5ARFA

Smyd2 in complex with small molecule inhibitor compound-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5arfA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5arfA01
5M72A 3KS2A 3GW4A 3CVLA 4H7YA 3VV0A 4G24A 2G46A 3GYZA 1KT0A 2WPVA 5CHEE 4BT9A 1HXIA 4N3BA 2UY1B 5G05C 4WNGA 4C1QA 4UI9C 1ELRA 2L6JA 3OXGA 3HYMB 3FWVA 3E4BA 4UI9K 2YQ8A 4U0SA 4QENA 4XI9A 1MVHA 5BW8C 3Q47B 3Q49B 1IYGA 3S8PA 1NA0A 4U0UA 3UPVA 2DBAA 2GW1A 2QFCA 5T5GA 1N6AA 3RQ4A 4GYYA 4AU7A 3VTXA 5KJMA 5EX3A 5FTPA 2VQ2A 3LPZA 3MV3B 4JA9A 2HR2A 2Q7FA 3UQ3A 4YVOA 2Y4UA 4WNDA 2WQHA 1NA3A 3CVNA 4UI9J 4GYWA 4KBQA 2C0LA 1ZU2A 5CCMA 4HOSA 3KMJA 4JA7A 3SF4A 3ZPJA 5HI7A 3F9WA 5CCLA 1Y8MA 5EX0A 3LY7A 3MO0A 3QDNA 3AS8A 4U0ZA 4FMUA 5T0KA 3IEGA 2VGXA 1QQEA 3PDNA 5JIYA 4G2VA 4RG9A 4GZ3A 4E47A 1ZKKA 4YPUA 5LSZA 3QWPA 4GZ6A 1PEGA 4G25A 5JJTA 5KJKA 3GZ1A 4J8EA 2KATA 4IJDA 1KT1A 4BT8A 4J7IA 3VTYA 2RFIA 3CVQA 3FFLA 3CK9A 4YNMA 4I17A 1O9SA 4MI0A 5F59A 2AVPA 4AIFA 3KAEA 2F69A 1H3IA 2OOEA 5HQ8A 3OXFA 5EG2A 3ZGQA 3ZFWA 3AS4A 3MKRA 4J8FA 4JDSA 2W5ZA 2VGXB 3GZ2A 5FZQA 3TGOA 2KCVA 4GZ5A 4J8OA 4GA2A 5ARFA 3NF1A 3Q4AB 4CDRA 5FT9A 5JHNA 1A17A 3LYAA 2VYIA 2R5SA 4GPKA 3MV2B 1N3JA 4GA0A 3MO2A 2KC7A 3DB5A 2YHCA 4HORA 5CPRB 5DBKA 2UWJG 3TG4A 2J9QA 5T0MA 1YA0A 4WNEA 3HNAA 4J7FA 1WM5A 2ONDA 3S7DA 4U04A 3CV0A 5FJYA 3LY9A 1XQHA 4N2SA 5C1DA 3F9YA 1QZ2A 4MI5A 3ASFA 4N3AA 2PL2A 5FZRA 4G1TA 2LSUA 4BTBA 2VGYA 3MA5A 4JL0A 3CK8A 4GCNA 3OXLA 5A7DB 5F6LA 4RG6A 2PZIA 3M56A 3AS5A 2PQNA 3TAXA 3RU0A 5KJLA 3OS5A 4JHRA 4NRHB 1B89A 4N3CA 4IJ8A 4GA1A 3LY8A 3M54A 3ASDA 3RAYA 4I9CA 4UQXA 5LCWC 4YPAA 5JJ0A 2V5FA 2VSYA 3O48A 5JJ6A 3RO3A 3CK7A 3KD7A 3Q15A 5G05J 1W3BA 4U07A 3MO5A 2FO7A 3EDTB 1P5QA 4J8DA 2KCKA 3BO5A 3JYSA 4BWRA 3ZN3A 4QEOA 4I9EA 2XCBA 3K9IA 2HYZA 5F6KC 3CKBA 3SZ7A 3ESKA 3ZHEA 5KJNA 4H7XA 3SWCA 3S7FA 4GYOA 1TJCA 5LCWJ 4KYOB 3QWWA 4LEUA 4CGVA 3CBMA 2UY1A 3QKYA 3RIBA 4ABNA 4QEPA 3ASHA 5JINA 5G04C 4AM9A 2XGOA 4O6FA 5AYWD 3QWVA 3F9XA 5TTFA 3ULQA 5BNWA 2XCCA 4J83A 3ASGA 2FBNA 2C0MA 2IF4A 2C2LA 3SW9A 1MUFA 3LCAA 2LSVA 2KCLA 5LSXA 1E96B 2JV0A 1HZ4A 3M53A 1KLXA 3CEQA 3S7BA 3CBPA 5EKQD 3LKUA 4O30A 2XGMA 2VSNA 3KMTA 3FP3A 5ARGA 3U4TA 5G04J 4NJ5A 3MEKA 4WUYA 2IGQA 4WNFA 4LDGA 3CKCA 3QOUA 4AY5A 2XPIA 3F9ZA 1ML9A 5D0QD 3CBOA 3N71A 4YNDA 4G23A 2QPWA 4GCOA 4XIFA 4A1SA 3RKVA 4IN3B 4YVQC 4Z4PA 3OOIA 2XGSA 2NC9A 2O8JA 4XI0A 2BQZA 4JLGA 1FCHA 4AY6A 4KXKB 5AYFA 4ME2A 3RO2A 3BEEA 3S7JA 5TH7A 4APOA 4EQFA 4HOTA 3M57A 4N39A 5FZSA 4I1AA 2Y4TA 4YPEA 3ZHEB 3KMAA 5BT1A 3M5AA 2P58C 2XEVA 4HOUA 1ELWA 1NZNA 4J0UA 1IHGA 3UUXA 5D0OD 3M59A 3Q5MA 3PE4A 3M55A 5F5EA 3DALA 2PQRA 4Y6WA 1MT6A 3K5KA 2HO1A 1ZBPA 4B94A 3CVPA 4NVQA 3FPDA 1OUVA 2BUGA 5JJ7A 4BTAA 2FI7A 5TEGA 2I6HA 4BUPA 4RZ0A 2FEZA 5DIZA 3WXXA 4N2QA 4W9RA 4G26A 1WAO1 4NQ0A 2W5YA 4Y6CA 3EP0A 4I51A 4CGWA 3OPEA 3RJVA 4UQZA 3M58A 4H12A 2MHKA 4UQYA 2LNIA 4YNPA 3PE3A 1N6CA 4N5CA 3RJWA 3U3WA 3R9AB 1PC2A 4I2WA 3VUZA 2FF4A 3IHXA 3URZA 1HH8A 5A6CA 4F3VA 2JLBA 2IFUA 4HOQA 3TG5A 1XNFA 1MVXA 2R3AA 4I2ZA 2E2EA
chains in the Genus database with same CATH superfamily
3KS2A 1YCSB 3GW4A 4H7YA 2RKKA 3BQOA 2GRNB 3CR3A 3APDA 3FTUA 3JUIA 4C1QA 3L6AA 3OXGA 1OWMA 3DWLG 2WXOA 3FWVA 3E4BA 3C98A 1GW6A 4J8YA 4U0SA 1OCOE 4DI4A 4EBAA 3FEYA 3Q49B 1IYGA 3MKQB 4U0UA 1H19A 2X38A 3QAQA 3QJZA 5T5GA 3RQ4A 4GYYA 3ZW3A 3VTXA 1RZ4A 2VQ2A 3MV3B 3HXDA 2XHEA 3UM0A 3RAUA 2HR2A 1HF8A 2OEVA 3UQ3A 1N95A 2Y4UA 3CVNA 4K5AB 4MKTA 3NBNB 4KBQA 2OCCE 4RQIA 2CHWA 1N94A 3FHEA 3L13A 5HRYA 5CCLA 1YYHA 3LVQE 1Y8MA 5EX0A 3CVXA 2A5UA 4JXTA 4EBAG 3SFXA 2KM4A 3UKRG 3APCA 5LX8A 3V30A 5KNGA 5CRUA 3TJPA 5BXUA 4GZ6A 1QYMA 4IULA 1X81A 4TUMA 3JQ0A 4G25A 4DLOA 5JJTA 4I6EA 5EYLA 2J4BA 2GRLA 3APFA 4J7IA 4WWOA 3CIAA 4NACA 2YINA 2RFIA 2XZDG 3CVQA 3B7UX 5D66A 1UN9A 4FULA 3FTYA 4I17A 5AJLA 1K1BA 3E30A 1IKND 3PS6A 3Q78A 4MI0A 3HRAA 4J6IA 3FUMA 2F69A 2OOEA 5HQ8A 2IQCA 5EG2A 1UG3A 3ZGQA 1EF1C 2VTBB 4ILHB 4HLLA 1DCQA 1FPPA 3Q75A 1HU3A 2VGXB 5FZQA 3TGOA 4PH4B 4GZ5A 4B8AA 4L23A 3Q4AB 2GRQB 4U63A 2R5SA 4GPKA 5E75A 3VLEA 3TWUA 4BX9A 2KC7A 2V4LA 4HORA 5CPRB 5DBKA 3ONKA 3LXUX 4HRMB 3L17A 3ESLA 3UM3A 1WM5A 2ONDA 3EIQC 2XENA 1UJJA 2P9LG 3CV0A 5FJYA 3LY9A 5C1DA 4MI5A 2QZAA 5AARA 5FZRA 3HXFA 4G1TA 4BERA 3MA5A 4JL0A 2ZXWE 4GCNA 5A7DB 3ZNGA 4RG6A 2CHZA 3PVLA 4GTSA 1DVPA 3IV0A 4JEUA 3CHMA 3LDZA 3DSXA 4DX5D 3GZSA 1MX4A 3LY8A 4GA1A 3RAYA 1PAQA 1OCZE 1BI7B 4UQXA 4JW1A 4YPAA 2H6HA 4L2YA 2H6FA 3L82A 5G05J 4ANUA 3FH8A 1D8DA 2BKKB 3KEAA 4HQDA 4FHKA 2KCKA 1L5JA 3JUEA 1TJFA 4I9EA 2XCBA 2HYZA 3LJNA 3TXMA 1EYHA 3UXGA 3SWCA 4GMJA 3CHQA 1TN6A 2RG8A 4GYOA 2LO6A 2CG2A 4XZ4A 2V0PA 4QQIA 3JXIA 3PZ1A 4G8LA 2JABA 3FH7A 3B7SA 2I1JA 4FJZA 3CHRA 3ZRHA 3ULQA 3EU5A 5BNWA 2QY7A 3OAWA 3BU8A 2MYOA 3ASGA 2C0MA 2IF4A 2LSVA 4FLHA 2WQ6A 5LSXA 1Z6TA 1O1TA 1DC2A 3FU0A 3M53A 1KLXA 3CEQA 4U8HA 2XEEA 3S7BA 3CBPA 4DX2A 4O30A 3Q73A 3FP3A 2ETCA 3NOCD 4NJ5A 1HO8A 1D8EA 3V2OA 3SFYA 3QOUA 4I6GA 2XPIA 4FJYA 1ML9A 3CBOA 2IY0C 4G23A 2QPWA 3FTWA 4YVQC 4Z4PA 3CVUA 3PNLB 2NC9A 2WXQA 2AXZA 1MZCA 4AY6A 3RO2A 3BEEA 3OTNA 3S7JA 5TH7A 2WVIA 4HOTA 3ASNE 2Y4TA 3ZHEB 2P58C 4HRLA 2OVBA 2J49A 1ELWA 3MJWA 3UUXA 4PS8A 3B7TA 1E8XA 4X8QA 3K5KA 4F1SA 4DK5A 3FU3A 3ZIMA 5LP0A 4NVQA 1H6PA 4BUPA 2ILRA 4L7TA 4AP2A 3WXXA 4W9RA 4A3TA 3AAAC 2EILE 3EP0A 3PUJA 3P1UA 1N4QA 1SA5A 5CBNA 3RSEG 4UQZA 3FUFA 1ZB1A 1UOHA 1PY1A 3CQCB 1EDUA 2DZNA 2OVFA 4WAFA 2MHKA 2VSXE 4IYPA 4UWLA 1XGWA 3ZXSA 2LNIA 4BFRA 1OCCE 3QC1A 4JC8A 3G2WA 3TWQA 3RJWA 3AJIA 4UUCA 1K3ZD 1TN8A 4GMLA 1O1SA 1LF8A 2FF4A 2LUHA 5A6CA 2JLBA 2WXKA 2IFUA 3Q7AA 3TG5A 4FA6A 3PZ4A 1V54E 2RD0A 1FVFA 5EYPF 5M72A 2AW6A 3FTXA 3CVLA 4FC8A 4DJAA 3NZUA 2P2CP 1KT0A 5B3SE 2WPVA 5CHEE 3ZXPA 1S63A 4CZ2D 3FUJA 2DYRE 3PZ3A 1ELRA 5KWDA 5JHBA 4TUUA 4QENA 5KCMA 1N4PA 5AQAA 4YDOA 2EINE 2BKGA 3TWTA 3FU6A 3B95A 3UPVA 3CVWA 2QFCA 4O1PA 3BUAA 4AU7A 4M7CA 5KJMA 2L6BA 3LPZA 5FQ6A 4YVOA 2V4HC 4CT0A 3IBEA 3ZKJA 4PS7A 1NA3A 1H6KA 4CT4A 4UI9J 1N0QA 3L54A 3ISMC 5CCMA 2Y0BG 2DCPA 3SF4A 3NQPA 3L08A 4TXQA 3ZPJA 2DVWA 3UKUG 5HI7A 3F9WA 3R7QA 3LY7A 3MO0A 3QDNA 5AAOA 3AS8A 4U0ZA 3IEGA 5ENNA 1OWPA 3PDNA 4URKA 3KSQA 3V79K 3C72A 4RSYA 2MRIA 3QNKA 2GROB 3AU4A 1TNUA 3NZSA 2QC9A 3ENEA 4ATZD 5KJKA 1S70B 4L1BA 4TXPA 4BT8A 4I6JA 4Q94A 3FUNA 3VTYA 2X6JA 2VTBA 4IRUA 4ANWA 2AWIA 4ZHBA 3I3NA 1H3IA 4CDNA 1Z3YA 4JEHA 3D3MA 2IU1A 3UIPC 3BG1B 3B13A 3DXKG 3AG1E 3MKRA 4FP7A 4JDSA 2WXMA 2W5ZA 3GZ2A 4BETA 4GA2A 5ARFA 2PM6A 5KNHD 4ACKA 4CDRA 5FT9A 4APFA 5J90A 1N3JA 1LD7A 3X2QE 4AJWA 3DB5A 4PUCA 5C2YA 3TG4A 2IONA 2GGFA 4U8YD 5BV1A 3S7DA 4U04A 3UT7A 1AP7A 5JHAA 2I9CA 4B8CB 4Q69A 4N2SA 2PNNA 5EIBE 1O1RA 3F9YA 4AOFA 4YDEA 3MKQA 4EZLA 5JMND 2VGYA 2AXUA 4ILIA 3M56A 2IOSA 4CYMD 3KSLA 4G8KA 3IXEA 2PQNA 4MBGA 3UT4A 2LAHA 4NRHB 3MYVA 4IJ8A 3M54A 3D9LA 2WXHA 3TXNA 3DPDA 4MS6A 5JJ0A 2F8XK 2KXPC 3D9JA 4AV7A 2F0YA 3CK7A 1JPLA 4AEZC 5CEAA 3Q15A 3NOGD 1W3BA 4U07A 1S64A 4ZFHA 1HFAA 3MO5A 3EDTB 3QB2A 3DRAA 3BO5A 3FTSA 4QEOA 2Y1LE 4U95D 2QYUA 3BG0B 4HXIA 3CKBA 2VJ8A 2ZGDA 4K0RA 1U3DA 4KYOB 1TNZA 3QWWA 4LEUA 4CGVA 3NAWA 2UY1A 4PS3A 3PEUB 3QKYA 3ASHA 5JINA 1TNYA 4K5BA 5LOZA 1WDYA 2R05A 2XGOA 5G55A 3F9XA 2X6HA 4KVOA 2H6IA 2X6FA 4J83A 3HIZA 3SI5A 1UJKA 2FBNA 2C2LA 3TWRA 4F53A 4MLPA 3T9KA 4U96D 1OT8A 1FT2A 3TWVA 3FEXA 3LKUA 2XGMA 3QARA 4HRNA 3B7RL 3CHPA 3CSTA 5G04J 3RRMB 3MEKA 4E85A 1BI8B 4DX1A 4A55A 3ML9A 4KZCA 3L16A 3ZYQA 2H6GA 1OWOA 3N71A 4YNDA 3EHNA 2WXJA 4XIFA 4A1SA 4C48B 3RKVA 5T8IA 1TNOA 2DIWA 4JLGA 3KEZA 1RW2A 5AENA 1MHQA 3HG0D 3C3QA 4EQFA 1H2UA 1H2VC 3FUIA 3M5AA 3E33A 2LAIA 4FADA 2RFMA 4J0UA 5D0OD 3M59A 5JA4D 4OVVA 5F5EA 5D2MC 4HS2A 4Y6WA 1MT6A 4ANXA 1FT1A 3FY4A 3TL5A 3CVPA 1E8ZA 3D9NA 5JJ7A 4OVUA 5TEGA 2VSOE 2FEZA 3CGHA 3NB2A 3W9GA 1MX6A 4JPSA 4N2QA 3ABLE 1E8YA 1K8KG 4G26A 1WAO1 4NQ0A 1QBQA 3R7RA 3DSTA 4Y6CA 4I51A 5E76A 2Y69E 1JCRA 3OPEA 5AN8A 3SFZA 1YMPA 4H12A 3SQVA 4UQYA 5AQ7A 3EIJA 3PE3A 1N4RA 4E6HA 3HXCA 3LEWA 2X6IA 3PUKA 4N5CA 4EECA 1A5EA 4CCAA 1D9SA 4LG6A 3R9AB 2WXPA 4I2WA 5ENSD 1OWNA 3EHRA 1NI1A 4CRWA 3URZA 4HB5A 3O4ZA 2XRZA 2DZOA 4TRQA 2R3AA 2GRMA 3FTVA 3V2XA 4YDYA 5EN5D 1UW4B 3PREA 5G05C 4WNGA 1TNBA 5ENTD 4UI9C 4UWKA 2E0IA 3JXJA 5BPPA 2YQ8A 3W9FA 1MVHA 5BW8C 3Q47B 4I43A 4DI3A 3S8PA 4JHJA 2DBAA 2GW1A 4Q96A 4DUIA 5KBAA 4J7WA 1N6AA 4M3OA 5FTPA 4D10C 2Q7FA 3JCKC 4L2LA 4ATGA 4WNDA 3D9OA 2WQHA 3C3OA 4KVMA 2A4ZA 4BSZB 1ZU2A 4JA7A 1OY3D 1N54A 2XEHA 3Q9UC 2BF0X 2IEJA 4FMUA 2ZISA 2VGXA 1QQEA 1JCSA 1DCEA 4ACLA 3UI2A 3CHOA 1KPSB 4G2VA 5B1BE 4GZ3A 2V8SE 4YPUA 5LSZA 3QWPA 4J8EA 4IJDA 2CHXA 1DNPA 2WMNA 3EUVA 3LS8A 5ENOD 5AJDA 3DSSA 4HFGA 5BXOA 1HG5A 4DX7D 3FTZA 3SO8A 5AQ9A 4XKBA 4LSZE 3CK9A 4YNMA 1O9SA 1HS6A 2P9NG 5F59A 1Z5SC 2AVPA 1IXVA 3OXFA 3S2AA 1IHBA 4DX6D 3V31A 3ZFWA 2XQ0A 4J8FA 4RLYA 2I2OA 4J8OA 4OAUC 3F6QA 3NF1A 5JHNA 1G3NB 1A17A 4JVSA 4KT6B 3E32A 4GTQA 1JUQA 2B6CA 5CERB 4GA0A 2DWZA 3G2UA 5CMWA 2YHCA 2X3MA 3U9WA 2WXGA 1YA0A 3PRZA 3HNAA 3UMVA 4L9PA 3FUKA 3D9HA 2P9KG 4ANVA 4V3IA 1QZ2A 2HE0A 3ASFA 1MJ0A 3FUHA 4N3AA 2PL2A 2KZTA 4GTTA 2LSUA 1E8WA 3CK8A 2OV8A 1NP7A 4RVBA 5F6LA 2WXLA 2PZIA 3VLFA 3AS5A 4HBDA 3RU0A 5KJLA 3OS5A 4N3CA 4U7EB 4AVXA 1OCRE 2A5EA 1TR4A 1V55E 3O48A 4XKCA 3RO3A 5ENRD 3UTMA 3T5XA 2GRRB 1SVXA 2R59A 3IKOB 1AWCB 2X6KA 3DEPA 2EIKE 3DBSA 1INZA 1TN7A 2EIJE 2P9SG 3JYSA 3ZN3A 2WXIA 3IHYA 3K9IA 3EU9A 3T5VA 3SZ7A 2ZGGA 5B1AE 3I5PA 3ESKA 2I1KA 2HM8A 3Q9NC 5LCWJ 1TJCA 4EPZA 4K03A 1SA4A 3ABME 3E37A 4F6RD 4ABNA 4QEPA 5G04C 3FDHA 4O6FA 5ENPD 2EQXA 4NIKA 4KZ0A 4R7LA 2XZTG 1N4SA 3QWVA 5AYWD 3SBSA 2IO3C 1TYQG 5TTFA 4LNBA 2WM9A 4A3VA 1MUFA 2KCLA 3T8KA 1N9AA 3C3RA 3Q7FA 3ULEG 3I4GA 1E96B 3CLJA 1HZ4A 2NYJA 4HLEA 2PM7A 3KMTA 1Z3XA 4WUYA 2IGQA 5T3RA 4LDGA 3CKCA 1E90A 3UT8A 1OWLA 3ZEFA 4CEMA 4LRZA 4GCOA 3UM1A 3DXMG 3EHMA 3ASOE 3P2BA 2XGSA 2O8JA 4I1OB 2BQZA 1FCHA 4KXKB 4ME2A 2VGEA 3AG2E 4QFVA 1BD8A 4APOA 3ONLA 5FZSA 4YPEA 3KMAA 2F8YA 2XEVA 1NZNA 3TWXA 3SGHA 3M55A 3DALA 3D9IA 1FVHA 4FHJA 2HO1A 5EILA 4B94A 5HKPA 2J4DA 1OUVA 2BUGA 2OEWA 1MYOA 2I6HA 1U3CA 4GTOA 5DIZA 1NL4A 3Q79A 4HVBA 2W5YA 5LFAA 2IO2C 2M63A 3VLDA 3RJVA 2AJAA 4LUNU 1BU9A 4DLQA 2AXVA 4HNAD 4O60A 4YNPA 4C0EA 4B0ZA 3PNTB 2KZTB 5FQ7A 4JHKA 3PZDA 2WQ7A 5CECB 2BTDA 1KZPA 3VUZA 3IHXA 3IHVA 4LERA 1HH8A 4P29A 4F3VA 2F37A 4K5CA 3UM2A 5CRVA 2XRYA 1MVXA 1SZAA 2E2EA 3AG3E 3U66A 3ZYKA 3VV0A 4G24A 2G46A 2LXLA 5H7PA 3GYZA 5ITZF 4BT9A 1HXIA 3L9TA 4N3BA 2UY1B 3C5RA 1U2VG 2L6JA 3HYMB 3ML8A 5ANLA 4UI9K 4LNUD 4XI9A 1O5MA 5EIDA 4ILGA 3SBTB 2GRPB 1NA0A 1N0RA 3HDXA 1WY6A 5EX3A 1NFIE 4U8VD 4JA9A 4C9BB 3MGBA 4UWGA 4GYWA 3LJ3A 2C0LA 4C0MA 1IQUA 4HOSA 1Y6IA 3B7BA 3KMJA 2ETAA 3U64A 4JD2G 3UIOC 2WMOA 3LVRE 2JEKA 4B93B 3SNXA 2CFZA 4GB9A 5T0KA 4UWFA 3HHMA 5JIYA 4RG9A 3SHFA 4A1GA 4BEPA 1K1AA 3EHQA 4E47A 1ZKKA 1LTXA 3ABKE 2YHEA 3D9KA 1PEGA 1HE8A 4O1OA 5FINA 3GZ1A 2KATA 1KT1A 2BEDA 3D9MA 3CHSA 1OXJA 2J8SD 3FFLA 4OYSA 3JQ1A 5J08A 2EIME 3AG4E 1LD8A 2CFUA 3DPYA 4JZYA 1E7VA 2FULA 4AIFA 3KAEA 1X5BA 5CMYA 1MQSA 5AQBA 3PZ2A 3RK6A 2ETBA 3AS4A 2WXFA 3TWWA 3HXEA 2KCVA 2YNQA 3FH5A 4PDXA 1Q2ZA 1TEZA 3ULYA 3LYAA 2VYIA 4GTVA 3MV2B 3D9PA 3CVVA 2B0OE 3MO2A 5FIOA 5FWQA 3AU5A 2UWJG 2J9QA 5T0MA 4WNEA 4LNGA 4J7FA 3R9MA 3MX3A 3T8MA 1XQHA 2NXPA 2L9BA 4NURA 1S0PA 1E7UA 4DRXE 2J08A 4BTBA 1SW6A 1WG0A 2R17C 4J8SA 2LXMA 3OXLA 4GTMA 2WB2A 3TAXA 3J5PA 2IOLA 1KZOA 4JHRA 5BV0A 1B89A 3CVYA 3DSWA 2ZIRA 3ASDA 3QK0A 1BLXB 4I9CA 4EZJA 5LCWC 2V5QC 2V5FA 2VSYA 5JJ6A 3KD7A 5G2NA 3HVEA 3ZYLA 2QYJA 2FO7A 1P5QA 4DPRA 4J8DA 4BY6A 3ZVVA 4BWRA 3HXBA 5HS0A 3G2VA 5F6KC 5FQ4A 2Y3AA 2WXRA 4FLBA 4HI9A 2IJGX 3ZHEA 4Z68A 3ZYMA 5KJNA 4XX5A 2ZU6B 4H7XA 3PEVB 3S7FA 2NSZA 4GMRA 2P9IG 4EHMA 5FQ8A 4OAVB 3SY2A 3CBMA 5ANRA 3RIBA 3HVEB 4GZDA 4YDWA 4GTRA 3G2SA 2DYSE 4AM9A 3UX4A 1EPUA 3L22A 2XCCA 3WG7E 4TXRA 1HX8A 3SW9A 3LCAA 3DEOA 2JV0A 4MRUA 1H0AA 5T4YA 3MCXA 5EKQD 1JWGA 3J5QB 4JB8P 1VDYA 3RRNB 2VSNA 4I1MA 4GPMA 2J07A 5ARGA 2R2LA 3U4TA 1JCQA 5A23A 4WNFA 3FUDA 1H2TC 4AY5A 3I4RB 4HI8A 3F9ZA 5D0QD 4GZCA 3RRUA 2R03A 2R02A 2WXNA 2XPZA 1ELKA 5BUZA 2L0IA 4IN3B 3FUEA 3OOIA 3ZUVB 1JWFA 2XS1A 3EJNA 4XI0A 1MX2A 3UINC 4GU5A 5ENQD 5AYFA 4F7AA 4WWPA 2FO1E 5AIJA 4BX8A 1UN8A 4WWNA 4LCTA 3M57A 4N39A 4I1AA 3FU5A 4XEIG 4F1PA 4XE0A 5BT1A 5CEDB 4A63B 2P9PG 3SD5A 4HOUA 1IHGA 2XPYA 2MOWA 3Q5MA 3PE4A 3DSVA 4GAAA 2PQRA 1N52A 3DSUA 3CSFA 3ZU7B 1ZBPA 3FPDA 1H6OA 4BTAA 2FI7A 1SQMA 4EZKA 4RZ0A 3PH0C 1IQRA 1QNFA 4TV3A 2RFAA 2L0TB 1BPOA 3CQGB 4B89A 4BSXA 3FULA 4AXHA 5EDSA 2P9UG 4G11A 4GTPA 4KMOA 1SZ9A 4CGWA 3E34A 2KBXA 1HG2A 3MZLB 5CBOA 2CG3A 3M58A 5IY5E 1N11A 4N5QA 1N6CA 4CDMA 3U3WA 4FU3A 3TWSA 3G2TA 4BESA 2J09A 1PC2A 2XS8A 4UWHA 4HOQA 1XNFA 4I2ZA
chains in the Genus database with same CATH topology
5M72A 2AW6A 3U66A 3KS2A 3FTXA 3FTVA 3CVLA 3GW4A 4FC8A 4H7YA 3ZYKA 4DJAA 3VV0A 4G24A 2G46A 3NZUA 3CR3A 1UW4B 3GYZA 1KT0A 2WPVA 3PREA 5CHEE 4BT9A 1HXIA 3APDA 4N3BA 2UY1B 3FTUA 5G05C 4WNGA 3JUIA 3FUJA 4C1QA 4UI9C 3L6AA 2E0IA 4UWKA 1ELRA 2L6JA 3OXGA 3HYMB 3ML8A 1OWMA 5ANLA 5JHBA 4TUUA 2WXOA 3FWVA 5BPPA 3E4BA 4UI9K 2YQ8A 3C98A 1GW6A 4U0SA 4QENA 4DI4A 4XI9A 1MVHA 5KCMA 5BW8C 3Q47B 4EBAA 3FEYA 3Q49B 4I43A 4ILGA 4DI3A 3SBTB 1IYGA 3FU6A 1NA0A 3S8PA 3MKQB 4U0UA 4JHJA 3UPVA 2DBAA 1H19A 2GW1A 2X38A 4Q96A 2QFCA 3HDXA 3CVWA 3QAQA 3QJZA 5T5GA 1WY6A 1N6AA 3RQ4A 4GYYA 4M3OA 4AU7A 3ZW3A 3VTXA 5KJMA 5EX3A 5FTPA 2VQ2A 3LPZA 3MV3B 5FQ6A 4D10C 4JA9A 2XHEA 4C9BB 2HR2A 1HF8A 2Q7FA 3JCKC 3UQ3A 4L2LA 4YVOA 4ATGA 2Y4UA 4WNDA 3D9OA 2WQHA 4CT0A 3MGBA 4KVMA 2A4ZA 3IBEA 4UWGA 4PS7A 1NA3A 1H6KA 4CT4A 3CVNA 4MKTA 4UI9J 4GYWA 3LJ3A 4KBQA 2C0LA 3L54A 1ZU2A 2CHWA 4C0MA 1IQUA 5CCMA 3FHEA 4HOSA 3L13A 1Y6IA 4JA7A 3KMJA 2DCPA 3SF4A 3U64A 1N54A 3NQPA 3L08A 3ZPJA 2WMOA 3LVRE 5HI7A 3F9WA 2JEKA 3R7QA 5CCLA 3LVQE 1Y8MA 5EX0A 2CFZA 3LY7A 3QDNA 3SNXA 3CVXA 3MO0A 2BF0X 3AS8A 2A5UA 4GB9A 4JXTA 4U0ZA 4EBAG 4FMUA 5T0KA 3IEGA 2VGXA 1QQEA 5ENNA 1OWPA 3PDNA 2KM4A 4UWFA 4ACLA 4URKA 3HHMA 3CHOA 5JIYA 4G2VA 4RG9A 4RSYA 3APCA 3SHFA 4A1GA 5LX8A 4GZ3A 2V8SE 4E47A 2MRIA 3QNKA 1ZKKA 4YPUA 3AU4A 3TJPA 2YHEA 3D9KA 5LSZA 3QWPA 3NZSA 4GZ6A 1PEGA 3ENEA 4IULA 1HE8A 3JQ0A 4G25A 4DLOA 5JJTA 4I6EA 5KJKA 3GZ1A 2J4BA 4J8EA 2KATA 4IJDA 2CHXA 4L1BA 1KT1A 2GRLA 1DNPA 2WMNA 3APFA 4BT8A 3D9MA 4I6JA 4J7IA 4Q94A 4WWOA 3FUNA 3LS8A 5AJDA 3CIAA 4NACA 3CHSA 3VTYA 4HFGA 2X6JA 2YINA 1HG5A 2RFIA 3FTZA 4XKBA 3CVQA 3FFLA 3B7UX 2VTBA 4OYSA 1UN9A 3JQ1A 4FULA 5J08A 3FTYA 3CK9A 4YNMA 4I17A 5AJLA 3PS6A 4IRUA 4ANWA 1O9SA 2CFUA 4JZYA 1HS6A 1E7VA 4MI0A 2FULA 2AWIA 5F59A 2AVPA 3I3NA 4AIFA 3KAEA 1X5BA 4J6IA 3FUMA 1H3IA 2OOEA 1Z3YA 4CDNA 5HQ8A 2F69A 4JEHA 5CMYA 1MQSA 2IQCA 2IU1A 3D3MA 3OXFA 5EG2A 3BG1B 3S2AA 1UG3A 3B13A 3ZGQA 3RK6A 1EF1C 2VTBB 4ILHB 3ZFWA 3AS4A 3MKRA 4FP7A 2XQ0A 4J8FA 2WXFA 4JDSA 2WXMA 2W5ZA 1HU3A 2VGXB 3GZ2A 5FZQA 3TGOA 2I2OA 2KCVA 4PH4B 4GZ5A 4B8AA 4GA2A 4J8OA 2YNQA 2PM6A 3FH5A 4L23A 3NF1A 4PDXA 5ARFA 4ACKA 3Q4AB 4CDRA 5FT9A 5JHNA 1TEZA 1A17A 4JVSA 4U63A 3LYAA 2VYIA 2R5SA 4KT6B 4APFA 4GPKA 5J90A 3MV2B 5E75A 1N3JA 3D9PA 1JUQA 3VLEA 3CVVA 4GA0A 4BX9A 3MO2A 2KC7A 4AJWA 3G2UA 5CMWA 5FWQA 3DB5A 3AU5A 2YHCA 4PUCA 2V4LA 2X3MA 3U9WA 4HORA 5DBKA 2UWJG 5C2YA 5CPRB 3ONKA 3TG4A 3LXUX 2J9QA 5T0MA 2IONA 1YA0A 2WXGA 2GGFA 3ESLA 3L17A 3PRZA 4WNEA 3HNAA 3UMVA 4J7FA 5BV1A 1WM5A 2ONDA 3S7DA 3EIQC 3FUKA 1UJJA 4U04A 3UT7A 3CV0A 5JHAA 2I9CA 4ANVA 4B8CB 5FJYA 3MX3A 3LY9A 4Q69A 3T8MA 1XQHA 2NXPA 4V3IA 4N2SA 2L9BA 5C1DA 3F9YA 1QZ2A 4NURA 4AOFA 4MI5A 1S0PA 3ASFA 3FUHA 4N3AA 1E7UA 2KZTA 2PL2A 5FZRA 3MKQA 2J08A 4G1TA 4EZLA 2LSUA 4BTBA 2VGYA 3MA5A 4JL0A 1E8WA 3CK8A 2R17C 2OV8A 1NP7A 2AXUA 4GCNA 4ILIA 4J8SA 3OXLA 4RVBA 5A7DB 5F6LA 4RG6A 2WXLA 2CHZA 2PZIA 3M56A 3PVLA 3VLFA 2IOSA 3AS5A 1DVPA 2PQNA 2WB2A 3IV0A 4JEUA 3TAXA 3RU0A 5KJLA 2IOLA 4JHRA 3UT4A 2LAHA 3OS5A 4NRHB 5BV0A 3CHMA 3LDZA 1B89A 4N3CA 3MYVA 4AVXA 3GZSA 4IJ8A 4GA1A 3LY8A 3CVYA 3M54A 3D9LA 3ASDA 2WXHA 3TXNA 3RAYA 1PAQA 3QK0A 3DPDA 4I9CA 4UQXA 4JW1A 4EZJA 5LCWC 4MS6A 4YPAA 5JJ0A 2V5FA 2VSYA 3O48A 5JJ6A 4XKCA 3D9JA 3RO3A 3CK7A 4AV7A 1JPLA 3KD7A 5G2NA 4L2YA 4AEZC 3Q15A 5G05J 1W3BA 3HVEA 4U07A 3T5XA 3FH8A 3ZYLA 4ANUA 2R59A 3IKOB 2X6KA 1HFAA 1INZA 3DBSA 3MO5A 4FHKA 2FO7A 3EDTB 3QB2A 1P5QA 4DPRA 4J8DA 2KCKA 4BY6A 3ZVVA 3BO5A 1L5JA 3FTSA 3JYSA 3ZN3A 4BWRA 1TJFA 4QEOA 2WXIA 4I9EA 2XCBA 3IHYA 3BG0B 2HYZA 3G2VA 3K9IA 5FQ4A 3T5VA 5F6KC 2Y3AA 4HXIA 3CKBA 3SZ7A 2WXRA 3I5PA 4FLBA 2IJGX 3ESKA 3ZHEA 3TXMA 3ZYMA 2VJ8A 5KJNA 2I1KA 1EYHA 2HM8A 4XX5A 2ZU6B 4H7XA 4K0RA 3SWCA 3PEVB 4GMJA 3CHQA 3S7FA 1U3DA 2RG8A 4GYOA 1TJCA 2NSZA 2LO6A 4EPZA 4K03A 5LCWJ 4KYOB 2CG2A 4XZ4A 3QWWA 4LEUA 5FQ8A 4CGVA 2V0PA 3CBMA 2UY1A 4PS3A 3PEUB 3QKYA 5ANRA 3HVEB 3RIBA 3ASHA 4GZDA 4ABNA 4QEPA 5JINA 5G04C 3G2SA 3FDHA 4AM9A 5LOZA 2XGOA 3FH7A 4O6FA 2EQXA 3UX4A 4KZ0A 3B7SA 4R7LA 2I1JA 1EPUA 4FJZA 3QWVA 5AYWD 5G55A 3F9XA 2X6HA 3SBSA 3CHRA 3ZRHA 5TTFA 4KVOA 2WM9A 3L22A 3ULQA 5BNWA 2XCCA 2QY7A 2X6FA 4J83A 3HIZA 3OAWA 3SI5A 4A3VA 3ASGA 1UJKA 2C0MA 2FBNA 2IF4A 2C2LA 1HX8A 3SW9A 1MUFA 3LCAA 2LSVA 2KCLA 4FLHA 4F53A 2WQ6A 4MLPA 5LSXA 1Z6TA 3I4GA 1E96B 2JV0A 3CLJA 1HZ4A 3FU0A 3M53A 4MRUA 1H0AA 1KLXA 3CEQA 4U8HA 5T4YA 3S7BA 3MCXA 5EKQD 4HLEA 3CBPA 1JWGA 3FEXA 2PM7A 3LKUA 4O30A 1VDYA 3RRNB 2XGMA 2VSNA 3QARA 3KMTA 3FP3A 4I1MA 2J07A 3B7RL 3CHPA 5ARGA 3CSTA 3U4TA 5G04J 1Z3XA 4NJ5A 1HO8A 3RRMB 3MEKA 4WUYA 4E85A 5A23A 5T3RA 4WNFA 3FUDA 2IGQA 3CKCA 4LDGA 3QOUA 1E90A 4I6GA 1H2TC 4AY5A 3ML9A 4A55A 3I4RB 2XPIA 4KZCA 3UT8A 4FJYA 3L16A 1OWLA 3ZEFA 3F9ZA 3ZYQA 4CEMA 5D0QD 4GZCA 3RRUA 1ML9A 4LRZA 1OWOA 3CBOA 3N71A 2XPZA 2WXNA 4YNDA 3EHNA 4G23A 2QPWA 1ELKA 5BUZA 2WXJA 4GCOA 4XIFA 2L0IA 4A1SA 3EHMA 3FTWA 3RKVA 4IN3B 4YVQC 3FUEA 5T8IA 4Z4PA 3OOIA 3CVUA 3P2BA 2XGSA 1JWFA 2NC9A 3PNLB 2O8JA 3EJNA 4I1OB 4XI0A 2BQZA 2WXQA 2DIWA 1FCHA 3KEZA 4GU5A 2AXZA 4JLGA 4AY6A 4KXKB 5AYFA 4ME2A 3RO2A 4F7AA 1MHQA 4WWPA 5AENA 5AIJA 3BEEA 4QFVA 3OTNA 3S7JA 5TH7A 4BX8A 1UN8A 2WVIA 4APOA 4WWNA 4EQFA 4HOTA 1H2UA 4LCTA 3ONLA 1H2VC 3M57A 4N39A 5FZSA 4I1AA 2Y4TA 4YPEA 3FU5A 3ZHEB 3KMAA 3FUIA 4XE0A 2P58C 5BT1A 3M5AA 2LAIA 2XEVA 2OVBA 4FADA 3SD5A 2J49A 4HOUA 1ELWA 1NZNA 3MJWA 1IHGA 4J0UA 5D0OD 3UUXA 2XPYA 3M59A 4OVVA 4PS8A 2MOWA 3Q5MA 3SGHA 3PE4A 3B7TA 3M55A 5F5EA 3DALA 4GAAA 2PQRA 1N52A 1E8XA 3CSFA 4HS2A 4Y6WA 3D9IA 1MT6A 1FVHA 4FHJA 4ANXA 3K5KA 4F1SA 2HO1A 3FY4A 3FU3A 3TL5A 4DK5A 1ZBPA 4B94A 3ZIMA 5LP0A 3CVPA 1E8ZA 2J4DA 4NVQA 3FPDA 1OUVA 2BUGA 3D9NA 5JJ7A 4OVUA 4BTAA 2FI7A 1SQMA 4EZKA 5TEGA 2I6HA 4BUPA 2VSOE 2ILRA 4RZ0A 4L7TA 3PH0C 2FEZA 1IQRA 1QNFA 4TV3A 3CGHA 1U3CA 5DIZA 4AP2A 3WXXA 4JPSA 4N2QA 2L0TB 1BPOA 3CQGB 1E8YA 4W9RA 4HVBA 4G26A 4B89A 4BSXA 1WAO1 3FULA 4A3TA 4AXHA 4NQ0A 5EDSA 2W5YA 5LFAA 3R7RA 4Y6CA 3EP0A 4I51A 4G11A 5E76A 2M63A 4KMOA 1SZ9A 3PUJA 3VLDA 4CGWA 3OPEA 3P1UA 3RJVA 4LUNU 4UQZA 3FUFA 4DLQA 1PY1A 3SFZA 1HG2A 3CQCB 1EDUA 3MZLB 2AXVA 3M58A 2CG3A 2OVFA 4H12A 4WAFA 2MHKA 2VSXE 4IYPA 4UWLA 1XGWA 3ZXSA 4UQYA 2LNIA 4BFRA 4YNPA 3QC1A 4JC8A 4C0EA 3EIJA 3PE3A 3G2WA 4B0ZA 3PNTB 4E6HA 1N6CA 3LEWA 2KZTB 2X6IA 3PUKA 5FQ7A 4JHKA 3PZDA 4N5CA 4CDMA 2WQ7A 3RJWA 2BTDA 4EECA 3U3WA 4CCAA 4FU3A 3G2TA 3R9AB 4GMLA 2J09A 2WXPA 1PC2A 4I2WA 1LF8A 1OWNA 3VUZA 4UWHA 2FF4A 3IHXA 3IHVA 4CRWA 4LERA 3URZA 1HH8A 5A6CA 4P29A 2JLBA 2WXKA 3O4ZA 4F3VA 2IFUA 2XRZA 4HOQA 3TG5A 2XRYA 1XNFA 4FA6A 4TRQA 1MVXA 2RD0A 2R3AA 4I2ZA 1FVFA 1SZAA 2E2EA 2GRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M72 A;  3KS2 A;  3GW4 A;  3CVL A;  4H7Y A;  3VV0 A;  4G24 A;  2G46 A;  3GYZ A;  1KT0 A;  2WPV A;  5CHE E;  4BT9 A;  1HXI A;  4N3B A;  2UY1 B;  5G05 C;  4WNG A;  4C1Q A;  4UI9 C;  1ELR A;  2L6J A;  3OXG A;  3HYM B;  3FWV A;  3E4B A;  4UI9 K;  2YQ8 A;  4U0S A;  4QEN A;  4XI9 A;  1MVH A;  5BW8 C;  3Q47 B;  3Q49 B;  1IYG A;  3S8P A;  1NA0 A;  4U0U A;  3UPV A;  2DBA A;  2GW1 A;  2QFC A;  5T5G A;  1N6A A;  3RQ4 A;  4GYY A;  4AU7 A;  3VTX A;  5KJM A;  5EX3 A;  5FTP A;  2VQ2 A;  3LPZ A;  3MV3 B;  4JA9 A;  2HR2 A;  2Q7F A;  3UQ3 A;  4YVO A;  2Y4U A;  4WND A;  2WQH A;  1NA3 A;  3CVN A;  4UI9 J;  4GYW A;  4KBQ A;  2C0L A;  1ZU2 A;  5CCM A;  4HOS A;  3KMJ A;  4JA7 A;  3SF4 A;  3ZPJ A;  5HI7 A;  3F9W A;  5CCL A;  1Y8M A;  5EX0 A;  3LY7 A;  3MO0 A;  3QDN A;  3AS8 A;  4U0Z A;  4FMU A;  5T0K A;  3IEG A;  2VGX A;  1QQE A;  3PDN A;  5JIY A;  4G2V A;  4RG9 A;  4GZ3 A;  4E47 A;  1ZKK A;  4YPU A;  5LSZ A;  3QWP A;  4GZ6 A;  1PEG A;  4G25 A;  5JJT A;  5KJK A;  3GZ1 A;  4J8E A;  2KAT A;  4IJD A;  1KT1 A;  4BT8 A;  4J7I A;  3VTY A;  2RFI A;  3CVQ A;  3FFL A;  3CK9 A;  4YNM A;  4I17 A;  1O9S A;  4MI0 A;  5F59 A;  2AVP A;  4AIF A;  3KAE A;  2F69 A;  1H3I A;  2OOE A;  5HQ8 A;  3OXF A;  5EG2 A;  3ZGQ A;  3ZFW A;  3AS4 A;  3MKR A;  4J8F A;  4JDS A;  2W5Z A;  2VGX B;  3GZ2 A;  5FZQ A;  3TGO A;  2KCV A;  4GZ5 A;  4J8O A;  4GA2 A;  5ARF A;  3NF1 A;  3Q4A B;  4CDR A;  5FT9 A;  5JHN A;  1A17 A;  3LYA A;  2VYI A;  2R5S A;  4GPK A;  3MV2 B;  1N3J A;  4GA0 A;  3MO2 A;  2KC7 A;  3DB5 A;  2YHC A;  4HOR A;  5CPR B;  5DBK A;  2UWJ G;  3TG4 A;  2J9Q A;  5T0M A;  1YA0 A;  4WNE A;  3HNA A;  4J7F A;  1WM5 A;  2OND A;  3S7D A;  4U04 A;  3CV0 A;  5FJY A;  3LY9 A;  1XQH A;  4N2S A;  5C1D A;  3F9Y A;  1QZ2 A;  4MI5 A;  3ASF A;  4N3A A;  2PL2 A;  5FZR A;  4G1T A;  2LSU A;  4BTB A;  2VGY A;  3MA5 A;  4JL0 A;  3CK8 A;  4GCN A;  3OXL A;  5A7D B;  5F6L A;  4RG6 A;  2PZI A;  3M56 A;  3AS5 A;  2PQN A;  3TAX A;  3RU0 A;  5KJL A;  3OS5 A;  4JHR A;  4NRH B;  1B89 A;  4N3C A;  4IJ8 A;  4GA1 A;  3LY8 A;  3M54 A;  3ASD A;  3RAY A;  4I9C A;  4UQX A;  5LCW C;  4YPA A;  5JJ0 A;  2V5F A;  2VSY A;  3O48 A;  5JJ6 A;  3RO3 A;  3CK7 A;  3KD7 A;  3Q15 A;  5G05 J;  1W3B A;  4U07 A;  3MO5 A;  2FO7 A;  3EDT B;  1P5Q A;  4J8D A;  2KCK A;  3BO5 A;  3JYS A;  4BWR A;  3ZN3 A;  4QEO A;  4I9E A;  2XCB A;  3K9I A;  2HYZ A;  5F6K C;  3CKB A;  3SZ7 A;  3ESK A;  3ZHE A;  5KJN A;  4H7X A;  3SWC A;  3S7F A;  4GYO A;  1TJC A;  5LCW J;  4KYO B;  3QWW A;  4LEU A;  4CGV A;  3CBM A;  2UY1 A;  3QKY A;  3RIB A;  4ABN A;  4QEP A;  3ASH A;  5JIN A;  5G04 C;  4AM9 A;  2XGO A;  4O6F A;  5AYW D;  3QWV A;  3F9X A;  5TTF A;  3ULQ A;  5BNW A;  2XCC A;  4J83 A;  3ASG A;  2FBN A;  2C0M A;  2IF4 A;  2C2L A;  3SW9 A;  1MUF A;  3LCA A;  2LSV A;  2KCL A;  5LSX A;  1E96 B;  2JV0 A;  1HZ4 A;  3M53 A;  1KLX A;  3CEQ A;  3S7B A;  3CBP A;  5EKQ D;  3LKU A;  4O30 A;  2XGM A;  2VSN A;  3KMT A;  3FP3 A;  5ARG A;  3U4T A;  5G04 J;  4NJ5 A;  3MEK A;  4WUY A;  2IGQ A;  4WNF A;  4LDG A;  3CKC A;  3QOU A;  4AY5 A;  2XPI A;  3F9Z A;  1ML9 A;  5D0Q D;  3CBO A;  3N71 A;  4YND A;  4G23 A;  2QPW A;  4GCO A;  4XIF A;  4A1S A;  3RKV A;  4IN3 B;  4YVQ C;  4Z4P A;  3OOI A;  2XGS A;  2NC9 A;  2O8J A;  4XI0 A;  2BQZ A;  4JLG A;  1FCH A;  4AY6 A;  4KXK B;  5AYF A;  4ME2 A;  3RO2 A;  3BEE A;  3S7J A;  5TH7 A;  4APO A;  4EQF A;  4HOT A;  3M57 A;  4N39 A;  5FZS A;  4I1A A;  2Y4T A;  4YPE A;  3ZHE B;  3KMA A;  5BT1 A;  3M5A A;  2P58 C;  2XEV A;  4HOU A;  1ELW A;  1NZN A;  4J0U A;  1IHG A;  3UUX A;  5D0O D;  3M59 A;  3Q5M A;  3PE4 A;  3M55 A;  5F5E A;  3DAL A;  2PQR A;  4Y6W A;  1MT6 A;  3K5K A;  2HO1 A;  1ZBP A;  4B94 A;  3CVP A;  4NVQ A;  3FPD A;  1OUV A;  2BUG A;  5JJ7 A;  4BTA A;  2FI7 A;  5TEG A;  2I6H A;  4BUP A;  4RZ0 A;  2FEZ A;  5DIZ A;  3WXX A;  4N2Q A;  4W9R A;  4G26 A;  1WAO 1;  4NQ0 A;  2W5Y A;  4Y6C A;  3EP0 A;  4I51 A;  4CGW A;  3OPE A;  3RJV A;  4UQZ A;  3M58 A;  4H12 A;  2MHK A;  4UQY A;  2LNI A;  4YNP A;  3PE3 A;  1N6C A;  4N5C A;  3RJW A;  3U3W A;  3R9A B;  1PC2 A;  4I2W A;  3VUZ A;  2FF4 A;  3IHX A;  3URZ A;  1HH8 A;  5A6C A;  4F3V A;  2JLB A;  2IFU A;  4HOQ A;  3TG5 A;  1XNF A;  1MVX A;  2R3A A;  4I2Z A;  2E2E A; 
#chains in the Genus database with same CATH topology
 3KS2 A;  1YCS B;  3GW4 A;  4H7Y A;  2RKK A;  3BQO A;  2GRN B;  3CR3 A;  3APD A;  3FTU A;  3JUI A;  4C1Q A;  3L6A A;  3OXG A;  1OWM A;  3DWL G;  2WXO A;  3FWV A;  3E4B A;  3C98 A;  1GW6 A;  4J8Y A;  4U0S A;  1OCO E;  4DI4 A;  4EBA A;  3FEY A;  3Q49 B;  1IYG A;  3MKQ B;  4U0U A;  1H19 A;  2X38 A;  3QAQ A;  3QJZ A;  5T5G A;  3RQ4 A;  4GYY A;  3ZW3 A;  3VTX A;  1RZ4 A;  2VQ2 A;  3MV3 B;  3HXD A;  2XHE A;  3UM0 A;  3RAU A;  2HR2 A;  1HF8 A;  2OEV A;  3UQ3 A;  1N95 A;  2Y4U A;  3CVN A;  4K5A B;  4MKT A;  3NBN B;  4KBQ A;  2OCC E;  4RQI A;  2CHW A;  1N94 A;  3FHE A;  3L13 A;  5HRY A;  5CCL A;  1YYH A;  3LVQ E;  1Y8M A;  5EX0 A;  3CVX A;  2A5U A;  4JXT A;  4EBA G;  3SFX A;  2KM4 A;  3UKR G;  3APC A;  5LX8 A;  3V30 A;  5KNG A;  5CRU A;  3TJP A;  5BXU A;  4GZ6 A;  1QYM A;  4IUL A;  1X81 A;  4TUM A;  3JQ0 A;  4G25 A;  4DLO A;  5JJT A;  4I6E A;  5EYL A;  2J4B A;  2GRL A;  3APF A;  4J7I A;  4WWO A;  3CIA A;  4NAC A;  2YIN A;  2RFI A;  2XZD G;  3CVQ A;  3B7U X;  5D66 A;  1UN9 A;  4FUL A;  3FTY A;  4I17 A;  5AJL A;  1K1B A;  3E30 A;  1IKN D;  3PS6 A;  3Q78 A;  4MI0 A;  3HRA A;  4J6I A;  3FUM A;  2F69 A;  2OOE A;  5HQ8 A;  2IQC A;  5EG2 A;  1UG3 A;  3ZGQ A;  1EF1 C;  2VTB B;  4ILH B;  4HLL A;  1DCQ A;  1FPP A;  3Q75 A;  1HU3 A;  2VGX B;  5FZQ A;  3TGO A;  4PH4 B;  4GZ5 A;  4B8A A;  4L23 A;  3Q4A B;  2GRQ B;  4U63 A;  2R5S A;  4GPK A;  5E75 A;  3VLE A;  3TWU A;  4BX9 A;  2KC7 A;  2V4L A;  4HOR A;  5CPR B;  5DBK A;  3ONK A;  3LXU X;  4HRM B;  3L17 A;  3ESL A;  3UM3 A;  1WM5 A;  2OND A;  3EIQ C;  2XEN A;  1UJJ A;  2P9L G;  3CV0 A;  5FJY A;  3LY9 A;  5C1D A;  4MI5 A;  2QZA A;  5AAR A;  5FZR A;  3HXF A;  4G1T A;  4BER A;  3MA5 A;  4JL0 A;  2ZXW E;  4GCN A;  5A7D B;  3ZNG A;  4RG6 A;  2CHZ A;  3PVL A;  4GTS A;  1DVP A;  3IV0 A;  4JEU A;  3CHM A;  3LDZ A;  3DSX A;  4DX5 D;  3GZS A;  1MX4 A;  3LY8 A;  4GA1 A;  3RAY A;  1PAQ A;  1OCZ E;  1BI7 B;  4UQX A;  4JW1 A;  4YPA A;  2H6H A;  4L2Y A;  2H6F A;  3L82 A;  5G05 J;  4ANU A;  3FH8 A;  1D8D A;  2BKK B;  3KEA A;  4HQD A;  4FHK A;  2KCK A;  1L5J A;  3JUE A;  1TJF A;  4I9E A;  2XCB A;  2HYZ A;  3LJN A;  3TXM A;  1EYH A;  3UXG A;  3SWC A;  4GMJ A;  3CHQ A;  1TN6 A;  2RG8 A;  4GYO A;  2LO6 A;  2CG2 A;  4XZ4 A;  2V0P A;  4QQI A;  3JXI A;  3PZ1 A;  4G8L A;  2JAB A;  3FH7 A;  3B7S A;  2I1J A;  4FJZ A;  3CHR A;  3ZRH A;  3ULQ A;  3EU5 A;  5BNW A;  2QY7 A;  3OAW A;  3BU8 A;  2MYO A;  3ASG A;  2C0M A;  2IF4 A;  2LSV A;  4FLH A;  2WQ6 A;  5LSX A;  1Z6T A;  1O1T A;  1DC2 A;  3FU0 A;  3M53 A;  1KLX A;  3CEQ A;  4U8H A;  2XEE A;  3S7B A;  3CBP A;  4DX2 A;  4O30 A;  3Q73 A;  3FP3 A;  2ETC A;  3NOC D;  4NJ5 A;  1HO8 A;  1D8E A;  3V2O A;  3SFY A;  3QOU A;  4I6G A;  2XPI A;  4FJY A;  1ML9 A;  3CBO A;  2IY0 C;  4G23 A;  2QPW A;  3FTW A;  4YVQ C;  4Z4P A;  3CVU A;  3PNL B;  2NC9 A;  2WXQ A;  2AXZ A;  1MZC A;  4AY6 A;  3RO2 A;  3BEE A;  3OTN A;  3S7J A;  5TH7 A;  2WVI A;  4HOT A;  3ASN E;  2Y4T A;  3ZHE B;  2P58 C;  4HRL A;  2OVB A;  2J49 A;  1ELW A;  3MJW A;  3UUX A;  4PS8 A;  3B7T A;  1E8X A;  4X8Q A;  3K5K A;  4F1S A;  4DK5 A;  3FU3 A;  3ZIM A;  5LP0 A;  4NVQ A;  1H6P A;  4BUP A;  2ILR A;  4L7T A;  4AP2 A;  3WXX A;  4W9R A;  4A3T A;  3AAA C;  2EIL E;  3EP0 A;  3PUJ A;  3P1U A;  1N4Q A;  1SA5 A;  5CBN A;  3RSE G;  4UQZ A;  3FUF A;  1ZB1 A;  1UOH A;  1PY1 A;  3CQC B;  1EDU A;  2DZN A;  2OVF A;  4WAF A;  2MHK A;  2VSX E;  4IYP A;  4UWL A;  1XGW A;  3ZXS A;  2LNI A;  4BFR A;  1OCC E;  3QC1 A;  4JC8 A;  3G2W A;  3TWQ A;  3RJW A;  3AJI A;  4UUC A;  1K3Z D;  1TN8 A;  4GML A;  1O1S A;  1LF8 A;  2FF4 A;  2LUH A;  5A6C A;  2JLB A;  2WXK A;  2IFU A;  3Q7A A;  3TG5 A;  4FA6 A;  3PZ4 A;  1V54 E;  2RD0 A;  1FVF A;  5EYP F;  5M72 A;  2AW6 A;  3FTX A;  3CVL A;  4FC8 A;  4DJA A;  3NZU A;  2P2C P;  1KT0 A;  5B3S E;  2WPV A;  5CHE E;  3ZXP A;  1S63 A;  4CZ2 D;  3FUJ A;  2DYR E;  3PZ3 A;  1ELR A;  5KWD A;  5JHB A;  4TUU A;  4QEN A;  5KCM A;  1N4P A;  5AQA A;  4YDO A;  2EIN E;  2BKG A;  3TWT A;  3FU6 A;  3B95 A;  3UPV A;  3CVW A;  2QFC A;  4O1P A;  3BUA A;  4AU7 A;  4M7C A;  5KJM A;  2L6B A;  3LPZ A;  5FQ6 A;  4YVO A;  2V4H C;  4CT0 A;  3IBE A;  3ZKJ A;  4PS7 A;  1NA3 A;  1H6K A;  4CT4 A;  4UI9 J;  1N0Q A;  3L54 A;  3ISM C;  5CCM A;  2Y0B G;  2DCP A;  3SF4 A;  3NQP A;  3L08 A;  4TXQ A;  3ZPJ A;  2DVW A;  3UKU G;  5HI7 A;  3F9W A;  3R7Q A;  3LY7 A;  3MO0 A;  3QDN A;  5AAO A;  3AS8 A;  4U0Z A;  3IEG A;  5ENN A;  1OWP A;  3PDN A;  4URK A;  3KSQ A;  3V79 K;  3C72 A;  4RSY A;  2MRI A;  3QNK A;  2GRO B;  3AU4 A;  1TNU A;  3NZS A;  2QC9 A;  3ENE A;  4ATZ D;  5KJK A;  1S70 B;  4L1B A;  4TXP A;  4BT8 A;  4I6J A;  4Q94 A;  3FUN A;  3VTY A;  2X6J A;  2VTB A;  4IRU A;  4ANW A;  2AWI A;  4ZHB A;  3I3N A;  1H3I A;  4CDN A;  1Z3Y A;  4JEH A;  3D3M A;  2IU1 A;  3UIP C;  3BG1 B;  3B13 A;  3DXK G;  3AG1 E;  3MKR A;  4FP7 A;  4JDS A;  2WXM A;  2W5Z A;  3GZ2 A;  4BET A;  4GA2 A;  5ARF A;  2PM6 A;  5KNH D;  4ACK A;  4CDR A;  5FT9 A;  4APF A;  5J90 A;  1N3J A;  1LD7 A;  3X2Q E;  4AJW A;  3DB5 A;  4PUC A;  5C2Y A;  3TG4 A;  2ION A;  2GGF A;  4U8Y D;  5BV1 A;  3S7D A;  4U04 A;  3UT7 A;  1AP7 A;  5JHA A;  2I9C A;  4B8C B;  4Q69 A;  4N2S A;  2PNN A;  5EIB E;  1O1R A;  3F9Y A;  4AOF A;  4YDE A;  3MKQ A;  4EZL A;  5JMN D;  2VGY A;  2AXU A;  4ILI A;  3M56 A;  2IOS A;  4CYM D;  3KSL A;  4G8K A;  3IXE A;  2PQN A;  4MBG A;  3UT4 A;  2LAH A;  4NRH B;  3MYV A;  4IJ8 A;  3M54 A;  3D9L A;  2WXH A;  3TXN A;  3DPD A;  4MS6 A;  5JJ0 A;  2F8X K;  2KXP C;  3D9J A;  4AV7 A;  2F0Y A;  3CK7 A;  1JPL A;  4AEZ C;  5CEA A;  3Q15 A;  3NOG D;  1W3B A;  4U07 A;  1S64 A;  4ZFH A;  1HFA A;  3MO5 A;  3EDT B;  3QB2 A;  3DRA A;  3BO5 A;  3FTS A;  4QEO A;  2Y1L E;  4U95 D;  2QYU A;  3BG0 B;  4HXI A;  3CKB A;  2VJ8 A;  2ZGD A;  4K0R A;  1U3D A;  4KYO B;  1TNZ A;  3QWW A;  4LEU A;  4CGV A;  3NAW A;  2UY1 A;  4PS3 A;  3PEU B;  3QKY A;  3ASH A;  5JIN A;  1TNY A;  4K5B A;  5LOZ A;  1WDY A;  2R05 A;  2XGO A;  5G55 A;  3F9X A;  2X6H A;  4KVO A;  2H6I A;  2X6F A;  4J83 A;  3HIZ A;  3SI5 A;  1UJK A;  2FBN A;  2C2L A;  3TWR A;  4F53 A;  4MLP A;  3T9K A;  4U96 D;  1OT8 A;  1FT2 A;  3TWV A;  3FEX A;  3LKU A;  2XGM A;  3QAR A;  4HRN A;  3B7R L;  3CHP A;  3CST A;  5G04 J;  3RRM B;  3MEK A;  4E85 A;  1BI8 B;  4DX1 A;  4A55 A;  3ML9 A;  4KZC A;  3L16 A;  3ZYQ A;  2H6G A;  1OWO A;  3N71 A;  4YND A;  3EHN A;  2WXJ A;  4XIF A;  4A1S A;  4C48 B;  3RKV A;  5T8I A;  1TNO A;  2DIW A;  4JLG A;  3KEZ A;  1RW2 A;  5AEN A;  1MHQ A;  3HG0 D;  3C3Q A;  4EQF A;  1H2U A;  1H2V C;  3FUI A;  3M5A A;  3E33 A;  2LAI A;  4FAD A;  2RFM A;  4J0U A;  5D0O D;  3M59 A;  5JA4 D;  4OVV A;  5F5E A;  5D2M C;  4HS2 A;  4Y6W A;  1MT6 A;  4ANX A;  1FT1 A;  3FY4 A;  3TL5 A;  3CVP A;  1E8Z A;  3D9N A;  5JJ7 A;  4OVU A;  5TEG A;  2VSO E;  2FEZ A;  3CGH A;  3NB2 A;  3W9G A;  1MX6 A;  4JPS A;  4N2Q A;  3ABL E;  1E8Y A;  1K8K G;  4G26 A;  1WAO 1;  4NQ0 A;  1QBQ A;  3R7R A;  3DST A;  4Y6C A;  4I51 A;  5E76 A;  2Y69 E;  1JCR A;  3OPE A;  5AN8 A;  3SFZ A;  1YMP A;  4H12 A;  3SQV A;  4UQY A;  5AQ7 A;  3EIJ A;  3PE3 A;  1N4R A;  4E6H A;  3HXC A;  3LEW A;  2X6I A;  3PUK A;  4N5C A;  4EEC A;  1A5E A;  4CCA A;  1D9S A;  4LG6 A;  3R9A B;  2WXP A;  4I2W A;  5ENS D;  1OWN A;  3EHR A;  1NI1 A;  4CRW A;  3URZ A;  4HB5 A;  3O4Z A;  2XRZ A;  2DZO A;  4TRQ A;  2R3A A;  2GRM A;  3FTV A;  3V2X A;  4YDY A;  5EN5 D;  1UW4 B;  3PRE A;  5G05 C;  4WNG A;  1TNB A;  5ENT D;  4UI9 C;  4UWK A;  2E0I A;  3JXJ A;  5BPP A;  2YQ8 A;  3W9F A;  1MVH A;  5BW8 C;  3Q47 B;  4I43 A;  4DI3 A;  3S8P A;  4JHJ A;  2DBA A;  2GW1 A;  4Q96 A;  4DUI A;  5KBA A;  4J7W A;  1N6A A;  4M3O A;  5FTP A;  4D10 C;  2Q7F A;  3JCK C;  4L2L A;  4ATG A;  4WND A;  3D9O A;  2WQH A;  3C3O A;  4KVM A;  2A4Z A;  4BSZ B;  1ZU2 A;  4JA7 A;  1OY3 D;  1N54 A;  2XEH A;  3Q9U C;  2BF0 X;  2IEJ A;  4FMU A;  2ZIS A;  2VGX A;  1QQE A;  1JCS A;  1DCE A;  4ACL A;  3UI2 A;  3CHO A;  1KPS B;  4G2V A;  5B1B E;  4GZ3 A;  2V8S E;  4YPU A;  5LSZ A;  3QWP A;  4J8E A;  4IJD A;  2CHX A;  1DNP A;  2WMN A;  3EUV A;  3LS8 A;  5ENO D;  5AJD A;  3DSS A;  4HFG A;  5BXO A;  1HG5 A;  4DX7 D;  3FTZ A;  3SO8 A;  5AQ9 A;  4XKB A;  4LSZ E;  3CK9 A;  4YNM A;  1O9S A;  1HS6 A;  2P9N G;  5F59 A;  1Z5S C;  2AVP A;  1IXV A;  3OXF A;  3S2A A;  1IHB A;  4DX6 D;  3V31 A;  3ZFW A;  2XQ0 A;  4J8F A;  4RLY A;  2I2O A;  4J8O A;  4OAU C;  3F6Q A;  3NF1 A;  5JHN A;  1G3N B;  1A17 A;  4JVS A;  4KT6 B;  3E32 A;  4GTQ A;  1JUQ A;  2B6C A;  5CER B;  4GA0 A;  2DWZ A;  3G2U A;  5CMW A;  2YHC A;  2X3M A;  3U9W A;  2WXG A;  1YA0 A;  3PRZ A;  3HNA A;  3UMV A;  4L9P A;  3FUK A;  3D9H A;  2P9K G;  4ANV A;  4V3I A;  1QZ2 A;  2HE0 A;  3ASF A;  1MJ0 A;  3FUH A;  4N3A A;  2PL2 A;  2KZT A;  4GTT A;  2LSU A;  1E8W A;  3CK8 A;  2OV8 A;  1NP7 A;  4RVB A;  5F6L A;  2WXL A;  2PZI A;  3VLF A;  3AS5 A;  4HBD A;  3RU0 A;  5KJL A;  3OS5 A;  4N3C A;  4U7E B;  4AVX A;  1OCR E;  2A5E A;  1TR4 A;  1V55 E;  3O48 A;  4XKC A;  3RO3 A;  5ENR D;  3UTM A;  3T5X A;  2GRR B;  1SVX A;  2R59 A;  3IKO B;  1AWC B;  2X6K A;  3DEP A;  2EIK E;  3DBS A;  1INZ A;  1TN7 A;  2EIJ E;  2P9S G;  3JYS A;  3ZN3 A;  2WXI A;  3IHY A;  3K9I A;  3EU9 A;  3T5V A;  3SZ7 A;  2ZGG A;  5B1A E;  3I5P A;  3ESK A;  2I1K A;  2HM8 A;  3Q9N C;  5LCW J;  1TJC A;  4EPZ A;  4K03 A;  1SA4 A;  3ABM E;  3E37 A;  4F6R D;  4ABN A;  4QEP A;  5G04 C;  3FDH A;  4O6F A;  5ENP D;  2EQX A;  4NIK A;  4KZ0 A;  4R7L A;  2XZT G;  1N4S A;  3QWV A;  5AYW D;  3SBS A;  2IO3 C;  1TYQ G;  5TTF A;  4LNB A;  2WM9 A;  4A3V A;  1MUF A;  2KCL A;  3T8K A;  1N9A A;  3C3R A;  3Q7F A;  3ULE G;  3I4G A;  1E96 B;  3CLJ A;  1HZ4 A;  2NYJ A;  4HLE A;  2PM7 A;  3KMT A;  1Z3X A;  4WUY A;  2IGQ A;  5T3R A;  4LDG A;  3CKC A;  1E90 A;  3UT8 A;  1OWL A;  3ZEF A;  4CEM A;  4LRZ A;  4GCO A;  3UM1 A;  3DXM G;  3EHM A;  3ASO E;  3P2B A;  2XGS A;  2O8J A;  4I1O B;  2BQZ A;  1FCH A;  4KXK B;  4ME2 A;  2VGE A;  3AG2 E;  4QFV A;  1BD8 A;  4APO A;  3ONL A;  5FZS A;  4YPE A;  3KMA A;  2F8Y A;  2XEV A;  1NZN A;  3TWX A;  3SGH A;  3M55 A;  3DAL A;  3D9I A;  1FVH A;  4FHJ A;  2HO1 A;  5EIL A;  4B94 A;  5HKP A;  2J4D A;  1OUV A;  2BUG A;  2OEW A;  1MYO A;  2I6H A;  1U3C A;  4GTO A;  5DIZ A;  1NL4 A;  3Q79 A;  4HVB A;  2W5Y A;  5LFA A;  2IO2 C;  2M63 A;  3VLD A;  3RJV A;  2AJA A;  4LUN U;  1BU9 A;  4DLQ A;  2AXV A;  4HNA D;  4O60 A;  4YNP A;  4C0E A;  4B0Z A;  3PNT B;  2KZT B;  5FQ7 A;  4JHK A;  3PZD A;  2WQ7 A;  5CEC B;  2BTD A;  1KZP A;  3VUZ A;  3IHX A;  3IHV A;  4LER A;  1HH8 A;  4P29 A;  4F3V A;  2F37 A;  4K5C A;  3UM2 A;  5CRV A;  2XRY A;  1MVX A;  1SZA A;  2E2E A;  3AG3 E;  3U66 A;  3ZYK A;  3VV0 A;  4G24 A;  2G46 A;  2LXL A;  5H7P A;  3GYZ A;  5ITZ F;  4BT9 A;  1HXI A;  3L9T A;  4N3B A;  2UY1 B;  3C5R A;  1U2V G;  2L6J A;  3HYM B;  3ML8 A;  5ANL A;  4UI9 K;  4LNU D;  4XI9 A;  1O5M A;  5EID A;  4ILG A;  3SBT B;  2GRP B;  1NA0 A;  1N0R A;  3HDX A;  1WY6 A;  5EX3 A;  1NFI E;  4U8V D;  4JA9 A;  4C9B B;  3MGB A;  4UWG A;  4GYW A;  3LJ3 A;  2C0L A;  4C0M A;  1IQU A;  4HOS A;  1Y6I A;  3B7B A;  3KMJ A;  2ETA A;  3U64 A;  4JD2 G;  3UIO C;  2WMO A;  3LVR E;  2JEK A;  4B93 B;  3SNX A;  2CFZ A;  4GB9 A;  5T0K A;  4UWF A;  3HHM A;  5JIY A;  4RG9 A;  3SHF A;  4A1G A;  4BEP A;  1K1A A;  3EHQ A;  4E47 A;  1ZKK A;  1LTX A;  3ABK E;  2YHE A;  3D9K A;  1PEG A;  1HE8 A;  4O1O A;  5FIN A;  3GZ1 A;  2KAT A;  1KT1 A;  2BED A;  3D9M A;  3CHS A;  1OXJ A;  2J8S D;  3FFL A;  4OYS A;  3JQ1 A;  5J08 A;  2EIM E;  3AG4 E;  1LD8 A;  2CFU A;  3DPY A;  4JZY A;  1E7V A;  2FUL A;  4AIF A;  3KAE A;  1X5B A;  5CMY A;  1MQS A;  5AQB A;  3PZ2 A;  3RK6 A;  2ETB A;  3AS4 A;  2WXF A;  3TWW A;  3HXE A;  2KCV A;  2YNQ A;  3FH5 A;  4PDX A;  1Q2Z A;  1TEZ A;  3ULY A;  3LYA A;  2VYI A;  4GTV A;  3MV2 B;  3D9P A;  3CVV A;  2B0O E;  3MO2 A;  5FIO A;  5FWQ A;  3AU5 A;  2UWJ G;  2J9Q A;  5T0M A;  4WNE A;  4LNG A;  4J7F A;  3R9M A;  3MX3 A;  3T8M A;  1XQH A;  2NXP A;  2L9B A;  4NUR A;  1S0P A;  1E7U A;  4DRX E;  2J08 A;  4BTB A;  1SW6 A;  1WG0 A;  2R17 C;  4J8S A;  2LXM A;  3OXL A;  4GTM A;  2WB2 A;  3TAX A;  3J5P A;  2IOL A;  1KZO A;  4JHR A;  5BV0 A;  1B89 A;  3CVY A;  3DSW A;  2ZIR A;  3ASD A;  3QK0 A;  1BLX B;  4I9C A;  4EZJ A;  5LCW C;  2V5Q C;  2V5F A;  2VSY A;  5JJ6 A;  3KD7 A;  5G2N A;  3HVE A;  3ZYL A;  2QYJ A;  2FO7 A;  1P5Q A;  4DPR A;  4J8D A;  4BY6 A;  3ZVV A;  4BWR A;  3HXB A;  5HS0 A;  3G2V A;  5F6K C;  5FQ4 A;  2Y3A A;  2WXR A;  4FLB A;  4HI9 A;  2IJG X;  3ZHE A;  4Z68 A;  3ZYM A;  5KJN A;  4XX5 A;  2ZU6 B;  4H7X A;  3PEV B;  3S7F A;  2NSZ A;  4GMR A;  2P9I G;  4EHM A;  5FQ8 A;  4OAV B;  3SY2 A;  3CBM A;  5ANR A;  3RIB A;  3HVE B;  4GZD A;  4YDW A;  4GTR A;  3G2S A;  2DYS E;  4AM9 A;  3UX4 A;  1EPU A;  3L22 A;  2XCC A;  3WG7 E;  4TXR A;  1HX8 A;  3SW9 A;  3LCA A;  3DEO A;  2JV0 A;  4MRU A;  1H0A A;  5T4Y A;  3MCX A;  5EKQ D;  1JWG A;  3J5Q B;  4JB8 P;  1VDY A;  3RRN B;  2VSN A;  4I1M A;  4GPM A;  2J07 A;  5ARG A;  2R2L A;  3U4T A;  1JCQ A;  5A23 A;  4WNF A;  3FUD A;  1H2T C;  4AY5 A;  3I4R B;  4HI8 A;  3F9Z A;  5D0Q D;  4GZC A;  3RRU A;  2R03 A;  2R02 A;  2WXN A;  2XPZ A;  1ELK A;  5BUZ A;  2L0I A;  4IN3 B;  3FUE A;  3OOI A;  3ZUV B;  1JWF A;  2XS1 A;  3EJN A;  4XI0 A;  1MX2 A;  3UIN C;  4GU5 A;  5ENQ D;  5AYF A;  4F7A A;  4WWP A;  2FO1 E;  5AIJ A;  4BX8 A;  1UN8 A;  4WWN A;  4LCT A;  3M57 A;  4N39 A;  4I1A A;  3FU5 A;  4XEI G;  4F1P A;  4XE0 A;  5BT1 A;  5CED B;  4A63 B;  2P9P G;  3SD5 A;  4HOU A;  1IHG A;  2XPY A;  2MOW A;  3Q5M A;  3PE4 A;  3DSV A;  4GAA A;  2PQR A;  1N52 A;  3DSU A;  3CSF A;  3ZU7 B;  1ZBP A;  3FPD A;  1H6O A;  4BTA A;  2FI7 A;  1SQM A;  4EZK A;  4RZ0 A;  3PH0 C;  1IQR A;  1QNF A;  4TV3 A;  2RFA A;  2L0T B;  1BPO A;  3CQG B;  4B89 A;  4BSX A;  3FUL A;  4AXH A;  5EDS A;  2P9U G;  4G11 A;  4GTP A;  4KMO A;  1SZ9 A;  4CGW A;  3E34 A;  2KBX A;  1HG2 A;  3MZL B;  5CBO A;  2CG3 A;  3M58 A;  5IY5 E;  1N11 A;  4N5Q A;  1N6C A;  4CDM A;  3U3W A;  4FU3 A;  3TWS A;  3G2T A;  4BES A;  2J09 A;  1PC2 A;  2XS8 A;  4UWH A;  4HOQ A;  1XNF A;  4I2Z A; 
#chains in the Genus database with same CATH homology
 5M72 A;  2AW6 A;  3U66 A;  3KS2 A;  3FTX A;  3FTV A;  3CVL A;  3GW4 A;  4FC8 A;  4H7Y A;  3ZYK A;  4DJA A;  3VV0 A;  4G24 A;  2G46 A;  3NZU A;  3CR3 A;  1UW4 B;  3GYZ A;  1KT0 A;  2WPV A;  3PRE A;  5CHE E;  4BT9 A;  1HXI A;  3APD A;  4N3B A;  2UY1 B;  3FTU A;  5G05 C;  4WNG A;  3JUI A;  3FUJ A;  4C1Q A;  4UI9 C;  3L6A A;  2E0I A;  4UWK A;  1ELR A;  2L6J A;  3OXG A;  3HYM B;  3ML8 A;  1OWM A;  5ANL A;  5JHB A;  4TUU A;  2WXO A;  3FWV A;  5BPP A;  3E4B A;  4UI9 K;  2YQ8 A;  3C98 A;  1GW6 A;  4U0S A;  4QEN A;  4DI4 A;  4XI9 A;  1MVH A;  5KCM A;  5BW8 C;  3Q47 B;  4EBA A;  3FEY A;  3Q49 B;  4I43 A;  4ILG A;  4DI3 A;  3SBT B;  1IYG A;  3FU6 A;  1NA0 A;  3S8P A;  3MKQ B;  4U0U A;  4JHJ A;  3UPV A;  2DBA A;  1H19 A;  2GW1 A;  2X38 A;  4Q96 A;  2QFC A;  3HDX A;  3CVW A;  3QAQ A;  3QJZ A;  5T5G A;  1WY6 A;  1N6A A;  3RQ4 A;  4GYY A;  4M3O A;  4AU7 A;  3ZW3 A;  3VTX A;  5KJM A;  5EX3 A;  5FTP A;  2VQ2 A;  3LPZ A;  3MV3 B;  5FQ6 A;  4D10 C;  4JA9 A;  2XHE A;  4C9B B;  2HR2 A;  1HF8 A;  2Q7F A;  3JCK C;  3UQ3 A;  4L2L A;  4YVO A;  4ATG A;  2Y4U A;  4WND A;  3D9O A;  2WQH A;  4CT0 A;  3MGB A;  4KVM A;  2A4Z A;  3IBE A;  4UWG A;  4PS7 A;  1NA3 A;  1H6K A;  4CT4 A;  3CVN A;  4MKT A;  4UI9 J;  4GYW A;  3LJ3 A;  4KBQ A;  2C0L A;  3L54 A;  1ZU2 A;  2CHW A;  4C0M A;  1IQU A;  5CCM A;  3FHE A;  4HOS A;  3L13 A;  1Y6I A;  4JA7 A;  3KMJ A;  2DCP A;  3SF4 A;  3U64 A;  1N54 A;  3NQP A;  3L08 A;  3ZPJ A;  2WMO A;  3LVR E;  5HI7 A;  3F9W A;  2JEK A;  3R7Q A;  5CCL A;  3LVQ E;  1Y8M A;  5EX0 A;  2CFZ A;  3LY7 A;  3QDN A;  3SNX A;  3CVX A;  3MO0 A;  2BF0 X;  3AS8 A;  2A5U A;  4GB9 A;  4JXT A;  4U0Z A;  4EBA G;  4FMU A;  5T0K A;  3IEG A;  2VGX A;  1QQE A;  5ENN A;  1OWP A;  3PDN A;  2KM4 A;  4UWF A;  4ACL A;  4URK A;  3HHM A;  3CHO A;  5JIY A;  4G2V A;  4RG9 A;  4RSY A;  3APC A;  3SHF A;  4A1G A;  5LX8 A;  4GZ3 A;  2V8S E;  4E47 A;  2MRI A;  3QNK A;  1ZKK A;  4YPU A;  3AU4 A;  3TJP A;  2YHE A;  3D9K A;  5LSZ A;  3QWP A;  3NZS A;  4GZ6 A;  1PEG A;  3ENE A;  4IUL A;  1HE8 A;  3JQ0 A;  4G25 A;  4DLO A;  5JJT A;  4I6E A;  5KJK A;  3GZ1 A;  2J4B A;  4J8E A;  2KAT A;  4IJD A;  2CHX A;  4L1B A;  1KT1 A;  2GRL A;  1DNP A;  2WMN A;  3APF A;  4BT8 A;  3D9M A;  4I6J A;  4J7I A;  4Q94 A;  4WWO A;  3FUN A;  3LS8 A;  5AJD A;  3CIA A;  4NAC A;  3CHS A;  3VTY A;  4HFG A;  2X6J A;  2YIN A;  1HG5 A;  2RFI A;  3FTZ A;  4XKB A;  3CVQ A;  3FFL A;  3B7U X;  2VTB A;  4OYS A;  1UN9 A;  3JQ1 A;  4FUL A;  5J08 A;  3FTY A;  3CK9 A;  4YNM A;  4I17 A;  5AJL A;  3PS6 A;  4IRU A;  4ANW A;  1O9S A;  2CFU A;  4JZY A;  1HS6 A;  1E7V A;  4MI0 A;  2FUL A;  2AWI A;  5F59 A;  2AVP A;  3I3N A;  4AIF A;  3KAE A;  1X5B A;  4J6I A;  3FUM A;  1H3I A;  2OOE A;  1Z3Y A;  4CDN A;  5HQ8 A;  2F69 A;  4JEH A;  5CMY A;  1MQS A;  2IQC A;  2IU1 A;  3D3M A;  3OXF A;  5EG2 A;  3BG1 B;  3S2A A;  1UG3 A;  3B13 A;  3ZGQ A;  3RK6 A;  1EF1 C;  2VTB B;  4ILH B;  3ZFW A;  3AS4 A;  3MKR A;  4FP7 A;  2XQ0 A;  4J8F A;  2WXF A;  4JDS A;  2WXM A;  2W5Z A;  1HU3 A;  2VGX B;  3GZ2 A;  5FZQ A;  3TGO A;  2I2O A;  2KCV A;  4PH4 B;  4GZ5 A;  4B8A A;  4GA2 A;  4J8O A;  2YNQ A;  2PM6 A;  3FH5 A;  4L23 A;  3NF1 A;  4PDX A;  5ARF A;  4ACK A;  3Q4A B;  4CDR A;  5FT9 A;  5JHN A;  1TEZ A;  1A17 A;  4JVS A;  4U63 A;  3LYA A;  2VYI A;  2R5S A;  4KT6 B;  4APF A;  4GPK A;  5J90 A;  3MV2 B;  5E75 A;  1N3J A;  3D9P A;  1JUQ A;  3VLE A;  3CVV A;  4GA0 A;  4BX9 A;  3MO2 A;  2KC7 A;  4AJW A;  3G2U A;  5CMW A;  5FWQ A;  3DB5 A;  3AU5 A;  2YHC A;  4PUC A;  2V4L A;  2X3M A;  3U9W A;  4HOR A;  5DBK A;  2UWJ G;  5C2Y A;  5CPR B;  3ONK A;  3TG4 A;  3LXU X;  2J9Q A;  5T0M A;  2ION A;  1YA0 A;  2WXG A;  2GGF A;  3ESL A;  3L17 A;  3PRZ A;  4WNE A;  3HNA A;  3UMV A;  4J7F A;  5BV1 A;  1WM5 A;  2OND A;  3S7D A;  3EIQ C;  3FUK A;  1UJJ A;  4U04 A;  3UT7 A;  3CV0 A;  5JHA A;  2I9C A;  4ANV A;  4B8C B;  5FJY A;  3MX3 A;  3LY9 A;  4Q69 A;  3T8M A;  1XQH A;  2NXP A;  4V3I A;  4N2S A;  2L9B A;  5C1D A;  3F9Y A;  1QZ2 A;  4NUR A;  4AOF A;  4MI5 A;  1S0P A;  3ASF A;  3FUH A;  4N3A A;  1E7U A;  2KZT A;  2PL2 A;  5FZR A;  3MKQ A;  2J08 A;  4G1T A;  4EZL A;  2LSU A;  4BTB A;  2VGY A;  3MA5 A;  4JL0 A;  1E8W A;  3CK8 A;  2R17 C;  2OV8 A;  1NP7 A;  2AXU A;  4GCN A;  4ILI A;  4J8S A;  3OXL A;  4RVB A;  5A7D B;  5F6L A;  4RG6 A;  2WXL A;  2CHZ A;  2PZI A;  3M56 A;  3PVL A;  3VLF A;  2IOS A;  3AS5 A;  1DVP A;  2PQN A;  2WB2 A;  3IV0 A;  4JEU A;  3TAX A;  3RU0 A;  5KJL A;  2IOL A;  4JHR A;  3UT4 A;  2LAH A;  3OS5 A;  4NRH B;  5BV0 A;  3CHM A;  3LDZ A;  1B89 A;  4N3C A;  3MYV A;  4AVX A;  3GZS A;  4IJ8 A;  4GA1 A;  3LY8 A;  3CVY A;  3M54 A;  3D9L A;  3ASD A;  2WXH A;  3TXN A;  3RAY A;  1PAQ A;  3QK0 A;  3DPD A;  4I9C A;  4UQX A;  4JW1 A;  4EZJ A;  5LCW C;  4MS6 A;  4YPA A;  5JJ0 A;  2V5F A;  2VSY A;  3O48 A;  5JJ6 A;  4XKC A;  3D9J A;  3RO3 A;  3CK7 A;  4AV7 A;  1JPL A;  3KD7 A;  5G2N A;  4L2Y A;  4AEZ C;  3Q15 A;  5G05 J;  1W3B A;  3HVE A;  4U07 A;  3T5X A;  3FH8 A;  3ZYL A;  4ANU A;  2R59 A;  3IKO B;  2X6K A;  1HFA A;  1INZ A;  3DBS A;  3MO5 A;  4FHK A;  2FO7 A;  3EDT B;  3QB2 A;  1P5Q A;  4DPR A;  4J8D A;  2KCK A;  4BY6 A;  3ZVV A;  3BO5 A;  1L5J A;  3FTS A;  3JYS A;  3ZN3 A;  4BWR A;  1TJF A;  4QEO A;  2WXI A;  4I9E A;  2XCB A;  3IHY A;  3BG0 B;  2HYZ A;  3G2V A;  3K9I A;  5FQ4 A;  3T5V A;  5F6K C;  2Y3A A;  4HXI A;  3CKB A;  3SZ7 A;  2WXR A;  3I5P A;  4FLB A;  2IJG X;  3ESK A;  3ZHE A;  3TXM A;  3ZYM A;  2VJ8 A;  5KJN A;  2I1K A;  1EYH A;  2HM8 A;  4XX5 A;  2ZU6 B;  4H7X A;  4K0R A;  3SWC A;  3PEV B;  4GMJ A;  3CHQ A;  3S7F A;  1U3D A;  2RG8 A;  4GYO A;  1TJC A;  2NSZ A;  2LO6 A;  4EPZ A;  4K03 A;  5LCW J;  4KYO B;  2CG2 A;  4XZ4 A;  3QWW A;  4LEU A;  5FQ8 A;  4CGV A;  2V0P A;  3CBM A;  2UY1 A;  4PS3 A;  3PEU B;  3QKY A;  5ANR A;  3HVE B;  3RIB A;  3ASH A;  4GZD A;  4ABN A;  4QEP A;  5JIN A;  5G04 C;  3G2S A;  3FDH A;  4AM9 A;  5LOZ A;  2XGO A;  3FH7 A;  4O6F A;  2EQX A;  3UX4 A;  4KZ0 A;  3B7S A;  4R7L A;  2I1J A;  1EPU A;  4FJZ A;  3QWV A;  5AYW D;  5G55 A;  3F9X A;  2X6H A;  3SBS A;  3CHR A;  3ZRH A;  5TTF A;  4KVO A;  2WM9 A;  3L22 A;  3ULQ A;  5BNW A;  2XCC A;  2QY7 A;  2X6F A;  4J83 A;  3HIZ A;  3OAW A;  3SI5 A;  4A3V A;  3ASG A;  1UJK A;  2C0M A;  2FBN A;  2IF4 A;  2C2L A;  1HX8 A;  3SW9 A;  1MUF A;  3LCA A;  2LSV A;  2KCL A;  4FLH A;  4F53 A;  2WQ6 A;  4MLP A;  5LSX A;  1Z6T A;  3I4G A;  1E96 B;  2JV0 A;  3CLJ A;  1HZ4 A;  3FU0 A;  3M53 A;  4MRU A;  1H0A A;  1KLX A;  3CEQ A;  4U8H A;  5T4Y A;  3S7B A;  3MCX A;  5EKQ D;  4HLE A;  3CBP A;  1JWG A;  3FEX A;  2PM7 A;  3LKU A;  4O30 A;  1VDY A;  3RRN B;  2XGM A;  2VSN A;  3QAR A;  3KMT A;  3FP3 A;  4I1M A;  2J07 A;  3B7R L;  3CHP A;  5ARG A;  3CST A;  3U4T A;  5G04 J;  1Z3X A;  4NJ5 A;  1HO8 A;  3RRM B;  3MEK A;  4WUY A;  4E85 A;  5A23 A;  5T3R A;  4WNF A;  3FUD A;  2IGQ A;  3CKC A;  4LDG A;  3QOU A;  1E90 A;  4I6G A;  1H2T C;  4AY5 A;  3ML9 A;  4A55 A;  3I4R B;  2XPI A;  4KZC A;  3UT8 A;  4FJY A;  3L16 A;  1OWL A;  3ZEF A;  3F9Z A;  3ZYQ A;  4CEM A;  5D0Q D;  4GZC A;  3RRU A;  1ML9 A;  4LRZ A;  1OWO A;  3CBO A;  3N71 A;  2XPZ A;  2WXN A;  4YND A;  3EHN A;  4G23 A;  2QPW A;  1ELK A;  5BUZ A;  2WXJ A;  4GCO A;  4XIF A;  2L0I A;  4A1S A;  3EHM A;  3FTW A;  3RKV A;  4IN3 B;  4YVQ C;  3FUE A;  5T8I A;  4Z4P A;  3OOI A;  3CVU A;  3P2B A;  2XGS A;  1JWF A;  2NC9 A;  3PNL B;  2O8J A;  3EJN A;  4I1O B;  4XI0 A;  2BQZ A;  2WXQ A;  2DIW A;  1FCH A;  3KEZ A;  4GU5 A;  2AXZ A;  4JLG A;  4AY6 A;  4KXK B;  5AYF A;  4ME2 A;  3RO2 A;  4F7A A;  1MHQ A;  4WWP A;  5AEN A;  5AIJ A;  3BEE A;  4QFV A;  3OTN A;  3S7J A;  5TH7 A;  4BX8 A;  1UN8 A;  2WVI A;  4APO A;  4WWN A;  4EQF A;  4HOT A;  1H2U A;  4LCT A;  3ONL A;  1H2V C;  3M57 A;  4N39 A;  5FZS A;  4I1A A;  2Y4T A;  4YPE A;  3FU5 A;  3ZHE B;  3KMA A;  3FUI A;  4XE0 A;  2P58 C;  5BT1 A;  3M5A A;  2LAI A;  2XEV A;  2OVB A;  4FAD A;  3SD5 A;  2J49 A;  4HOU A;  1ELW A;  1NZN A;  3MJW A;  1IHG A;  4J0U A;  5D0O D;  3UUX A;  2XPY A;  3M59 A;  4OVV A;  4PS8 A;  2MOW A;  3Q5M A;  3SGH A;  3PE4 A;  3B7T A;  3M55 A;  5F5E A;  3DAL A;  4GAA A;  2PQR A;  1N52 A;  1E8X A;  3CSF A;  4HS2 A;  4Y6W A;  3D9I A;  1MT6 A;  1FVH A;  4FHJ A;  4ANX A;  3K5K A;  4F1S A;  2HO1 A;  3FY4 A;  3FU3 A;  3TL5 A;  4DK5 A;  1ZBP A;  4B94 A;  3ZIM A;  5LP0 A;  3CVP A;  1E8Z A;  2J4D A;  4NVQ A;  3FPD A;  1OUV A;  2BUG A;  3D9N A;  5JJ7 A;  4OVU A;  4BTA A;  2FI7 A;  1SQM A;  4EZK A;  5TEG A;  2I6H A;  4BUP A;  2VSO E;  2ILR A;  4RZ0 A;  4L7T A;  3PH0 C;  2FEZ A;  1IQR A;  1QNF A;  4TV3 A;  3CGH A;  1U3C A;  5DIZ A;  4AP2 A;  3WXX A;  4JPS A;  4N2Q A;  2L0T B;  1BPO A;  3CQG B;  1E8Y A;  4W9R A;  4HVB A;  4G26 A;  4B89 A;  4BSX A;  1WAO 1;  3FUL A;  4A3T A;  4AXH A;  4NQ0 A;  5EDS A;  2W5Y A;  5LFA A;  3R7R A;  4Y6C A;  3EP0 A;  4I51 A;  4G11 A;  5E76 A;  2M63 A;  4KMO A;  1SZ9 A;  3PUJ A;  3VLD A;  4CGW A;  3OPE A;  3P1U A;  3RJV A;  4LUN U;  4UQZ A;  3FUF A;  4DLQ A;  1PY1 A;  3SFZ A;  1HG2 A;  3CQC B;  1EDU A;  3MZL B;  2AXV A;  3M58 A;  2CG3 A;  2OVF A;  4H12 A;  4WAF A;  2MHK A;  2VSX E;  4IYP A;  4UWL A;  1XGW A;  3ZXS A;  4UQY A;  2LNI A;  4BFR A;  4YNP A;  3QC1 A;  4JC8 A;  4C0E A;  3EIJ A;  3PE3 A;  3G2W A;  4B0Z A;  3PNT B;  4E6H A;  1N6C A;  3LEW A;  2KZT B;  2X6I A;  3PUK A;  5FQ7 A;  4JHK A;  3PZD A;  4N5C A;  4CDM A;  2WQ7 A;  3RJW A;  2BTD A;  4EEC A;  3U3W A;  4CCA A;  4FU3 A;  3G2T A;  3R9A B;  4GML A;  2J09 A;  2WXP A;  1PC2 A;  4I2W A;  1LF8 A;  1OWN A;  3VUZ A;  4UWH A;  2FF4 A;  3IHX A;  3IHV A;  4CRW A;  4LER A;  3URZ A;  1HH8 A;  5A6C A;  4P29 A;  2JLB A;  2WXK A;  3O4Z A;  4F3V A;  2IFU A;  2XRZ A;  4HOQ A;  3TG5 A;  2XRY A;  1XNF A;  4FA6 A;  4TRQ A;  1MVX A;  2RD0 A;  2R3A A;  4I2Z A;  1FVF A;  1SZA A;  2E2E A;  2GRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...