3IHXA

Methyltransferase domain of human pr domain-containing protein 10
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
141
structure length
126
Chain Sequence
HPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPLVRGSELKDCYIHLKVLWFELSDETLCNWMMFVRPAQNHLEQNLVAYQYGHHVYYTTIKNVEPKQELKVWYAASYAEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 10
publication title Methyltransferase domain of human PR domain-containing protein 10
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 24
structure length 126
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ihxA01
3DB5A 5ARGA 5HQ8A 3S7DA 2BQZA 2R3AA 4LDGA 2RFIA 4IJ8A 4NJ5A 3CBPA 5F6KC 3M54A 3M55A 4YNDA 5T0MA 5EG2A 3S7FA 2JV0A 3M59A 3RAYA 3M57A 3S8PA 3RJWA 5JINA 3F9YA 3OS5A 3F9ZA 2IGQA 3VV0A 3OOIA 5ARFA 2O8JA 3MO0A 4BUPA 1N6CA 1N6AA 5KJNA 3RU0A 4O30A 4JLGA 4J7IA 4E47A 2G46A 5TH7A 5CPRB 2QPWA 3M53A 3M58A 1MT6A 4IJDA 3KMJA 5AYFA 5KJMA 1MUFA 5T5GA 4Z4PA 3SWCA 5F5EA 3OXGA 4C1QA 3MO5A 4O6FA 4JDSA 1MVHA 2W5ZA 3MEKA 5F59A 5KJKA 3K5KA 3DALA 1N3JA 4QENA 3M56A 3F9WA 3BO5A 2F69A 4FMUA 5CCMA 4MI0A 5EX0A 5CCLA 3TG5A 5JJ0A 5F6LA 3QWVA 3EP0A 1MVXA 3QWPA 3OPEA 1XQHA 4MI5A 5LSZA 3KMTA 4YPEA 3FPDA 3QWWA 4I51A 3S7BA 3VUZA 4RZ0A 3M5AA 5JHNA 3SW9A 5JIYA 4YNMA 5TTFA 3IHXA 4AU7A 3HNAA 4WUYA 3TG4A 1ZKKA 4YPAA 4YNPA 4H12A 4J83A 5T0KA 1PEGA 5LSXA 3N71A 3RQ4A 5EX3A 4QEOA 3F9XA 3OXFA 1ML9A 1O9SA 4J7FA 3MO2A 4YPUA 5TEGA 3CBOA 5HI7A 3CBMA 3OXLA 4NVQA 3RIBA 4QEPA 3KMAA 3PDNA 4J8OA 1H3IA 5KJLA 2W5YA 3S7JA
chains in the Genus database with same CATH superfamily
3DB5A 5ARGA 5HQ8A 3S7DA 2BQZA 2R3AA 4LDGA 2RFIA 4IJ8A 4NJ5A 3CBPA 5F6KC 3M54A 3M55A 4YNDA 5T0MA 5EG2A 3S7FA 2JV0A 3M59A 3RAYA 3M57A 3S8PA 3RJWA 5JINA 3F9YA 3OS5A 3F9ZA 2IGQA 3VV0A 3OOIA 5ARFA 2O8JA 3MO0A 4BUPA 1N6CA 1N6AA 5KJNA 3RU0A 4O30A 4JLGA 4J7IA 4E47A 2G46A 5TH7A 5CPRB 2QPWA 3M53A 3M58A 1MT6A 4IJDA 3KMJA 5AYFA 5KJMA 1MUFA 5T5GA 4Z4PA 3SWCA 5F5EA 3OXGA 4C1QA 3MO5A 4O6FA 4JDSA 1MVHA 2W5ZA 3MEKA 5F59A 5KJKA 3K5KA 3DALA 1N3JA 4QENA 3M56A 3F9WA 3BO5A 2F69A 4FMUA 5CCMA 4MI0A 5EX0A 5CCLA 3TG5A 5JJ0A 5F6LA 3QWVA 3EP0A 1MVXA 3QWPA 3OPEA 1XQHA 4MI5A 5LSZA 3KMTA 4YPEA 3FPDA 3QWWA 4I51A 3S7BA 3VUZA 4RZ0A 3M5AA 5JHNA 3SW9A 5JIYA 4YNMA 5TTFA 3IHXA 4AU7A 3HNAA 4WUYA 3TG4A 1ZKKA 4YPAA 4YNPA 4H12A 4J83A 5T0KA 1PEGA 5LSXA 3N71A 3RQ4A 5EX3A 4QEOA 3F9XA 3OXFA 1ML9A 1O9SA 4J7FA 3MO2A 4YPUA 5TEGA 3CBOA 5HI7A 3CBMA 3OXLA 4NVQA 3RIBA 4QEPA 3KMAA 3PDNA 4J8OA 1H3IA 5KJLA 2W5YA 3S7JA
chains in the Genus database with same CATH topology
3DB5A 5ARGA 5HQ8A 3S7DA 2BQZA 2R3AA 4LDGA 2RFIA 4IJ8A 4NJ5A 3CBPA 5F6KC 3M54A 3M55A 4YNDA 5T0MA 5EG2A 3S7FA 2JV0A 3M59A 3RAYA 3M57A 3S8PA 3RJWA 5JINA 3F9YA 3OS5A 3F9ZA 2IGQA 3VV0A 3OOIA 5ARFA 2O8JA 3MO0A 4BUPA 1N6CA 1N6AA 5KJNA 3RU0A 4O30A 4JLGA 4J7IA 4E47A 2G46A 5TH7A 5CPRB 2QPWA 3M53A 3M58A 1MT6A 4IJDA 3KMJA 5AYFA 5KJMA 1MUFA 5T5GA 4Z4PA 3SWCA 5F5EA 3OXGA 4C1QA 3MO5A 4O6FA 4JDSA 1MVHA 2W5ZA 3MEKA 5F59A 5KJKA 3K5KA 3DALA 1N3JA 4QENA 3M56A 3F9WA 3BO5A 2F69A 4FMUA 5CCMA 4MI0A 5EX0A 5CCLA 3TG5A 5JJ0A 5F6LA 3QWVA 3EP0A 1MVXA 3QWPA 3OPEA 1XQHA 4MI5A 5LSZA 3KMTA 4YPEA 3FPDA 3QWWA 4I51A 3S7BA 3VUZA 4RZ0A 3M5AA 5JHNA 3SW9A 5JIYA 4YNMA 5TTFA 3IHXA 4AU7A 3HNAA 4WUYA 3TG4A 1ZKKA 4YPAA 4YNPA 4H12A 4J83A 5T0KA 1PEGA 5LSXA 3N71A 3RQ4A 5EX3A 4QEOA 3F9XA 3OXFA 1ML9A 1O9SA 4J7FA 3MO2A 4YPUA 5TEGA 3CBOA 5HI7A 3CBMA 3OXLA 4NVQA 3RIBA 4QEPA 3KMAA 3PDNA 4J8OA 1H3IA 5KJLA 2W5YA 3S7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB5 A;  5ARG A;  5HQ8 A;  3S7D A;  2BQZ A;  2R3A A;  4LDG A;  2RFI A;  4IJ8 A;  4NJ5 A;  3CBP A;  5F6K C;  3M54 A;  3M55 A;  4YND A;  5T0M A;  5EG2 A;  3S7F A;  2JV0 A;  3M59 A;  3RAY A;  3M57 A;  3S8P A;  3RJW A;  5JIN A;  3F9Y A;  3OS5 A;  3F9Z A;  2IGQ A;  3VV0 A;  3OOI A;  5ARF A;  2O8J A;  3MO0 A;  4BUP A;  1N6C A;  1N6A A;  5KJN A;  3RU0 A;  4O30 A;  4JLG A;  4J7I A;  4E47 A;  2G46 A;  5TH7 A;  5CPR B;  2QPW A;  3M53 A;  3M58 A;  1MT6 A;  4IJD A;  3KMJ A;  5AYF A;  5KJM A;  1MUF A;  5T5G A;  4Z4P A;  3SWC A;  5F5E A;  3OXG A;  4C1Q A;  3MO5 A;  4O6F A;  4JDS A;  1MVH A;  2W5Z A;  3MEK A;  5F59 A;  5KJK A;  3K5K A;  3DAL A;  1N3J A;  4QEN A;  3M56 A;  3F9W A;  3BO5 A;  2F69 A;  4FMU A;  5CCM A;  4MI0 A;  5EX0 A;  5CCL A;  3TG5 A;  5JJ0 A;  5F6L A;  3QWV A;  3EP0 A;  1MVX A;  3QWP A;  3OPE A;  1XQH A;  4MI5 A;  5LSZ A;  3KMT A;  4YPE A;  3FPD A;  3QWW A;  4I51 A;  3S7B A;  3VUZ A;  4RZ0 A;  3M5A A;  5JHN A;  3SW9 A;  5JIY A;  4YNM A;  5TTF A;  3IHX A;  4AU7 A;  3HNA A;  4WUY A;  3TG4 A;  1ZKK A;  4YPA A;  4YNP A;  4H12 A;  4J83 A;  5T0K A;  1PEG A;  5LSX A;  3N71 A;  3RQ4 A;  5EX3 A;  4QEO A;  3F9X A;  3OXF A;  1ML9 A;  1O9S A;  4J7F A;  3MO2 A;  4YPU A;  5TEG A;  3CBO A;  5HI7 A;  3CBM A;  3OXL A;  4NVQ A;  3RIB A;  4QEP A;  3KMA A;  3PDN A;  4J8O A;  1H3I A;  5KJL A;  2W5Y A;  3S7J A; 
#chains in the Genus database with same CATH topology
 3DB5 A;  5ARG A;  5HQ8 A;  3S7D A;  2BQZ A;  2R3A A;  4LDG A;  2RFI A;  4IJ8 A;  4NJ5 A;  3CBP A;  5F6K C;  3M54 A;  3M55 A;  4YND A;  5T0M A;  5EG2 A;  3S7F A;  2JV0 A;  3M59 A;  3RAY A;  3M57 A;  3S8P A;  3RJW A;  5JIN A;  3F9Y A;  3OS5 A;  3F9Z A;  2IGQ A;  3VV0 A;  3OOI A;  5ARF A;  2O8J A;  3MO0 A;  4BUP A;  1N6C A;  1N6A A;  5KJN A;  3RU0 A;  4O30 A;  4JLG A;  4J7I A;  4E47 A;  2G46 A;  5TH7 A;  5CPR B;  2QPW A;  3M53 A;  3M58 A;  1MT6 A;  4IJD A;  3KMJ A;  5AYF A;  5KJM A;  1MUF A;  5T5G A;  4Z4P A;  3SWC A;  5F5E A;  3OXG A;  4C1Q A;  3MO5 A;  4O6F A;  4JDS A;  1MVH A;  2W5Z A;  3MEK A;  5F59 A;  5KJK A;  3K5K A;  3DAL A;  1N3J A;  4QEN A;  3M56 A;  3F9W A;  3BO5 A;  2F69 A;  4FMU A;  5CCM A;  4MI0 A;  5EX0 A;  5CCL A;  3TG5 A;  5JJ0 A;  5F6L A;  3QWV A;  3EP0 A;  1MVX A;  3QWP A;  3OPE A;  1XQH A;  4MI5 A;  5LSZ A;  3KMT A;  4YPE A;  3FPD A;  3QWW A;  4I51 A;  3S7B A;  3VUZ A;  4RZ0 A;  3M5A A;  5JHN A;  3SW9 A;  5JIY A;  4YNM A;  5TTF A;  3IHX A;  4AU7 A;  3HNA A;  4WUY A;  3TG4 A;  1ZKK A;  4YPA A;  4YNP A;  4H12 A;  4J83 A;  5T0K A;  1PEG A;  5LSX A;  3N71 A;  3RQ4 A;  5EX3 A;  4QEO A;  3F9X A;  3OXF A;  1ML9 A;  1O9S A;  4J7F A;  3MO2 A;  4YPU A;  5TEG A;  3CBO A;  5HI7 A;  3CBM A;  3OXL A;  4NVQ A;  3RIB A;  4QEP A;  3KMA A;  3PDN A;  4J8O A;  1H3I A;  5KJL A;  2W5Y A;  3S7J A; 
#chains in the Genus database with same CATH homology
 3DB5 A;  5ARG A;  5HQ8 A;  3S7D A;  2BQZ A;  2R3A A;  4LDG A;  2RFI A;  4IJ8 A;  4NJ5 A;  3CBP A;  5F6K C;  3M54 A;  3M55 A;  4YND A;  5T0M A;  5EG2 A;  3S7F A;  2JV0 A;  3M59 A;  3RAY A;  3M57 A;  3S8P A;  3RJW A;  5JIN A;  3F9Y A;  3OS5 A;  3F9Z A;  2IGQ A;  3VV0 A;  3OOI A;  5ARF A;  2O8J A;  3MO0 A;  4BUP A;  1N6C A;  1N6A A;  5KJN A;  3RU0 A;  4O30 A;  4JLG A;  4J7I A;  4E47 A;  2G46 A;  5TH7 A;  5CPR B;  2QPW A;  3M53 A;  3M58 A;  1MT6 A;  4IJD A;  3KMJ A;  5AYF A;  5KJM A;  1MUF A;  5T5G A;  4Z4P A;  3SWC A;  5F5E A;  3OXG A;  4C1Q A;  3MO5 A;  4O6F A;  4JDS A;  1MVH A;  2W5Z A;  3MEK A;  5F59 A;  5KJK A;  3K5K A;  3DAL A;  1N3J A;  4QEN A;  3M56 A;  3F9W A;  3BO5 A;  2F69 A;  4FMU A;  5CCM A;  4MI0 A;  5EX0 A;  5CCL A;  3TG5 A;  5JJ0 A;  5F6L A;  3QWV A;  3EP0 A;  1MVX A;  3QWP A;  3OPE A;  1XQH A;  4MI5 A;  5LSZ A;  3KMT A;  4YPE A;  3FPD A;  3QWW A;  4I51 A;  3S7B A;  3VUZ A;  4RZ0 A;  3M5A A;  5JHN A;  3SW9 A;  5JIY A;  4YNM A;  5TTF A;  3IHX A;  4AU7 A;  3HNA A;  4WUY A;  3TG4 A;  1ZKK A;  4YPA A;  4YNP A;  4H12 A;  4J83 A;  5T0K A;  1PEG A;  5LSX A;  3N71 A;  3RQ4 A;  5EX3 A;  4QEO A;  3F9X A;  3OXF A;  1ML9 A;  1O9S A;  4J7F A;  3MO2 A;  4YPU A;  5TEG A;  3CBO A;  5HI7 A;  3CBM A;  3OXL A;  4NVQ A;  3RIB A;  4QEP A;  3KMA A;  3PDN A;  4J8O A;  1H3I A;  5KJL A;  2W5Y A;  3S7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...