUYA 3F9ZA 4YNDA 5JHNA 3M59A 4YNMA 1PEGA 1O9SA 5F6KC 5T5GA 3TG5A 3M56A 3MEKA 3CBOA 5LSZA 3CBPA 5KJKA 4J7IA 4MI5A 4O6FA 3N71A 5CCMA 5ARGA 3SW9A 3M54A 4C1QA 4YPUA 2QPWA 5ARFA 4FMUA 4J8OA 3PDNA 3S7JA 5F59A 4QEOA 5TH7A 5EG2A 5EX3A 3MO0A 5CPRB 5F6LA 1MVHA 1N6CA 3F9XA 4H12A 4J7FA 2O8JA 3S7BA 2G46A 5LSXA 1MVXA 4JLGA 2BQZA 5KJNA 5EX0A 4QENA 3DALA 1MUFA 3F9YA 3S8PA 2F69A 4AU7A 5JIYA 3VUZA 3SWCA 3S7FA 4J83A 1XQHA 3IHXA 5CCLA 3M58A 3QWWA 3M5AA 1N3JA 3QWPA 4YPAA 5HI7A 3RU0A 2R3AA 3S7DA 3KMJA 5JJ0A 3OXFA 3M57A 4E47A 3RQ4A 2W5ZA 1ML9A 3BO5A 3HNAA 5T0KA 4QEPA 5KJLA 5T0MA 1N6AA 4BUPA 5JINA 3RAYA 4RZ0A 2W5YA 3OXLA 4IJDA 5HQ8A 3KMTA 3OPEA 5F5EA 3OS5A 3FPDA 4NVQA 3QWVA 1H3IA 3M55A 3EP0A 4LDGA 4O30A 3TG4A 5TTFA 3KMAA 2RFIA 4I51A 3MO2A 3VV0A 4YPEA 5AYFA 3RIBA 5KJMA 3MO5A 3K5KA 5TEGA 2JV0A 3OOIA 3CBMA 4NJ5A 4JDSA 4YNPA 4Z4PA 1MT6A 3M53A 4IJ8A
chains in the Genus database with same CATH superfamily
3RJWA 1ZKKA 3F9WA 3OXGA 2IGQA 4MI0A 3DB5A 4WUYA 3F9ZA 4YNDA 5JHNA 3M59A 4YNMA 1PEGA 1O9SA 5F6KC 5T5GA 3TG5A 3M56A 3MEKA 3CBOA 5LSZA 3CBPA 5KJKA 4J7IA 4MI5A 4O6FA 3N71A 5CCMA 5ARGA 3SW9A 3M54A 4C1QA 4YPUA 2QPWA 5ARFA 4FMUA 4J8OA 3PDNA 3S7JA 5F59A 4QEOA 5TH7A 5EG2A 5EX3A 3MO0A 5CPRB 5F6LA 1MVHA 1N6CA 3F9XA 4H12A 4J7FA 2O8JA 3S7BA 2G46A 5LSXA 1MVXA 4JLGA 2BQZA 5KJNA 5EX0A 4QENA 3DALA 1MUFA 3F9YA 3S8PA 2F69A 4AU7A 5JIYA 3VUZA 3SWCA 3S7FA 4J83A 1XQHA 3IHXA 5CCLA 3M58A 3QWWA 3M5AA 1N3JA 3QWPA 4YPAA 5HI7A 3RU0A 2R3AA 3S7DA 3KMJA 5JJ0A 3OXFA 3M57A 4E47A 3RQ4A 2W5ZA 1ML9A 3BO5A 3HNAA 5T0KA 4QEPA 5KJLA 5T0MA 1N6AA 4BUPA 5JINA 3RAYA 4RZ0A 2W5YA 3OXLA 4IJDA 5HQ8A 3KMTA 3OPEA 5F5EA 3OS5A 3FPDA 4NVQA 3QWVA 1H3IA 3M55A 3EP0A 4LDGA 4O30A 3TG4A 5TTFA 3KMAA 2RFIA 4I51A 3MO2A 3VV0A 4YPEA 5AYFA 3RIBA 5KJMA 3MO5A 3K5KA 5TEGA 2JV0A 3OOIA 3CBMA 4NJ5A 4JDSA 4YNPA 4Z4PA 1MT6A 3M53A 4IJ8A
chains in the Genus database with same CATH topology
3RJWA 1ZKKA 3F9WA 3OXGA 2IGQA 4MI0A 3DB5A 4WUYA 3F9ZA 4YNDA 5JHNA 3M59A 4YNMA 1PEGA 1O9SA 5F6KC 5T5GA 3TG5A 3M56A 3MEKA 3CBOA 5LSZA 3CBPA 5KJKA 4J7IA 4MI5A 4O6FA 3N71A 5CCMA 5ARGA 3SW9A 3M54A 4C1QA 4YPUA 2QPWA 5ARFA 4FMUA 4J8OA 3PDNA 3S7JA 5F59A 4QEOA 5TH7A 5EG2A 5EX3A 3MO0A 5CPRB 5F6LA 1MVHA 1N6CA 3F9XA 4H12A 4J7FA 2O8JA 3S7BA 2G46A 5LSXA 1MVXA 4JLGA 2BQZA 5KJNA 5EX0A 4QENA 3DALA 1MUFA 3F9YA 3S8PA 2F69A 4AU7A 5JIYA 3VUZA 3SWCA 3S7FA 4J83A 1XQHA 3IHXA 5CCLA 3M58A 3QWWA 3M5AA 1N3JA 3QWPA 4YPAA 5HI7A 3RU0A 2R3AA 3S7DA 3KMJA 5JJ0A 3OXFA 3M57A 4E47A 3RQ4A 2W5ZA 1ML9A 3BO5A 3HNAA 5T0KA 4QEPA 5KJLA 5T0MA 1N6AA 4BUPA 5JINA 3RAYA 4RZ0A 2W5YA 3OXLA 4IJDA 5HQ8A 3KMTA 3OPEA 5F5EA 3OS5A 3FPDA 4NVQA 3QWVA 1H3IA 3M55A 3EP0A 4LDGA 4O30A 3TG4A 5TTFA 3KMAA 2RFIA 4I51A 3MO2A 3VV0A 4YPEA 5AYFA 3RIBA 5KJMA 3MO5A 3K5KA 5TEGA 2JV0A 3OOIA 3CBMA 4NJ5A 4JDSA 4YNPA 4Z4PA 1MT6A 3M53A 4IJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJW A;  1ZKK A;  3F9W A;  3OXG A;  2IGQ A;  4MI0 A;  3DB5 A;  4WUY A;  3F9Z A;  4YND A;  5JHN A;  3M59 A;  4YNM A;  1PEG A;  1O9S A;  5F6K C;  5T5G A;  3TG5 A;  3M56 A;  3MEK A;  3CBO A;  5LSZ A;  3CBP A;  5KJK A;  4J7I A;  4MI5 A;  4O6F A;  3N71 A;  5CCM A;  5ARG A;  3SW9 A;  3M54 A;  4C1Q A;  4YPU A;  2QPW A;  5ARF A;  4FMU A;  4J8O A;  3PDN A;  3S7J A;  5F59 A;  4QEO A;  5TH7 A;  5EG2 A;  5EX3 A;  3MO0 A;  5CPR B;  5F6L A;  1MVH A;  1N6C A;  3F9X A;  4H12 A;  4J7F A;  2O8J A;  3S7B A;  2G46 A;  5LSX A;  1MVX A;  4JLG A;  2BQZ A;  5KJN A;  5EX0 A;  4QEN A;  3DAL A;  1MUF A;  3F9Y A;  3S8P A;  2F69 A;  4AU7 A;  5JIY A;  3VUZ A;  3SWC A;  3S7F A;  4J83 A;  1XQH A;  3IHX A;  5CCL A;  3M58 A;  3QWW A;  3M5A A;  1N3J A;  3QWP A;  4YPA A;  5HI7 A;  3RU0 A;  2R3A A;  3S7D A;  3KMJ A;  5JJ0 A;  3OXF A;  3M57 A;  4E47 A;  3RQ4 A;  2W5Z A;  1ML9 A;  3BO5 A;  3HNA A;  5T0K A;  4QEP A;  5KJL A;  5T0M A;  1N6A A;  4BUP A;  5JIN A;  3RAY A;  4RZ0 A;  2W5Y A;  3OXL A;  4IJD A;  5HQ8 A;  3KMT A;  3OPE A;  5F5E A;  3OS5 A;  3FPD A;  4NVQ A;  3QWV A;  1H3I A;  3M55 A;  3EP0 A;  4LDG A;  4O30 A;  3TG4 A;  5TTF A;  3KMA A;  2RFI A;  4I51 A;  3MO2 A;  3VV0 A;  4YPE A;  5AYF A;  3RIB A;  5KJM A;  3MO5 A;  3K5K A;  5TEG A;  2JV0 A;  3OOI A;  3CBM A;  4NJ5 A;  4JDS A;  4YNP A;  4Z4P A;  1MT6 A;  3M53 A;  4IJ8 A; 
#chains in the Genus database with same CATH topology
 3RJW A;  1ZKK A;  3F9W A;  3OXG A;  2IGQ A;  4MI0 A;  3DB5 A;  4WUY A;  3F9Z A;  4YND A;  5JHN A;  3M59 A;  4YNM A;  1PEG A;  1O9S A;  5F6K C;  5T5G A;  3TG5 A;  3M56 A;  3MEK A;  3CBO A;  5LSZ A;  3CBP A;  5KJK A;  4J7I A;  4MI5 A;  4O6F A;  3N71 A;  5CCM A;  5ARG A;  3SW9 A;  3M54 A;  4C1Q A;  4YPU A;  2QPW A;  5ARF A;  4FMU A;  4J8O A;  3PDN A;  3S7J A;  5F59 A;  4QEO A;  5TH7 A;  5EG2 A;  5EX3 A;  3MO0 A;  5CPR B;  5F6L A;  1MVH A;  1N6C A;  3F9X A;  4H12 A;  4J7F A;  2O8J A;  3S7B A;  2G46 A;  5LSX A;  1MVX A;  4JLG A;  2BQZ A;  5KJN A;  5EX0 A;  4QEN A;  3DAL A;  1MUF A;  3F9Y A;  3S8P A;  2F69 A;  4AU7 A;  5JIY A;  3VUZ A;  3SWC A;  3S7F A;  4J83 A;  1XQH A;  3IHX A;  5CCL A;  3M58 A;  3QWW A;  3M5A A;  1N3J A;  3QWP A;  4YPA A;  5HI7 A;  3RU0 A;  2R3A A;  3S7D A;  3KMJ A;  5JJ0 A;  3OXF A;  3M57 A;  4E47 A;  3RQ4 A;  2W5Z A;  1ML9 A;  3BO5 A;  3HNA A;  5T0K A;  4QEP A;  5KJL A;  5T0M A;  1N6A A;  4BUP A;  5JIN A;  3RAY A;  4RZ0 A;  2W5Y A;  3OXL A;  4IJD A;  5HQ8 A;  3KMT A;  3OPE A;  5F5E A;  3OS5 A;  3FPD A;  4NVQ A;  3QWV A;  1H3I A;  3M55 A;  3EP0 A;  4LDG A;  4O30 A;  3TG4 A;  5TTF A;  3KMA A;  2RFI A;  4I51 A;  3MO2 A;  3VV0 A;  4YPE A;  5AYF A;  3RIB A;  5KJM A;  3MO5 A;  3K5K A;  5TEG A;  2JV0 A;  3OOI A;  3CBM A;  4NJ5 A;  4JDS A;  4YNP A;  4Z4P A;  1MT6 A;  3M53 A;  4IJ8 A; 
#chains in the Genus database with same CATH homology
 3RJW A;  1ZKK A;  3F9W A;  3OXG A;  2IGQ A;  4MI0 A;  3DB5 A;  4WUY A;  3F9Z A;  4YND A;  5JHN A;  3M59 A;  4YNM A;  1PEG A;  1O9S A;  5F6K C;  5T5G A;  3TG5 A;  3M56 A;  3MEK A;  3CBO A;  5LSZ A;  3CBP A;  5KJK A;  4J7I A;  4MI5 A;  4O6F A;  3N71 A;  5CCM A;  5ARG A;  3SW9 A;  3M54 A;  4C1Q A;  4YPU A;  2QPW A;  5ARF A;  4FMU A;  4J8O A;  3PDN A;  3S7J A;  5F59 A;  4QEO A;  5TH7 A;  5EG2 A;  5EX3 A;  3MO0 A;  5CPR B;  5F6L A;  1MVH A;  1N6C A;  3F9X A;  4H12 A;  4J7F A;  2O8J A;  3S7B A;  2G46 A;  5LSX A;  1MVX A;  4JLG A;  2BQZ A;  5KJN A;  5EX0 A;  4QEN A;  3DAL A;  1MUF A;  3F9Y A;  3S8P A;  2F69 A;  4AU7 A;  5JIY A;  3VUZ A;  3SWC A;  3S7F A;  4J83 A;  1XQH A;  3IHX A;  5CCL A;  3M58 A;  3QWW A;  3M5A A;  1N3J A;  3QWP A;  4YPA A;  5HI7 A;  3RU0 A;  2R3A A;  3S7D A;  3KMJ A;  5JJ0 A;  3OXF A;  3M57 A;  4E47 A;  3RQ4 A;  2W5Z A;  1ML9 A;  3BO5 A;  3HNA A;  5T0K A;  4QEP A;  5KJL A;  5T0M A;  1N6A A;  4BUP A;  5JIN A;  3RAY A;  4RZ0 A;  2W5Y A;  3OXL A;  4IJD A;  5HQ8 A;  3KMT A;  3OPE A;  5F5E A;  3OS5 A;  3FPD A;  4NVQ A;  3QWV A;  1H3I A;  3M55 A;  3EP0 A;  4LDG A;  4O30 A;  3TG4 A;  5TTF A;  3KMA A;  2RFI A;  4I51 A;  3MO2 A;  3VV0 A;  4YPE A;  5AYF A;  3RIB A;  5KJM A;  3MO5 A;  3K5K A;  5TEG A;  2JV0 A;  3OOI A;  3CBM A;  4NJ5 A;  4JDS A;  4YNP A;  4Z4P A;  1MT6 A;  3M53 A;  4IJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...