3IHXA

Methyltransferase domain of human pr domain-containing protein 10
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
141
structure length
126
Chain Sequence
HPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPLVRGSELKDCYIHLKVLWFELSDETLCNWMMFVRPAQNHLEQNLVAYQYGHHVYYTTIKNVEPKQELKVWYAASYAEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methyltransferase domain of human PR domain-containing protein 10
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PR domain zinc finger protein 10
total genus 24
structure length 126
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ihxA01
4O30A 3KMTA 1ML9A 5KJMA 5KJNA 3RQ4A 4IJDA 3MO2A 1N6CA 5KJKA 3OS5A 3OPEA 4J8OA 3PDNA 3OXLA 2BQZA 3KMJA 2R3AA 3HNAA 4MI0A 3S7FA 3TG5A 2W5ZA 5EX0A 5LSZA 3F9YA 2RFIA 2O8JA 4I51A 3M56A 4YPAA 3M5AA 3OOIA 3S7BA 1O9SA 3F9WA 5TTFA 3S8PA 3IHXA 4J7FA 2JV0A 4JDSA 4H12A 4C1QA 3M55A 3QWPA 3BO5A 3RAYA 3S7DA 3N71A 5F59A 3VV0A 4RZ0A 3SW9A 4J7IA 4FMUA 3VUZA 3SWCA 5LSXA 3F9XA 3MEKA 3S7JA 3CBMA 5F5EA 2QPWA 2F69A 2W5YA 5EX3A 3DB5A 1MT6A 3M58A 5JJ0A 2G46A 4Z4PA 5TH7A 3MO0A 1MUFA 4O6FA 1H3IA 5CCLA 3RU0A 5T5GA 5F6LA 5T0KA 4QEPA 5ARGA 5HQ8A 3KMAA 1N6AA 4YNDA 5EG2A 3RIBA 5JHNA 5HI7A 1MVXA 3RJWA 4YNPA 3MO5A 4BUPA 4YPUA 5AYFA 4MI5A 3M54A 4YPEA 1PEGA 3TG4A 5JINA 3K5KA 3OXGA 4IJ8A 3CBPA 3DALA 3F9ZA 5CCMA 5ARFA 5TEGA 4YNMA 5F6KC 3M59A 2IGQA 3EP0A 3FPDA 3M57A 3QWWA 4E47A 4WUYA 5T0MA 1MVHA 4NVQA 5CPRB 3QWVA 4NJ5A 1XQHA 3CBOA 4J83A 4AU7A 3OXFA 5JIYA 1N3JA 4QEOA 1ZKKA 3M53A 4JLGA 4QENA 5KJLA 4LDGA
chains in the Genus database with same CATH superfamily
4O30A 3KMTA 1ML9A 5KJMA 5KJNA 3RQ4A 4IJDA 3MO2A 1N6CA 5KJKA 3OS5A 3OPEA 4J8OA 3PDNA 3OXLA 2BQZA 3KMJA 2R3AA 3HNAA 4MI0A 3S7FA 3TG5A 2W5ZA 5EX0A 5LSZA 3F9YA 2RFIA 2O8JA 4I51A 3M56A 4YPAA 3M5AA 3OOIA 3S7BA 1O9SA 3F9WA 5TTFA 3S8PA 3IHXA 4J7FA 2JV0A 4JDSA 4H12A 4C1QA 3M55A 3QWPA 3BO5A 3RAYA 3S7DA 3N71A 5F59A 3VV0A 4RZ0A 3SW9A 4J7IA 4FMUA 3VUZA 3SWCA 5LSXA 3F9XA 3MEKA 3S7JA 3CBMA 5F5EA 2QPWA 2F69A 2W5YA 5EX3A 3DB5A 1MT6A 3M58A 5JJ0A 2G46A 4Z4PA 5TH7A 3MO0A 1MUFA 4O6FA 1H3IA 5CCLA 3RU0A 5T5GA 5F6LA 5T0KA 4QEPA 5ARGA 5HQ8A 3KMAA 1N6AA 4YNDA 5EG2A 3RIBA 5JHNA 5HI7A 1MVXA 3RJWA 4YNPA 3MO5A 4BUPA 4YPUA 5AYFA 4MI5A 3M54A 4YPEA 1PEGA 3TG4A 5JINA 3K5KA 3OXGA 4IJ8A 3CBPA 3DALA 3F9ZA 5CCMA 5ARFA 5TEGA 4YNMA 5F6KC 3M59A 2IGQA 3EP0A 3FPDA 3M57A 3QWWA 4E47A 4WUYA 5T0MA 1MVHA 4NVQA 5CPRB 3QWVA 4NJ5A 1XQHA 3CBOA 4J83A 4AU7A 3OXFA 5JIYA 1N3JA 4QEOA 1ZKKA 3M53A 4JLGA 4QENA 5KJLA 4LDGA
chains in the Genus database with same CATH topology
4O30A 3KMTA 1ML9A 5KJMA 5KJNA 3RQ4A 4IJDA 3MO2A 1N6CA 5KJKA 3OS5A 3OPEA 4J8OA 3PDNA 3OXLA 2BQZA 3KMJA 2R3AA 3HNAA 4MI0A 3S7FA 3TG5A 2W5ZA 5EX0A 5LSZA 3F9YA 2RFIA 2O8JA 4I51A 3M56A 4YPAA 3M5AA 3OOIA 3S7BA 1O9SA 3F9WA 5TTFA 3S8PA 3IHXA 4J7FA 2JV0A 4JDSA 4H12A 4C1QA 3M55A 3QWPA 3BO5A 3RAYA 3S7DA 3N71A 5F59A 3VV0A 4RZ0A 3SW9A 4J7IA 4FMUA 3VUZA 3SWCA 5LSXA 3F9XA 3MEKA 3S7JA 3CBMA 5F5EA 2QPWA 2F69A 2W5YA 5EX3A 3DB5A 1MT6A 3M58A 5JJ0A 2G46A 4Z4PA 5TH7A 3MO0A 1MUFA 4O6FA 1H3IA 5CCLA 3RU0A 5T5GA 5F6LA 5T0KA 4QEPA 5ARGA 5HQ8A 3KMAA 1N6AA 4YNDA 5EG2A 3RIBA 5JHNA 5HI7A 1MVXA 3RJWA 4YNPA 3MO5A 4BUPA 4YPUA 5AYFA 4MI5A 3M54A 4YPEA 1PEGA 3TG4A 5JINA 3K5KA 3OXGA 4IJ8A 3CBPA 3DALA 3F9ZA 5CCMA 5ARFA 5TEGA 4YNMA 5F6KC 3M59A 2IGQA 3EP0A 3FPDA 3M57A 3QWWA 4E47A 4WUYA 5T0MA 1MVHA 4NVQA 5CPRB 3QWVA 4NJ5A 1XQHA 3CBOA 4J83A 4AU7A 3OXFA 5JIYA 1N3JA 4QEOA 1ZKKA 3M53A 4JLGA 4QENA 5KJLA 4LDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O30 A;  3KMT A;  1ML9 A;  5KJM A;  5KJN A;  3RQ4 A;  4IJD A;  3MO2 A;  1N6C A;  5KJK A;  3OS5 A;  3OPE A;  4J8O A;  3PDN A;  3OXL A;  2BQZ A;  3KMJ A;  2R3A A;  3HNA A;  4MI0 A;  3S7F A;  3TG5 A;  2W5Z A;  5EX0 A;  5LSZ A;  3F9Y A;  2RFI A;  2O8J A;  4I51 A;  3M56 A;  4YPA A;  3M5A A;  3OOI A;  3S7B A;  1O9S A;  3F9W A;  5TTF A;  3S8P A;  3IHX A;  4J7F A;  2JV0 A;  4JDS A;  4H12 A;  4C1Q A;  3M55 A;  3QWP A;  3BO5 A;  3RAY A;  3S7D A;  3N71 A;  5F59 A;  3VV0 A;  4RZ0 A;  3SW9 A;  4J7I A;  4FMU A;  3VUZ A;  3SWC A;  5LSX A;  3F9X A;  3MEK A;  3S7J A;  3CBM A;  5F5E A;  2QPW A;  2F69 A;  2W5Y A;  5EX3 A;  3DB5 A;  1MT6 A;  3M58 A;  5JJ0 A;  2G46 A;  4Z4P A;  5TH7 A;  3MO0 A;  1MUF A;  4O6F A;  1H3I A;  5CCL A;  3RU0 A;  5T5G A;  5F6L A;  5T0K A;  4QEP A;  5ARG A;  5HQ8 A;  3KMA A;  1N6A A;  4YND A;  5EG2 A;  3RIB A;  5JHN A;  5HI7 A;  1MVX A;  3RJW A;  4YNP A;  3MO5 A;  4BUP A;  4YPU A;  5AYF A;  4MI5 A;  3M54 A;  4YPE A;  1PEG A;  3TG4 A;  5JIN A;  3K5K A;  3OXG A;  4IJ8 A;  3CBP A;  3DAL A;  3F9Z A;  5CCM A;  5ARF A;  5TEG A;  4YNM A;  5F6K C;  3M59 A;  2IGQ A;  3EP0 A;  3FPD A;  3M57 A;  3QWW A;  4E47 A;  4WUY A;  5T0M A;  1MVH A;  4NVQ A;  5CPR B;  3QWV A;  4NJ5 A;  1XQH A;  3CBO A;  4J83 A;  4AU7 A;  3OXF A;  5JIY A;  1N3J A;  4QEO A;  1ZKK A;  3M53 A;  4JLG A;  4QEN A;  5KJL A;  4LDG A; 
#chains in the Genus database with same CATH topology
 4O30 A;  3KMT A;  1ML9 A;  5KJM A;  5KJN A;  3RQ4 A;  4IJD A;  3MO2 A;  1N6C A;  5KJK A;  3OS5 A;  3OPE A;  4J8O A;  3PDN A;  3OXL A;  2BQZ A;  3KMJ A;  2R3A A;  3HNA A;  4MI0 A;  3S7F A;  3TG5 A;  2W5Z A;  5EX0 A;  5LSZ A;  3F9Y A;  2RFI A;  2O8J A;  4I51 A;  3M56 A;  4YPA A;  3M5A A;  3OOI A;  3S7B A;  1O9S A;  3F9W A;  5TTF A;  3S8P A;  3IHX A;  4J7F A;  2JV0 A;  4JDS A;  4H12 A;  4C1Q A;  3M55 A;  3QWP A;  3BO5 A;  3RAY A;  3S7D A;  3N71 A;  5F59 A;  3VV0 A;  4RZ0 A;  3SW9 A;  4J7I A;  4FMU A;  3VUZ A;  3SWC A;  5LSX A;  3F9X A;  3MEK A;  3S7J A;  3CBM A;  5F5E A;  2QPW A;  2F69 A;  2W5Y A;  5EX3 A;  3DB5 A;  1MT6 A;  3M58 A;  5JJ0 A;  2G46 A;  4Z4P A;  5TH7 A;  3MO0 A;  1MUF A;  4O6F A;  1H3I A;  5CCL A;  3RU0 A;  5T5G A;  5F6L A;  5T0K A;  4QEP A;  5ARG A;  5HQ8 A;  3KMA A;  1N6A A;  4YND A;  5EG2 A;  3RIB A;  5JHN A;  5HI7 A;  1MVX A;  3RJW A;  4YNP A;  3MO5 A;  4BUP A;  4YPU A;  5AYF A;  4MI5 A;  3M54 A;  4YPE A;  1PEG A;  3TG4 A;  5JIN A;  3K5K A;  3OXG A;  4IJ8 A;  3CBP A;  3DAL A;  3F9Z A;  5CCM A;  5ARF A;  5TEG A;  4YNM A;  5F6K C;  3M59 A;  2IGQ A;  3EP0 A;  3FPD A;  3M57 A;  3QWW A;  4E47 A;  4WUY A;  5T0M A;  1MVH A;  4NVQ A;  5CPR B;  3QWV A;  4NJ5 A;  1XQH A;  3CBO A;  4J83 A;  4AU7 A;  3OXF A;  5JIY A;  1N3J A;  4QEO A;  1ZKK A;  3M53 A;  4JLG A;  4QEN A;  5KJL A;  4LDG A; 
#chains in the Genus database with same CATH homology
 4O30 A;  3KMT A;  1ML9 A;  5KJM A;  5KJN A;  3RQ4 A;  4IJD A;  3MO2 A;  1N6C A;  5KJK A;  3OS5 A;  3OPE A;  4J8O A;  3PDN A;  3OXL A;  2BQZ A;  3KMJ A;  2R3A A;  3HNA A;  4MI0 A;  3S7F A;  3TG5 A;  2W5Z A;  5EX0 A;  5LSZ A;  3F9Y A;  2RFI A;  2O8J A;  4I51 A;  3M56 A;  4YPA A;  3M5A A;  3OOI A;  3S7B A;  1O9S A;  3F9W A;  5TTF A;  3S8P A;  3IHX A;  4J7F A;  2JV0 A;  4JDS A;  4H12 A;  4C1Q A;  3M55 A;  3QWP A;  3BO5 A;  3RAY A;  3S7D A;  3N71 A;  5F59 A;  3VV0 A;  4RZ0 A;  3SW9 A;  4J7I A;  4FMU A;  3VUZ A;  3SWC A;  5LSX A;  3F9X A;  3MEK A;  3S7J A;  3CBM A;  5F5E A;  2QPW A;  2F69 A;  2W5Y A;  5EX3 A;  3DB5 A;  1MT6 A;  3M58 A;  5JJ0 A;  2G46 A;  4Z4P A;  5TH7 A;  3MO0 A;  1MUF A;  4O6F A;  1H3I A;  5CCL A;  3RU0 A;  5T5G A;  5F6L A;  5T0K A;  4QEP A;  5ARG A;  5HQ8 A;  3KMA A;  1N6A A;  4YND A;  5EG2 A;  3RIB A;  5JHN A;  5HI7 A;  1MVX A;  3RJW A;  4YNP A;  3MO5 A;  4BUP A;  4YPU A;  5AYF A;  4MI5 A;  3M54 A;  4YPE A;  1PEG A;  3TG4 A;  5JIN A;  3K5K A;  3OXG A;  4IJ8 A;  3CBP A;  3DAL A;  3F9Z A;  5CCM A;  5ARF A;  5TEG A;  4YNM A;  5F6K C;  3M59 A;  2IGQ A;  3EP0 A;  3FPD A;  3M57 A;  3QWW A;  4E47 A;  4WUY A;  5T0M A;  1MVH A;  4NVQ A;  5CPR B;  3QWV A;  4NJ5 A;  1XQH A;  3CBO A;  4J83 A;  4AU7 A;  3OXF A;  5JIY A;  1N3J A;  4QEO A;  1ZKK A;  3M53 A;  4JLG A;  4QEN A;  5KJL A;  4LDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...