3IHXA

Methyltransferase domain of human pr domain-containing protein 10
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
141
structure length
126
Chain Sequence
HPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPLVRGSELKDCYIHLKVLWFELSDETLCNWMMFVRPAQNHLEQNLVAYQYGHHVYYTTIKNVEPKQELKVWYAASYAEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PR domain zinc finger protein 10
publication title Methyltransferase domain of human PR domain-containing protein 10
rcsb
source organism Homo sapiens
total genus 24
structure length 126
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ihxA01
3CBMA 1N3JA 3MO2A 4O30A 5CCLA 4MI5A 4J7IA 4YNMA 5ARGA 5LSZA 4RZ0A 3BO5A 3OS5A 3OPEA 3M55A 1O9SA 3M58A 2RFIA 1PEGA 3RAYA 5F59A 4NJ5A 4YNDA 3QWWA 1N6AA 4Z4PA 3M56A 4NVQA 1MUFA 4LDGA 2O8JA 5KJMA 3CBOA 5KJLA 3OXGA 5JHNA 5F5EA 4JLGA 3F9WA 5T0MA 3DB5A 4H12A 3FPDA 4E47A 3S7FA 4QENA 4J83A 1H3IA 2G46A 4YPUA 3S8PA 3M53A 3RIBA 1ZKKA 3MO5A 5TEGA 4YNPA 5HI7A 3VUZA 4AU7A 1XQHA 4IJ8A 4MI0A 5CCMA 5JINA 2BQZA 5JJ0A 4QEPA 2JV0A 3KMAA 2F69A 3KMTA 4J7FA 3N71A 1MT6A 3MO0A 5KJNA 3TG5A 5F6KC 3DALA 3TG4A 4WUYA 3KMJA 5T5GA 5HQ8A 3S7DA 3S7JA 4I51A 3MEKA 5EX0A 2IGQA 5T0KA 2R3AA 1N6CA 3SWCA 3IHXA 3CBPA 1ML9A 4JDSA 5EG2A 5CPRB 3K5KA 4BUPA 3M54A 5TTFA 3F9YA 5F6LA 3F9XA 3M5AA 5ARFA 3RQ4A 2QPWA 5EX3A 3SW9A 3OXFA 5AYFA 3QWVA 3RU0A 3S7BA 1MVHA 3EP0A 5TH7A 3F9ZA 3M57A 3M59A 5KJKA 2W5ZA 2W5YA 4FMUA 1MVXA 5JIYA 4O6FA 3RJWA 4QEOA 3OXLA 3OOIA 3PDNA 4C1QA 3VV0A 3QWPA 3HNAA 5LSXA 4YPAA 4IJDA 4YPEA 4J8OA
chains in the Genus database with same CATH superfamily
3CBMA 1N3JA 3MO2A 4O30A 5CCLA 4MI5A 4J7IA 4YNMA 5ARGA 5LSZA 4RZ0A 3BO5A 3OS5A 3OPEA 3M55A 1O9SA 3M58A 2RFIA 1PEGA 3RAYA 5F59A 4NJ5A 4YNDA 3QWWA 1N6AA 4Z4PA 3M56A 4NVQA 1MUFA 4LDGA 2O8JA 5KJMA 3CBOA 5KJLA 3OXGA 5JHNA 5F5EA 4JLGA 3F9WA 5T0MA 3DB5A 4H12A 3FPDA 4E47A 3S7FA 4QENA 4J83A 1H3IA 2G46A 4YPUA 3S8PA 3M53A 3RIBA 1ZKKA 3MO5A 5TEGA 4YNPA 5HI7A 3VUZA 4AU7A 1XQHA 4IJ8A 4MI0A 5CCMA 5JINA 2BQZA 5JJ0A 4QEPA 2JV0A 3KMAA 2F69A 3KMTA 4J7FA 3N71A 1MT6A 3MO0A 5KJNA 3TG5A 5F6KC 3DALA 3TG4A 4WUYA 3KMJA 5T5GA 5HQ8A 3S7DA 3S7JA 4I51A 3MEKA 5EX0A 2IGQA 5T0KA 2R3AA 1N6CA 3SWCA 3IHXA 3CBPA 1ML9A 4JDSA 5EG2A 5CPRB 3K5KA 4BUPA 3M54A 5TTFA 3F9YA 5F6LA 3F9XA 3M5AA 5ARFA 3RQ4A 2QPWA 5EX3A 3SW9A 3OXFA 5AYFA 3QWVA 3RU0A 3S7BA 1MVHA 3EP0A 5TH7A 3F9ZA 3M57A 3M59A 5KJKA 2W5ZA 2W5YA 4FMUA 1MVXA 5JIYA 4O6FA 3RJWA 4QEOA 3OXLA 3OOIA 3PDNA 4C1QA 3VV0A 3QWPA 3HNAA 5LSXA 4YPAA 4IJDA 4YPEA 4J8OA
chains in the Genus database with same CATH topology
3CBMA 1N3JA 3MO2A 4O30A 5CCLA 4MI5A 4J7IA 4YNMA 5ARGA 5LSZA 4RZ0A 3BO5A 3OS5A 3OPEA 3M55A 1O9SA 3M58A 2RFIA 1PEGA 3RAYA 5F59A 4NJ5A 4YNDA 3QWWA 1N6AA 4Z4PA 3M56A 4NVQA 1MUFA 4LDGA 2O8JA 5KJMA 3CBOA 5KJLA 3OXGA 5JHNA 5F5EA 4JLGA 3F9WA 5T0MA 3DB5A 4H12A 3FPDA 4E47A 3S7FA 4QENA 4J83A 1H3IA 2G46A 4YPUA 3S8PA 3M53A 3RIBA 1ZKKA 3MO5A 5TEGA 4YNPA 5HI7A 3VUZA 4AU7A 1XQHA 4IJ8A 4MI0A 5CCMA 5JINA 2BQZA 5JJ0A 4QEPA 2JV0A 3KMAA 2F69A 3KMTA 4J7FA 3N71A 1MT6A 3MO0A 5KJNA 3TG5A 5F6KC 3DALA 3TG4A 4WUYA 3KMJA 5T5GA 5HQ8A 3S7DA 3S7JA 4I51A 3MEKA 5EX0A 2IGQA 5T0KA 2R3AA 1N6CA 3SWCA 3IHXA 3CBPA 1ML9A 4JDSA 5EG2A 5CPRB 3K5KA 4BUPA 3M54A 5TTFA 3F9YA 5F6LA 3F9XA 3M5AA 5ARFA 3RQ4A 2QPWA 5EX3A 3SW9A 3OXFA 5AYFA 3QWVA 3RU0A 3S7BA 1MVHA 3EP0A 5TH7A 3F9ZA 3M57A 3M59A 5KJKA 2W5ZA 2W5YA 4FMUA 1MVXA 5JIYA 4O6FA 3RJWA 4QEOA 3OXLA 3OOIA 3PDNA 4C1QA 3VV0A 3QWPA 3HNAA 5LSXA 4YPAA 4IJDA 4YPEA 4J8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBM A;  1N3J A;  3MO2 A;  4O30 A;  5CCL A;  4MI5 A;  4J7I A;  4YNM A;  5ARG A;  5LSZ A;  4RZ0 A;  3BO5 A;  3OS5 A;  3OPE A;  3M55 A;  1O9S A;  3M58 A;  2RFI A;  1PEG A;  3RAY A;  5F59 A;  4NJ5 A;  4YND A;  3QWW A;  1N6A A;  4Z4P A;  3M56 A;  4NVQ A;  1MUF A;  4LDG A;  2O8J A;  5KJM A;  3CBO A;  5KJL A;  3OXG A;  5JHN A;  5F5E A;  4JLG A;  3F9W A;  5T0M A;  3DB5 A;  4H12 A;  3FPD A;  4E47 A;  3S7F A;  4QEN A;  4J83 A;  1H3I A;  2G46 A;  4YPU A;  3S8P A;  3M53 A;  3RIB A;  1ZKK A;  3MO5 A;  5TEG A;  4YNP A;  5HI7 A;  3VUZ A;  4AU7 A;  1XQH A;  4IJ8 A;  4MI0 A;  5CCM A;  5JIN A;  2BQZ A;  5JJ0 A;  4QEP A;  2JV0 A;  3KMA A;  2F69 A;  3KMT A;  4J7F A;  3N71 A;  1MT6 A;  3MO0 A;  5KJN A;  3TG5 A;  5F6K C;  3DAL A;  3TG4 A;  4WUY A;  3KMJ A;  5T5G A;  5HQ8 A;  3S7D A;  3S7J A;  4I51 A;  3MEK A;  5EX0 A;  2IGQ A;  5T0K A;  2R3A A;  1N6C A;  3SWC A;  3IHX A;  3CBP A;  1ML9 A;  4JDS A;  5EG2 A;  5CPR B;  3K5K A;  4BUP A;  3M54 A;  5TTF A;  3F9Y A;  5F6L A;  3F9X A;  3M5A A;  5ARF A;  3RQ4 A;  2QPW A;  5EX3 A;  3SW9 A;  3OXF A;  5AYF A;  3QWV A;  3RU0 A;  3S7B A;  1MVH A;  3EP0 A;  5TH7 A;  3F9Z A;  3M57 A;  3M59 A;  5KJK A;  2W5Z A;  2W5Y A;  4FMU A;  1MVX A;  5JIY A;  4O6F A;  3RJW A;  4QEO A;  3OXL A;  3OOI A;  3PDN A;  4C1Q A;  3VV0 A;  3QWP A;  3HNA A;  5LSX A;  4YPA A;  4IJD A;  4YPE A;  4J8O A; 
#chains in the Genus database with same CATH topology
 3CBM A;  1N3J A;  3MO2 A;  4O30 A;  5CCL A;  4MI5 A;  4J7I A;  4YNM A;  5ARG A;  5LSZ A;  4RZ0 A;  3BO5 A;  3OS5 A;  3OPE A;  3M55 A;  1O9S A;  3M58 A;  2RFI A;  1PEG A;  3RAY A;  5F59 A;  4NJ5 A;  4YND A;  3QWW A;  1N6A A;  4Z4P A;  3M56 A;  4NVQ A;  1MUF A;  4LDG A;  2O8J A;  5KJM A;  3CBO A;  5KJL A;  3OXG A;  5JHN A;  5F5E A;  4JLG A;  3F9W A;  5T0M A;  3DB5 A;  4H12 A;  3FPD A;  4E47 A;  3S7F A;  4QEN A;  4J83 A;  1H3I A;  2G46 A;  4YPU A;  3S8P A;  3M53 A;  3RIB A;  1ZKK A;  3MO5 A;  5TEG A;  4YNP A;  5HI7 A;  3VUZ A;  4AU7 A;  1XQH A;  4IJ8 A;  4MI0 A;  5CCM A;  5JIN A;  2BQZ A;  5JJ0 A;  4QEP A;  2JV0 A;  3KMA A;  2F69 A;  3KMT A;  4J7F A;  3N71 A;  1MT6 A;  3MO0 A;  5KJN A;  3TG5 A;  5F6K C;  3DAL A;  3TG4 A;  4WUY A;  3KMJ A;  5T5G A;  5HQ8 A;  3S7D A;  3S7J A;  4I51 A;  3MEK A;  5EX0 A;  2IGQ A;  5T0K A;  2R3A A;  1N6C A;  3SWC A;  3IHX A;  3CBP A;  1ML9 A;  4JDS A;  5EG2 A;  5CPR B;  3K5K A;  4BUP A;  3M54 A;  5TTF A;  3F9Y A;  5F6L A;  3F9X A;  3M5A A;  5ARF A;  3RQ4 A;  2QPW A;  5EX3 A;  3SW9 A;  3OXF A;  5AYF A;  3QWV A;  3RU0 A;  3S7B A;  1MVH A;  3EP0 A;  5TH7 A;  3F9Z A;  3M57 A;  3M59 A;  5KJK A;  2W5Z A;  2W5Y A;  4FMU A;  1MVX A;  5JIY A;  4O6F A;  3RJW A;  4QEO A;  3OXL A;  3OOI A;  3PDN A;  4C1Q A;  3VV0 A;  3QWP A;  3HNA A;  5LSX A;  4YPA A;  4IJD A;  4YPE A;  4J8O A; 
#chains in the Genus database with same CATH homology
 3CBM A;  1N3J A;  3MO2 A;  4O30 A;  5CCL A;  4MI5 A;  4J7I A;  4YNM A;  5ARG A;  5LSZ A;  4RZ0 A;  3BO5 A;  3OS5 A;  3OPE A;  3M55 A;  1O9S A;  3M58 A;  2RFI A;  1PEG A;  3RAY A;  5F59 A;  4NJ5 A;  4YND A;  3QWW A;  1N6A A;  4Z4P A;  3M56 A;  4NVQ A;  1MUF A;  4LDG A;  2O8J A;  5KJM A;  3CBO A;  5KJL A;  3OXG A;  5JHN A;  5F5E A;  4JLG A;  3F9W A;  5T0M A;  3DB5 A;  4H12 A;  3FPD A;  4E47 A;  3S7F A;  4QEN A;  4J83 A;  1H3I A;  2G46 A;  4YPU A;  3S8P A;  3M53 A;  3RIB A;  1ZKK A;  3MO5 A;  5TEG A;  4YNP A;  5HI7 A;  3VUZ A;  4AU7 A;  1XQH A;  4IJ8 A;  4MI0 A;  5CCM A;  5JIN A;  2BQZ A;  5JJ0 A;  4QEP A;  2JV0 A;  3KMA A;  2F69 A;  3KMT A;  4J7F A;  3N71 A;  1MT6 A;  3MO0 A;  5KJN A;  3TG5 A;  5F6K C;  3DAL A;  3TG4 A;  4WUY A;  3KMJ A;  5T5G A;  5HQ8 A;  3S7D A;  3S7J A;  4I51 A;  3MEK A;  5EX0 A;  2IGQ A;  5T0K A;  2R3A A;  1N6C A;  3SWC A;  3IHX A;  3CBP A;  1ML9 A;  4JDS A;  5EG2 A;  5CPR B;  3K5K A;  4BUP A;  3M54 A;  5TTF A;  3F9Y A;  5F6L A;  3F9X A;  3M5A A;  5ARF A;  3RQ4 A;  2QPW A;  5EX3 A;  3SW9 A;  3OXF A;  5AYF A;  3QWV A;  3RU0 A;  3S7B A;  1MVH A;  3EP0 A;  5TH7 A;  3F9Z A;  3M57 A;  3M59 A;  5KJK A;  2W5Z A;  2W5Y A;  4FMU A;  1MVX A;  5JIY A;  4O6F A;  3RJW A;  4QEO A;  3OXL A;  3OOI A;  3PDN A;  4C1Q A;  3VV0 A;  3QWP A;  3HNA A;  5LSX A;  4YPA A;  4IJD A;  4YPE A;  4J8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...