3IHXA

Methyltransferase domain of human pr domain-containing protein 10
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
141
structure length
126
Chain Sequence
HPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPLVRGSELKDCYIHLKVLWFELSDETLCNWMMFVRPAQNHLEQNLVAYQYGHHVYYTTIKNVEPKQELKVWYAASYAEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 10
publication title Methyltransferase domain of human PR domain-containing protein 10
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 24
structure length 126
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ihxA01
5JJ0A 4J7IA 4H12A 1MVXA 5KJLA 3CBMA 4O30A 5KJMA 2W5ZA 4YNPA 2IGQA 3F9YA 2F69A 2QPWA 3OPEA 3OXFA 3M53A 5HI7A 3VV0A 3M55A 4J83A 5F6LA 5F5EA 5HQ8A 5JHNA 3EP0A 5ARGA 5EG2A 5T0KA 3F9XA 2JV0A 3OS5A 1MT6A 3RU0A 4E47A 4J7FA 1O9SA 5AYFA 3RIBA 3BO5A 3F9ZA 3DB5A 4QENA 3MO0A 4NVQA 4YPUA 5TTFA 2RFIA 4J8OA 5F59A 4AU7A 3FPDA 3TG4A 3OXLA 3M56A 3S7BA 4FMUA 4QEOA 4NJ5A 3S7DA 3DALA 3MO2A 3MEKA 3S7JA 1N3JA 2BQZA 3S8PA 3M5AA 3M59A 4MI0A 5KJNA 2R3AA 1ML9A 4YPAA 4YNMA 3S7FA 4LDGA 3KMTA 3OXGA 3CBOA 4JLGA 4IJDA 3HNAA 4C1QA 4IJ8A 1MVHA 3RQ4A 3TG5A 5JINA 4QEPA 3SW9A 4Z4PA 4MI5A 3KMJA 3M57A 2W5YA 5CPRB 3N71A 3VUZA 1N6CA 3M58A 4YNDA 3OOIA 5CCMA 3RAYA 4YPEA 3QWPA 2O8JA 5EX3A 5ARFA 3IHXA 5LSZA 3M54A 5EX0A 5KJKA 4JDSA 5T0MA 5T5GA 1H3IA 1ZKKA 3PDNA 3K5KA 3MO5A 3RJWA 3KMAA 3SWCA 1MUFA 5CCLA 4WUYA 5LSXA 4RZ0A 1PEGA 3QWVA 5TH7A 3F9WA 5TEGA 4I51A 5JIYA 4O6FA 5F6KC 3CBPA 2G46A 1XQHA 3QWWA 1N6AA 4BUPA
chains in the Genus database with same CATH superfamily
5JJ0A 4J7IA 4H12A 1MVXA 5KJLA 3CBMA 4O30A 5KJMA 2W5ZA 4YNPA 2IGQA 3F9YA 2F69A 2QPWA 3OPEA 3OXFA 3M53A 5HI7A 3VV0A 3M55A 4J83A 5F6LA 5F5EA 5HQ8A 5JHNA 3EP0A 5ARGA 5EG2A 5T0KA 3F9XA 2JV0A 3OS5A 1MT6A 3RU0A 4E47A 4J7FA 1O9SA 5AYFA 3RIBA 3BO5A 3F9ZA 3DB5A 4QENA 3MO0A 4NVQA 4YPUA 5TTFA 2RFIA 4J8OA 5F59A 4AU7A 3FPDA 3TG4A 3OXLA 3M56A 3S7BA 4FMUA 4QEOA 4NJ5A 3S7DA 3DALA 3MO2A 3MEKA 3S7JA 1N3JA 2BQZA 3S8PA 3M5AA 3M59A 4MI0A 5KJNA 2R3AA 1ML9A 4YPAA 4YNMA 3S7FA 4LDGA 3KMTA 3OXGA 3CBOA 4JLGA 4IJDA 3HNAA 4C1QA 4IJ8A 1MVHA 3RQ4A 3TG5A 5JINA 4QEPA 3SW9A 4Z4PA 4MI5A 3KMJA 3M57A 2W5YA 5CPRB 3N71A 3VUZA 1N6CA 3M58A 4YNDA 3OOIA 5CCMA 3RAYA 4YPEA 3QWPA 2O8JA 5EX3A 5ARFA 3IHXA 5LSZA 3M54A 5EX0A 5KJKA 4JDSA 5T0MA 5T5GA 1H3IA 1ZKKA 3PDNA 3K5KA 3MO5A 3RJWA 3KMAA 3SWCA 1MUFA 5CCLA 4WUYA 5LSXA 4RZ0A 1PEGA 3QWVA 5TH7A 3F9WA 5TEGA 4I51A 5JIYA 4O6FA 5F6KC 3CBPA 2G46A 1XQHA 3QWWA 1N6AA 4BUPA
chains in the Genus database with same CATH topology
5JJ0A 4J7IA 4H12A 1MVXA 5KJLA 3CBMA 4O30A 5KJMA 2W5ZA 4YNPA 2IGQA 3F9YA 2F69A 2QPWA 3OPEA 3OXFA 3M53A 5HI7A 3VV0A 3M55A 4J83A 5F6LA 5F5EA 5HQ8A 5JHNA 3EP0A 5ARGA 5EG2A 5T0KA 3F9XA 2JV0A 3OS5A 1MT6A 3RU0A 4E47A 4J7FA 1O9SA 5AYFA 3RIBA 3BO5A 3F9ZA 3DB5A 4QENA 3MO0A 4NVQA 4YPUA 5TTFA 2RFIA 4J8OA 5F59A 4AU7A 3FPDA 3TG4A 3OXLA 3M56A 3S7BA 4FMUA 4QEOA 4NJ5A 3S7DA 3DALA 3MO2A 3MEKA 3S7JA 1N3JA 2BQZA 3S8PA 3M5AA 3M59A 4MI0A 5KJNA 2R3AA 1ML9A 4YPAA 4YNMA 3S7FA 4LDGA 3KMTA 3OXGA 3CBOA 4JLGA 4IJDA 3HNAA 4C1QA 4IJ8A 1MVHA 3RQ4A 3TG5A 5JINA 4QEPA 3SW9A 4Z4PA 4MI5A 3KMJA 3M57A 2W5YA 5CPRB 3N71A 3VUZA 1N6CA 3M58A 4YNDA 3OOIA 5CCMA 3RAYA 4YPEA 3QWPA 2O8JA 5EX3A 5ARFA 3IHXA 5LSZA 3M54A 5EX0A 5KJKA 4JDSA 5T0MA 5T5GA 1H3IA 1ZKKA 3PDNA 3K5KA 3MO5A 3RJWA 3KMAA 3SWCA 1MUFA 5CCLA 4WUYA 5LSXA 4RZ0A 1PEGA 3QWVA 5TH7A 3F9WA 5TEGA 4I51A 5JIYA 4O6FA 5F6KC 3CBPA 2G46A 1XQHA 3QWWA 1N6AA 4BUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ0 A;  4J7I A;  4H12 A;  1MVX A;  5KJL A;  3CBM A;  4O30 A;  5KJM A;  2W5Z A;  4YNP A;  2IGQ A;  3F9Y A;  2F69 A;  2QPW A;  3OPE A;  3OXF A;  3M53 A;  5HI7 A;  3VV0 A;  3M55 A;  4J83 A;  5F6L A;  5F5E A;  5HQ8 A;  5JHN A;  3EP0 A;  5ARG A;  5EG2 A;  5T0K A;  3F9X A;  2JV0 A;  3OS5 A;  1MT6 A;  3RU0 A;  4E47 A;  4J7F A;  1O9S A;  5AYF A;  3RIB A;  3BO5 A;  3F9Z A;  3DB5 A;  4QEN A;  3MO0 A;  4NVQ A;  4YPU A;  5TTF A;  2RFI A;  4J8O A;  5F59 A;  4AU7 A;  3FPD A;  3TG4 A;  3OXL A;  3M56 A;  3S7B A;  4FMU A;  4QEO A;  4NJ5 A;  3S7D A;  3DAL A;  3MO2 A;  3MEK A;  3S7J A;  1N3J A;  2BQZ A;  3S8P A;  3M5A A;  3M59 A;  4MI0 A;  5KJN A;  2R3A A;  1ML9 A;  4YPA A;  4YNM A;  3S7F A;  4LDG A;  3KMT A;  3OXG A;  3CBO A;  4JLG A;  4IJD A;  3HNA A;  4C1Q A;  4IJ8 A;  1MVH A;  3RQ4 A;  3TG5 A;  5JIN A;  4QEP A;  3SW9 A;  4Z4P A;  4MI5 A;  3KMJ A;  3M57 A;  2W5Y A;  5CPR B;  3N71 A;  3VUZ A;  1N6C A;  3M58 A;  4YND A;  3OOI A;  5CCM A;  3RAY A;  4YPE A;  3QWP A;  2O8J A;  5EX3 A;  5ARF A;  3IHX A;  5LSZ A;  3M54 A;  5EX0 A;  5KJK A;  4JDS A;  5T0M A;  5T5G A;  1H3I A;  1ZKK A;  3PDN A;  3K5K A;  3MO5 A;  3RJW A;  3KMA A;  3SWC A;  1MUF A;  5CCL A;  4WUY A;  5LSX A;  4RZ0 A;  1PEG A;  3QWV A;  5TH7 A;  3F9W A;  5TEG A;  4I51 A;  5JIY A;  4O6F A;  5F6K C;  3CBP A;  2G46 A;  1XQH A;  3QWW A;  1N6A A;  4BUP A; 
#chains in the Genus database with same CATH topology
 5JJ0 A;  4J7I A;  4H12 A;  1MVX A;  5KJL A;  3CBM A;  4O30 A;  5KJM A;  2W5Z A;  4YNP A;  2IGQ A;  3F9Y A;  2F69 A;  2QPW A;  3OPE A;  3OXF A;  3M53 A;  5HI7 A;  3VV0 A;  3M55 A;  4J83 A;  5F6L A;  5F5E A;  5HQ8 A;  5JHN A;  3EP0 A;  5ARG A;  5EG2 A;  5T0K A;  3F9X A;  2JV0 A;  3OS5 A;  1MT6 A;  3RU0 A;  4E47 A;  4J7F A;  1O9S A;  5AYF A;  3RIB A;  3BO5 A;  3F9Z A;  3DB5 A;  4QEN A;  3MO0 A;  4NVQ A;  4YPU A;  5TTF A;  2RFI A;  4J8O A;  5F59 A;  4AU7 A;  3FPD A;  3TG4 A;  3OXL A;  3M56 A;  3S7B A;  4FMU A;  4QEO A;  4NJ5 A;  3S7D A;  3DAL A;  3MO2 A;  3MEK A;  3S7J A;  1N3J A;  2BQZ A;  3S8P A;  3M5A A;  3M59 A;  4MI0 A;  5KJN A;  2R3A A;  1ML9 A;  4YPA A;  4YNM A;  3S7F A;  4LDG A;  3KMT A;  3OXG A;  3CBO A;  4JLG A;  4IJD A;  3HNA A;  4C1Q A;  4IJ8 A;  1MVH A;  3RQ4 A;  3TG5 A;  5JIN A;  4QEP A;  3SW9 A;  4Z4P A;  4MI5 A;  3KMJ A;  3M57 A;  2W5Y A;  5CPR B;  3N71 A;  3VUZ A;  1N6C A;  3M58 A;  4YND A;  3OOI A;  5CCM A;  3RAY A;  4YPE A;  3QWP A;  2O8J A;  5EX3 A;  5ARF A;  3IHX A;  5LSZ A;  3M54 A;  5EX0 A;  5KJK A;  4JDS A;  5T0M A;  5T5G A;  1H3I A;  1ZKK A;  3PDN A;  3K5K A;  3MO5 A;  3RJW A;  3KMA A;  3SWC A;  1MUF A;  5CCL A;  4WUY A;  5LSX A;  4RZ0 A;  1PEG A;  3QWV A;  5TH7 A;  3F9W A;  5TEG A;  4I51 A;  5JIY A;  4O6F A;  5F6K C;  3CBP A;  2G46 A;  1XQH A;  3QWW A;  1N6A A;  4BUP A; 
#chains in the Genus database with same CATH homology
 5JJ0 A;  4J7I A;  4H12 A;  1MVX A;  5KJL A;  3CBM A;  4O30 A;  5KJM A;  2W5Z A;  4YNP A;  2IGQ A;  3F9Y A;  2F69 A;  2QPW A;  3OPE A;  3OXF A;  3M53 A;  5HI7 A;  3VV0 A;  3M55 A;  4J83 A;  5F6L A;  5F5E A;  5HQ8 A;  5JHN A;  3EP0 A;  5ARG A;  5EG2 A;  5T0K A;  3F9X A;  2JV0 A;  3OS5 A;  1MT6 A;  3RU0 A;  4E47 A;  4J7F A;  1O9S A;  5AYF A;  3RIB A;  3BO5 A;  3F9Z A;  3DB5 A;  4QEN A;  3MO0 A;  4NVQ A;  4YPU A;  5TTF A;  2RFI A;  4J8O A;  5F59 A;  4AU7 A;  3FPD A;  3TG4 A;  3OXL A;  3M56 A;  3S7B A;  4FMU A;  4QEO A;  4NJ5 A;  3S7D A;  3DAL A;  3MO2 A;  3MEK A;  3S7J A;  1N3J A;  2BQZ A;  3S8P A;  3M5A A;  3M59 A;  4MI0 A;  5KJN A;  2R3A A;  1ML9 A;  4YPA A;  4YNM A;  3S7F A;  4LDG A;  3KMT A;  3OXG A;  3CBO A;  4JLG A;  4IJD A;  3HNA A;  4C1Q A;  4IJ8 A;  1MVH A;  3RQ4 A;  3TG5 A;  5JIN A;  4QEP A;  3SW9 A;  4Z4P A;  4MI5 A;  3KMJ A;  3M57 A;  2W5Y A;  5CPR B;  3N71 A;  3VUZ A;  1N6C A;  3M58 A;  4YND A;  3OOI A;  5CCM A;  3RAY A;  4YPE A;  3QWP A;  2O8J A;  5EX3 A;  5ARF A;  3IHX A;  5LSZ A;  3M54 A;  5EX0 A;  5KJK A;  4JDS A;  5T0M A;  5T5G A;  1H3I A;  1ZKK A;  3PDN A;  3K5K A;  3MO5 A;  3RJW A;  3KMA A;  3SWC A;  1MUF A;  5CCL A;  4WUY A;  5LSX A;  4RZ0 A;  1PEG A;  3QWV A;  5TH7 A;  3F9W A;  5TEG A;  4I51 A;  5JIY A;  4O6F A;  5F6K C;  3CBP A;  2G46 A;  1XQH A;  3QWW A;  1N6A A;  4BUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...