5ARFA

Smyd2 in complex with small molecule inhibitor compound-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
b'LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5arfA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5arfA01
2I6HA 4BTAA 3OXLA 3ASFA 4AU7A 4YPUA 2Q7FA 2LSVA 4GYOA 4G23A 1ZU2A 2GW1A 3M54A 4UI9K 2NC9A 3ZGQA 4YVQC 5EX3A 1HXIA 1ML9A 2HYZA 2FI7A 1MVHA 3SF4A 2YHCA 2FO7A 4G24A 4F3VA 3FPDA 2F69A 1NA0A 4J0UA 3M59A 3QWPA 5JJ6A 1PC2A 3S7JA 3Q47B 5CPRB 3MV3B 3UPVA 5JJ0A 3CV0A 2XGOA 3M57A 4O30A 1YA0A 1KLXA 5D0QD 3KD7A 3MO5A 5DBKA 1O9SA 5F59A 4HOSA 4MI0A 2BQZA 1IHGA 1N6AA 4N2SA 1NA3A 3RJWA 4A1SA 5FJYA 5AYFA 4XI0A 3LPZA 4N3BA 4KXKB 2BUGA 1WAO1 4RG9A 3M53A 3CVQA 3LY9A 1H3IA 2VYIA 3GZ2A 3ZN3A 2FEZA 3GYZA 4NJ5A 1HH8A 2KCKA 1MUFA 3OOIA 5TTFA 4GZ3A 4YVOA 3ULQA 4JHRA 2PQNA 4KYOB 1B89A 3QDNA 2UWJG 4B94A 3SZ7A 5T0KA 5KJNA 3URZA 4U0UA 3RQ4A 3UUXA 1MVXA 4CGVA 3LCAA 1FCHA 3K9IA 4N3AA 3RKVA 1QZ2A 4J8DA 4ME2A 5T5GA 5FTPA 2XGMA 5G05C 4J8FA 3HYMB 3VUZA 4AY6A 2JV0A 4J83A 5AYWD 3TG5A 5T0MA 4BWRA 3AS4A 4WUYA 4U0ZA 1PEGA 3ASHA 4LEUA 4EQFA 3PDNA 4UQYA 3CEQA 2VQ2A 3LY8A 3ZFWA 3F9WA 3BO5A 1XNFA 5KJKA 4UI9C 2WQHA 4XIFA 3RU0A 4YPEA 4J7IA 3PE3A 5BT1A 5KJLA 3MO2A 4RG6A 4YNMA 4YPAA 3OXGA 2Y4TA 3K5KA 3SWCA 3TAXA 2FF4A 2G46A 4G1TA 1N6CA 5CCLA 5HQ8A 3BEEA 3QWVA 5TH7A 2IFUA 4N39A 4YNPA 2MHKA 4NRHB 4GZ5A 3Q5MA 2C2LA 2PZIA 4I1AA 4H12A 3LY7A 4IJDA 3FFLA 4HOTA 3KMTA 5EKQD 4GA2A 2XEVA 4E47A 2ONDA 2W5YA 3S7FA 4AIFA 2VGXB 2L6JA 5FZRA 5G04J 3TG4A 4Y6WA 3U3WA 1XQHA 5G05J 2P58C 1Y8MA 1MT6A 5EX0A 5A7DB 4IN3B 4I17A 2LNIA 4UQXA 5LCWJ 3EP0A 3CBPA 5CHEE 3Q15A 2VSNA 4WNGA 3O48A 5FT9A 3RAYA 3MA5A 2C0LA 3CBMA 3LKUA 4H7XA 4KBQA 5JIYA 5DIZA 5M72A 2C0MA 4G25A 3ZPJA 3VTYA 5F6KC 4O6FA 3Q49B 4BUPA 3ASDA 5FZQA 1ELWA 3ZHEB 3RO3A 4NQ0A 4AM9A 2RFIA 1ZBPA 3CK7A 5HI7A 3ZHEA 3F9YA 2KATA 2YQ8A 4UQZA 3KAEA 3CVLA 3N71A 2V5FA 4JA9A 3ASGA 3AS8A 4JDSA 3VV0A 4XI9A 3F9XA 3FWVA 1ZKKA 4WNEA 5BNWA 4ABNA 1W3BA 3CK8A 5JHNA 3OXFA 4N3CA 2J9QA 3QOUA 2XCBA 4U0SA 5LSZA 4RZ0A 2IF4A 3CVNA 3CKCA 4U07A 2O8JA 5ARFA 5A6CA 3S8PA 2XGSA 2PQRA 5JJ7A 4QEOA 3S7DA 3FP3A 1HZ4A 2OOEA 5LSXA 4JL0A 1IYGA 3CVPA 4J8EA 2UY1B 3JYSA 3M55A 2DBAA 2R5SA 4BTBA 2UY1A 2XCCA 4GPKA 1ELRA 1KT1A 4WNDA 3RO2A 4I2WA 4APOA 3M56A 5D0OD 1A17A 4J8OA 4HOUA 2Y4UA 3OPEA 1OUVA 1E96B 4H7YA 4IJ8A 2HO1A 1WM5A 3KMJA 4N2QA 3GW4A 3ESKA 4GA0A 3DB5A 4I51A 2HR2A 4MI5A 5F5EA 1KT0A 3U4TA 5C1DA 3RJVA 4BT9A 4G26A 2KC7A 4GA1A 2FBNA 2VGXA 2W5ZA 5EG2A 5TEGA 4I9EA 4GCOA 3DALA 4GYWA 4GZ6A 3MV2B 4CGWA 2LSUA 3HNAA 4BT8A 3M5AA 3IHXA 3SW9A 3GZ1A 5FZSA 3UQ3A 4LDGA 3CK9A 3MO0A 4NVQA 4GYYA 3F9ZA 2JLBA 3WXXA 4U04A 4G2VA 1N3JA 2R3AA 2IGQA 4HOQA 4UI9J 4JLGA 5JINA 3CKBA 3QKYA 3PE4A 4CDRA 5KJMA 5JJTA 1NZNA 3NF1A 2QFCA 2XPIA 3AS5A 2KCLA 3RIBA 2KCVA 3IEGA 2QPWA 1P5QA 3CBOA 2VGYA 4QEPA 4AY5A 3R9AB 2WPVA 3Q4AB 1QQEA 4C1QA 3QWWA 4W9RA 3LYAA 5G04C 3E4BA 5F6LA 3EDTB 3TGOA 3KMAA 2PL2A 5ARGA 5BW8C 2AVPA 4FMUA 4QENA 4I9CA 4J7FA 3VTXA 3KS2A 4YNDA 4Z4PA 5LCWC 4I2ZA 3S7BA 1TJCA 4N5CA 4GCNA 2E2EA 4WNFA 5CCMA 3MEKA 3M58A 2VSYA 4Y6CA 3OS5A 4HORA 3MKRA 4JA7A
chains in the Genus database with same CATH superfamily
2I6HA 3ASFA 2V5QC 4L23A 5ENPD 4YPUA 5FQ8A 2LSVA 3LJNA 3SY2A 3HHMA 3U64A 3UINC 2P9UG 4G23A 3M54A 5LX8A 4IYPA 3V30A 3MCXA 4DI4A 3NOGD 5EX3A 1BI8B 2GROB 4F3VA 3FPDA 4C0MA 1NA0A 5LP0A 4LRZA 3QWPA 3ZW3A 5JJ6A 2Y1LE 2R2LA 3L08A 3Q47B 5CPRB 3MV3B 3M57A 2KXPC 2FULA 4O30A 1YA0A 2XRYA 3D9LA 1U3CA 1O9SA 3LEWA 4CT0A 4MI0A 2BQZA 2P9SG 4WWOA 4CYMD 4GU5A 3ZVVA 3EIJA 3W9GA 1WAO1 4RG9A 4DJAA 3SHFA 1E8ZA 3M53A 1H3IA 5EIBE 4XKBA 2KZTA 3TXMA 3PREA 3VLDA 3I3NA 4HVBA 3PH0C 5KJNA 3L6AA 1S0PA 3TWRA 3TWUA 3UMVA 1ZB1A 3AG4E 3HXDA 4C0EA 1QZ2A 4J8DA 2CHZA 3Q79A 3QJZA 5LFAA 4HS2A 3FTWA 4J83A 5AYWD 3TG5A 2A5UA 1D8DA 2QY7A 3RRNB 3FEYA 1EPUA 4LEUA 4EQFA 3FEXA 1TR4A 4G8LA 2YHEA 5AJLA 2VQ2A 1KZPA 3LY8A 4YDOA 3ZFWA 3BO5A 5JMND 1N52A 2H6FA 4JXTA 4DRXE 3O4ZA 1LTXA 5BT1A 2IY0C 1H19A 3K5KA 3SWCA 3TAXA 4PUCA 2G46A 2FO1E 1N6CA 3RK6A 3RRMB 2RFMA 4FP7A 4HI8A 5EYPF 4N39A 2MHKA 4NRHB 5T8IA 2PZIA 2EIKE 4NIKA 3LY7A 2J08A 2V4HC 2DZOA 2OVBA 1S64A 3FTXA 3FFLA 4AV7A 4TXQA 2IOLA 1RW2A 4YDWA 3T5XA 3UT4A 1E7VA 3E34A 5CBNA 4AIFA 2WXMA 2OVFA 3QAQA 4U7EB 5D2MC 3U3WA 2BF0X 3HXFA 1ELKA 3FTSA 4FJZA 1MT6A 4IULA 4AOFA 1FT1A 3MKQA 3ONLA 2Y69E 1SA4A 3S2AA 2KM4A 3PEUB 2CFZA 3CBPA 3J5QB 1SZAA 5BUZA 3BUAA 5CHEE 4CRWA 3Q15A 3DSVA 3O48A 3CBMA 3FTUA 2WQ7A 5KNGA 1X81A 2IEJA 1A5EA 3TWTA 3CIAA 3DXMG 3ZPJA 2ZU6B 4O6FA 3VLEA 2MRIA 1ELWA 2WXFA 3ZHEB 2IJGX 1K1AA 5BV0A 4OVVA 3TWWA 3SFXA 2V4LA 1SVXA 2CHWA 1S63A 3F9YA 2DCPA 4TUUA 2YQ8A 3N71A 3CVLA 3JXIA 4CEMA 3LJ3A 4B8AA 4JDSA 4JEHA 4FHJA 3F9XA 3FWVA 4F7AA 1IKND 3OXFA 1TNZA 4BX8A 3D9PA 3S8PA 2XGSA 3CHMA 5LSXA 2L9BA 5CEAA 1IYGA 1TN6A 3JYSA 1PAQA 3CVXA 4BTBA 2I1JA 2L0IA 4GPKA 4WNDA 3FU3A 3PUJA 3ZU7B 3UX4A 4EZLA 2LO6A 1IQUA 2VJ8A 5AJDA 1DVPA 1OUVA 2LAIA 4H7YA 3DSUA 4N2QA 2RFAA 3ESKA 1K8KG 4GA0A 4I51A 4MI5A 3DEOA 3Q9UC 1TEZA 3D9JA 3L82A 2WXPA 3APDA 5C1DA 2WXJA 4EBAA 4G26A 4ANWA 4UWKA 2VGXA 2W5ZA 2WXRA 3DALA 2RD0A 2CG3A 3BQOA 4GTOA 4CDNA 4ACKA 1FT2A 4BFRA 3GZ1A 3UQ3A 2ETAA 3MO0A 1JUQA 2XS1A 3F9ZA 2JLBA 4I1MA 4U04A 3ULEG 3LXUX 5JINA 2KZTB 3QKYA 3VLFA 3G2UA 4LSZE 4IRUA 2XPIA 3D9HA 5CEDB 2EILE 3HXCA 2KBXA 4WWNA 3I5PA 4DX6D 4DI3A 3E33A 4K0RA 4L2LA 4XX5A 3L17A 2ZXWE 1UN8A 1H2TC 3KSQA 3FUHA 5BW8C 3OTNA 4J7FA 5AENA 2I1KA 3QARA 4L9PA 3PEVB 4Z4PA 3C3RA 1MHQA 3B7UX 5CMYA 2WVIA 3FUFA 4K5CA 2LXMA 4GCNA 4GTVA 5CCMA 1AP7A 2PNNA 3TXNA 3OXLA 4DUIA 3Q9NC 4RSYA 3U9WA 5J90A 2ZGGA 2WMNA 4GYOA 2V8SE 2WM9A 4XE0A 2P9NG 4ANVA 2GW1A 4UI9K 2NC9A 4J6IA 3ZGQA 4YVQC 3L22A 3B7RL 4UWLA 1N4RA 2DVWA 2YHCA 4Q96A 4HRLA 4J0UA 3PUKA 4GTTA 5JJ0A 4BSZB 4XKCA 1KLXA 4JC8A 2CHXA 3EU5A 4HRMB 4TV3A 4PH4B 4FULA 1NP7A 3D9OA 1E8WA 4UWHA 4N2SA 1NA3A 3RJWA 3CSFA 5AYFA 3LPZA 4N3BA 3CVUA 3MKQB 4KXKB 3LVQE 5ENTD 4DPRA 4X8QA 3FUEA 4I6EA 5T3RA 3LY9A 1O1SA 3GZ2A 2FEZA 3GYZA 2P9IG 4HFGA 4GB9A 1HH8A 3FDHA 4NJ5A 4OAUC 4GZ3A 4YVOA 4JHRA 2PQNA 3SZ7A 2RG8A 5G2NA 3RQ4A 2Y0BG 3UUXA 1K1BA 1MQSA 1MVXA 3LCAA 3C3OA 3EHQA 2XPZA 2XENA 2IQCA 2ETCA 5G05C 2X6JA 4J8FA 2L0TB 4XEIG 2QZAA 5AQ7A 4B93B 3HVEA 1TNYA 3AS4A 2ETBA 3CR3A 3ML9A 4WUYA 3D9KA 1TJFA 4U0ZA 3C98A 1PEGA 1Z3XA 1N94A 5FWQA 4UQYA 2J49A 3MZLB 4A3TA 3F9WA 3FH8A 1OWNA 5KJKA 3T9KA 3Q78A 3I4RB 2J8SD 5KCMA 4QQIA 4J7IA 1OY3D 5KJLA 2I9CA 3MO2A 3FU0A 2XZTG 3D3MA 3OXGA 4CT4A 4JEUA 1OWLA 1LF8A 1OWPA 5FQ4A 1OWMA 4Z68A 2YINA 4FJYA 3FU5A 3JQ0A 2IFUA 4K03A 4MRUA 3Q5MA 2OEWA 5FIOA 3CVWA 2RKKA 4HLLA 3QNKA 3ZNGA 1N9AA 2LAHA 4L1BA 3LVRE 2J09A 3EJNA 2ONDA 1D9SA 5B1BE 2VGXB 3EUVA 2ILRA 4Y6WA 4JVSA 2IOSA 4TXRA 5E76A 5EX0A 4ZFHA 4I17A 2X6KA 4UQXA 2AWIA 1TNBA 3UIPC 5LCWJ 3EP0A 3AJIA 3IKOB 4OAVB 3UM0A 5FT9A 1UJJA 3MA5A 2C0LA 5ENQD 1E8YA 2R05A 2C0MA 5B1AE 3FHEA 3VTYA 4PS7A 3Q49B 5KWDA 3ASDA 4DLOA 3MGBA 4EECA 3ASOE 4XZ4A 2F8XK 3RO3A 4AM9A 4F1PA 1UN9A 2RFIA 4LCTA 5HI7A 3W9FA 4EBAG 1SA5A 4UQZA 3UKRG 2P9PG 5G55A 3ASGA 3AS8A 4FU3A 4XI9A 1PY1A 3C5RA 3CK8A 4N3CA 2XCBA 4U0SA 3CVNA 1LD7A 2QC9A 3CKCA 3E32A 4URKA 4U07A 5ARFA 3DSXA 1L5JA 2IU1A 2PQRA 4YDYA 1MZCA 3S7DA 2OOEA 1N54A 4M3OA 5CRVA 1HG5A 5C2YA 2DBAA 3T8KA 2R5SA 2UY1A 4I2WA 3NBNB 5D0OD 1H0AA 4OYSA 3DPYA 1BPOA 1E96B 4MLPA 4IJ8A 2HO1A 4FLBA 4GAAA 1WM5A 1OWOA 1WY6A 4G8KA 3DB5A 3UM1A 3DSTA 3R7QA 4UWGA 5ENOD 4BT9A 2KC7A 2FBNA 5TEGA 3PVLA 4I9EA 4GZDA 4BX9A 1U3DA 3DSWA 3TWSA 3FTZA 1SZ9A 3PZ1A 4CGWA 4BT8A 2H6GA 3IHXA 4LDGA 3FH7A 3FUDA 2A4ZA 4GYYA 4PS8A 5LOZA 1N3JA 2R3AA 1YYHA 4HOQA 4JLGA 2WXKA 3PE4A 1SW6A 5KJMA 2EQXA 3PZ2A 1INZA 4ILIA 1DNPA 5BXOA 3ZXPA 3PS6A 3QK0A 1N95A 5AN8A 2NXPA 4Q94A 3Q4AB 1QQEA 1E8XA 4W9RA 3LYAA 3UTMA 3CSTA 5E75A 5F6LA 2VGEA 3AU5A 3Q7AA 3UKUG 3KMAA 2PL2A 3FUMA 4QENA 2WXQA 3NQPA 3KS2A 5AARA 5LCWC 4I2ZA 1TJCA 4HQDA 1HFAA 1UOHA 2E2EA 3P2BA 3ZIMA 3QC1A 3ZEFA 2J4DA 3UIOC 1IHBA 3OS5A 3SI5A 4HORA 3MX3A 5AQ9A 1N0RA 4BSXA 5ANLA 1VDYA 2X38A 4C9BB 4GTPA 5ENNA 3FU6A 1HXIA 5CERB 1MVHA 4GMJA 2FO7A 4L2YA 2F69A 4MBGA 3M59A 1PC2A 4AXHA 2DIWA 2VTBA 3ULYA 3S7JA 1KZOA 4ACLA 1Y6IA 4BEPA 2OEVA 3ZYQA 3NZUA 3KD7A 2X6IA 4A63B 1V55E 3MO5A 1JCQA 5AQBA 2B0OE 2R17C 1N6AA 5T4YA 3B13A 4A1SA 1UJKA 1BI7B 5EIDA 5FJYA 5JHAA 3UXGA 4XI0A 5B3SE 2BUGA 4LNBA 4RQIA 1N11A 3JCKC 3CVQA 4EPZA 3V31A 3CVYA 1QYMA 4I43A 4P29A 3ZN3A 4OVUA 2KCKA 2WB2A 1MUFA 1QNFA 3OOIA 3EU9A 1OXJA 2X6FA 3C72A 3ISMC 3FUIA 4KYOB 4B8CB 1NL4A 1IQRA 1RZ4A 2F8YA 2UWJG 4B94A 2BTDA 3HG0D 5T0KA 3B95A 2DYRE 3LDZA 2JABA 4MS6A 4CZ2D 2WXNA 3NOCD 4N3AA 1GW6A 5T5GA 1KPSB 2BKKB 4MKTA 3HYMB 3LS8A 3VUZA 3BG0B 3TWVA 2HE0A 2GRMA 4ANXA 3RSEG 5T0MA 4BWRA 1S70B 4R7LA 1JCSA 4LERA 3U66A 3B7BA 3CEQA 4GMLA 4GMRA 3KSLA 1DCEA 3JUEA 4UUCA 4FC8A 5EYLA 4JHKA 4XIFA 3IBEA 3UI2A 3CHSA 4YPEA 3PE3A 4DX5D 4RG6A 1OCRE 3QB2A 3IHYA 5CCLA 5HQ8A 3MJWA 4ANUA 3BEEA 3QWVA 5TH7A 4E6HA 5CBOA 2VSOE 3E37A 4YNPA 3EHRA 4GZ5A 2ZGDA 2DWZA 3AU4A 3PNLB 1WDYA 4I1AA 4H12A 2QYUA 4ZHBA 5KBAA 2I2OA 2V0PA 4PS3A 5EKQD 2QYJA 3EIQC 4GA2A 3CVVA 3R9MA 4E47A 2WMOA 1OCCE 2LUHA 2XRZA 3S7FA 1MX6A 2L6JA 5FZRA 3DXKG 5G04J 3TG4A 4JHJA 5FINA 1XQHA 2P58C 5HRYA 4TUMA 3D9IA 1FVHA 1D8EA 4L7TA 3HRAA 5A7DB 4IN3B 4WAFA 2XQ0A 5EN5D 2EIME 4BESA 4KZCA 2VSNA 2AXZA 4HRNA 4WNGA 5ENSD 5KNHD 5J08A 1V54E 1YMPA 4QFVA 5JIYA 2XZDG 4G25A 4LNUD 3I4GA 3MYVA 1EYHA 4TRQA 5HS0A 5FZQA 4HLEA 2B6CA 4KVOA 3FUJA 3CHPA 4JZYA 3CGHA 3CK7A 3EHMA 4JW1A 3ZHEA 2KATA 5BPPA 3KAEA 2V5FA 3IV0A 4JA9A 2PM6A 4I6JA 3VV0A 3L13A 3P1UA 1DC2A 1TN8A 4WNEA 5BNWA 4ABNA 3SFYA 2IONA 1N4QA 4ATZD 3DSSA 1UG3A 3JXJA 2WXGA 5LSZA 4RZ0A 1OCZE 2O8JA 2AW6A 5A6CA 4KVMA 4LNGA 2GRPB 1HZ4A 2WXHA 4GTQA 3T8MA 1EF1C 3AAAC 3SBSA 3M55A 2P9LG 3JUIA 4O60A 4LUNU 3M56A 1A17A 3CHQA 4J8OA 4GTMA 4HOUA 2Y4UA 5AAOA 3OPEA 4U96D 1G3NB 4HBDA 1FVFA 2VTBB 3GW4A 2DYSE 3L16A 2HR2A 1FPPA 5F5EA 1KT0A 2IO2C 3ZUVB 4GA1A 5EG2A 3G2TA 4GCOA 4GZ6A 3MV2B 2LSUA 4FADA 1O1TA 2JEKA 2CG2A 5FZSA 4DX7D 3CHRA 3PZ3A 3ZYMA 1O1RA 3SFZA 3WXXA 3NZSA 3C3QA 4G2VA 4EZJA 1HX8A 1MX2A 3FTYA 4UI9J 5ITZF 5FQ6A 3CKBA 2H6HA 3AS5A 4HNAD 2KCLA 1HF8A 3DEPA 2QPWA 3CBOA 2VGYA 4QEPA 4UWFA 3FUNA 3X2QE 2WPVA 1OCOE 4YDEA 4C1QA 4U8VD 4K5AB 3L54A 1MJ0A 3FTVA 3IXEA 5G04C 3AG2E 3SNXA 1WG0A 4I6GA 5ARGA 3G2SA 2AVPA 3V79K 4I9CA 3WG7E 3VTXA 3PZDA 3S7BA 2XHEA 4N5CA 2R03A 4WNFA 4FHKA 1N0QA 3M58A 2VSYA 3MKRA 4JA7A 3BU8A 4BTAA 4LG6A 4AU7A 3FUKA 2GRLA 4FLHA 2GRRB 2P9KG 2Q7FA 2MOWA 2H6IA 2WXIA 1HO8A 1ZU2A 5IY5E 3APCA 1E90A 1Z3YA 3SGHA 1N4PA 1ML9A 2HYZA 2FI7A 3ZKJA 2ZISA 4V3IA 1H2UA 4HXIA 3SF4A 4DK5A 4G24A 3PNTB 3GZSA 1H6PA 3UPVA 3CV0A 2XGOA 4J7WA 1HU3A 5D0QD 4DLQA 1JWFA 1JPLA 5DBKA 3F6QA 5F59A 3AG1E 4HOSA 4DX1A 3HDXA 3ABLE 5EDSA 1IHGA 1Z5SC 4F6RD 5CMWA 3FULA 4GZCA 4ILGA 3SQVA 2AJAA 4B0ZA 5CECB 2YNQA 2J4BA 2VYIA 3NB2A 3TJPA 3ZYKA 1UW4B 3IHVA 3CHOA 5TTFA 3B7SA 5H7PA 4GTRA 3ULQA 2R02A 1B89A 3QDNA 3ZYLA 4Q69A 4U95D 3HXBA 3URZA 4U0UA 5CRUA 4AEZC 3UM3A 3SD5A 4CGVA 4FA6A 1FCHA 3K9IA 3RKVA 3Q75A 4ME2A 3HVEB 4DX2A 5FTPA 2XGMA 4AY6A 2JV0A 3HIZA 3KEAA 4U63A 2XPYA 3Q73A 2E0IA 3ASHA 5JHBA 4I1OB 4D10C 2PM7A 4K5BA 3PDNA 2P2CP 1E7UA 5BV1A 3L9TA 4RVBA 4EHMA 3TL5A 1XNFA 1QBQA 4CDMA 4UI9C 2WQHA 3RU0A 3JQ1A 4A1GA 3TWQA 2EINE 4E85A 1H6KA 2DZNA 4YNMA 1EDUA 2XEHA 3DPDA 4YPAA 3FY4A 3EHNA 2Y4TA 3ML8A 2IO3C 4B89A 2FF4A 4G1TA 3ASNE 2XEEA 3ZRHA 2BEDA 4WWPA 3RRUA 2C2LA 3SO8A 2Y3AA 4N5QA 4IJDA 3J5PA 4BY6A 4O1OA 4HOTA 3KMTA 2BKGA 2R59A 4HI9A 1BD8A 3CQCB 1XGWA 2AXUA 2NSZA 2XEVA 3NAWA 2W5YA 3CQGB 4JD2G 2L6BA 5HKPA 4JPSA 3AG3E 5G05J 1Y8MA 2LXLA 4EZKA 2WQ6A 1BU9A 2M63A 2LNIA 3RAUA 3KEZA 3RAYA 1H2VC 3LKUA 3OAWA 4H7XA 4A55A 4KBQA 5DIZA 5M72A 4RLYA 2OCCE 2HM8A 4M7CA 5F6KC 1Q2ZA 4GTSA 4U8YD 4BUPA 1DCQA 1TYQG 1O5MA 3UT8A 4NQ0A 3D9NA 1X5BA 1HS6A 5D66A 1ZBPA 5AIJA 4O1PA 5A23A 1AWCB 5JA4D 1OT8A 1H6OA 4AVXA 3G2VA 5EILA 4BERA 1ZKKA 2GGFA 3G2WA 1W3BA 1LD8A 1JCRA 5JHNA 4U8HA 2J9QA 3QOUA 1SQMA 4HB5A 4KT6B 4NURA 2IF4A 2NYJA 2X3MA 3ENEA 5JJ7A 4QEOA 4J8SA 1Z6TA 3PRZA 3T5VA 3APFA 3FP3A 4JL0A 1BLXB 2ZIRA 3DRAA 3CVPA 5AQAA 2MYOA 4J8EA 2UY1B 2EIJE 4AJWA 1K3ZD 4CCAA 3ZXSA 3R7RA 4KMOA 4ATGA 3UM2A 2XCCA 4PDXA 1ELRA 1KT1A 1JWGA 3RO2A 4A3VA 4APOA 4ILHB 4AP2A 3TWXA 3DBSA 1U2VG 3KMJA 5BXUA 2A5EA 5ANRA 3ESLA 3U4TA 2J07A 3CLJA 3UT7A 3RJVA 4BETA 3PZ4A 2GRQB 1N4SA 4GPMA 1NI1A 1NFIE 4GYWA 3ONKA 3HNAA 1TN7A 3D9MA 3M5AA 3SW9A 3DWLG 3CK9A 4NVQA 3ABME 1YCSB 3Q7FA 2F37A 2IGQA 1MYOA 1TNOA 1TNUA 4CDRA 3V2OA 5JJTA 1HG2A 1NZNA 3NF1A 2QFCA 4NACA 3B7TA 3RIBA 2KCVA 2WXOA 5ENRD 3IEGA 1P5QA 2AXVA 1HE8A 2X6HA 4KZ0A 4TXPA 4AY5A 3R9AB 2VSXE 3QWWA 4APFA 3V2XA 3E4BA 3ABKE 5FQ7A 3EDTB 2OV8A 3E30A 3HXEA 3TGOA 2XS8A 4FMUA 4J8YA 4F53A 3FH5A 3BG1B 4YNDA 1MX4A 2F0YA 2WXLA 2CFUA 2GRNB 4C48B 3SBTB 3MEKA 4G11A 1IXVA 4JB8P 4Y6CA 4F1SA
chains in the Genus database with same CATH topology
2I6HA 3MX3A 4BTAA 3OXLA 3ASFA 4AU7A 4RSYA 3FUKA 2GRLA 4L23A 4FLHA 3FPDA 3U9WA 4BSXA 5J90A 4YPUA 2WMNA 2Q7FA 5FQ8A 2LSVA 4GYOA 2MOWA 2V8SE 3HHMA 5ANLA 2WM9A 1VDYA 2X38A 4XE0A 3U64A 4C9BB 2WXIA 4G23A 1HO8A 4ANVA 1ZU2A 2GW1A 5LX8A 4UI9K 4IYPA 3M54A 3APCA 2NC9A 4J6IA 3ZGQA 3MCXA 5ENNA 1E90A 4YVQC 4DI4A 1Z3YA 3SGHA 5EX3A 3FU6A 3L22A 1HXIA 1ML9A 2HYZA 2FI7A 1MVHA 3B7RL 4GMJA 4UWLA 4V3IA 1H2UA 4HXIA 3SF4A 2YHCA 4DK5A 2FO7A 4Q96A 4G24A 4L2YA 4F3VA 4C0MA 1NA0A 3PNTB 4J0UA 4LRZA 5LP0A 3QWPA 3ZW3A 2F69A 3M59A 5JJ6A 1PC2A 4AXHA 3GZSA 3PUKA 2DIWA 2VTBA 3L08A 3Q47B 3S7JA 5CPRB 3MV3B 4ACLA 3UPVA 5JJ0A 1Y6IA 3CV0A 2XGOA 3M57A 2FULA 4O30A 3ZYQA 3NZUA 1YA0A 1HU3A 1KLXA 2XRYA 4XKCA 5D0QD 1JWFA 3D9LA 4JC8A 2CHXA 3KD7A 4DLQA 2X6IA 1U3CA 1JPLA 3MO5A 4TV3A 5DBKA 4PH4B 1O9SA 4FULA 1NP7A 5F59A 3LEWA 4HOSA 4CT0A 4MI0A 2BQZA 3D9OA 3HDXA 4WWOA 2R17C 5EDSA 1IHGA 1E8WA 1N6AA 4UWHA 4N2SA 5T4YA 1NA3A 3RJWA 3B13A 4A1SA 4GU5A 1UJKA 5FJYA 3EIJA 3ZVVA 5JHAA 3CSFA 5CMWA 5AYFA 4XI0A 3LPZA 4N3BA 3CVUA 3FULA 3MKQB 4GZCA 4KXKB 2BUGA 3LVQE 4ILGA 4DPRA 1WAO1 4RG9A 4DJAA 4B0ZA 3FUEA 4I6EA 3SHFA 1E8ZA 3JCKC 5T3RA 3M53A 2YNQA 2J4BA 3CVQA 3LY9A 1H3IA 2VYIA 4EPZA 3GZ2A 3TJPA 4I43A 4P29A 3ZN3A 3ZYKA 3CVYA 2FEZA 3GYZA 4HFGA 4GB9A 1HH8A 3FDHA 4OVUA 4NJ5A 2KCKA 1UW4B 2WB2A 4XKBA 3IHVA 1MUFA 2KZTA 3CHOA 1QNFA 3OOIA 5TTFA 3TXMA 3B7SA 4GZ3A 4YVOA 3PREA 3VLDA 3ULQA 4JHRA 3I3NA 2PQNA 2X6FA 4KYOB 4HVBA 3FUIA 4B8CB 1B89A 1IQRA 3PH0C 3QDNA 3ZYLA 2UWJG 4B94A 3SZ7A 4Q69A 2BTDA 2RG8A 5T0KA 5G2NA 5KJNA 3L6AA 3URZA 1S0PA 4U0UA 4AEZC 3RQ4A 3UUXA 3LDZA 3SD5A 1MQSA 4CGVA 4MS6A 1MVXA 3LCAA 4FA6A 1FCHA 3UMVA 2WXNA 4C0EA 3K9IA 2XPZA 4N3AA 3RKVA 1QZ2A 4J8DA 4ME2A 3HVEB 1GW6A 2CHZA 2IQCA 5FTPA 2XGMA 5T5GA 5G05C 4MKTA 2X6JA 4J8FA 3HYMB 3LS8A 3QJZA 4AY6A 3VUZA 5LFAA 3BG0B 4HS2A 2L0TB 3FTWA 2GRMA 3HIZA 4ANXA 2JV0A 4J83A 4U63A 5AYWD 3TG5A 5T0MA 2XPYA 3HVEA 4BWRA 2A5UA 3AS4A 3CR3A 3ML9A 4WUYA 4R7LA 2E0IA 1TJFA 3D9KA 3C98A 2QY7A 4U0ZA 1PEGA 1Z3XA 3RRNB 3ASHA 3FEYA 1EPUA 4LEUA 4LERA 5JHBA 3U66A 4I1OB 4EQFA 4D10C 2PM7A 3PDNA 5FWQA 3FEXA 4UQYA 2J49A 3CEQA 4GMLA 1E7UA 5BV1A 3MZLB 4RVBA 2YHEA 5AJLA 2VQ2A 4A3TA 3LY8A 3ZFWA 3F9WA 3FH8A 3TL5A 1XNFA 3BO5A 1OWNA 5KJKA 4FC8A 1N52A 4CDMA 4UI9C 2WQHA 4JHKA 4XIFA 3IBEA 3RU0A 3I4RB 3JQ1A 4JXTA 5KCMA 4A1GA 3CHSA 4YPEA 3O4ZA 4J7IA 3PE3A 5BT1A 4E85A 5KJLA 2I9CA 3MO2A 1H6KA 3FU0A 4RG6A 4YNMA 1EDUA 3DPDA 4YPAA 3D3MA 3FY4A 1H19A 3EHNA 3OXGA 2Y4TA 3QB2A 3K5KA 3ML8A 3SWCA 3TAXA 4CT4A 4JEUA 4B89A 4PUCA 1OWLA 2FF4A 3IHYA 4G1TA 1LF8A 2G46A 1OWPA 5FQ4A 1N6CA 3RK6A 1OWMA 5CCLA 5HQ8A 3MJWA 2YINA 4FJYA 3RRMB 3ZRHA 4ANUA 3BEEA 3QWVA 4FP7A 3FU5A 5TH7A 3JQ0A 4E6HA 2VSOE 2IFUA 4N39A 4K03A 4YNPA 2MHKA 4WWPA 4NRHB 3RRUA 4MRUA 4GZ5A 5T8IA 3Q5MA 2C2LA 2PZIA 3CVWA 3AU4A 2Y3AA 3PNLB 4I1AA 4H12A 3LY7A 3QNKA 4IJDA 2J08A 4BY6A 2OVBA 3FTXA 2LAHA 3FFLA 4AV7A 2I2OA 2V0PA 4PS3A 4HOTA 2IOLA 3KMTA 2R59A 3UT4A 3T5XA 5EKQD 3CQCB 1XGWA 2AXUA 3EIQC 4GA2A 3CVVA 2NSZA 4L1BA 2XEVA 1E7VA 3LVRE 4E47A 2WMOA 2J09A 3EJNA 2ONDA 2W5YA 2XRZA 3S7FA 4AIFA 2VGXB 2WXMA 2L6JA 3CQGB 2ILRA 2OVFA 5FZRA 3QAQA 5G04J 3TG4A 4JHJA 4Y6WA 3U3WA 4JVSA 4JPSA 1XQHA 5G05J 2P58C 1Y8MA 2BF0X 3D9IA 1ELKA 1FVHA 3FTSA 4FJZA 4EZKA 2IOSA 1MT6A 4IULA 5E76A 4L7TA 2WQ6A 5EX0A 5A7DB 4AOFA 4IN3B 2M63A 3MKQA 3ONLA 4I17A 2LNIA 2X6KA 4WAFA 4UQXA 2XQ0A 2AWIA 3S2AA 2KM4A 3PEUB 5LCWJ 3EP0A 2CFZA 3IKOB 3CBPA 5BUZA 1SZAA 5CHEE 3KEZA 4CRWA 3Q15A 2VSNA 2AXZA 4KZCA 4WNGA 3O48A 5FT9A 3RAYA 1UJJA 1H2VC 3MA5A 2C0LA 3CBMA 3FTUA 3LKUA 3OAWA 4H7XA 2WQ7A 1E8YA 4A55A 4KBQA 5J08A 4QFVA 5JIYA 5DIZA 5M72A 3CIAA 2C0MA 4G25A 2HM8A 3FHEA 3ZPJA 3VTYA 5F6KC 2ZU6B 4O6FA 3I4GA 3VLEA 4PS7A 3Q49B 3MYVA 1EYHA 2MRIA 4TRQA 4BUPA 3ASDA 5FZQA 1ELWA 4DLOA 4HLEA 3MGBA 4EECA 2WXFA 4XZ4A 3ZHEB 3UT8A 3RO3A 2IJGX 3FUJA 4KVOA 5BV0A 4NQ0A 3D9NA 3CHPA 4AM9A 1X5BA 4OVVA 4GPKA 1HS6A 1UN9A 2RFIA 2V4LA 4JZYA 1ZBPA 3CGHA 3CK7A 4LCTA 3EHMA 5HI7A 5A23A 5AIJA 2CHWA 4JW1A 3ZHEA 4EBAG 3F9YA 2DCPA 2KATA 4TUUA 5BPPA 2YQ8A 3KAEA 3N71A 3CVLA 4UQZA 2V5FA 3IV0A 4JA9A 4CEMA 5G55A 3LJ3A 3ASGA 2PM6A 3AS8A 4B8AA 4JDSA 4JEHA 4AVXA 3G2VA 4I6JA 3VV0A 4FU3A 3L13A 4FHJA 1PY1A 4XI9A 3FWVA 3F9XA 1ZKKA 3P1UA 4F7AA 2GGFA 3G2WA 4WNEA 5BNWA 4ABNA 2IONA 1W3BA 3CK8A 5JHNA 3OXFA 4N3CA 4U8HA 2J9QA 3QOUA 2XCBA 1UG3A 4U0SA 2WXGA 5LSZA 1SQMA 4RZ0A 4KT6B 4NURA 2IF4A 4BX8A 3CVNA 3CKCA 3D9PA 4URKA 4U07A 2O8JA 2AW6A 2X3MA 5ARFA 5A6CA 3S8PA 4KVMA 1L5JA 2XGSA 2IU1A 2PQRA 3ENEA 5JJ7A 4QEOA 4J8SA 1Z6TA 3PRZA 3T5VA 3S7DA 3APFA 3CHMA 3FP3A 1HZ4A 2WXHA 2OOEA 5LSXA 3T8MA 1EF1C 4JL0A 2L9BA 1IYGA 3CVPA 1N54A 3SBSA 4J8EA 2UY1B 4M3OA 3JYSA 1PAQA 4AJWA 1HG5A 5C2YA 3M55A 2DBAA 2R5SA 3CVXA 4CCAA 3ZXSA 4BTBA 3R7RA 2I1JA 2L0IA 2UY1A 4KMOA 4ATGA 2XCCA 3JUIA 1ELRA 1KT1A 1JWGA 4PDXA 4WNDA 4I2WA 3RO2A 4LUNU 4A3VA 5D0OD 4APOA 1H0AA 3M56A 3FU3A 1A17A 3CHQA 4ILHB 3PUJA 4OYSA 3UX4A 4AP2A 4EZLA 4J8OA 4HOUA 3DBSA 2Y4UA 2LO6A 3OPEA 1IQUA 2VJ8A 1BPOA 5AJDA 1DVPA 1OUVA 1E96B 4MLPA 2LAIA 4H7YA 4IJ8A 2HO1A 4FLBA 4GAAA 1WM5A 3KMJA 1OWOA 1FVFA 2VTBB 1WY6A 4N2QA 3GW4A 5ANRA 3ESKA 3L16A 4GA0A 3DB5A 4I51A 2HR2A 4MI5A 5F5EA 1TEZA 1KT0A 3ESLA 3D9JA 3R7QA 2WXPA 3U4TA 3APDA 2J07A 4UWGA 3CLJA 3UT7A 3RJVA 2WXJA 5C1DA 4EBAA 4BT9A 4G26A 2KC7A 4GA1A 4UWKA 4ANWA 2FBNA 2VGXA 2W5ZA 2WXRA 5EG2A 5TEGA 3G2TA 3PVLA 4GCOA 4I9EA 3DALA 2RD0A 2CG3A 4GZDA 4GYWA 4GZ6A 1U3DA 4BX9A 3ONKA 3FTZA 1SZ9A 3MV2B 4CGWA 2LSUA 4CDNA 3HNAA 4BT8A 4FADA 2JEKA 4ACKA 2CG2A 4BFRA 3D9MA 3M5AA 3IHXA 3SW9A 3GZ1A 5FZSA 3UQ3A 4LDGA 3CK9A 3FH7A 3MO0A 3FUDA 4NVQA 1JUQA 3CHRA 2A4ZA 4GYYA 3ZYMA 2JLBA 4I1MA 3F9ZA 3SFZA 3WXXA 4U04A 3NZSA 4G2VA 4PS8A 5LOZA 4EZJA 1N3JA 2R3AA 1HX8A 3LXUX 2IGQA 4HOQA 2KZTB 3FTYA 4UI9J 4JLGA 5FQ6A 3CKBA 3QKYA 5JINA 2WXKA 3PE4A 3VLFA 3G2UA 4CDRA 4IRUA 5KJMA 5JJTA 2EQXA 1HG2A 1NZNA 3NF1A 1INZA 2QFCA 2XPIA 3AS5A 4NACA 2KCLA 1HF8A 4ILIA 3B7TA 3RIBA 1DNPA 2KCVA 2WXOA 3IEGA 3PS6A 2QPWA 1P5QA 2AXVA 3CBOA 2VGYA 4WWNA 1HE8A 2X6HA 3QK0A 4QEPA 2NXPA 3I5PA 4KZ0A 4UWFA 4DI3A 4AY5A 3FUNA 3R9AB 2WPVA 2VSXE 4Q94A 3Q4AB 1QQEA 4C1QA 1E8XA 3QWWA 4W9RA 4APFA 3L54A 4K0RA 3LYAA 3CSTA 4L2LA 3FTVA 5G04C 4XX5A 3E4BA 3SNXA 5E75A 5FQ7A 3L17A 5F6LA 1UN8A 3AU5A 1H2TC 3EDTB 2OV8A 3FUHA 3TGOA 4I6GA 3KMAA 2PL2A 5ARGA 3G2SA 2AVPA 5BW8C 4FMUA 3FUMA 3OTNA 4I9CA 4F53A 4J7FA 5AENA 4QENA 2I1KA 2WXQA 3QARA 3VTXA 3PEVB 3NQPA 3FH5A 3BG1B 3KS2A 3PZDA 4YNDA 4Z4PA 5LCWC 1MHQA 2WXLA 3B7UX 2WVIA 4I2ZA 5CMYA 3FUFA 2XHEA 1TJCA 2CFUA 4N5CA 3S7BA 1HFAA 4GCNA 2E2EA 4WNFA 3SBTB 3P2BA 3ZIMA 3QC1A 3ZEFA 5CCMA 2J4DA 4FHKA 3MEKA 4G11A 2VSYA 3M58A 3TXNA 4Y6CA 4F1SA 3SI5A 4HORA 3MKRA 4JA7A 3OS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6H A;  4BTA A;  3OXL A;  3ASF A;  4AU7 A;  4YPU A;  2Q7F A;  2LSV A;  4GYO A;  4G23 A;  1ZU2 A;  2GW1 A;  3M54 A;  4UI9 K;  2NC9 A;  3ZGQ A;  4YVQ C;  5EX3 A;  1HXI A;  1ML9 A;  2HYZ A;  2FI7 A;  1MVH A;  3SF4 A;  2YHC A;  2FO7 A;  4G24 A;  4F3V A;  3FPD A;  2F69 A;  1NA0 A;  4J0U A;  3M59 A;  3QWP A;  5JJ6 A;  1PC2 A;  3S7J A;  3Q47 B;  5CPR B;  3MV3 B;  3UPV A;  5JJ0 A;  3CV0 A;  2XGO A;  3M57 A;  4O30 A;  1YA0 A;  1KLX A;  5D0Q D;  3KD7 A;  3MO5 A;  5DBK A;  1O9S A;  5F59 A;  4HOS A;  4MI0 A;  2BQZ A;  1IHG A;  1N6A A;  4N2S A;  1NA3 A;  3RJW A;  4A1S A;  5FJY A;  5AYF A;  4XI0 A;  3LPZ A;  4N3B A;  4KXK B;  2BUG A;  1WAO 1;  4RG9 A;  3M53 A;  3CVQ A;  3LY9 A;  1H3I A;  2VYI A;  3GZ2 A;  3ZN3 A;  2FEZ A;  3GYZ A;  4NJ5 A;  1HH8 A;  2KCK A;  1MUF A;  3OOI A;  5TTF A;  4GZ3 A;  4YVO A;  3ULQ A;  4JHR A;  2PQN A;  4KYO B;  1B89 A;  3QDN A;  2UWJ G;  4B94 A;  3SZ7 A;  5T0K A;  5KJN A;  3URZ A;  4U0U A;  3RQ4 A;  3UUX A;  1MVX A;  4CGV A;  3LCA A;  1FCH A;  3K9I A;  4N3A A;  3RKV A;  1QZ2 A;  4J8D A;  4ME2 A;  5T5G A;  5FTP A;  2XGM A;  5G05 C;  4J8F A;  3HYM B;  3VUZ A;  4AY6 A;  2JV0 A;  4J83 A;  5AYW D;  3TG5 A;  5T0M A;  4BWR A;  3AS4 A;  4WUY A;  4U0Z A;  1PEG A;  3ASH A;  4LEU A;  4EQF A;  3PDN A;  4UQY A;  3CEQ A;  2VQ2 A;  3LY8 A;  3ZFW A;  3F9W A;  3BO5 A;  1XNF A;  5KJK A;  4UI9 C;  2WQH A;  4XIF A;  3RU0 A;  4YPE A;  4J7I A;  3PE3 A;  5BT1 A;  5KJL A;  3MO2 A;  4RG6 A;  4YNM A;  4YPA A;  3OXG A;  2Y4T A;  3K5K A;  3SWC A;  3TAX A;  2FF4 A;  2G46 A;  4G1T A;  1N6C A;  5CCL A;  5HQ8 A;  3BEE A;  3QWV A;  5TH7 A;  2IFU A;  4N39 A;  4YNP A;  2MHK A;  4NRH B;  4GZ5 A;  3Q5M A;  2C2L A;  2PZI A;  4I1A A;  4H12 A;  3LY7 A;  4IJD A;  3FFL A;  4HOT A;  3KMT A;  5EKQ D;  4GA2 A;  2XEV A;  4E47 A;  2OND A;  2W5Y A;  3S7F A;  4AIF A;  2VGX B;  2L6J A;  5FZR A;  5G04 J;  3TG4 A;  4Y6W A;  3U3W A;  1XQH A;  5G05 J;  2P58 C;  1Y8M A;  1MT6 A;  5EX0 A;  5A7D B;  4IN3 B;  4I17 A;  2LNI A;  4UQX A;  5LCW J;  3EP0 A;  3CBP A;  5CHE E;  3Q15 A;  2VSN A;  4WNG A;  3O48 A;  5FT9 A;  3RAY A;  3MA5 A;  2C0L A;  3CBM A;  3LKU A;  4H7X A;  4KBQ A;  5JIY A;  5DIZ A;  5M72 A;  2C0M A;  4G25 A;  3ZPJ A;  3VTY A;  5F6K C;  4O6F A;  3Q49 B;  4BUP A;  3ASD A;  5FZQ A;  1ELW A;  3ZHE B;  3RO3 A;  4NQ0 A;  4AM9 A;  2RFI A;  1ZBP A;  3CK7 A;  5HI7 A;  3ZHE A;  3F9Y A;  2KAT A;  2YQ8 A;  4UQZ A;  3KAE A;  3CVL A;  3N71 A;  2V5F A;  4JA9 A;  3ASG A;  3AS8 A;  4JDS A;  3VV0 A;  4XI9 A;  3F9X A;  3FWV A;  1ZKK A;  4WNE A;  5BNW A;  4ABN A;  1W3B A;  3CK8 A;  5JHN A;  3OXF A;  4N3C A;  2J9Q A;  3QOU A;  2XCB A;  4U0S A;  5LSZ A;  4RZ0 A;  2IF4 A;  3CVN A;  3CKC A;  4U07 A;  2O8J A;  5ARF A;  5A6C A;  3S8P A;  2XGS A;  2PQR A;  5JJ7 A;  4QEO A;  3S7D A;  3FP3 A;  1HZ4 A;  2OOE A;  5LSX A;  4JL0 A;  1IYG A;  3CVP A;  4J8E A;  2UY1 B;  3JYS A;  3M55 A;  2DBA A;  2R5S A;  4BTB A;  2UY1 A;  2XCC A;  4GPK A;  1ELR A;  1KT1 A;  4WND A;  3RO2 A;  4I2W A;  4APO A;  3M56 A;  5D0O D;  1A17 A;  4J8O A;  4HOU A;  2Y4U A;  3OPE A;  1OUV A;  1E96 B;  4H7Y A;  4IJ8 A;  2HO1 A;  1WM5 A;  3KMJ A;  4N2Q A;  3GW4 A;  3ESK A;  4GA0 A;  3DB5 A;  4I51 A;  2HR2 A;  4MI5 A;  5F5E A;  1KT0 A;  3U4T A;  5C1D A;  3RJV A;  4BT9 A;  4G26 A;  2KC7 A;  4GA1 A;  2FBN A;  2VGX A;  2W5Z A;  5EG2 A;  5TEG A;  4I9E A;  4GCO A;  3DAL A;  4GYW A;  4GZ6 A;  3MV2 B;  4CGW A;  2LSU A;  3HNA A;  4BT8 A;  3M5A A;  3IHX A;  3SW9 A;  3GZ1 A;  5FZS A;  3UQ3 A;  4LDG A;  3CK9 A;  3MO0 A;  4NVQ A;  4GYY A;  3F9Z A;  2JLB A;  3WXX A;  4U04 A;  4G2V A;  1N3J A;  2R3A A;  2IGQ A;  4HOQ A;  4UI9 J;  4JLG A;  5JIN A;  3CKB A;  3QKY A;  3PE4 A;  4CDR A;  5KJM A;  5JJT A;  1NZN A;  3NF1 A;  2QFC A;  2XPI A;  3AS5 A;  2KCL A;  3RIB A;  2KCV A;  3IEG A;  2QPW A;  1P5Q A;  3CBO A;  2VGY A;  4QEP A;  4AY5 A;  3R9A B;  2WPV A;  3Q4A B;  1QQE A;  4C1Q A;  3QWW A;  4W9R A;  3LYA A;  5G04 C;  3E4B A;  5F6L A;  3EDT B;  3TGO A;  3KMA A;  2PL2 A;  5ARG A;  5BW8 C;  2AVP A;  4FMU A;  4QEN A;  4I9C A;  4J7F A;  3VTX A;  3KS2 A;  4YND A;  4Z4P A;  5LCW C;  4I2Z A;  3S7B A;  1TJC A;  4N5C A;  4GCN A;  2E2E A;  4WNF A;  5CCM A;  3MEK A;  3M58 A;  2VSY A;  4Y6C A;  3OS5 A;  4HOR A;  3MKR A;  4JA7 A; 
#chains in the Genus database with same CATH topology
 2I6H A;  3ASF A;  2V5Q C;  4L23 A;  5ENP D;  4YPU A;  5FQ8 A;  2LSV A;  3LJN A;  3SY2 A;  3HHM A;  3U64 A;  3UIN C;  2P9U G;  4G23 A;  3M54 A;  5LX8 A;  4IYP A;  3V30 A;  3MCX A;  4DI4 A;  3NOG D;  5EX3 A;  1BI8 B;  2GRO B;  4F3V A;  3FPD A;  4C0M A;  1NA0 A;  5LP0 A;  4LRZ A;  3QWP A;  3ZW3 A;  5JJ6 A;  2Y1L E;  2R2L A;  3L08 A;  3Q47 B;  5CPR B;  3MV3 B;  3M57 A;  2KXP C;  2FUL A;  4O30 A;  1YA0 A;  2XRY A;  3D9L A;  1U3C A;  1O9S A;  3LEW A;  4CT0 A;  4MI0 A;  2BQZ A;  2P9S G;  4WWO A;  4CYM D;  4GU5 A;  3ZVV A;  3EIJ A;  3W9G A;  1WAO 1;  4RG9 A;  4DJA A;  3SHF A;  1E8Z A;  3M53 A;  1H3I A;  5EIB E;  4XKB A;  2KZT A;  3TXM A;  3PRE A;  3VLD A;  3I3N A;  4HVB A;  3PH0 C;  5KJN A;  3L6A A;  1S0P A;  3TWR A;  3TWU A;  3UMV A;  1ZB1 A;  3AG4 E;  3HXD A;  4C0E A;  1QZ2 A;  4J8D A;  2CHZ A;  3Q79 A;  3QJZ A;  5LFA A;  4HS2 A;  3FTW A;  4J83 A;  5AYW D;  3TG5 A;  2A5U A;  1D8D A;  2QY7 A;  3RRN B;  3FEY A;  1EPU A;  4LEU A;  4EQF A;  3FEX A;  1TR4 A;  4G8L A;  2YHE A;  5AJL A;  2VQ2 A;  1KZP A;  3LY8 A;  4YDO A;  3ZFW A;  3BO5 A;  5JMN D;  1N52 A;  2H6F A;  4JXT A;  4DRX E;  3O4Z A;  1LTX A;  5BT1 A;  2IY0 C;  1H19 A;  3K5K A;  3SWC A;  3TAX A;  4PUC A;  2G46 A;  2FO1 E;  1N6C A;  3RK6 A;  3RRM B;  2RFM A;  4FP7 A;  4HI8 A;  5EYP F;  4N39 A;  2MHK A;  4NRH B;  5T8I A;  2PZI A;  2EIK E;  4NIK A;  3LY7 A;  2J08 A;  2V4H C;  2DZO A;  2OVB A;  1S64 A;  3FTX A;  3FFL A;  4AV7 A;  4TXQ A;  2IOL A;  1RW2 A;  4YDW A;  3T5X A;  3UT4 A;  1E7V A;  3E34 A;  5CBN A;  4AIF A;  2WXM A;  2OVF A;  3QAQ A;  4U7E B;  5D2M C;  3U3W A;  2BF0 X;  3HXF A;  1ELK A;  3FTS A;  4FJZ A;  1MT6 A;  4IUL A;  4AOF A;  1FT1 A;  3MKQ A;  3ONL A;  2Y69 E;  1SA4 A;  3S2A A;  2KM4 A;  3PEU B;  2CFZ A;  3CBP A;  3J5Q B;  1SZA A;  5BUZ A;  3BUA A;  5CHE E;  4CRW A;  3Q15 A;  3DSV A;  3O48 A;  3CBM A;  3FTU A;  2WQ7 A;  5KNG A;  1X81 A;  2IEJ A;  1A5E A;  3TWT A;  3CIA A;  3DXM G;  3ZPJ A;  2ZU6 B;  4O6F A;  3VLE A;  2MRI A;  1ELW A;  2WXF A;  3ZHE B;  2IJG X;  1K1A A;  5BV0 A;  4OVV A;  3TWW A;  3SFX A;  2V4L A;  1SVX A;  2CHW A;  1S63 A;  3F9Y A;  2DCP A;  4TUU A;  2YQ8 A;  3N71 A;  3CVL A;  3JXI A;  4CEM A;  3LJ3 A;  4B8A A;  4JDS A;  4JEH A;  4FHJ A;  3F9X A;  3FWV A;  4F7A A;  1IKN D;  3OXF A;  1TNZ A;  4BX8 A;  3D9P A;  3S8P A;  2XGS A;  3CHM A;  5LSX A;  2L9B A;  5CEA A;  1IYG A;  1TN6 A;  3JYS A;  1PAQ A;  3CVX A;  4BTB A;  2I1J A;  2L0I A;  4GPK A;  4WND A;  3FU3 A;  3PUJ A;  3ZU7 B;  3UX4 A;  4EZL A;  2LO6 A;  1IQU A;  2VJ8 A;  5AJD A;  1DVP A;  1OUV A;  2LAI A;  4H7Y A;  3DSU A;  4N2Q A;  2RFA A;  3ESK A;  1K8K G;  4GA0 A;  4I51 A;  4MI5 A;  3DEO A;  3Q9U C;  1TEZ A;  3D9J A;  3L82 A;  2WXP A;  3APD A;  5C1D A;  2WXJ A;  4EBA A;  4G26 A;  4ANW A;  4UWK A;  2VGX A;  2W5Z A;  2WXR A;  3DAL A;  2RD0 A;  2CG3 A;  3BQO A;  4GTO A;  4CDN A;  4ACK A;  1FT2 A;  4BFR A;  3GZ1 A;  3UQ3 A;  2ETA A;  3MO0 A;  1JUQ A;  2XS1 A;  3F9Z A;  2JLB A;  4I1M A;  4U04 A;  3ULE G;  3LXU X;  5JIN A;  2KZT B;  3QKY A;  3VLF A;  3G2U A;  4LSZ E;  4IRU A;  2XPI A;  3D9H A;  5CED B;  2EIL E;  3HXC A;  2KBX A;  4WWN A;  3I5P A;  4DX6 D;  4DI3 A;  3E33 A;  4K0R A;  4L2L A;  4XX5 A;  3L17 A;  2ZXW E;  1UN8 A;  1H2T C;  3KSQ A;  3FUH A;  5BW8 C;  3OTN A;  4J7F A;  5AEN A;  2I1K A;  3QAR A;  4L9P A;  3PEV B;  4Z4P A;  3C3R A;  1MHQ A;  3B7U X;  5CMY A;  2WVI A;  3FUF A;  4K5C A;  2LXM A;  4GCN A;  4GTV A;  5CCM A;  1AP7 A;  2PNN A;  3TXN A;  3OXL A;  4DUI A;  3Q9N C;  4RSY A;  3U9W A;  5J90 A;  2ZGG A;  2WMN A;  4GYO A;  2V8S E;  2WM9 A;  4XE0 A;  2P9N G;  4ANV A;  2GW1 A;  4UI9 K;  2NC9 A;  4J6I A;  3ZGQ A;  4YVQ C;  3L22 A;  3B7R L;  4UWL A;  1N4R A;  2DVW A;  2YHC A;  4Q96 A;  4HRL A;  4J0U A;  3PUK A;  4GTT A;  5JJ0 A;  4BSZ B;  4XKC A;  1KLX A;  4JC8 A;  2CHX A;  3EU5 A;  4HRM B;  4TV3 A;  4PH4 B;  4FUL A;  1NP7 A;  3D9O A;  1E8W A;  4UWH A;  4N2S A;  1NA3 A;  3RJW A;  3CSF A;  5AYF A;  3LPZ A;  4N3B A;  3CVU A;  3MKQ B;  4KXK B;  3LVQ E;  5ENT D;  4DPR A;  4X8Q A;  3FUE A;  4I6E A;  5T3R A;  3LY9 A;  1O1S A;  3GZ2 A;  2FEZ A;  3GYZ A;  2P9I G;  4HFG A;  4GB9 A;  1HH8 A;  3FDH A;  4NJ5 A;  4OAU C;  4GZ3 A;  4YVO A;  4JHR A;  2PQN A;  3SZ7 A;  2RG8 A;  5G2N A;  3RQ4 A;  2Y0B G;  3UUX A;  1K1B A;  1MQS A;  1MVX A;  3LCA A;  3C3O A;  3EHQ A;  2XPZ A;  2XEN A;  2IQC A;  2ETC A;  5G05 C;  2X6J A;  4J8F A;  2L0T B;  4XEI G;  2QZA A;  5AQ7 A;  4B93 B;  3HVE A;  1TNY A;  3AS4 A;  2ETB A;  3CR3 A;  3ML9 A;  4WUY A;  3D9K A;  1TJF A;  4U0Z A;  3C98 A;  1PEG A;  1Z3X A;  1N94 A;  5FWQ A;  4UQY A;  2J49 A;  3MZL B;  4A3T A;  3F9W A;  3FH8 A;  1OWN A;  5KJK A;  3T9K A;  3Q78 A;  3I4R B;  2J8S D;  5KCM A;  4QQI A;  4J7I A;  1OY3 D;  5KJL A;  2I9C A;  3MO2 A;  3FU0 A;  2XZT G;  3D3M A;  3OXG A;  4CT4 A;  4JEU A;  1OWL A;  1LF8 A;  1OWP A;  5FQ4 A;  1OWM A;  4Z68 A;  2YIN A;  4FJY A;  3FU5 A;  3JQ0 A;  2IFU A;  4K03 A;  4MRU A;  3Q5M A;  2OEW A;  5FIO A;  3CVW A;  2RKK A;  4HLL A;  3QNK A;  3ZNG A;  1N9A A;  2LAH A;  4L1B A;  3LVR E;  2J09 A;  3EJN A;  2OND A;  1D9S A;  5B1B E;  2VGX B;  3EUV A;  2ILR A;  4Y6W A;  4JVS A;  2IOS A;  4TXR A;  5E76 A;  5EX0 A;  4ZFH A;  4I17 A;  2X6K A;  4UQX A;  2AWI A;  1TNB A;  3UIP C;  5LCW J;  3EP0 A;  3AJI A;  3IKO B;  4OAV B;  3UM0 A;  5FT9 A;  1UJJ A;  3MA5 A;  2C0L A;  5ENQ D;  1E8Y A;  2R05 A;  2C0M A;  5B1A E;  3FHE A;  3VTY A;  4PS7 A;  3Q49 B;  5KWD A;  3ASD A;  4DLO A;  3MGB A;  4EEC A;  3ASO E;  4XZ4 A;  2F8X K;  3RO3 A;  4AM9 A;  4F1P A;  1UN9 A;  2RFI A;  4LCT A;  5HI7 A;  3W9F A;  4EBA G;  1SA5 A;  4UQZ A;  3UKR G;  2P9P G;  5G55 A;  3ASG A;  3AS8 A;  4FU3 A;  4XI9 A;  1PY1 A;  3C5R A;  3CK8 A;  4N3C A;  2XCB A;  4U0S A;  3CVN A;  1LD7 A;  2QC9 A;  3CKC A;  3E32 A;  4URK A;  4U07 A;  5ARF A;  3DSX A;  1L5J A;  2IU1 A;  2PQR A;  4YDY A;  1MZC A;  3S7D A;  2OOE A;  1N54 A;  4M3O A;  5CRV A;  1HG5 A;  5C2Y A;  2DBA A;  3T8K A;  2R5S A;  2UY1 A;  4I2W A;  3NBN B;  5D0O D;  1H0A A;  4OYS A;  3DPY A;  1BPO A;  1E96 B;  4MLP A;  4IJ8 A;  2HO1 A;  4FLB A;  4GAA A;  1WM5 A;  1OWO A;  1WY6 A;  4G8K A;  3DB5 A;  3UM1 A;  3DST A;  3R7Q A;  4UWG A;  5ENO D;  4BT9 A;  2KC7 A;  2FBN A;  5TEG A;  3PVL A;  4I9E A;  4GZD A;  4BX9 A;  1U3D A;  3DSW A;  3TWS A;  3FTZ A;  1SZ9 A;  3PZ1 A;  4CGW A;  4BT8 A;  2H6G A;  3IHX A;  4LDG A;  3FH7 A;  3FUD A;  2A4Z A;  4GYY A;  4PS8 A;  5LOZ A;  1N3J A;  2R3A A;  1YYH A;  4HOQ A;  4JLG A;  2WXK A;  3PE4 A;  1SW6 A;  5KJM A;  2EQX A;  3PZ2 A;  1INZ A;  4ILI A;  1DNP A;  5BXO A;  3ZXP A;  3PS6 A;  3QK0 A;  1N95 A;  5AN8 A;  2NXP A;  4Q94 A;  3Q4A B;  1QQE A;  1E8X A;  4W9R A;  3LYA A;  3UTM A;  3CST A;  5E75 A;  5F6L A;  2VGE A;  3AU5 A;  3Q7A A;  3UKU G;  3KMA A;  2PL2 A;  3FUM A;  4QEN A;  2WXQ A;  3NQP A;  3KS2 A;  5AAR A;  5LCW C;  4I2Z A;  1TJC A;  4HQD A;  1HFA A;  1UOH A;  2E2E A;  3P2B A;  3ZIM A;  3QC1 A;  3ZEF A;  2J4D A;  3UIO C;  1IHB A;  3OS5 A;  3SI5 A;  4HOR A;  3MX3 A;  5AQ9 A;  1N0R A;  4BSX A;  5ANL A;  1VDY A;  2X38 A;  4C9B B;  4GTP A;  5ENN A;  3FU6 A;  1HXI A;  5CER B;  1MVH A;  4GMJ A;  2FO7 A;  4L2Y A;  2F69 A;  4MBG A;  3M59 A;  1PC2 A;  4AXH A;  2DIW A;  2VTB A;  3ULY A;  3S7J A;  1KZO A;  4ACL A;  1Y6I A;  4BEP A;  2OEV A;  3ZYQ A;  3NZU A;  3KD7 A;  2X6I A;  4A63 B;  1V55 E;  3MO5 A;  1JCQ A;  5AQB A;  2B0O E;  2R17 C;  1N6A A;  5T4Y A;  3B13 A;  4A1S A;  1UJK A;  1BI7 B;  5EID A;  5FJY A;  5JHA A;  3UXG A;  4XI0 A;  5B3S E;  2BUG A;  4LNB A;  4RQI A;  1N11 A;  3JCK C;  3CVQ A;  4EPZ A;  3V31 A;  3CVY A;  1QYM A;  4I43 A;  4P29 A;  3ZN3 A;  4OVU A;  2KCK A;  2WB2 A;  1MUF A;  1QNF A;  3OOI A;  3EU9 A;  1OXJ A;  2X6F A;  3C72 A;  3ISM C;  3FUI A;  4KYO B;  4B8C B;  1NL4 A;  1IQR A;  1RZ4 A;  2F8Y A;  2UWJ G;  4B94 A;  2BTD A;  3HG0 D;  5T0K A;  3B95 A;  2DYR E;  3LDZ A;  2JAB A;  4MS6 A;  4CZ2 D;  2WXN A;  3NOC D;  4N3A A;  1GW6 A;  5T5G A;  1KPS B;  2BKK B;  4MKT A;  3HYM B;  3LS8 A;  3VUZ A;  3BG0 B;  3TWV A;  2HE0 A;  2GRM A;  4ANX A;  3RSE G;  5T0M A;  4BWR A;  1S70 B;  4R7L A;  1JCS A;  4LER A;  3U66 A;  3B7B A;  3CEQ A;  4GML A;  4GMR A;  3KSL A;  1DCE A;  3JUE A;  4UUC A;  4FC8 A;  5EYL A;  4JHK A;  4XIF A;  3IBE A;  3UI2 A;  3CHS A;  4YPE A;  3PE3 A;  4DX5 D;  4RG6 A;  1OCR E;  3QB2 A;  3IHY A;  5CCL A;  5HQ8 A;  3MJW A;  4ANU A;  3BEE A;  3QWV A;  5TH7 A;  4E6H A;  5CBO A;  2VSO E;  3E37 A;  4YNP A;  3EHR A;  4GZ5 A;  2ZGD A;  2DWZ A;  3AU4 A;  3PNL B;  1WDY A;  4I1A A;  4H12 A;  2QYU A;  4ZHB A;  5KBA A;  2I2O A;  2V0P A;  4PS3 A;  5EKQ D;  2QYJ A;  3EIQ C;  4GA2 A;  3CVV A;  3R9M A;  4E47 A;  2WMO A;  1OCC E;  2LUH A;  2XRZ A;  3S7F A;  1MX6 A;  2L6J A;  5FZR A;  3DXK G;  5G04 J;  3TG4 A;  4JHJ A;  5FIN A;  1XQH A;  2P58 C;  5HRY A;  4TUM A;  3D9I A;  1FVH A;  1D8E A;  4L7T A;  3HRA A;  5A7D B;  4IN3 B;  4WAF A;  2XQ0 A;  5EN5 D;  2EIM E;  4BES A;  4KZC A;  2VSN A;  2AXZ A;  4HRN A;  4WNG A;  5ENS D;  5KNH D;  5J08 A;  1V54 E;  1YMP A;  4QFV A;  5JIY A;  2XZD G;  4G25 A;  4LNU D;  3I4G A;  3MYV A;  1EYH A;  4TRQ A;  5HS0 A;  5FZQ A;  4HLE A;  2B6C A;  4KVO A;  3FUJ A;  3CHP A;  4JZY A;  3CGH A;  3CK7 A;  3EHM A;  4JW1 A;  3ZHE A;  2KAT A;  5BPP A;  3KAE A;  2V5F A;  3IV0 A;  4JA9 A;  2PM6 A;  4I6J A;  3VV0 A;  3L13 A;  3P1U A;  1DC2 A;  1TN8 A;  4WNE A;  5BNW A;  4ABN A;  3SFY A;  2ION A;  1N4Q A;  4ATZ D;  3DSS A;  1UG3 A;  3JXJ A;  2WXG A;  5LSZ A;  4RZ0 A;  1OCZ E;  2O8J A;  2AW6 A;  5A6C A;  4KVM A;  4LNG A;  2GRP B;  1HZ4 A;  2WXH A;  4GTQ A;  3T8M A;  1EF1 C;  3AAA C;  3SBS A;  3M55 A;  2P9L G;  3JUI A;  4O60 A;  4LUN U;  3M56 A;  1A17 A;  3CHQ A;  4J8O A;  4GTM A;  4HOU A;  2Y4U A;  5AAO A;  3OPE A;  4U96 D;  1G3N B;  4HBD A;  1FVF A;  2VTB B;  3GW4 A;  2DYS E;  3L16 A;  2HR2 A;  1FPP A;  5F5E A;  1KT0 A;  2IO2 C;  3ZUV B;  4GA1 A;  5EG2 A;  3G2T A;  4GCO A;  4GZ6 A;  3MV2 B;  2LSU A;  4FAD A;  1O1T A;  2JEK A;  2CG2 A;  5FZS A;  4DX7 D;  3CHR A;  3PZ3 A;  3ZYM A;  1O1R A;  3SFZ A;  3WXX A;  3NZS A;  3C3Q A;  4G2V A;  4EZJ A;  1HX8 A;  1MX2 A;  3FTY A;  4UI9 J;  5ITZ F;  5FQ6 A;  3CKB A;  2H6H A;  3AS5 A;  4HNA D;  2KCL A;  1HF8 A;  3DEP A;  2QPW A;  3CBO A;  2VGY A;  4QEP A;  4UWF A;  3FUN A;  3X2Q E;  2WPV A;  1OCO E;  4YDE A;  4C1Q A;  4U8V D;  4K5A B;  3L54 A;  1MJ0 A;  3FTV A;  3IXE A;  5G04 C;  3AG2 E;  3SNX A;  1WG0 A;  4I6G A;  5ARG A;  3G2S A;  2AVP A;  3V79 K;  4I9C A;  3WG7 E;  3VTX A;  3PZD A;  3S7B A;  2XHE A;  4N5C A;  2R03 A;  4WNF A;  4FHK A;  1N0Q A;  3M58 A;  2VSY A;  3MKR A;  4JA7 A;  3BU8 A;  4BTA A;  4LG6 A;  4AU7 A;  3FUK A;  2GRL A;  4FLH A;  2GRR B;  2P9K G;  2Q7F A;  2MOW A;  2H6I A;  2WXI A;  1HO8 A;  1ZU2 A;  5IY5 E;  3APC A;  1E90 A;  1Z3Y A;  3SGH A;  1N4P A;  1ML9 A;  2HYZ A;  2FI7 A;  3ZKJ A;  2ZIS A;  4V3I A;  1H2U A;  4HXI A;  3SF4 A;  4DK5 A;  4G24 A;  3PNT B;  3GZS A;  1H6P A;  3UPV A;  3CV0 A;  2XGO A;  4J7W A;  1HU3 A;  5D0Q D;  4DLQ A;  1JWF A;  1JPL A;  5DBK A;  3F6Q A;  5F59 A;  3AG1 E;  4HOS A;  4DX1 A;  3HDX A;  3ABL E;  5EDS A;  1IHG A;  1Z5S C;  4F6R D;  5CMW A;  3FUL A;  4GZC A;  4ILG A;  3SQV A;  2AJA A;  4B0Z A;  5CEC B;  2YNQ A;  2J4B A;  2VYI A;  3NB2 A;  3TJP A;  3ZYK A;  1UW4 B;  3IHV A;  3CHO A;  5TTF A;  3B7S A;  5H7P A;  4GTR A;  3ULQ A;  2R02 A;  1B89 A;  3QDN A;  3ZYL A;  4Q69 A;  4U95 D;  3HXB A;  3URZ A;  4U0U A;  5CRU A;  4AEZ C;  3UM3 A;  3SD5 A;  4CGV A;  4FA6 A;  1FCH A;  3K9I A;  3RKV A;  3Q75 A;  4ME2 A;  3HVE B;  4DX2 A;  5FTP A;  2XGM A;  4AY6 A;  2JV0 A;  3HIZ A;  3KEA A;  4U63 A;  2XPY A;  3Q73 A;  2E0I A;  3ASH A;  5JHB A;  4I1O B;  4D10 C;  2PM7 A;  4K5B A;  3PDN A;  2P2C P;  1E7U A;  5BV1 A;  3L9T A;  4RVB A;  4EHM A;  3TL5 A;  1XNF A;  1QBQ A;  4CDM A;  4UI9 C;  2WQH A;  3RU0 A;  3JQ1 A;  4A1G A;  3TWQ A;  2EIN E;  4E85 A;  1H6K A;  2DZN A;  4YNM A;  1EDU A;  2XEH A;  3DPD A;  4YPA A;  3FY4 A;  3EHN A;  2Y4T A;  3ML8 A;  2IO3 C;  4B89 A;  2FF4 A;  4G1T A;  3ASN E;  2XEE A;  3ZRH A;  2BED A;  4WWP A;  3RRU A;  2C2L A;  3SO8 A;  2Y3A A;  4N5Q A;  4IJD A;  3J5P A;  4BY6 A;  4O1O A;  4HOT A;  3KMT A;  2BKG A;  2R59 A;  4HI9 A;  1BD8 A;  3CQC B;  1XGW A;  2AXU A;  2NSZ A;  2XEV A;  3NAW A;  2W5Y A;  3CQG B;  4JD2 G;  2L6B A;  5HKP A;  4JPS A;  3AG3 E;  5G05 J;  1Y8M A;  2LXL A;  4EZK A;  2WQ6 A;  1BU9 A;  2M63 A;  2LNI A;  3RAU A;  3KEZ A;  3RAY A;  1H2V C;  3LKU A;  3OAW A;  4H7X A;  4A55 A;  4KBQ A;  5DIZ A;  5M72 A;  4RLY A;  2OCC E;  2HM8 A;  4M7C A;  5F6K C;  1Q2Z A;  4GTS A;  4U8Y D;  4BUP A;  1DCQ A;  1TYQ G;  1O5M A;  3UT8 A;  4NQ0 A;  3D9N A;  1X5B A;  1HS6 A;  5D66 A;  1ZBP A;  5AIJ A;  4O1P A;  5A23 A;  1AWC B;  5JA4 D;  1OT8 A;  1H6O A;  4AVX A;  3G2V A;  5EIL A;  4BER A;  1ZKK A;  2GGF A;  3G2W A;  1W3B A;  1LD8 A;  1JCR A;  5JHN A;  4U8H A;  2J9Q A;  3QOU A;  1SQM A;  4HB5 A;  4KT6 B;  4NUR A;  2IF4 A;  2NYJ A;  2X3M A;  3ENE A;  5JJ7 A;  4QEO A;  4J8S A;  1Z6T A;  3PRZ A;  3T5V A;  3APF A;  3FP3 A;  4JL0 A;  1BLX B;  2ZIR A;  3DRA A;  3CVP A;  5AQA A;  2MYO A;  4J8E A;  2UY1 B;  2EIJ E;  4AJW A;  1K3Z D;  4CCA A;  3ZXS A;  3R7R A;  4KMO A;  4ATG A;  3UM2 A;  2XCC A;  4PDX A;  1ELR A;  1KT1 A;  1JWG A;  3RO2 A;  4A3V A;  4APO A;  4ILH B;  4AP2 A;  3TWX A;  3DBS A;  1U2V G;  3KMJ A;  5BXU A;  2A5E A;  5ANR A;  3ESL A;  3U4T A;  2J07 A;  3CLJ A;  3UT7 A;  3RJV A;  4BET A;  3PZ4 A;  2GRQ B;  1N4S A;  4GPM A;  1NI1 A;  1NFI E;  4GYW A;  3ONK A;  3HNA A;  1TN7 A;  3D9M A;  3M5A A;  3SW9 A;  3DWL G;  3CK9 A;  4NVQ A;  3ABM E;  1YCS B;  3Q7F A;  2F37 A;  2IGQ A;  1MYO A;  1TNO A;  1TNU A;  4CDR A;  3V2O A;  5JJT A;  1HG2 A;  1NZN A;  3NF1 A;  2QFC A;  4NAC A;  3B7T A;  3RIB A;  2KCV A;  2WXO A;  5ENR D;  3IEG A;  1P5Q A;  2AXV A;  1HE8 A;  2X6H A;  4KZ0 A;  4TXP A;  4AY5 A;  3R9A B;  2VSX E;  3QWW A;  4APF A;  3V2X A;  3E4B A;  3ABK E;  5FQ7 A;  3EDT B;  2OV8 A;  3E30 A;  3HXE A;  3TGO A;  2XS8 A;  4FMU A;  4J8Y A;  4F53 A;  3FH5 A;  3BG1 B;  4YND A;  1MX4 A;  2F0Y A;  2WXL A;  2CFU A;  2GRN B;  4C48 B;  3SBT B;  3MEK A;  4G11 A;  1IXV A;  4JB8 P;  4Y6C A;  4F1S A; 
#chains in the Genus database with same CATH homology
 2I6H A;  3MX3 A;  4BTA A;  3OXL A;  3ASF A;  4AU7 A;  4RSY A;  3FUK A;  2GRL A;  4L23 A;  4FLH A;  3FPD A;  3U9W A;  4BSX A;  5J90 A;  4YPU A;  2WMN A;  2Q7F A;  5FQ8 A;  2LSV A;  4GYO A;  2MOW A;  2V8S E;  3HHM A;  5ANL A;  2WM9 A;  1VDY A;  2X38 A;  4XE0 A;  3U64 A;  4C9B B;  2WXI A;  4G23 A;  1HO8 A;  4ANV A;  1ZU2 A;  2GW1 A;  5LX8 A;  4UI9 K;  4IYP A;  3M54 A;  3APC A;  2NC9 A;  4J6I A;  3ZGQ A;  3MCX A;  5ENN A;  1E90 A;  4YVQ C;  4DI4 A;  1Z3Y A;  3SGH A;  5EX3 A;  3FU6 A;  3L22 A;  1HXI A;  1ML9 A;  2HYZ A;  2FI7 A;  1MVH A;  3B7R L;  4GMJ A;  4UWL A;  4V3I A;  1H2U A;  4HXI A;  3SF4 A;  2YHC A;  4DK5 A;  2FO7 A;  4Q96 A;  4G24 A;  4L2Y A;  4F3V A;  4C0M A;  1NA0 A;  3PNT B;  4J0U A;  4LRZ A;  5LP0 A;  3QWP A;  3ZW3 A;  2F69 A;  3M59 A;  5JJ6 A;  1PC2 A;  4AXH A;  3GZS A;  3PUK A;  2DIW A;  2VTB A;  3L08 A;  3Q47 B;  3S7J A;  5CPR B;  3MV3 B;  4ACL A;  3UPV A;  5JJ0 A;  1Y6I A;  3CV0 A;  2XGO A;  3M57 A;  2FUL A;  4O30 A;  3ZYQ A;  3NZU A;  1YA0 A;  1HU3 A;  1KLX A;  2XRY A;  4XKC A;  5D0Q D;  1JWF A;  3D9L A;  4JC8 A;  2CHX A;  3KD7 A;  4DLQ A;  2X6I A;  1U3C A;  1JPL A;  3MO5 A;  4TV3 A;  5DBK A;  4PH4 B;  1O9S A;  4FUL A;  1NP7 A;  5F59 A;  3LEW A;  4HOS A;  4CT0 A;  4MI0 A;  2BQZ A;  3D9O A;  3HDX A;  4WWO A;  2R17 C;  5EDS A;  1IHG A;  1E8W A;  1N6A A;  4UWH A;  4N2S A;  5T4Y A;  1NA3 A;  3RJW A;  3B13 A;  4A1S A;  4GU5 A;  1UJK A;  5FJY A;  3EIJ A;  3ZVV A;  5JHA A;  3CSF A;  5CMW A;  5AYF A;  4XI0 A;  3LPZ A;  4N3B A;  3CVU A;  3FUL A;  3MKQ B;  4GZC A;  4KXK B;  2BUG A;  3LVQ E;  4ILG A;  4DPR A;  1WAO 1;  4RG9 A;  4DJA A;  4B0Z A;  3FUE A;  4I6E A;  3SHF A;  1E8Z A;  3JCK C;  5T3R A;  3M53 A;  2YNQ A;  2J4B A;  3CVQ A;  3LY9 A;  1H3I A;  2VYI A;  4EPZ A;  3GZ2 A;  3TJP A;  4I43 A;  4P29 A;  3ZN3 A;  3ZYK A;  3CVY A;  2FEZ A;  3GYZ A;  4HFG A;  4GB9 A;  1HH8 A;  3FDH A;  4OVU A;  4NJ5 A;  2KCK A;  1UW4 B;  2WB2 A;  4XKB A;  3IHV A;  1MUF A;  2KZT A;  3CHO A;  1QNF A;  3OOI A;  5TTF A;  3TXM A;  3B7S A;  4GZ3 A;  4YVO A;  3PRE A;  3VLD A;  3ULQ A;  4JHR A;  3I3N A;  2PQN A;  2X6F A;  4KYO B;  4HVB A;  3FUI A;  4B8C B;  1B89 A;  1IQR A;  3PH0 C;  3QDN A;  3ZYL A;  2UWJ G;  4B94 A;  3SZ7 A;  4Q69 A;  2BTD A;  2RG8 A;  5T0K A;  5G2N A;  5KJN A;  3L6A A;  3URZ A;  1S0P A;  4U0U A;  4AEZ C;  3RQ4 A;  3UUX A;  3LDZ A;  3SD5 A;  1MQS A;  4CGV A;  4MS6 A;  1MVX A;  3LCA A;  4FA6 A;  1FCH A;  3UMV A;  2WXN A;  4C0E A;  3K9I A;  2XPZ A;  4N3A A;  3RKV A;  1QZ2 A;  4J8D A;  4ME2 A;  3HVE B;  1GW6 A;  2CHZ A;  2IQC A;  5FTP A;  2XGM A;  5T5G A;  5G05 C;  4MKT A;  2X6J A;  4J8F A;  3HYM B;  3LS8 A;  3QJZ A;  4AY6 A;  3VUZ A;  5LFA A;  3BG0 B;  4HS2 A;  2L0T B;  3FTW A;  2GRM A;  3HIZ A;  4ANX A;  2JV0 A;  4J83 A;  4U63 A;  5AYW D;  3TG5 A;  5T0M A;  2XPY A;  3HVE A;  4BWR A;  2A5U A;  3AS4 A;  3CR3 A;  3ML9 A;  4WUY A;  4R7L A;  2E0I A;  1TJF A;  3D9K A;  3C98 A;  2QY7 A;  4U0Z A;  1PEG A;  1Z3X A;  3RRN B;  3ASH A;  3FEY A;  1EPU A;  4LEU A;  4LER A;  5JHB A;  3U66 A;  4I1O B;  4EQF A;  4D10 C;  2PM7 A;  3PDN A;  5FWQ A;  3FEX A;  4UQY A;  2J49 A;  3CEQ A;  4GML A;  1E7U A;  5BV1 A;  3MZL B;  4RVB A;  2YHE A;  5AJL A;  2VQ2 A;  4A3T A;  3LY8 A;  3ZFW A;  3F9W A;  3FH8 A;  3TL5 A;  1XNF A;  3BO5 A;  1OWN A;  5KJK A;  4FC8 A;  1N52 A;  4CDM A;  4UI9 C;  2WQH A;  4JHK A;  4XIF A;  3IBE A;  3RU0 A;  3I4R B;  3JQ1 A;  4JXT A;  5KCM A;  4A1G A;  3CHS A;  4YPE A;  3O4Z A;  4J7I A;  3PE3 A;  5BT1 A;  4E85 A;  5KJL A;  2I9C A;  3MO2 A;  1H6K A;  3FU0 A;  4RG6 A;  4YNM A;  1EDU A;  3DPD A;  4YPA A;  3D3M A;  3FY4 A;  1H19 A;  3EHN A;  3OXG A;  2Y4T A;  3QB2 A;  3K5K A;  3ML8 A;  3SWC A;  3TAX A;  4CT4 A;  4JEU A;  4B89 A;  4PUC A;  1OWL A;  2FF4 A;  3IHY A;  4G1T A;  1LF8 A;  2G46 A;  1OWP A;  5FQ4 A;  1N6C A;  3RK6 A;  1OWM A;  5CCL A;  5HQ8 A;  3MJW A;  2YIN A;  4FJY A;  3RRM B;  3ZRH A;  4ANU A;  3BEE A;  3QWV A;  4FP7 A;  3FU5 A;  5TH7 A;  3JQ0 A;  4E6H A;  2VSO E;  2IFU A;  4N39 A;  4K03 A;  4YNP A;  2MHK A;  4WWP A;  4NRH B;  3RRU A;  4MRU A;  4GZ5 A;  5T8I A;  3Q5M A;  2C2L A;  2PZI A;  3CVW A;  3AU4 A;  2Y3A A;  3PNL B;  4I1A A;  4H12 A;  3LY7 A;  3QNK A;  4IJD A;  2J08 A;  4BY6 A;  2OVB A;  3FTX A;  2LAH A;  3FFL A;  4AV7 A;  2I2O A;  2V0P A;  4PS3 A;  4HOT A;  2IOL A;  3KMT A;  2R59 A;  3UT4 A;  3T5X A;  5EKQ D;  3CQC B;  1XGW A;  2AXU A;  3EIQ C;  4GA2 A;  3CVV A;  2NSZ A;  4L1B A;  2XEV A;  1E7V A;  3LVR E;  4E47 A;  2WMO A;  2J09 A;  3EJN A;  2OND A;  2W5Y A;  2XRZ A;  3S7F A;  4AIF A;  2VGX B;  2WXM A;  2L6J A;  3CQG B;  2ILR A;  2OVF A;  5FZR A;  3QAQ A;  5G04 J;  3TG4 A;  4JHJ A;  4Y6W A;  3U3W A;  4JVS A;  4JPS A;  1XQH A;  5G05 J;  2P58 C;  1Y8M A;  2BF0 X;  3D9I A;  1ELK A;  1FVH A;  3FTS A;  4FJZ A;  4EZK A;  2IOS A;  1MT6 A;  4IUL A;  5E76 A;  4L7T A;  2WQ6 A;  5EX0 A;  5A7D B;  4AOF A;  4IN3 B;  2M63 A;  3MKQ A;  3ONL A;  4I17 A;  2LNI A;  2X6K A;  4WAF A;  4UQX A;  2XQ0 A;  2AWI A;  3S2A A;  2KM4 A;  3PEU B;  5LCW J;  3EP0 A;  2CFZ A;  3IKO B;  3CBP A;  5BUZ A;  1SZA A;  5CHE E;  3KEZ A;  4CRW A;  3Q15 A;  2VSN A;  2AXZ A;  4KZC A;  4WNG A;  3O48 A;  5FT9 A;  3RAY A;  1UJJ A;  1H2V C;  3MA5 A;  2C0L A;  3CBM A;  3FTU A;  3LKU A;  3OAW A;  4H7X A;  2WQ7 A;  1E8Y A;  4A55 A;  4KBQ A;  5J08 A;  4QFV A;  5JIY A;  5DIZ A;  5M72 A;  3CIA A;  2C0M A;  4G25 A;  2HM8 A;  3FHE A;  3ZPJ A;  3VTY A;  5F6K C;  2ZU6 B;  4O6F A;  3I4G A;  3VLE A;  4PS7 A;  3Q49 B;  3MYV A;  1EYH A;  2MRI A;  4TRQ A;  4BUP A;  3ASD A;  5FZQ A;  1ELW A;  4DLO A;  4HLE A;  3MGB A;  4EEC A;  2WXF A;  4XZ4 A;  3ZHE B;  3UT8 A;  3RO3 A;  2IJG X;  3FUJ A;  4KVO A;  5BV0 A;  4NQ0 A;  3D9N A;  3CHP A;  4AM9 A;  1X5B A;  4OVV A;  4GPK A;  1HS6 A;  1UN9 A;  2RFI A;  2V4L A;  4JZY A;  1ZBP A;  3CGH A;  3CK7 A;  4LCT A;  3EHM A;  5HI7 A;  5A23 A;  5AIJ A;  2CHW A;  4JW1 A;  3ZHE A;  4EBA G;  3F9Y A;  2DCP A;  2KAT A;  4TUU A;  5BPP A;  2YQ8 A;  3KAE A;  3N71 A;  3CVL A;  4UQZ A;  2V5F A;  3IV0 A;  4JA9 A;  4CEM A;  5G55 A;  3LJ3 A;  3ASG A;  2PM6 A;  3AS8 A;  4B8A A;  4JDS A;  4JEH A;  4AVX A;  3G2V A;  4I6J A;  3VV0 A;  4FU3 A;  3L13 A;  4FHJ A;  1PY1 A;  4XI9 A;  3FWV A;  3F9X A;  1ZKK A;  3P1U A;  4F7A A;  2GGF A;  3G2W A;  4WNE A;  5BNW A;  4ABN A;  2ION A;  1W3B A;  3CK8 A;  5JHN A;  3OXF A;  4N3C A;  4U8H A;  2J9Q A;  3QOU A;  2XCB A;  1UG3 A;  4U0S A;  2WXG A;  5LSZ A;  1SQM A;  4RZ0 A;  4KT6 B;  4NUR A;  2IF4 A;  4BX8 A;  3CVN A;  3CKC A;  3D9P A;  4URK A;  4U07 A;  2O8J A;  2AW6 A;  2X3M A;  5ARF A;  5A6C A;  3S8P A;  4KVM A;  1L5J A;  2XGS A;  2IU1 A;  2PQR A;  3ENE A;  5JJ7 A;  4QEO A;  4J8S A;  1Z6T A;  3PRZ A;  3T5V A;  3S7D A;  3APF A;  3CHM A;  3FP3 A;  1HZ4 A;  2WXH A;  2OOE A;  5LSX A;  3T8M A;  1EF1 C;  4JL0 A;  2L9B A;  1IYG A;  3CVP A;  1N54 A;  3SBS A;  4J8E A;  2UY1 B;  4M3O A;  3JYS A;  1PAQ A;  4AJW A;  1HG5 A;  5C2Y A;  3M55 A;  2DBA A;  2R5S A;  3CVX A;  4CCA A;  3ZXS A;  4BTB A;  3R7R A;  2I1J A;  2L0I A;  2UY1 A;  4KMO A;  4ATG A;  2XCC A;  3JUI A;  1ELR A;  1KT1 A;  1JWG A;  4PDX A;  4WND A;  4I2W A;  3RO2 A;  4LUN U;  4A3V A;  5D0O D;  4APO A;  1H0A A;  3M56 A;  3FU3 A;  1A17 A;  3CHQ A;  4ILH B;  3PUJ A;  4OYS A;  3UX4 A;  4AP2 A;  4EZL A;  4J8O A;  4HOU A;  3DBS A;  2Y4U A;  2LO6 A;  3OPE A;  1IQU A;  2VJ8 A;  1BPO A;  5AJD A;  1DVP A;  1OUV A;  1E96 B;  4MLP A;  2LAI A;  4H7Y A;  4IJ8 A;  2HO1 A;  4FLB A;  4GAA A;  1WM5 A;  3KMJ A;  1OWO A;  1FVF A;  2VTB B;  1WY6 A;  4N2Q A;  3GW4 A;  5ANR A;  3ESK A;  3L16 A;  4GA0 A;  3DB5 A;  4I51 A;  2HR2 A;  4MI5 A;  5F5E A;  1TEZ A;  1KT0 A;  3ESL A;  3D9J A;  3R7Q A;  2WXP A;  3U4T A;  3APD A;  2J07 A;  4UWG A;  3CLJ A;  3UT7 A;  3RJV A;  2WXJ A;  5C1D A;  4EBA A;  4BT9 A;  4G26 A;  2KC7 A;  4GA1 A;  4UWK A;  4ANW A;  2FBN A;  2VGX A;  2W5Z A;  2WXR A;  5EG2 A;  5TEG A;  3G2T A;  3PVL A;  4GCO A;  4I9E A;  3DAL A;  2RD0 A;  2CG3 A;  4GZD A;  4GYW A;  4GZ6 A;  1U3D A;  4BX9 A;  3ONK A;  3FTZ A;  1SZ9 A;  3MV2 B;  4CGW A;  2LSU A;  4CDN A;  3HNA A;  4BT8 A;  4FAD A;  2JEK A;  4ACK A;  2CG2 A;  4BFR A;  3D9M A;  3M5A A;  3IHX A;  3SW9 A;  3GZ1 A;  5FZS A;  3UQ3 A;  4LDG A;  3CK9 A;  3FH7 A;  3MO0 A;  3FUD A;  4NVQ A;  1JUQ A;  3CHR A;  2A4Z A;  4GYY A;  3ZYM A;  2JLB A;  4I1M A;  3F9Z A;  3SFZ A;  3WXX A;  4U04 A;  3NZS A;  4G2V A;  4PS8 A;  5LOZ A;  4EZJ A;  1N3J A;  2R3A A;  1HX8 A;  3LXU X;  2IGQ A;  4HOQ A;  2KZT B;  3FTY A;  4UI9 J;  4JLG A;  5FQ6 A;  3CKB A;  3QKY A;  5JIN A;  2WXK A;  3PE4 A;  3VLF A;  3G2U A;  4CDR A;  4IRU A;  5KJM A;  5JJT A;  2EQX A;  1HG2 A;  1NZN A;  3NF1 A;  1INZ A;  2QFC A;  2XPI A;  3AS5 A;  4NAC A;  2KCL A;  1HF8 A;  4ILI A;  3B7T A;  3RIB A;  1DNP A;  2KCV A;  2WXO A;  3IEG A;  3PS6 A;  2QPW A;  1P5Q A;  2AXV A;  3CBO A;  2VGY A;  4WWN A;  1HE8 A;  2X6H A;  3QK0 A;  4QEP A;  2NXP A;  3I5P A;  4KZ0 A;  4UWF A;  4DI3 A;  4AY5 A;  3FUN A;  3R9A B;  2WPV A;  2VSX E;  4Q94 A;  3Q4A B;  1QQE A;  4C1Q A;  1E8X A;  3QWW A;  4W9R A;  4APF A;  3L54 A;  4K0R A;  3LYA A;  3CST A;  4L2L A;  3FTV A;  5G04 C;  4XX5 A;  3E4B A;  3SNX A;  5E75 A;  5FQ7 A;  3L17 A;  5F6L A;  1UN8 A;  3AU5 A;  1H2T C;  3EDT B;  2OV8 A;  3FUH A;  3TGO A;  4I6G A;  3KMA A;  2PL2 A;  5ARG A;  3G2S A;  2AVP A;  5BW8 C;  4FMU A;  3FUM A;  3OTN A;  4I9C A;  4F53 A;  4J7F A;  5AEN A;  4QEN A;  2I1K A;  2WXQ A;  3QAR A;  3VTX A;  3PEV B;  3NQP A;  3FH5 A;  3BG1 B;  3KS2 A;  3PZD A;  4YND A;  4Z4P A;  5LCW C;  1MHQ A;  2WXL A;  3B7U X;  2WVI A;  4I2Z A;  5CMY A;  3FUF A;  2XHE A;  1TJC A;  2CFU A;  4N5C A;  3S7B A;  1HFA A;  4GCN A;  2E2E A;  4WNF A;  3SBT B;  3P2B A;  3ZIM A;  3QC1 A;  3ZEF A;  5CCM A;  2J4D A;  4FHK A;  3MEK A;  4G11 A;  2VSY A;  3M58 A;  3TXN A;  4Y6C A;  4F1S A;  3SI5 A;  4HOR A;  3MKR A;  4JA7 A;  3OS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...