5ARFA

Smyd2 in complex with small molecule inhibitor compound-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5arfA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5arfA01
2C0LA 4YPAA 4KBQA 4BT8A 3EP0A 4ME2A 3KMJA 4YVQC 4WUYA 2Y4UA 3RJVA 4QENA 3K9IA 2VGYA 1NA3A 3TAXA 2IGQA 4AU7A 3Q5MA 3CBOA 3OXGA 3LYAA 2VQ2A 4JL0A 2XCCA 3LCAA 2JV0A 3RQ4A 3CVPA 2HR2A 3K5KA 3ZGQA 4G2VA 3VUZA 3M54A 2KC7A 4KXKB 5A7DB 3VV0A 3QDNA 5G04J 5KJMA 5EX0A 4I51A 3UUXA 2V5FA 4MI0A 5T5GA 5ARFA 4EQFA 3FFLA 3F9WA 4GPKA 3LY8A 4UI9C 5FZQA 3ULQA 4A1SA 1ZBPA 3CKCA 4Y6CA 1MUFA 3RKVA 2XGOA 3ASFA 3DALA 3SWCA 4IJ8A 5HI7A 4UQXA 2VGXA 4GZ6A 1KLXA 4NQ0A 4Z4PA 1E96B 2XGMA 2KCVA 3M58A 3KAEA 3ZN3A 2BQZA 4KYOB 4JA9A 2L6JA 1XNFA 3RJWA 3BEEA 3HYMB 4N39A 4NVQA 4HOQA 1WAO1 3MO2A 3PE3A 4HORA 2FEZA 4BTBA 3RU0A 5BT1A 3FP3A 5CCLA 4FMUA 4JDSA 5M72A 1XQHA 2VYIA 3SW9A 4I2ZA 3URZA 4H12A 5F6KC 2KCLA 3MV2B 2R3AA 2P58C 4U0SA 2HO1A 3NF1A 5ARGA 3JYSA 2OOEA 2FF4A 3M57A 3CEQA 1MVXA 5FZRA 4GYOA 3FWVA 5AYWD 4GYWA 3CVNA 4I1AA 4J8OA 3EDTB 4CGWA 4J7FA 3E4BA 3ZPJA 1ELWA 3CK7A 2LSVA 3IHXA 4IJDA 4O30A 3U3WA 5KJNA 3TG5A 3OOIA 4I9EA 3F9ZA 3PE4A 2LSUA 4GA0A 3Q49B 2VGXB 4U07A 3M56A 1A17A 3S7BA 5G05C 4N2SA 2PZIA 5DBKA 4J8EA 3S7JA 4F3VA 3MO0A 1MT6A 4I9CA 4APOA 4J83A 1N3JA 4GA2A 4N3BA 3TG4A 4N3AA 2XGSA 3UQ3A 3OPEA 4BUPA 1B89A 3KS2A 4GA1A 3BO5A 3Q15A 2FBNA 3QWPA 4GYYA 4JA7A 3ESKA 5LSZA 3AS5A 3GZ1A 2NC9A 3OXLA 3PDNA 3S7FA 3ZHEB 5G04C 2LNIA 3QWWA 4RG6A 2IF4A 4BWRA 1FCHA 3CBPA 4G25A 3KMTA 4NRHB 5JJ0A 2PL2A 4B94A 3M55A 4NJ5A 3ASDA 4CGVA 4RZ0A 1IYGA 4LEUA 5D0OD 3N71A 4UI9J 2UY1A 2Y4TA 1KT1A 4N5CA 5F6LA 3DB5A 4G23A 2FO7A 4UQZA 4YNDA 2AVPA 2YQ8A 4HOUA 1HH8A 5BNWA 3GZ2A 1ZKKA 2IFUA 4GCOA 3GYZA 2GW1A 4J8FA 5FZSA 3VTXA 4AY5A 4I17A 5JINA 3LPZA 4H7XA 4N2QA 4GZ3A 5TTFA 5JHNA 2HYZA 5HQ8A 3AS8A 1PEGA 3WXXA 2KCKA 2C2LA 2WQHA 1O9SA 3RO2A 2VSYA 2PQNA 2R5SA 4C1QA 4G24A 2O8JA 5F5EA 5LCWC 3RAYA 3GW4A 2XCBA 1N6CA 3Q47B 4WNGA 4E47A 1P5QA 3CKBA 5A6CA 5EX3A 4UI9K 2WPVA 1ML9A 4AM9A 5FTPA 4I2WA 4G1TA 1TJCA 3QWVA 1PC2A 4HOSA 1NA0A 3MV3B 2E2EA 3CVLA 4J8DA 3S7DA 1ZU2A 3F9XA 2I6HA 3QOUA 4WNEA 5F59A 3CVQA 3CBMA 3ZFWA 2PQRA 2XEVA 4YVOA 4N3CA 4U0UA 3M5AA 1H3IA 3U4TA 5TEGA 2KATA 2W5YA 4AY6A 2QFCA 3M53A 5BW8C 5CPRB 2G46A 5G05J 4RG9A 5DIZA 5EKQD 1YA0A 2F69A 2VSNA 1N6AA 4UQYA 3VTYA 5EG2A 2C0MA 4YNMA 3RO3A 1NZNA 1HXIA 3CV0A 3FPDA 2QPWA 3ASHA 2FI7A 3O48A 2JLBA 2RFIA 4MI5A 4GCNA 3QKYA 3UPVA 2YHCA 4BT9A 3RIBA 4AIFA 3F9YA 4BTAA 4GZ5A 4YPUA 4WNFA 4IN3B 2J9QA 2ONDA 4Y6WA 1ELRA 4U04A 3MA5A 3ASGA 3MO5A 2UWJG 3MEKA 1Y8MA 3OXFA 4ABNA 4J0UA 4XIFA 4J7IA 1HZ4A 4XI9A 3LKUA 4JLGA 2MHKA 3R9AB 5T0MA 4WNDA 2XPIA 3SZ7A 5FJYA 3Q4AB 3KMAA 4QEOA 1OUVA 4XI0A 4H7YA 3IEGA 5T0KA 4JHRA 1WM5A 5JIYA 1QZ2A 4G26A 3AS4A 1QQEA 3KD7A 2Q7FA 3M59A 4U0ZA 3S8PA 1IHGA 4O6FA 5JJTA 4YNPA 3LY7A 3CK9A 4HOTA 5LCWJ 3ZHEA 3LY9A 5JJ7A 5CCMA 5TH7A 5FT9A 5KJLA 5D0QD 4W9RA 5CHEE 5JJ6A 3SF4A 3OS5A 5AYFA 4LDGA 5LSXA 3MKRA 2UY1B 4YPEA 5KJKA 1MVHA 1W3BA 3TGOA 2W5ZA 1KT0A 3HNAA 4QEPA 5C1DA 3CK8A 2BUGA 4CDRA 2DBAA
chains in the Genus database with same CATH superfamily
4KBQA 3PUJA 1HO8A 4ME2A 2CG2A 4DX2A 2XRYA 4I6EA 3IBEA 2Y4UA 4QENA 4X8QA 1WG0A 2EINE 2WXQA 3ML8A 3NZSA 3MCXA 1NA3A 3Q5MA 4GTVA 5EIBE 1BPOA 1RZ4A 3R7RA 5IY5E 2VQ2A 3ZRHA 2A5EA 3UMVA 2JV0A 2WXKA 1GW6A 5CERB 4HLEA 3I4RB 1V54E 3PZ4A 3P2BA 4KXKB 5FQ7A 5AN8A 3PZ3A 4JC8A 5LOZA 2CHWA 4ANWA 3UUXA 3AG1E 5T5GA 4EQFA 3SI5A 3U9WA 3F9WA 4R7LA 1TNOA 1BD8A 2QYUA 2XQ0A 3RRUA 4FLHA 2KZTA 3ZEFA 4GTSA 4U7EB 3ULEG 3RKVA 2P9KG 1JCQA 2R02A 1G3NB 2OVFA 4Q94A 4IJ8A 5HI7A 2R03A 3HVEA 4MLPA 3IXEA 4QQIA 4Z4PA 1NL4A 2KCVA 3M58A 4LNBA 3ZN3A 2BEDA 4L9PA 4JA9A 4L2YA 3RJWA 3BEEA 3NBNB 3ISMC 4N39A 4NVQA 2I1KA 3D9NA 3ONLA 4BTBA 1EDUA 1D8EA 5BT1A 3FP3A 1JWFA 4K0RA 4F1PA 2H6HA 2QY7A 1DCEA 2P58C 4UUCA 3W9GA 3FU3A 2OOEA 3APCA 5ITZF 5J08A 1WDYA 3HIZA 3EDTB 4CGWA 4HBDA 2WXRA 4O30A 4UWHA 3U3WA 1HE8A 3ZYMA 1OCRE 3TG5A 4HXIA 4I9EA 3PE4A 2AWIA 2VGXB 4ACKA 2XZDG 2OV8A 3QARA 3L13A 4NACA 3ZUVB 5CBNA 5AARA 3V30A 5LFAA 3MO0A 1MT6A 4ATZD 4J83A 4HFGA 2VSXE 3NAWA 4GA2A 4CZ2D 3DSTA 3FEXA 3OPEA 3SFZA 4E6HA 4BUPA 3KS2A 3ASNE 2FBNA 4GYYA 3ESKA 3OXLA 4HRNA 3S7FA 3APFA 3AAAC 4RG6A 4BWRA 4YDYA 3CBPA 3FTYA 4NRHB 3KMTA 5JJ0A 1H2UA 4NJ5A 3MGBA 3AG4E 2QC9A 4CGVA 1Y6IA 3ABLE 1HS6A 2AXZA 1MHQA 3EHQA 2XPZA 2Y4TA 4G23A 2FO7A 4TRQA 5BNWA 4GCOA 4DX5D 2GW1A 3PNTB 3VTXA 5CEDB 3Q79A 4I17A 1Z6TA 3LPZA 2RD0A 4JVSA 5HQ8A 2DZNA 3WXXA 2C2LA 1JPLA 2CHZA 2O8JA 2R05A 2VTBB 3UTMA 1P5QA 5EX3A 5BV0A 4B8AA 5AIJA 1OCZE 1TJCA 2F8YA 2IU1A 1PAQA 3PH0C 4PS7A 2RFMA 2E2EA 3VLFA 4Q96A 4FJZA 3S7DA 3FUEA 4WWOA 3DEPA 4WNEA 2LXMA 3CVQA 3E30A 4EPZA 3CBMA 3ZFWA 3HXBA 2XPYA 1Z3YA 4LNGA 4F1SA 5EDSA 3U4TA 4A1GA 1UJKA 2W5YA 3ZKJA 4AY6A 4BY6A 2G46A 2X6HA 5G05J 3EU9A 5EKQD 1YA0A 1N6AA 3VTYA 2Y0BG 1NZNA 4GMLA 4AXHA 2X6KA 3L16A 3CV0A 3FUMA 4HS2A 2QPWA 2XZTG 4ILHB 5FINA 2X3MA 3QKYA 4ILGA 5ANRA 4EZJA 1BU9A 4AIFA 4MBGA 1DC2A 4GZ5A 4WNFA 4UWKA 2J9QA 5ENSD 1TN7A 4YDEA 3PEUB 4NIKA 3MA5A 2OCCE 4OAUC 3ASGA 3DPDA 2UWJG 3MEKA 4V3IA 4JZYA 4J7IA 4DX6D 3ZXPA 3R9AB 4LCTA 5T0MA 2XPIA 3KMAA 1OUVA 3R7QA 2V4HC 3LVQE 3IEGA 1JWGA 3BUAA 1UN8A 3S2AA 2MRIA 2GRRB 1Q2ZA 3IHVA 2I9CA 5JIYA 1QZ2A 3D9LA 2A4ZA 3ZYQA 3B13A 3EHRA 1QQEA 1DVPA 1D9SA 3FUKA 3KD7A 4HVBA 4U0ZA 3DXKG 1DNPA 3Q75A 4O6FA 3LY7A 3PREA 3SO8A 2XRZA 4KVMA 3V79K 4EBAG 1HX8A 4DLQA 5JJ7A 1U3DA 3AU5A 3UT7A 5D0QD 5AYFA 3MKQB 3MKRA 5CMWA 1PY1A 4GTOA 4RLYA 5FQ6A 2CFUA 3HNAA 1KZOA 3SBTB 4U95D 5T3RA 1Z5SC 2C0LA 1V55E 3FEYA 4I6JA 5ENOD 2PM7A 4YVQC 3RJVA 3PRZA 3K9IA 3ZW3A 2VGYA 1IQUA 4GMJA 3TWVA 3RK6A 3B7SA 3UKRG 5BXOA 3OXGA 2L9BA 3JUEA 4L7TA 2CG3A 1ZB1A 2BKGA 4EZKA 4DUIA 2GGFA 1E8YA 2XCCA 4RVBA 3RQ4A 4TV3A 3Q9NC 1N4PA 1N11A 2YHEA 2QYJA 3ZGQA 1NI1A 2YNQA 4G2VA 3VUZA 1N9AA 4XKBA 2J8SD 4BSXA 4BETA 5KJMA 4I51A 1X5BA 1KPSB 2V5FA 3TXNA 3FFLA 4UWFA 4GPKA 3RSEG 1N0RA 2V4LA 3BG0B 1JUQA 1ZBPA 2X38A 4D10C 3ZXSA 4GPMA 2XGOA 3ASFA 1FVFA 3EU5A 1S64A 4GZ6A 1KLXA 1FT1A 4NQ0A 4AJWA 4U8VD 4GZDA 2XGMA 2A5UA 4M7CA 3C3OA 2HE0A 2BQZA 4KYOB 2L6JA 3HYMB 3V2XA 4URKA 1AP7A 2P9NG 1WAO1 3RU0A 5JMND 4MS6A 3UT8A 4ANXA 3SW9A 4H12A 1TJFA 3T8KA 3NF1A 5ARGA 5EIDA 3FU5A 3TWUA 4LERA 5C2YA 5JHBA 1MVXA 4GU5A 2E0IA 1SZ9A 4I1AA 3UKUG 1EF1C 4CCAA 4J7FA 2B0OE 3ENEA 2LSVA 4IJDA 4G8KA 4J6IA 3AJIA 2ZGDA 5HRYA 1SA5A 4Q69A 4OAVB 5B3SE 4U96D 2PZIA 3J5QB 5DBKA 4J8EA 4F3VA 2EQXA 2PNNA 4XEIG 1N3JA 4K5AB 1EYHA 4L1BA 3TG4A 2GRQB 3PZ1A 3R9MA 1KZPA 4OVUA 5H7PA 3I3NA 1QNFA 5AQAA 2R59A 3Q15A 4JA7A 4KMOA 5LSZA 2NC9A 3PDNA 3NB2A 5D66A 1Z3XA 4CYMD 2H6IA 3QWWA 5AQ7A 3PS6A 3CIAA 2P9UG 2MOWA 4G25A 4B94A 3ASOE 3ZU7B 3AU4A 2Y3AA 3G2VA 4RZ0A 4LEUA 4PDXA 4EECA 3CLJA 5AQBA 3FDHA 1KT1A 2KXPC 3RRMB 4UQZA 3FU6A 1JCSA 4CT0A 1TR4A 4FP7A 2YQ8A 4HOUA 3GZ2A 5ENPD 5JA4D 2ETAA 1ZKKA 1E7UA 2ZISA 5FZSA 3D9IA 2IO2C 4H7XA 2HM8A 2WXPA 2J49A 3OTNA 3AS8A 1PEGA 1MYOA 2I1JA 2KCKA 2Y1LE 2WQHA 1O9SA 2BKKB 2VGEA 1O1TA 2DYRE 4IYPA 3FTZA 3FUIA 5F5EA 3ML9A 5LCWC 1N54A 3DRAA 4PUCA 4PS8A 1N6CA 4HLLA 4E47A 3ZIMA 4GTPA 4I2WA 4G1TA 5CRUA 1H0AA 2OEVA 3QWVA 2WXGA 4KZ0A 3CVLA 2ZIRA 4ACLA 3SGHA 2GRPB 2P2CP 3B7TA 4FADA 5F59A 2WXHA 3CVUA 2PQRA 4YVOA 3CSFA 4U0UA 2H6GA 4QFVA 2H6FA 3QB2A 4DK5A 3M53A 5BW8C 5CPRB 2ZXWE 1H2TC 3QC1A 3TWSA 4IRUA 2F69A 4U63A 4YNMA 3UI2A 2EIKE 3C5RA 3CHOA 4JD2G 4HI9A 3FPDA 2FI7A 1E90A 3O48A 5AAOA 5D2MC 1S0PA 2RFIA 4GCNA 3LDZA 3J5PA 1LTXA 4B89A 2LXLA 4BT9A 3RIBA 2GROB 3F9YA 4YPUA 4IN3B 3MYVA 4BEPA 2LAHA 1A5EA 5CRVA 4C0MA 1HF8A 5J90A 4L23A 4DJAA 1Y8MA 2V5QC 3PEVB 4TUUA 4DX7D 4J0UA 1MX6A 1HZ4A 4P29A 1OWNA 3LKUA 1OT8A 4JLGA 2MHKA 3SZ7A 1L5JA 3Q4AB 4QEOA 3UX4A 1OCCE 2DZOA 3PUKA 3Q7FA 4FULA 2WMOA 3G2TA 3FUNA 1WM5A 4B8CB 4JEHA 1N4RA 3G2SA 2P9PG 1AWCB 1UW4B 5JHAA 3AS4A 2XHEA 2RFAA 3CQCB 2EILE 4HOTA 4WWPA 3LY9A 3BU8A 5FT9A 1TN6A 4W9RA 1SA4A 2NSZA 5BPPA 5LSXA 5T8IA 2UY1B 1OCOE 5EILA 4O1OA 1MVHA 1W3BA 4CRWA 1LF8A 2GRMA 3L54A 3RAUA 4DRXE 3ZYKA 3CK8A 3QJZA 2BUGA 5AJLA 4YPAA 4LNUD 4BT8A 3SFYA 4B93B 1NP7A 1K1AA 1E8WA 4TXPA 2L0TB 4FU3A 4I6GA 4M3OA 3VLEA 1TNBA 3TAXA 1RW2A 4AU7A 5E75A 3CBOA 3V31A 4O60A 2VSOE 3FUDA 3Q9UC 2WMNA 4ATGA 4JL0A 3QAQA 2OVBA 3CVPA 3K5KA 4TXRA 2J4BA 3M54A 5BXUA 2KC7A 5A7DB 5ENTD 4BESA 3VV0A 4U8YD 5G04J 2VTBA 2BTDA 2EIJE 3UM2A 4WWNA 5ARFA 1LD7A 3EHMA 3LY8A 4UI9C 5FZQA 3ULQA 2DIWA 1TEZA 2X6IA 5BUZA 3CVXA 1MUFA 4XX5A 5EYPF 3G2WA 4GMRA 3DALA 3SWCA 2X6FA 2LO6A 3I4GA 3L22A 4UQXA 4HNAD 3ZVVA 1INZA 4A63B 2XS1A 2IONA 2XS8A 1E96B 3L6AA 3UM0A 3KAEA 4HI8A 3CHMA 3IHYA 1UG3A 1XNFA 1N4SA 3LEWA 1UOHA 3MO2A 3KSQA 3LXUX 3PE3A 2FEZA 1N95A 4AVXA 1TNZA 1IQRA 3JXJA 4ZHBA 4A3TA 3D9JA 4JDSA 3T9KA 1XQHA 2VYIA 2IY0C 4I2ZA 1E7VA 3ABME 3FTXA 2KCLA 3HXEA 4E85A 1MZCA 2R3AA 4GB9A 5F6KC 1BLXB 3LJNA 3JYSA 2FF4A 3DBSA 5FZRA 2IEJA 1HG2A 3HXDA 4GYWA 1OWOA 1QBQA 5HKPA 2L6BA 4FA6A 4A3VA 3E4BA 3UM1A 4WAFA 1ELWA 3CVYA 1MQSA 3JXIA 3SBSA 3L82A 3CK7A 1JCRA 3IHXA 3NZUA 3Q73A 5KJNA 4A55A 2LSUA 3D9HA 2R17C 3TXMA 3SY2A 4U07A 4GTTA 3S7BA 3PVLA 4N2SA 4I1MA 1BI8B 2NYJA 3S7JA 4GTRA 4I9CA 2WXOA 5CECB 4U8HA 5E76A 3T5XA 4N3BA 3VLDA 1FPPA 3FH8A 2XGSA 3UQ3A 2AJAA 1B89A 4AP2A 4DI4A 4YDOA 3BO5A 1YMPA 1YYHA 5HS0A 3GZ1A 3ZHEB 2LNIA 3DSSA 3FTUA 4K03A 2WXLA 3CSTA 3M55A 3ULYA 1VDYA 2I2OA 3CQGB 5D0OD 4C48B 3N71A 3MKQA 5CEAA 4N5CA 4I43A 3UINC 3DB5A 1QYMA 4TXQA 4YNDA 2WQ6A 3F6QA 3FH5A 2IFUA 3QK0A 4PS3A 3GYZA 3UXGA 4XZ4A 4J8FA 4AY5A 3G2UA 4FHKA 5JINA 1MX2A 2QZAA 3MZLB 3EIJA 3C98A 2AXUA 1FVHA 5AJDA 5TTFA 2HYZA 5JHNA 2R2LA 3ONKA 3RO2A 2IJGX 2VSYA 5CMYA 5LX8A 2LUHA 4C1QA 1UJJA 2WQ7A 3Q47B 4WNGA 3CKBA 4UI9K 5KNGA 1ML9A 4AM9A 5FTPA 3EJNA 1DCQA 2P9IG 2KZTB 1PC2A 4HOSA 1NA0A 4J8DA 4JB8P 4DPRA 3F9XA 2I6HA 3E32A 3QOUA 3B7BA 1OY3D 5B1BE 4EBAA 3HVEB 5T4YA 3FTWA 2ZGGA 3D9OA 1U3CA 4N3CA 3CVWA 1H3IA 1SQMA 2KATA 2QFCA 5DIZA 4GAAA 5EG2A 1BI7B 3FH7A 4JXTA 1ELKA 1HXIA 4G8LA 1N52A 4AV7A 2GRLA 2J07A 3ASHA 5KBAA 2JLBA 2YHCA 1O5MA 3O4ZA 3KEAA 2BF0X 2DCPA 2ONDA 4ANUA 4FJYA 3UT4A 1ELRA 4FC8A 3MO5A 3C3RA 4G11A 4HRMB 1K1BA 4ABNA 3UIPC 3D9MA 4XIFA 2V8SE 4XI9A 3T5VA 3U64A 2J09A 3SNXA 1UN9A 1O1RA 1K3ZD 2YINA 3FUJA 1TNYA 4RQIA 3HXFA 4GZCA 4YDWA 5FJYA 1TN8A 5AQ9A 5BV1A 4EHMA 3L9TA 1H19A 2WXJA 4EZLA 3LVRE 4OYSA 4G26A 5ENQD 3PZ2A 3Q7AA 1HU3A 2ZU6B 3AG3E 3TWRA 3M59A 3IKOB 2IQCA 3S8PA 2WXMA 3FHEA 3CK9A 1SW6A 3E33A 5LCWJ 5G55A 1MX4A 1HG5A 5TH7A 5CHEE 3SF4A 3OS5A 4FHJA 2VJ8A 3KSLA 2XEEA 2P9LG 2DVWA 3CHPA 1H6OA 1EPUA 4N5QA 4MKTA 2W5ZA 4BX8A 4QEPA 1MJ0A 2ETBA 5C1DA 4APFA 1YCSB 5FQ8A 3EP0A 4BX9A 3TWTA 3KMJA 4WUYA 2CFZA 3DSVA 2ETCA 3HXCA 3C72A 2IGQA 1S70B 4XKCA 3SHFA 2XEHA 3LYAA 3LCAA 4AEZC 2HR2A 1XGWA 3NOGD 2KBXA 3E37A 3E34A 4HRLA 2ILRA 3DSWA 3QDNA 3B95A 5EX0A 1S63A 3FTVA 4HQDA 4MI0A 1SVXA 4BFRA 4K5CA 4C9BB 4A1SA 3FUHA 3HDXA 5AENA 3CKCA 4Y6CA 3ABKE 4F6RD 3FULA 3D3MA 3L17A 3P1UA 3HG0D 4J8YA 3HRAA 2F37A 2FO1E 2VGXA 3X2QE 4JHKA 3LS8A 3LJ3A 1K8KG 4LUNU 3BG1B 3T8MA 4CDNA 4FLBA 3TWXA 4HOQA 3CVVA 3ZNGA 4HORA 2Y69E 3EHNA 4UWLA 5CCLA 4FMUA 1HFAA 4O1PA 3FU0A 2KM4A 4BSZB 1TNUA 5M72A 3URZA 3MV2B 1WY6A 4U0SA 2HO1A 3M57A 3CEQA 4L2LA 2AW6A 3TWQA 2CHXA 4GYOA 1H6PA 3FWVA 5AYWD 1OWPA 2L0IA 3CVNA 4ILIA 4UWGA 3DWLG 5ENRD 4J8OA 5ANLA 3APDA 3TJPA 3ZPJA 4F53A 2JEKA 3OOIA 3DXMG 3F9ZA 4GA0A 3Q49B 3M56A 1A17A 3B7UX 5G05C 3DSXA 2OEWA 4HB5A 3DEOA 4APOA 4C0EA 4ZFHA 4N3AA 4CEMA 4GA1A 5KCMA 4CDMA 4GTMA 3QWPA 2J4DA 3AS5A 4J7WA 1H6KA 5G04C 3I5PA 2DYSE 2RKKA 4DI3A 5KNHD 2IF4A 4KVOA 1FCHA 4NURA 2PL2A 3ASDA 3QNKA 1IHBA 5G2NA 1IYGA 4UI9J 2UY1A 2EIME 4GTQA 5F6LA 3MX3A 3JQ0A 1IXVA 2AVPA 2PM6A 3CR3A 1HH8A 3PZDA 3L08A 5FIOA 4K5BA 2IO3C 3EUVA 1OXJA 3PNLB 4ANVA 1OWLA 4N2QA 2F0YA 4KT6B 4GZ3A 2IOLA 3SQVA 5KWDA 3V2OA 2PQNA 2R5SA 5EYLA 4G24A 4TUMA 2RG8A 3RAYA 3FY4A 3GW4A 2XCBA 3C3QA 3IV0A 4DX1A 5A6CA 2MYOA 2JABA 2WPVA 2F8XK 4LRZA 4JPSA 3AG2E 3MV3B 4CT4A 4LSZE 3Q78A 2WM9A 1ZU2A 2X6JA 1H2VC 2NXPA 2WB2A 4AOFA 3FUFA 3BQOA 2XEVA 4JW1A 1D8DA 3DPYA 3M5AA 4Z68A 5B1AE 5TEGA 3HHMA 2LAIA 5FQ4A 1X81A 1SZAA 4IULA 4RG9A 1E8ZA 1OWMA 2DWZA 4KZCA 2VSNA 4UQYA 3GZSA 3NQPA 2C0MA 3D9KA 4XE0A 5A23A 3RO3A 3UM3A 3CHSA 3NOCD 3MJWA 4F7AA 2AXVA 4JHJA 4MI5A 3DSUA 4DLOA 3UIOC 3UPVA 3TWWA 2V0PA 3FTSA 4BTAA 3JCKC 4Y6WA 4LG6A 3KEZA 4U04A 2J08A 1FT2A 3OXFA 2P9SG 1IKND 3D9PA 3ZYLA 1N0QA 4JEUA 1N94A 5FWQA 1NFIE 3CHRA 4WNDA 5ENNA 2GRNB 1LD8A 3SD5A 3CHQA 2WVIA 4XI0A 4H7YA 4MRUA 2WXIA 1O1SA 5T0KA 3OAWA 4JHRA 4J8SA 2XENA 2FULA 1TYQG 2B6CA 4I1OB 5EN5D 4B0ZA 4OVVA 3JUIA 3ESLA 2IOSA 3B7RL 2Q7FA 3U66A 1N4QA 4PH4B 4BERA 1IHGA 5JJTA 4YNPA 3JQ1A 1U2VG 1E8XA 2WXNA 3W9FA 3ZHEA 5LP0A 5CCMA 3EIQC 5KJLA 4RSYA 5JJ6A 4LDGA 5CBOA 3TL5A 4YPEA 5KJKA 3CGHA 3TGOA 1KT0A 2WXFA 3RRNB 2M63A 4CDRA 3WG7E 3SFXA 2DBAA
chains in the Genus database with same CATH topology
2C0LA 4YPAA 4APFA 4KBQA 4BT8A 3FEYA 5FQ8A 3EP0A 3PUJA 4BX9A 1HO8A 1NP7A 4I6JA 4ME2A 2CG2A 1E8WA 3KMJA 2PM7A 2XRYA 4I6EA 3IBEA 4YVQC 2L0TB 4WUYA 2Y4UA 2CFZA 3RJVA 4QENA 4FU3A 3PRZA 2WXQA 3K9IA 3ML8A 4I6GA 4M3OA 3VLEA 3NZSA 3ZW3A 3MCXA 2VGYA 1IQUA 1NA3A 4GMJA 3TAXA 2IGQA 4AU7A 5E75A 3Q5MA 3CBOA 3RK6A 3B7SA 3OXGA 2L9BA 2VSOE 3FUDA 1BPOA 4L7TA 2CG3A 4XKCA 3SHFA 3R7RA 4EZKA 2WMNA 2GGFA 3LYAA 2VQ2A 4ATGA 4JL0A 1E8YA 2XCCA 4RVBA 3QAQA 3LCAA 2OVBA 3UMVA 3ZRHA 2WXKA 1GW6A 4TV3A 2JV0A 3RQ4A 3CVPA 4AEZC 2HR2A 4HLEA 1XGWA 2YHEA 3K5KA 3ZGQA 3I4RB 2J4BA 2YNQA 4G2VA 5F6KC 3VUZA 3P2BA 3M54A 4XKBA 2KC7A 4KXKB 5FQ7A 5A7DB 3VV0A 2ILRA 4BSXA 4JC8A 3QDNA 5G04J 5LOZA 2VTBA 2BTDA 2CHWA 4ANWA 5KJMA 5EX0A 4I51A 3UUXA 1X5BA 3FTVA 2V5FA 3TXNA 4MI0A 4WWNA 5ARFA 3SI5A 3FFLA 3U9WA 3EHMA 3LY8A 4UWFA 4EQFA 4GPKA 4R7LA 4UI9C 3F9WA 4BFRA 5FZQA 4C9BB 3ULQA 2DIWA 4A1SA 1TEZA 2X6IA 3FUHA 3HDXA 2V4LA 2XQ0A 3BG0B 1JUQA 4FLHA 3RRUA 5AENA 1ZBPA 2X38A 2KZTA 3CKCA 3ZEFA 4Y6CA 4D10C 5BUZA 3CVXA 1MUFA 4XX5A 3FULA 3ZXSA 3G2WA 3RKVA 3D3MA 2XGOA 3ASFA 3L17A 3DALA 2OVFA 3P1UA 3SWCA 2X6FA 2LO6A 4Q94A 1FVFA 4IJ8A 5HI7A 3I4GA 2VGXA 3L22A 4UQXA 4GZ6A 3ZVVA 1INZA 1KLXA 3HVEA 4MLPA 4NQ0A 2IONA 4AJWA 4Z4PA 1E96B 3L6AA 4GZDA 2XGMA 2KCVA 4JHKA 3LS8A 2A5UA 3M58A 3LJ3A 3KAEA 4LUNU 3ZN3A 2BQZA 3CHMA 4KYOB 3BG1B 3IHYA 1UG3A 2L6JA 4JA9A 4L2YA 1XNFA 4FLBA 3T8MA 3BEEA 4CDNA 3RJWA 3HYMB 4URKA 4N39A 3LEWA 4NVQA 2I1KA 4HOQA 1WAO1 3MO2A 3CVVA 3D9NA 3LXUX 3PE3A 4HORA 2FEZA 3ONLA 4BTBA 1EDUA 3RU0A 4AVXA 1IQRA 5BT1A 3FP3A 3EHNA 4MS6A 4UWLA 3UT8A 5CCLA 4FMUA 4ANXA 1JWFA 4K0RA 1HFAA 4A3TA 3D9JA 3FU0A 4JDSA 2KM4A 5M72A 2QY7A 1XQHA 2VYIA 3SW9A 4I2ZA 1E7VA 3URZA 3FTXA 2KCLA 3MV2B 4E85A 4H12A 1WY6A 1TJFA 2P58C 4GB9A 2R3AA 4U0SA 2HO1A 3NF1A 5ARGA 3FU5A 3FU3A 3JYSA 4LERA 2OOEA 2FF4A 3DBSA 5C2YA 3M57A 3CEQA 4L2LA 2AW6A 5JHBA 1MVXA 5FZRA 4GU5A 3APCA 2CHXA 4GYOA 1HG2A 3FWVA 5AYWD 1OWPA 2L0IA 5J08A 4GYWA 2E0IA 3CVNA 1SZ9A 3HIZA 4I1AA 1OWOA 4ILIA 4UWGA 4J8OA 5ANLA 3EDTB 1EF1C 4A3VA 4CCAA 4FA6A 3E4BA 4CGWA 4J7FA 3APDA 4WAFA 3TJPA 3ZPJA 1ELWA 3CVYA 1MQSA 3ENEA 3SBSA 3CK7A 2LSVA 2WXRA 3IHXA 4IJDA 4O30A 4UWHA 4F53A 3NZUA 3U3WA 1HE8A 3ZYMA 4J6IA 2JEKA 3TG5A 4HXIA 4I9EA 4A55A 3PE4A 5KJNA 3F9ZA 3OOIA 2LSUA 4GA0A 3Q49B 2AWIA 2R17C 2VGXB 4ACKA 3TXMA 2OV8A 4U07A 3M56A 1A17A 3B7UX 3L13A 3QARA 4Q69A 3S7BA 4NACA 3PVLA 5G05C 4N2SA 4I1MA 2PZIA 5DBKA 5LFAA 4J8EA 3S7JA 4F3VA 3MO0A 2EQXA 1MT6A 4I9CA 2WXOA 4APOA 4C0EA 4J83A 4HFGA 1N3JA 2VSXE 4U8HA 5E76A 4GA2A 4N3BA 3T5XA 1EYHA 3VLDA 4L1BA 3TG4A 3FH8A 4N3AA 2XGSA 3FEXA 3UQ3A 3OPEA 3SFZA 4CEMA 4E6HA 4BUPA 1B89A 3KS2A 4GA1A 5KCMA 4AP2A 4CDMA 4DI4A 4OVUA 3BO5A 3I3NA 1QNFA 2R59A 2FBNA 3Q15A 3QWPA 4GYYA 4JA7A 4KMOA 3ESKA 2J4DA 3AS5A 5LSZA 3GZ1A 2NC9A 3OXLA 1H6KA 3PDNA 3S7FA 3ZHEB 5G04C 3I5PA 4DI3A 1Z3XA 2LNIA 3APFA 3QWWA 3FTUA 2IF4A 4KVOA 4RG6A 3PS6A 1FCHA 4BWRA 3CIAA 2MOWA 4K03A 3CBPA 2WXLA 4G25A 3FTYA 4NRHB 4NURA 3KMTA 1H2UA 2PL2A 4B94A 5JJ0A 3CSTA 3M55A 4NJ5A 3ASDA 3AU4A 3MGBA 3QNKA 1VDYA 2Y3AA 2I2OA 3CQGB 3G2VA 4CGVA 1Y6IA 5G2NA 4RZ0A 1HS6A 1IYGA 4LEUA 2AXZA 5D0OD 1MHQA 3N71A 4PDXA 4EECA 3MKQA 3CLJA 2UY1A 3FDHA 2XPZA 4UI9J 2Y4TA 1KT1A 4N5CA 5F6LA 3MX3A 4I43A 3JQ0A 3RRMB 4G23A 2FO7A 3DB5A 4UQZA 3FU6A 4YNDA 4CT0A 4TRQA 4FP7A 2AVPA 2PM6A 2YQ8A 3CR3A 1HH8A 4HOUA 5BNWA 2WQ6A 3FH5A 3GZ2A 1ZKKA 2IFUA 1E7UA 3QK0A 4GCOA 3PZDA 4PS3A 3L08A 3GYZA 2GW1A 3PNTB 4XZ4A 4J8FA 5FZSA 3VTXA 4AY5A 3G2UA 4FHKA 4I17A 1Z6TA 3D9IA 5JINA 3PNLB 3LPZA 4ANVA 4H7XA 1OWLA 4N2QA 2HM8A 2WXPA 2J49A 3MZLB 4KT6B 3EIJA 2RD0A 2AXUA 3C98A 1FVHA 4GZ3A 5AJDA 2HYZA 3OTNA 3AS8A 4JVSA 3WXXA 5HQ8A 1PEGA 5TTFA 2I1JA 2KCKA 2C2LA 2WQHA 1JPLA 2IOLA 3ONKA 1O9SA 3RO2A 2IJGX 2VSYA 5CMYA 5LX8A 2PQNA 2CHZA 2R5SA 4IYPA 3FTZA 4C1QA 3FUIA 4G24A 2O8JA 5F5EA 3ML9A 2RG8A 5LCWC 1UJJA 3RAYA 3FY4A 1N54A 4PS8A 4PUCA 3GW4A 2VTBB 2WQ7A 2XCBA 1N6CA 3IV0A 3Q47B 4WNGA 4E47A 3ZIMA 1P5QA 3CKBA 5A6CA 5EX3A 5BV0A 4B8AA 4UI9K 2WPVA 1ML9A 4AM9A 5FTPA 4I2WA 5AIJA 4G1TA 3EJNA 1TJCA 3PH0C 2IU1A 1PAQA 4PS7A 1H0AA 3QWVA 4LRZA 2KZTB 4JPSA 1PC2A 4HOSA 1NA0A 2WXGA 3MV3B 4KZ0A 4CT4A 2E2EA 3CVLA 3VLFA 4J8DA 4Q96A 4FJZA 3S7DA 2WM9A 3FUEA 4ACLA 5JHNA 1ZU2A 2X6JA 4WWOA 4DPRA 1H2VC 2NXPA 3F9XA 2I6HA 3QOUA 4WNEA 2WB2A 3SGHA 3B7TA 4FADA 4AOFA 4EBAA 5F59A 3HVEB 3CVQA 5T4YA 2WXHA 4EPZA 3CBMA 3ZFWA 2XPYA 3FUFA 3FTWA 1Z3YA 3CVUA 2PQRA 2XEVA 4JW1A 4YVOA 4F1SA 3CSFA 3D9OA 5EDSA 1U3CA 4N3CA 4U0UA 3CVWA 1H3IA 3M5AA 1SQMA 3U4TA 4A1GA 1UJKA 5TEGA 4QFVA 2KATA 3HHMA 2W5YA 3QB2A 4AY6A 2QFCA 4DK5A 2LAIA 5FQ4A 5BW8C 4BY6A 3M53A 5CPRB 2G46A 2X6HA 1SZAA 1H2TC 4IULA 5G05J 4RG9A 5DIZA 1E8ZA 5EKQD 3QC1A 1OWMA 1YA0A 4IRUA 4KZCA 4GAAA 2VSNA 2F69A 4U63A 1N6AA 4UQYA 3GZSA 3VTYA 5EG2A 3NQPA 2C0MA 3D9KA 4XE0A 4YNMA 3FH7A 4JXTA 1ELKA 5A23A 3RO3A 1NZNA 4GMLA 4AXHA 1HXIA 3CHSA 3CHOA 2X6KA 3MJWA 4F7AA 3L16A 3CV0A 1N52A 3FUMA 4HS2A 3FPDA 2AXVA 2GRLA 2J07A 3ASHA 2FI7A 4JHJA 1E90A 3O48A 4AV7A 2QPWA 4ILHB 1S0PA 2JLBA 2RFIA 4MI5A 4GCNA 4DLOA 3LDZA 2X3MA 3QKYA 4ILGA 5ANRA 3UPVA 4B89A 4EZJA 2YHCA 4BT9A 2V0PA 3RIBA 3O4ZA 4AIFA 3F9YA 3FTSA 4BTAA 4GZ5A 3JCKC 4YPUA 4WNFA 4IN3B 4UWKA 2J9QA 2BF0X 2DCPA 2ONDA 2LAHA 3MYVA 4Y6WA 4ANUA 4FJYA 3KEZA 3UT4A 1ELRA 4U04A 2J08A 4C0MA 3PEUB 1HF8A 3MA5A 5J90A 3ASGA 4L23A 3DPDA 4FC8A 4DJAA 3MO5A 2UWJG 3R7QA 3MEKA 1Y8MA 3OXFA 3PEVB 4G11A 4V3IA 4TUUA 4JZYA 4ABNA 3D9MA 4J0UA 4XIFA 4J7IA 1HZ4A 2V8SE 3D9PA 4JEUA 4XI9A 3ZYLA 3T5VA 3U64A 4P29A 5FWQA 1OWNA 3LKUA 2J09A 3SNXA 1UN9A 3CHRA 2YINA 3FUJA 4JLGA 2MHKA 3R9AB 4LCTA 4WNDA 5T0MA 2XPIA 3SZ7A 5ENNA 4GZCA 5FJYA 1L5JA 3Q4AB 3KMAA 3SD5A 4QEOA 3UX4A 1OUVA 2WVIA 3CHQA 3LVQE 3PUKA 3IEGA 2WXIA 4H7YA 1JWGA 4MRUA 4XI0A 4FULA 2WMOA 5T0KA 3G2TA 5BV1A 3OAWA 1UN8A 4JHRA 4J8SA 2MRIA 2FULA 3FUNA 3S2AA 1WM5A 4B8CB 1H19A 4JEHA 2WXJA 3IHVA 2I9CA 4EZLA 3LVRE 5JIYA 3G2SA 1QZ2A 4OYSA 3D9LA 4G26A 2A4ZA 3ZYQA 3B13A 1UW4B 5JHAA 4I1OB 3AS4A 1QQEA 4B0ZA 1DVPA 4OVVA 2XHEA 1HU3A 3JUIA 2ZU6B 3FUKA 3ESLA 2IOSA 3B7RL 2Q7FA 3KD7A 4HVBA 3U66A 3IKOB 3M59A 2IQCA 4PH4B 4U0ZA 3S8PA 1DNPA 3CQCB 1IHGA 4O6FA 2WXMA 5JJTA 4YNPA 3FHEA 3LY7A 3PREA 3JQ1A 3CK9A 1E8XA 2XRZA 2WXNA 4KVMA 4HOTA 4WWPA 5LCWJ 5G55A 4EBAG 3ZHEA 1HX8A 3LY9A 4DLQA 5JJ7A 5CCMA 5LP0A 1U3DA 3AU5A 1HG5A 3EIQC 5T5GA 5FT9A 3UT7A 5TH7A 5KJLA 5D0QD 4RSYA 4W9RA 5CHEE 5JJ6A 3SF4A 4FHJA 3OS5A 5AYFA 2NSZA 2VJ8A 4LDGA 5BPPA 5LSXA 3MKQB 3MKRA 5T8IA 5CMWA 2UY1B 3TL5A 1PY1A 4YPEA 5KJKA 3CGHA 1W3BA 3CHPA 1MVHA 1EPUA 5FQ6A 3TGOA 4CRWA 1LF8A 4MKTA 2W5ZA 2GRMA 1KT0A 2WXFA 3L54A 4BX8A 2CFUA 3HNAA 4QEPA 3SBTB 3RRNB 5C1DA 3ZYKA 2M63A 3CK8A 3QJZA 5T3RA 2BUGA 4CDRA 2DBAA 5AJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0L A;  4YPA A;  4KBQ A;  4BT8 A;  3EP0 A;  4ME2 A;  3KMJ A;  4YVQ C;  4WUY A;  2Y4U A;  3RJV A;  4QEN A;  3K9I A;  2VGY A;  1NA3 A;  3TAX A;  2IGQ A;  4AU7 A;  3Q5M A;  3CBO A;  3OXG A;  3LYA A;  2VQ2 A;  4JL0 A;  2XCC A;  3LCA A;  2JV0 A;  3RQ4 A;  3CVP A;  2HR2 A;  3K5K A;  3ZGQ A;  4G2V A;  3VUZ A;  3M54 A;  2KC7 A;  4KXK B;  5A7D B;  3VV0 A;  3QDN A;  5G04 J;  5KJM A;  5EX0 A;  4I51 A;  3UUX A;  2V5F A;  4MI0 A;  5T5G A;  5ARF A;  4EQF A;  3FFL A;  3F9W A;  4GPK A;  3LY8 A;  4UI9 C;  5FZQ A;  3ULQ A;  4A1S A;  1ZBP A;  3CKC A;  4Y6C A;  1MUF A;  3RKV A;  2XGO A;  3ASF A;  3DAL A;  3SWC A;  4IJ8 A;  5HI7 A;  4UQX A;  2VGX A;  4GZ6 A;  1KLX A;  4NQ0 A;  4Z4P A;  1E96 B;  2XGM A;  2KCV A;  3M58 A;  3KAE A;  3ZN3 A;  2BQZ A;  4KYO B;  4JA9 A;  2L6J A;  1XNF A;  3RJW A;  3BEE A;  3HYM B;  4N39 A;  4NVQ A;  4HOQ A;  1WAO 1;  3MO2 A;  3PE3 A;  4HOR A;  2FEZ A;  4BTB A;  3RU0 A;  5BT1 A;  3FP3 A;  5CCL A;  4FMU A;  4JDS A;  5M72 A;  1XQH A;  2VYI A;  3SW9 A;  4I2Z A;  3URZ A;  4H12 A;  5F6K C;  2KCL A;  3MV2 B;  2R3A A;  2P58 C;  4U0S A;  2HO1 A;  3NF1 A;  5ARG A;  3JYS A;  2OOE A;  2FF4 A;  3M57 A;  3CEQ A;  1MVX A;  5FZR A;  4GYO A;  3FWV A;  5AYW D;  4GYW A;  3CVN A;  4I1A A;  4J8O A;  3EDT B;  4CGW A;  4J7F A;  3E4B A;  3ZPJ A;  1ELW A;  3CK7 A;  2LSV A;  3IHX A;  4IJD A;  4O30 A;  3U3W A;  5KJN A;  3TG5 A;  3OOI A;  4I9E A;  3F9Z A;  3PE4 A;  2LSU A;  4GA0 A;  3Q49 B;  2VGX B;  4U07 A;  3M56 A;  1A17 A;  3S7B A;  5G05 C;  4N2S A;  2PZI A;  5DBK A;  4J8E A;  3S7J A;  4F3V A;  3MO0 A;  1MT6 A;  4I9C A;  4APO A;  4J83 A;  1N3J A;  4GA2 A;  4N3B A;  3TG4 A;  4N3A A;  2XGS A;  3UQ3 A;  3OPE A;  4BUP A;  1B89 A;  3KS2 A;  4GA1 A;  3BO5 A;  3Q15 A;  2FBN A;  3QWP A;  4GYY A;  4JA7 A;  3ESK A;  5LSZ A;  3AS5 A;  3GZ1 A;  2NC9 A;  3OXL A;  3PDN A;  3S7F A;  3ZHE B;  5G04 C;  2LNI A;  3QWW A;  4RG6 A;  2IF4 A;  4BWR A;  1FCH A;  3CBP A;  4G25 A;  3KMT A;  4NRH B;  5JJ0 A;  2PL2 A;  4B94 A;  3M55 A;  4NJ5 A;  3ASD A;  4CGV A;  4RZ0 A;  1IYG A;  4LEU A;  5D0O D;  3N71 A;  4UI9 J;  2UY1 A;  2Y4T A;  1KT1 A;  4N5C A;  5F6L A;  3DB5 A;  4G23 A;  2FO7 A;  4UQZ A;  4YND A;  2AVP A;  2YQ8 A;  4HOU A;  1HH8 A;  5BNW A;  3GZ2 A;  1ZKK A;  2IFU A;  4GCO A;  3GYZ A;  2GW1 A;  4J8F A;  5FZS A;  3VTX A;  4AY5 A;  4I17 A;  5JIN A;  3LPZ A;  4H7X A;  4N2Q A;  4GZ3 A;  5TTF A;  5JHN A;  2HYZ A;  5HQ8 A;  3AS8 A;  1PEG A;  3WXX A;  2KCK A;  2C2L A;  2WQH A;  1O9S A;  3RO2 A;  2VSY A;  2PQN A;  2R5S A;  4C1Q A;  4G24 A;  2O8J A;  5F5E A;  5LCW C;  3RAY A;  3GW4 A;  2XCB A;  1N6C A;  3Q47 B;  4WNG A;  4E47 A;  1P5Q A;  3CKB A;  5A6C A;  5EX3 A;  4UI9 K;  2WPV A;  1ML9 A;  4AM9 A;  5FTP A;  4I2W A;  4G1T A;  1TJC A;  3QWV A;  1PC2 A;  4HOS A;  1NA0 A;  3MV3 B;  2E2E A;  3CVL A;  4J8D A;  3S7D A;  1ZU2 A;  3F9X A;  2I6H A;  3QOU A;  4WNE A;  5F59 A;  3CVQ A;  3CBM A;  3ZFW A;  2PQR A;  2XEV A;  4YVO A;  4N3C A;  4U0U A;  3M5A A;  1H3I A;  3U4T A;  5TEG A;  2KAT A;  2W5Y A;  4AY6 A;  2QFC A;  3M53 A;  5BW8 C;  5CPR B;  2G46 A;  5G05 J;  4RG9 A;  5DIZ A;  5EKQ D;  1YA0 A;  2F69 A;  2VSN A;  1N6A A;  4UQY A;  3VTY A;  5EG2 A;  2C0M A;  4YNM A;  3RO3 A;  1NZN A;  1HXI A;  3CV0 A;  3FPD A;  2QPW A;  3ASH A;  2FI7 A;  3O48 A;  2JLB A;  2RFI A;  4MI5 A;  4GCN A;  3QKY A;  3UPV A;  2YHC A;  4BT9 A;  3RIB A;  4AIF A;  3F9Y A;  4BTA A;  4GZ5 A;  4YPU A;  4WNF A;  4IN3 B;  2J9Q A;  2OND A;  4Y6W A;  1ELR A;  4U04 A;  3MA5 A;  3ASG A;  3MO5 A;  2UWJ G;  3MEK A;  1Y8M A;  3OXF A;  4ABN A;  4J0U A;  4XIF A;  4J7I A;  1HZ4 A;  4XI9 A;  3LKU A;  4JLG A;  2MHK A;  3R9A B;  5T0M A;  4WND A;  2XPI A;  3SZ7 A;  5FJY A;  3Q4A B;  3KMA A;  4QEO A;  1OUV A;  4XI0 A;  4H7Y A;  3IEG A;  5T0K A;  4JHR A;  1WM5 A;  5JIY A;  1QZ2 A;  4G26 A;  3AS4 A;  1QQE A;  3KD7 A;  2Q7F A;  3M59 A;  4U0Z A;  3S8P A;  1IHG A;  4O6F A;  5JJT A;  4YNP A;  3LY7 A;  3CK9 A;  4HOT A;  5LCW J;  3ZHE A;  3LY9 A;  5JJ7 A;  5CCM A;  5TH7 A;  5FT9 A;  5KJL A;  5D0Q D;  4W9R A;  5CHE E;  5JJ6 A;  3SF4 A;  3OS5 A;  5AYF A;  4LDG A;  5LSX A;  3MKR A;  2UY1 B;  4YPE A;  5KJK A;  1MVH A;  1W3B A;  3TGO A;  2W5Z A;  1KT0 A;  3HNA A;  4QEP A;  5C1D A;  3CK8 A;  2BUG A;  4CDR A;  2DBA A; 
#chains in the Genus database with same CATH topology
 4KBQ A;  3PUJ A;  1HO8 A;  4ME2 A;  2CG2 A;  4DX2 A;  2XRY A;  4I6E A;  3IBE A;  2Y4U A;  4QEN A;  4X8Q A;  1WG0 A;  2EIN E;  2WXQ A;  3ML8 A;  3NZS A;  3MCX A;  1NA3 A;  3Q5M A;  4GTV A;  5EIB E;  1BPO A;  1RZ4 A;  3R7R A;  5IY5 E;  2VQ2 A;  3ZRH A;  2A5E A;  3UMV A;  2JV0 A;  2WXK A;  1GW6 A;  5CER B;  4HLE A;  3I4R B;  1V54 E;  3PZ4 A;  3P2B A;  4KXK B;  5FQ7 A;  5AN8 A;  3PZ3 A;  4JC8 A;  5LOZ A;  2CHW A;  4ANW A;  3UUX A;  3AG1 E;  5T5G A;  4EQF A;  3SI5 A;  3U9W A;  3F9W A;  4R7L A;  1TNO A;  1BD8 A;  2QYU A;  2XQ0 A;  3RRU A;  4FLH A;  2KZT A;  3ZEF A;  4GTS A;  4U7E B;  3ULE G;  3RKV A;  2P9K G;  1JCQ A;  2R02 A;  1G3N B;  2OVF A;  4Q94 A;  4IJ8 A;  5HI7 A;  2R03 A;  3HVE A;  4MLP A;  3IXE A;  4QQI A;  4Z4P A;  1NL4 A;  2KCV A;  3M58 A;  4LNB A;  3ZN3 A;  2BED A;  4L9P A;  4JA9 A;  4L2Y A;  3RJW A;  3BEE A;  3NBN B;  3ISM C;  4N39 A;  4NVQ A;  2I1K A;  3D9N A;  3ONL A;  4BTB A;  1EDU A;  1D8E A;  5BT1 A;  3FP3 A;  1JWF A;  4K0R A;  4F1P A;  2H6H A;  2QY7 A;  1DCE A;  2P58 C;  4UUC A;  3W9G A;  3FU3 A;  2OOE A;  3APC A;  5ITZ F;  5J08 A;  1WDY A;  3HIZ A;  3EDT B;  4CGW A;  4HBD A;  2WXR A;  4O30 A;  4UWH A;  3U3W A;  1HE8 A;  3ZYM A;  1OCR E;  3TG5 A;  4HXI A;  4I9E A;  3PE4 A;  2AWI A;  2VGX B;  4ACK A;  2XZD G;  2OV8 A;  3QAR A;  3L13 A;  4NAC A;  3ZUV B;  5CBN A;  5AAR A;  3V30 A;  5LFA A;  3MO0 A;  1MT6 A;  4ATZ D;  4J83 A;  4HFG A;  2VSX E;  3NAW A;  4GA2 A;  4CZ2 D;  3DST A;  3FEX A;  3OPE A;  3SFZ A;  4E6H A;  4BUP A;  3KS2 A;  3ASN E;  2FBN A;  4GYY A;  3ESK A;  3OXL A;  4HRN A;  3S7F A;  3APF A;  3AAA C;  4RG6 A;  4BWR A;  4YDY A;  3CBP A;  3FTY A;  4NRH B;  3KMT A;  5JJ0 A;  1H2U A;  4NJ5 A;  3MGB A;  3AG4 E;  2QC9 A;  4CGV A;  1Y6I A;  3ABL E;  1HS6 A;  2AXZ A;  1MHQ A;  3EHQ A;  2XPZ A;  2Y4T A;  4G23 A;  2FO7 A;  4TRQ A;  5BNW A;  4GCO A;  4DX5 D;  2GW1 A;  3PNT B;  3VTX A;  5CED B;  3Q79 A;  4I17 A;  1Z6T A;  3LPZ A;  2RD0 A;  4JVS A;  5HQ8 A;  2DZN A;  3WXX A;  2C2L A;  1JPL A;  2CHZ A;  2O8J A;  2R05 A;  2VTB B;  3UTM A;  1P5Q A;  5EX3 A;  5BV0 A;  4B8A A;  5AIJ A;  1OCZ E;  1TJC A;  2F8Y A;  2IU1 A;  1PAQ A;  3PH0 C;  4PS7 A;  2RFM A;  2E2E A;  3VLF A;  4Q96 A;  4FJZ A;  3S7D A;  3FUE A;  4WWO A;  3DEP A;  4WNE A;  2LXM A;  3CVQ A;  3E30 A;  4EPZ A;  3CBM A;  3ZFW A;  3HXB A;  2XPY A;  1Z3Y A;  4LNG A;  4F1S A;  5EDS A;  3U4T A;  4A1G A;  1UJK A;  2W5Y A;  3ZKJ A;  4AY6 A;  4BY6 A;  2G46 A;  2X6H A;  5G05 J;  3EU9 A;  5EKQ D;  1YA0 A;  1N6A A;  3VTY A;  2Y0B G;  1NZN A;  4GML A;  4AXH A;  2X6K A;  3L16 A;  3CV0 A;  3FUM A;  4HS2 A;  2QPW A;  2XZT G;  4ILH B;  5FIN A;  2X3M A;  3QKY A;  4ILG A;  5ANR A;  4EZJ A;  1BU9 A;  4AIF A;  4MBG A;  1DC2 A;  4GZ5 A;  4WNF A;  4UWK A;  2J9Q A;  5ENS D;  1TN7 A;  4YDE A;  3PEU B;  4NIK A;  3MA5 A;  2OCC E;  4OAU C;  3ASG A;  3DPD A;  2UWJ G;  3MEK A;  4V3I A;  4JZY A;  4J7I A;  4DX6 D;  3ZXP A;  3R9A B;  4LCT A;  5T0M A;  2XPI A;  3KMA A;  1OUV A;  3R7Q A;  2V4H C;  3LVQ E;  3IEG A;  1JWG A;  3BUA A;  1UN8 A;  3S2A A;  2MRI A;  2GRR B;  1Q2Z A;  3IHV A;  2I9C A;  5JIY A;  1QZ2 A;  3D9L A;  2A4Z A;  3ZYQ A;  3B13 A;  3EHR A;  1QQE A;  1DVP A;  1D9S A;  3FUK A;  3KD7 A;  4HVB A;  4U0Z A;  3DXK G;  1DNP A;  3Q75 A;  4O6F A;  3LY7 A;  3PRE A;  3SO8 A;  2XRZ A;  4KVM A;  3V79 K;  4EBA G;  1HX8 A;  4DLQ A;  5JJ7 A;  1U3D A;  3AU5 A;  3UT7 A;  5D0Q D;  5AYF A;  3MKQ B;  3MKR A;  5CMW A;  1PY1 A;  4GTO A;  4RLY A;  5FQ6 A;  2CFU A;  3HNA A;  1KZO A;  3SBT B;  4U95 D;  5T3R A;  1Z5S C;  2C0L A;  1V55 E;  3FEY A;  4I6J A;  5ENO D;  2PM7 A;  4YVQ C;  3RJV A;  3PRZ A;  3K9I A;  3ZW3 A;  2VGY A;  1IQU A;  4GMJ A;  3TWV A;  3RK6 A;  3B7S A;  3UKR G;  5BXO A;  3OXG A;  2L9B A;  3JUE A;  4L7T A;  2CG3 A;  1ZB1 A;  2BKG A;  4EZK A;  4DUI A;  2GGF A;  1E8Y A;  2XCC A;  4RVB A;  3RQ4 A;  4TV3 A;  3Q9N C;  1N4P A;  1N11 A;  2YHE A;  2QYJ A;  3ZGQ A;  1NI1 A;  2YNQ A;  4G2V A;  3VUZ A;  1N9A A;  4XKB A;  2J8S D;  4BSX A;  4BET A;  5KJM A;  4I51 A;  1X5B A;  1KPS B;  2V5F A;  3TXN A;  3FFL A;  4UWF A;  4GPK A;  3RSE G;  1N0R A;  2V4L A;  3BG0 B;  1JUQ A;  1ZBP A;  2X38 A;  4D10 C;  3ZXS A;  4GPM A;  2XGO A;  3ASF A;  1FVF A;  3EU5 A;  1S64 A;  4GZ6 A;  1KLX A;  1FT1 A;  4NQ0 A;  4AJW A;  4U8V D;  4GZD A;  2XGM A;  2A5U A;  4M7C A;  3C3O A;  2HE0 A;  2BQZ A;  4KYO B;  2L6J A;  3HYM B;  3V2X A;  4URK A;  1AP7 A;  2P9N G;  1WAO 1;  3RU0 A;  5JMN D;  4MS6 A;  3UT8 A;  4ANX A;  3SW9 A;  4H12 A;  1TJF A;  3T8K A;  3NF1 A;  5ARG A;  5EID A;  3FU5 A;  3TWU A;  4LER A;  5C2Y A;  5JHB A;  1MVX A;  4GU5 A;  2E0I A;  1SZ9 A;  4I1A A;  3UKU G;  1EF1 C;  4CCA A;  4J7F A;  2B0O E;  3ENE A;  2LSV A;  4IJD A;  4G8K A;  4J6I A;  3AJI A;  2ZGD A;  5HRY A;  1SA5 A;  4Q69 A;  4OAV B;  5B3S E;  4U96 D;  2PZI A;  3J5Q B;  5DBK A;  4J8E A;  4F3V A;  2EQX A;  2PNN A;  4XEI G;  1N3J A;  4K5A B;  1EYH A;  4L1B A;  3TG4 A;  2GRQ B;  3PZ1 A;  3R9M A;  1KZP A;  4OVU A;  5H7P A;  3I3N A;  1QNF A;  5AQA A;  2R59 A;  3Q15 A;  4JA7 A;  4KMO A;  5LSZ A;  2NC9 A;  3PDN A;  3NB2 A;  5D66 A;  1Z3X A;  4CYM D;  2H6I A;  3QWW A;  5AQ7 A;  3PS6 A;  3CIA A;  2P9U G;  2MOW A;  4G25 A;  4B94 A;  3ASO E;  3ZU7 B;  3AU4 A;  2Y3A A;  3G2V A;  4RZ0 A;  4LEU A;  4PDX A;  4EEC A;  3CLJ A;  5AQB A;  3FDH A;  1KT1 A;  2KXP C;  3RRM B;  4UQZ A;  3FU6 A;  1JCS A;  4CT0 A;  1TR4 A;  4FP7 A;  2YQ8 A;  4HOU A;  3GZ2 A;  5ENP D;  5JA4 D;  2ETA A;  1ZKK A;  1E7U A;  2ZIS A;  5FZS A;  3D9I A;  2IO2 C;  4H7X A;  2HM8 A;  2WXP A;  2J49 A;  3OTN A;  3AS8 A;  1PEG A;  1MYO A;  2I1J A;  2KCK A;  2Y1L E;  2WQH A;  1O9S A;  2BKK B;  2VGE A;  1O1T A;  2DYR E;  4IYP A;  3FTZ A;  3FUI A;  5F5E A;  3ML9 A;  5LCW C;  1N54 A;  3DRA A;  4PUC A;  4PS8 A;  1N6C A;  4HLL A;  4E47 A;  3ZIM A;  4GTP A;  4I2W A;  4G1T A;  5CRU A;  1H0A A;  2OEV A;  3QWV A;  2WXG A;  4KZ0 A;  3CVL A;  2ZIR A;  4ACL A;  3SGH A;  2GRP B;  2P2C P;  3B7T A;  4FAD A;  5F59 A;  2WXH A;  3CVU A;  2PQR A;  4YVO A;  3CSF A;  4U0U A;  2H6G A;  4QFV A;  2H6F A;  3QB2 A;  4DK5 A;  3M53 A;  5BW8 C;  5CPR B;  2ZXW E;  1H2T C;  3QC1 A;  3TWS A;  4IRU A;  2F69 A;  4U63 A;  4YNM A;  3UI2 A;  2EIK E;  3C5R A;  3CHO A;  4JD2 G;  4HI9 A;  3FPD A;  2FI7 A;  1E90 A;  3O48 A;  5AAO A;  5D2M C;  1S0P A;  2RFI A;  4GCN A;  3LDZ A;  3J5P A;  1LTX A;  4B89 A;  2LXL A;  4BT9 A;  3RIB A;  2GRO B;  3F9Y A;  4YPU A;  4IN3 B;  3MYV A;  4BEP A;  2LAH A;  1A5E A;  5CRV A;  4C0M A;  1HF8 A;  5J90 A;  4L23 A;  4DJA A;  1Y8M A;  2V5Q C;  3PEV B;  4TUU A;  4DX7 D;  4J0U A;  1MX6 A;  1HZ4 A;  4P29 A;  1OWN A;  3LKU A;  1OT8 A;  4JLG A;  2MHK A;  3SZ7 A;  1L5J A;  3Q4A B;  4QEO A;  3UX4 A;  1OCC E;  2DZO A;  3PUK A;  3Q7F A;  4FUL A;  2WMO A;  3G2T A;  3FUN A;  1WM5 A;  4B8C B;  4JEH A;  1N4R A;  3G2S A;  2P9P G;  1AWC B;  1UW4 B;  5JHA A;  3AS4 A;  2XHE A;  2RFA A;  3CQC B;  2EIL E;  4HOT A;  4WWP A;  3LY9 A;  3BU8 A;  5FT9 A;  1TN6 A;  4W9R A;  1SA4 A;  2NSZ A;  5BPP A;  5LSX A;  5T8I A;  2UY1 B;  1OCO E;  5EIL A;  4O1O A;  1MVH A;  1W3B A;  4CRW A;  1LF8 A;  2GRM A;  3L54 A;  3RAU A;  4DRX E;  3ZYK A;  3CK8 A;  3QJZ A;  2BUG A;  5AJL A;  4YPA A;  4LNU D;  4BT8 A;  3SFY A;  4B93 B;  1NP7 A;  1K1A A;  1E8W A;  4TXP A;  2L0T B;  4FU3 A;  4I6G A;  4M3O A;  3VLE A;  1TNB A;  3TAX A;  1RW2 A;  4AU7 A;  5E75 A;  3CBO A;  3V31 A;  4O60 A;  2VSO E;  3FUD A;  3Q9U C;  2WMN A;  4ATG A;  4JL0 A;  3QAQ A;  2OVB A;  3CVP A;  3K5K A;  4TXR A;  2J4B A;  3M54 A;  5BXU A;  2KC7 A;  5A7D B;  5ENT D;  4BES A;  3VV0 A;  4U8Y D;  5G04 J;  2VTB A;  2BTD A;  2EIJ E;  3UM2 A;  4WWN A;  5ARF A;  1LD7 A;  3EHM A;  3LY8 A;  4UI9 C;  5FZQ A;  3ULQ A;  2DIW A;  1TEZ A;  2X6I A;  5BUZ A;  3CVX A;  1MUF A;  4XX5 A;  5EYP F;  3G2W A;  4GMR A;  3DAL A;  3SWC A;  2X6F A;  2LO6 A;  3I4G A;  3L22 A;  4UQX A;  4HNA D;  3ZVV A;  1INZ A;  4A63 B;  2XS1 A;  2ION A;  2XS8 A;  1E96 B;  3L6A A;  3UM0 A;  3KAE A;  4HI8 A;  3CHM A;  3IHY A;  1UG3 A;  1XNF A;  1N4S A;  3LEW A;  1UOH A;  3MO2 A;  3KSQ A;  3LXU X;  3PE3 A;  2FEZ A;  1N95 A;  4AVX A;  1TNZ A;  1IQR A;  3JXJ A;  4ZHB A;  4A3T A;  3D9J A;  4JDS A;  3T9K A;  1XQH A;  2VYI A;  2IY0 C;  4I2Z A;  1E7V A;  3ABM E;  3FTX A;  2KCL A;  3HXE A;  4E85 A;  1MZC A;  2R3A A;  4GB9 A;  5F6K C;  1BLX B;  3LJN A;  3JYS A;  2FF4 A;  3DBS A;  5FZR A;  2IEJ A;  1HG2 A;  3HXD A;  4GYW A;  1OWO A;  1QBQ A;  5HKP A;  2L6B A;  4FA6 A;  4A3V A;  3E4B A;  3UM1 A;  4WAF A;  1ELW A;  3CVY A;  1MQS A;  3JXI A;  3SBS A;  3L82 A;  3CK7 A;  1JCR A;  3IHX A;  3NZU A;  3Q73 A;  5KJN A;  4A55 A;  2LSU A;  3D9H A;  2R17 C;  3TXM A;  3SY2 A;  4U07 A;  4GTT A;  3S7B A;  3PVL A;  4N2S A;  4I1M A;  1BI8 B;  2NYJ A;  3S7J A;  4GTR A;  4I9C A;  2WXO A;  5CEC B;  4U8H A;  5E76 A;  3T5X A;  4N3B A;  3VLD A;  1FPP A;  3FH8 A;  2XGS A;  3UQ3 A;  2AJA A;  1B89 A;  4AP2 A;  4DI4 A;  4YDO A;  3BO5 A;  1YMP A;  1YYH A;  5HS0 A;  3GZ1 A;  3ZHE B;  2LNI A;  3DSS A;  3FTU A;  4K03 A;  2WXL A;  3CST A;  3M55 A;  3ULY A;  1VDY A;  2I2O A;  3CQG B;  5D0O D;  4C48 B;  3N71 A;  3MKQ A;  5CEA A;  4N5C A;  4I43 A;  3UIN C;  3DB5 A;  1QYM A;  4TXQ A;  4YND A;  2WQ6 A;  3F6Q A;  3FH5 A;  2IFU A;  3QK0 A;  4PS3 A;  3GYZ A;  3UXG A;  4XZ4 A;  4J8F A;  4AY5 A;  3G2U A;  4FHK A;  5JIN A;  1MX2 A;  2QZA A;  3MZL B;  3EIJ A;  3C98 A;  2AXU A;  1FVH A;  5AJD A;  5TTF A;  2HYZ A;  5JHN A;  2R2L A;  3ONK A;  3RO2 A;  2IJG X;  2VSY A;  5CMY A;  5LX8 A;  2LUH A;  4C1Q A;  1UJJ A;  2WQ7 A;  3Q47 B;  4WNG A;  3CKB A;  4UI9 K;  5KNG A;  1ML9 A;  4AM9 A;  5FTP A;  3EJN A;  1DCQ A;  2P9I G;  2KZT B;  1PC2 A;  4HOS A;  1NA0 A;  4J8D A;  4JB8 P;  4DPR A;  3F9X A;  2I6H A;  3E32 A;  3QOU A;  3B7B A;  1OY3 D;  5B1B E;  4EBA A;  3HVE B;  5T4Y A;  3FTW A;  2ZGG A;  3D9O A;  1U3C A;  4N3C A;  3CVW A;  1H3I A;  1SQM A;  2KAT A;  2QFC A;  5DIZ A;  4GAA A;  5EG2 A;  1BI7 B;  3FH7 A;  4JXT A;  1ELK A;  1HXI A;  4G8L A;  1N52 A;  4AV7 A;  2GRL A;  2J07 A;  3ASH A;  5KBA A;  2JLB A;  2YHC A;  1O5M A;  3O4Z A;  3KEA A;  2BF0 X;  2DCP A;  2OND A;  4ANU A;  4FJY A;  3UT4 A;  1ELR A;  4FC8 A;  3MO5 A;  3C3R A;  4G11 A;  4HRM B;  1K1B A;  4ABN A;  3UIP C;  3D9M A;  4XIF A;  2V8S E;  4XI9 A;  3T5V A;  3U64 A;  2J09 A;  3SNX A;  1UN9 A;  1O1R A;  1K3Z D;  2YIN A;  3FUJ A;  1TNY A;  4RQI A;  3HXF A;  4GZC A;  4YDW A;  5FJY A;  1TN8 A;  5AQ9 A;  5BV1 A;  4EHM A;  3L9T A;  1H19 A;  2WXJ A;  4EZL A;  3LVR E;  4OYS A;  4G26 A;  5ENQ D;  3PZ2 A;  3Q7A A;  1HU3 A;  2ZU6 B;  3AG3 E;  3TWR A;  3M59 A;  3IKO B;  2IQC A;  3S8P A;  2WXM A;  3FHE A;  3CK9 A;  1SW6 A;  3E33 A;  5LCW J;  5G55 A;  1MX4 A;  1HG5 A;  5TH7 A;  5CHE E;  3SF4 A;  3OS5 A;  4FHJ A;  2VJ8 A;  3KSL A;  2XEE A;  2P9L G;  2DVW A;  3CHP A;  1H6O A;  1EPU A;  4N5Q A;  4MKT A;  2W5Z A;  4BX8 A;  4QEP A;  1MJ0 A;  2ETB A;  5C1D A;  4APF A;  1YCS B;  5FQ8 A;  3EP0 A;  4BX9 A;  3TWT A;  3KMJ A;  4WUY A;  2CFZ A;  3DSV A;  2ETC A;  3HXC A;  3C72 A;  2IGQ A;  1S70 B;  4XKC A;  3SHF A;  2XEH A;  3LYA A;  3LCA A;  4AEZ C;  2HR2 A;  1XGW A;  3NOG D;  2KBX A;  3E37 A;  3E34 A;  4HRL A;  2ILR A;  3DSW A;  3QDN A;  3B95 A;  5EX0 A;  1S63 A;  3FTV A;  4HQD A;  4MI0 A;  1SVX A;  4BFR A;  4K5C A;  4C9B B;  4A1S A;  3FUH A;  3HDX A;  5AEN A;  3CKC A;  4Y6C A;  3ABK E;  4F6R D;  3FUL A;  3D3M A;  3L17 A;  3P1U A;  3HG0 D;  4J8Y A;  3HRA A;  2F37 A;  2FO1 E;  2VGX A;  3X2Q E;  4JHK A;  3LS8 A;  3LJ3 A;  1K8K G;  4LUN U;  3BG1 B;  3T8M A;  4CDN A;  4FLB A;  3TWX A;  4HOQ A;  3CVV A;  3ZNG A;  4HOR A;  2Y69 E;  3EHN A;  4UWL A;  5CCL A;  4FMU A;  1HFA A;  4O1P A;  3FU0 A;  2KM4 A;  4BSZ B;  1TNU A;  5M72 A;  3URZ A;  3MV2 B;  1WY6 A;  4U0S A;  2HO1 A;  3M57 A;  3CEQ A;  4L2L A;  2AW6 A;  3TWQ A;  2CHX A;  4GYO A;  1H6P A;  3FWV A;  5AYW D;  1OWP A;  2L0I A;  3CVN A;  4ILI A;  4UWG A;  3DWL G;  5ENR D;  4J8O A;  5ANL A;  3APD A;  3TJP A;  3ZPJ A;  4F53 A;  2JEK A;  3OOI A;  3DXM G;  3F9Z A;  4GA0 A;  3Q49 B;  3M56 A;  1A17 A;  3B7U X;  5G05 C;  3DSX A;  2OEW A;  4HB5 A;  3DEO A;  4APO A;  4C0E A;  4ZFH A;  4N3A A;  4CEM A;  4GA1 A;  5KCM A;  4CDM A;  4GTM A;  3QWP A;  2J4D A;  3AS5 A;  4J7W A;  1H6K A;  5G04 C;  3I5P A;  2DYS E;  2RKK A;  4DI3 A;  5KNH D;  2IF4 A;  4KVO A;  1FCH A;  4NUR A;  2PL2 A;  3ASD A;  3QNK A;  1IHB A;  5G2N A;  1IYG A;  4UI9 J;  2UY1 A;  2EIM E;  4GTQ A;  5F6L A;  3MX3 A;  3JQ0 A;  1IXV A;  2AVP A;  2PM6 A;  3CR3 A;  1HH8 A;  3PZD A;  3L08 A;  5FIO A;  4K5B A;  2IO3 C;  3EUV A;  1OXJ A;  3PNL B;  4ANV A;  1OWL A;  4N2Q A;  2F0Y A;  4KT6 B;  4GZ3 A;  2IOL A;  3SQV A;  5KWD A;  3V2O A;  2PQN A;  2R5S A;  5EYL A;  4G24 A;  4TUM A;  2RG8 A;  3RAY A;  3FY4 A;  3GW4 A;  2XCB A;  3C3Q A;  3IV0 A;  4DX1 A;  5A6C A;  2MYO A;  2JAB A;  2WPV A;  2F8X K;  4LRZ A;  4JPS A;  3AG2 E;  3MV3 B;  4CT4 A;  4LSZ E;  3Q78 A;  2WM9 A;  1ZU2 A;  2X6J A;  1H2V C;  2NXP A;  2WB2 A;  4AOF A;  3FUF A;  3BQO A;  2XEV A;  4JW1 A;  1D8D A;  3DPY A;  3M5A A;  4Z68 A;  5B1A E;  5TEG A;  3HHM A;  2LAI A;  5FQ4 A;  1X81 A;  1SZA A;  4IUL A;  4RG9 A;  1E8Z A;  1OWM A;  2DWZ A;  4KZC A;  2VSN A;  4UQY A;  3GZS A;  3NQP A;  2C0M A;  3D9K A;  4XE0 A;  5A23 A;  3RO3 A;  3UM3 A;  3CHS A;  3NOC D;  3MJW A;  4F7A A;  2AXV A;  4JHJ A;  4MI5 A;  3DSU A;  4DLO A;  3UIO C;  3UPV A;  3TWW A;  2V0P A;  3FTS A;  4BTA A;  3JCK C;  4Y6W A;  4LG6 A;  3KEZ A;  4U04 A;  2J08 A;  1FT2 A;  3OXF A;  2P9S G;  1IKN D;  3D9P A;  3ZYL A;  1N0Q A;  4JEU A;  1N94 A;  5FWQ A;  1NFI E;  3CHR A;  4WND A;  5ENN A;  2GRN B;  1LD8 A;  3SD5 A;  3CHQ A;  2WVI A;  4XI0 A;  4H7Y A;  4MRU A;  2WXI A;  1O1S A;  5T0K A;  3OAW A;  4JHR A;  4J8S A;  2XEN A;  2FUL A;  1TYQ G;  2B6C A;  4I1O B;  5EN5 D;  4B0Z A;  4OVV A;  3JUI A;  3ESL A;  2IOS A;  3B7R L;  2Q7F A;  3U66 A;  1N4Q A;  4PH4 B;  4BER A;  1IHG A;  5JJT A;  4YNP A;  3JQ1 A;  1U2V G;  1E8X A;  2WXN A;  3W9F A;  3ZHE A;  5LP0 A;  5CCM A;  3EIQ C;  5KJL A;  4RSY A;  5JJ6 A;  4LDG A;  5CBO A;  3TL5 A;  4YPE A;  5KJK A;  3CGH A;  3TGO A;  1KT0 A;  2WXF A;  3RRN B;  2M63 A;  4CDR A;  3WG7 E;  3SFX A;  2DBA A; 
#chains in the Genus database with same CATH homology
 2C0L A;  4YPA A;  4APF A;  4KBQ A;  4BT8 A;  3FEY A;  5FQ8 A;  3EP0 A;  3PUJ A;  4BX9 A;  1HO8 A;  1NP7 A;  4I6J A;  4ME2 A;  2CG2 A;  1E8W A;  3KMJ A;  2PM7 A;  2XRY A;  4I6E A;  3IBE A;  4YVQ C;  2L0T B;  4WUY A;  2Y4U A;  2CFZ A;  3RJV A;  4QEN A;  4FU3 A;  3PRZ A;  2WXQ A;  3K9I A;  3ML8 A;  4I6G A;  4M3O A;  3VLE A;  3NZS A;  3ZW3 A;  3MCX A;  2VGY A;  1IQU A;  1NA3 A;  4GMJ A;  3TAX A;  2IGQ A;  4AU7 A;  5E75 A;  3Q5M A;  3CBO A;  3RK6 A;  3B7S A;  3OXG A;  2L9B A;  2VSO E;  3FUD A;  1BPO A;  4L7T A;  2CG3 A;  4XKC A;  3SHF A;  3R7R A;  4EZK A;  2WMN A;  2GGF A;  3LYA A;  2VQ2 A;  4ATG A;  4JL0 A;  1E8Y A;  2XCC A;  4RVB A;  3QAQ A;  3LCA A;  2OVB A;  3UMV A;  3ZRH A;  2WXK A;  1GW6 A;  4TV3 A;  2JV0 A;  3RQ4 A;  3CVP A;  4AEZ C;  2HR2 A;  4HLE A;  1XGW A;  2YHE A;  3K5K A;  3ZGQ A;  3I4R B;  2J4B A;  2YNQ A;  4G2V A;  5F6K C;  3VUZ A;  3P2B A;  3M54 A;  4XKB A;  2KC7 A;  4KXK B;  5FQ7 A;  5A7D B;  3VV0 A;  2ILR A;  4BSX A;  4JC8 A;  3QDN A;  5G04 J;  5LOZ A;  2VTB A;  2BTD A;  2CHW A;  4ANW A;  5KJM A;  5EX0 A;  4I51 A;  3UUX A;  1X5B A;  3FTV A;  2V5F A;  3TXN A;  4MI0 A;  4WWN A;  5ARF A;  3SI5 A;  3FFL A;  3U9W A;  3EHM A;  3LY8 A;  4UWF A;  4EQF A;  4GPK A;  4R7L A;  4UI9 C;  3F9W A;  4BFR A;  5FZQ A;  4C9B B;  3ULQ A;  2DIW A;  4A1S A;  1TEZ A;  2X6I A;  3FUH A;  3HDX A;  2V4L A;  2XQ0 A;  3BG0 B;  1JUQ A;  4FLH A;  3RRU A;  5AEN A;  1ZBP A;  2X38 A;  2KZT A;  3CKC A;  3ZEF A;  4Y6C A;  4D10 C;  5BUZ A;  3CVX A;  1MUF A;  4XX5 A;  3FUL A;  3ZXS A;  3G2W A;  3RKV A;  3D3M A;  2XGO A;  3ASF A;  3L17 A;  3DAL A;  2OVF A;  3P1U A;  3SWC A;  2X6F A;  2LO6 A;  4Q94 A;  1FVF A;  4IJ8 A;  5HI7 A;  3I4G A;  2VGX A;  3L22 A;  4UQX A;  4GZ6 A;  3ZVV A;  1INZ A;  1KLX A;  3HVE A;  4MLP A;  4NQ0 A;  2ION A;  4AJW A;  4Z4P A;  1E96 B;  3L6A A;  4GZD A;  2XGM A;  2KCV A;  4JHK A;  3LS8 A;  2A5U A;  3M58 A;  3LJ3 A;  3KAE A;  4LUN U;  3ZN3 A;  2BQZ A;  3CHM A;  4KYO B;  3BG1 B;  3IHY A;  1UG3 A;  2L6J A;  4JA9 A;  4L2Y A;  1XNF A;  4FLB A;  3T8M A;  3BEE A;  4CDN A;  3RJW A;  3HYM B;  4URK A;  4N39 A;  3LEW A;  4NVQ A;  2I1K A;  4HOQ A;  1WAO 1;  3MO2 A;  3CVV A;  3D9N A;  3LXU X;  3PE3 A;  4HOR A;  2FEZ A;  3ONL A;  4BTB A;  1EDU A;  3RU0 A;  4AVX A;  1IQR A;  5BT1 A;  3FP3 A;  3EHN A;  4MS6 A;  4UWL A;  3UT8 A;  5CCL A;  4FMU A;  4ANX A;  1JWF A;  4K0R A;  1HFA A;  4A3T A;  3D9J A;  3FU0 A;  4JDS A;  2KM4 A;  5M72 A;  2QY7 A;  1XQH A;  2VYI A;  3SW9 A;  4I2Z A;  1E7V A;  3URZ A;  3FTX A;  2KCL A;  3MV2 B;  4E85 A;  4H12 A;  1WY6 A;  1TJF A;  2P58 C;  4GB9 A;  2R3A A;  4U0S A;  2HO1 A;  3NF1 A;  5ARG A;  3FU5 A;  3FU3 A;  3JYS A;  4LER A;  2OOE A;  2FF4 A;  3DBS A;  5C2Y A;  3M57 A;  3CEQ A;  4L2L A;  2AW6 A;  5JHB A;  1MVX A;  5FZR A;  4GU5 A;  3APC A;  2CHX A;  4GYO A;  1HG2 A;  3FWV A;  5AYW D;  1OWP A;  2L0I A;  5J08 A;  4GYW A;  2E0I A;  3CVN A;  1SZ9 A;  3HIZ A;  4I1A A;  1OWO A;  4ILI A;  4UWG A;  4J8O A;  5ANL A;  3EDT B;  1EF1 C;  4A3V A;  4CCA A;  4FA6 A;  3E4B A;  4CGW A;  4J7F A;  3APD A;  4WAF A;  3TJP A;  3ZPJ A;  1ELW A;  3CVY A;  1MQS A;  3ENE A;  3SBS A;  3CK7 A;  2LSV A;  2WXR A;  3IHX A;  4IJD A;  4O30 A;  4UWH A;  4F53 A;  3NZU A;  3U3W A;  1HE8 A;  3ZYM A;  4J6I A;  2JEK A;  3TG5 A;  4HXI A;  4I9E A;  4A55 A;  3PE4 A;  5KJN A;  3F9Z A;  3OOI A;  2LSU A;  4GA0 A;  3Q49 B;  2AWI A;  2R17 C;  2VGX B;  4ACK A;  3TXM A;  2OV8 A;  4U07 A;  3M56 A;  1A17 A;  3B7U X;  3L13 A;  3QAR A;  4Q69 A;  3S7B A;  4NAC A;  3PVL A;  5G05 C;  4N2S A;  4I1M A;  2PZI A;  5DBK A;  5LFA A;  4J8E A;  3S7J A;  4F3V A;  3MO0 A;  2EQX A;  1MT6 A;  4I9C A;  2WXO A;  4APO A;  4C0E A;  4J83 A;  4HFG A;  1N3J A;  2VSX E;  4U8H A;  5E76 A;  4GA2 A;  4N3B A;  3T5X A;  1EYH A;  3VLD A;  4L1B A;  3TG4 A;  3FH8 A;  4N3A A;  2XGS A;  3FEX A;  3UQ3 A;  3OPE A;  3SFZ A;  4CEM A;  4E6H A;  4BUP A;  1B89 A;  3KS2 A;  4GA1 A;  5KCM A;  4AP2 A;  4CDM A;  4DI4 A;  4OVU A;  3BO5 A;  3I3N A;  1QNF A;  2R59 A;  2FBN A;  3Q15 A;  3QWP A;  4GYY A;  4JA7 A;  4KMO A;  3ESK A;  2J4D A;  3AS5 A;  5LSZ A;  3GZ1 A;  2NC9 A;  3OXL A;  1H6K A;  3PDN A;  3S7F A;  3ZHE B;  5G04 C;  3I5P A;  4DI3 A;  1Z3X A;  2LNI A;  3APF A;  3QWW A;  3FTU A;  2IF4 A;  4KVO A;  4RG6 A;  3PS6 A;  1FCH A;  4BWR A;  3CIA A;  2MOW A;  4K03 A;  3CBP A;  2WXL A;  4G25 A;  3FTY A;  4NRH B;  4NUR A;  3KMT A;  1H2U A;  2PL2 A;  4B94 A;  5JJ0 A;  3CST A;  3M55 A;  4NJ5 A;  3ASD A;  3AU4 A;  3MGB A;  3QNK A;  1VDY A;  2Y3A A;  2I2O A;  3CQG B;  3G2V A;  4CGV A;  1Y6I A;  5G2N A;  4RZ0 A;  1HS6 A;  1IYG A;  4LEU A;  2AXZ A;  5D0O D;  1MHQ A;  3N71 A;  4PDX A;  4EEC A;  3MKQ A;  3CLJ A;  2UY1 A;  3FDH A;  2XPZ A;  4UI9 J;  2Y4T A;  1KT1 A;  4N5C A;  5F6L A;  3MX3 A;  4I43 A;  3JQ0 A;  3RRM B;  4G23 A;  2FO7 A;  3DB5 A;  4UQZ A;  3FU6 A;  4YND A;  4CT0 A;  4TRQ A;  4FP7 A;  2AVP A;  2PM6 A;  2YQ8 A;  3CR3 A;  1HH8 A;  4HOU A;  5BNW A;  2WQ6 A;  3FH5 A;  3GZ2 A;  1ZKK A;  2IFU A;  1E7U A;  3QK0 A;  4GCO A;  3PZD A;  4PS3 A;  3L08 A;  3GYZ A;  2GW1 A;  3PNT B;  4XZ4 A;  4J8F A;  5FZS A;  3VTX A;  4AY5 A;  3G2U A;  4FHK A;  4I17 A;  1Z6T A;  3D9I A;  5JIN A;  3PNL B;  3LPZ A;  4ANV A;  4H7X A;  1OWL A;  4N2Q A;  2HM8 A;  2WXP A;  2J49 A;  3MZL B;  4KT6 B;  3EIJ A;  2RD0 A;  2AXU A;  3C98 A;  1FVH A;  4GZ3 A;  5AJD A;  2HYZ A;  3OTN A;  3AS8 A;  4JVS A;  3WXX A;  5HQ8 A;  1PEG A;  5TTF A;  2I1J A;  2KCK A;  2C2L A;  2WQH A;  1JPL A;  2IOL A;  3ONK A;  1O9S A;  3RO2 A;  2IJG X;  2VSY A;  5CMY A;  5LX8 A;  2PQN A;  2CHZ A;  2R5S A;  4IYP A;  3FTZ A;  4C1Q A;  3FUI A;  4G24 A;  2O8J A;  5F5E A;  3ML9 A;  2RG8 A;  5LCW C;  1UJJ A;  3RAY A;  3FY4 A;  1N54 A;  4PS8 A;  4PUC A;  3GW4 A;  2VTB B;  2WQ7 A;  2XCB A;  1N6C A;  3IV0 A;  3Q47 B;  4WNG A;  4E47 A;  3ZIM A;  1P5Q A;  3CKB A;  5A6C A;  5EX3 A;  5BV0 A;  4B8A A;  4UI9 K;  2WPV A;  1ML9 A;  4AM9 A;  5FTP A;  4I2W A;  5AIJ A;  4G1T A;  3EJN A;  1TJC A;  3PH0 C;  2IU1 A;  1PAQ A;  4PS7 A;  1H0A A;  3QWV A;  4LRZ A;  2KZT B;  4JPS A;  1PC2 A;  4HOS A;  1NA0 A;  2WXG A;  3MV3 B;  4KZ0 A;  4CT4 A;  2E2E A;  3CVL A;  3VLF A;  4J8D A;  4Q96 A;  4FJZ A;  3S7D A;  2WM9 A;  3FUE A;  4ACL A;  5JHN A;  1ZU2 A;  2X6J A;  4WWO A;  4DPR A;  1H2V C;  2NXP A;  3F9X A;  2I6H A;  3QOU A;  4WNE A;  2WB2 A;  3SGH A;  3B7T A;  4FAD A;  4AOF A;  4EBA A;  5F59 A;  3HVE B;  3CVQ A;  5T4Y A;  2WXH A;  4EPZ A;  3CBM A;  3ZFW A;  2XPY A;  3FUF A;  3FTW A;  1Z3Y A;  3CVU A;  2PQR A;  2XEV A;  4JW1 A;  4YVO A;  4F1S A;  3CSF A;  3D9O A;  5EDS A;  1U3C A;  4N3C A;  4U0U A;  3CVW A;  1H3I A;  3M5A A;  1SQM A;  3U4T A;  4A1G A;  1UJK A;  5TEG A;  4QFV A;  2KAT A;  3HHM A;  2W5Y A;  3QB2 A;  4AY6 A;  2QFC A;  4DK5 A;  2LAI A;  5FQ4 A;  5BW8 C;  4BY6 A;  3M53 A;  5CPR B;  2G46 A;  2X6H A;  1SZA A;  1H2T C;  4IUL A;  5G05 J;  4RG9 A;  5DIZ A;  1E8Z A;  5EKQ D;  3QC1 A;  1OWM A;  1YA0 A;  4IRU A;  4KZC A;  4GAA A;  2VSN A;  2F69 A;  4U63 A;  1N6A A;  4UQY A;  3GZS A;  3VTY A;  5EG2 A;  3NQP A;  2C0M A;  3D9K A;  4XE0 A;  4YNM A;  3FH7 A;  4JXT A;  1ELK A;  5A23 A;  3RO3 A;  1NZN A;  4GML A;  4AXH A;  1HXI A;  3CHS A;  3CHO A;  2X6K A;  3MJW A;  4F7A A;  3L16 A;  3CV0 A;  1N52 A;  3FUM A;  4HS2 A;  3FPD A;  2AXV A;  2GRL A;  2J07 A;  3ASH A;  2FI7 A;  4JHJ A;  1E90 A;  3O48 A;  4AV7 A;  2QPW A;  4ILH B;  1S0P A;  2JLB A;  2RFI A;  4MI5 A;  4GCN A;  4DLO A;  3LDZ A;  2X3M A;  3QKY A;  4ILG A;  5ANR A;  3UPV A;  4B89 A;  4EZJ A;  2YHC A;  4BT9 A;  2V0P A;  3RIB A;  3O4Z A;  4AIF A;  3F9Y A;  3FTS A;  4BTA A;  4GZ5 A;  3JCK C;  4YPU A;  4WNF A;  4IN3 B;  4UWK A;  2J9Q A;  2BF0 X;  2DCP A;  2OND A;  2LAH A;  3MYV A;  4Y6W A;  4ANU A;  4FJY A;  3KEZ A;  3UT4 A;  1ELR A;  4U04 A;  2J08 A;  4C0M A;  3PEU B;  1HF8 A;  3MA5 A;  5J90 A;  3ASG A;  4L23 A;  3DPD A;  4FC8 A;  4DJA A;  3MO5 A;  2UWJ G;  3R7Q A;  3MEK A;  1Y8M A;  3OXF A;  3PEV B;  4G11 A;  4V3I A;  4TUU A;  4JZY A;  4ABN A;  3D9M A;  4J0U A;  4XIF A;  4J7I A;  1HZ4 A;  2V8S E;  3D9P A;  4JEU A;  4XI9 A;  3ZYL A;  3T5V A;  3U64 A;  4P29 A;  5FWQ A;  1OWN A;  3LKU A;  2J09 A;  3SNX A;  1UN9 A;  3CHR A;  2YIN A;  3FUJ A;  4JLG A;  2MHK A;  3R9A B;  4LCT A;  4WND A;  5T0M A;  2XPI A;  3SZ7 A;  5ENN A;  4GZC A;  5FJY A;  1L5J A;  3Q4A B;  3KMA A;  3SD5 A;  4QEO A;  3UX4 A;  1OUV A;  2WVI A;  3CHQ A;  3LVQ E;  3PUK A;  3IEG A;  2WXI A;  4H7Y A;  1JWG A;  4MRU A;  4XI0 A;  4FUL A;  2WMO A;  5T0K A;  3G2T A;  5BV1 A;  3OAW A;  1UN8 A;  4JHR A;  4J8S A;  2MRI A;  2FUL A;  3FUN A;  3S2A A;  1WM5 A;  4B8C B;  1H19 A;  4JEH A;  2WXJ A;  3IHV A;  2I9C A;  4EZL A;  3LVR E;  5JIY A;  3G2S A;  1QZ2 A;  4OYS A;  3D9L A;  4G26 A;  2A4Z A;  3ZYQ A;  3B13 A;  1UW4 B;  5JHA A;  4I1O B;  3AS4 A;  1QQE A;  4B0Z A;  1DVP A;  4OVV A;  2XHE A;  1HU3 A;  3JUI A;  2ZU6 B;  3FUK A;  3ESL A;  2IOS A;  3B7R L;  2Q7F A;  3KD7 A;  4HVB A;  3U66 A;  3IKO B;  3M59 A;  2IQC A;  4PH4 B;  4U0Z A;  3S8P A;  1DNP A;  3CQC B;  1IHG A;  4O6F A;  2WXM A;  5JJT A;  4YNP A;  3FHE A;  3LY7 A;  3PRE A;  3JQ1 A;  3CK9 A;  1E8X A;  2XRZ A;  2WXN A;  4KVM A;  4HOT A;  4WWP A;  5LCW J;  5G55 A;  4EBA G;  3ZHE A;  1HX8 A;  3LY9 A;  4DLQ A;  5JJ7 A;  5CCM A;  5LP0 A;  1U3D A;  3AU5 A;  1HG5 A;  3EIQ C;  5T5G A;  5FT9 A;  3UT7 A;  5TH7 A;  5KJL A;  5D0Q D;  4RSY A;  4W9R A;  5CHE E;  5JJ6 A;  3SF4 A;  4FHJ A;  3OS5 A;  5AYF A;  2NSZ A;  2VJ8 A;  4LDG A;  5BPP A;  5LSX A;  3MKQ B;  3MKR A;  5T8I A;  5CMW A;  2UY1 B;  3TL5 A;  1PY1 A;  4YPE A;  5KJK A;  3CGH A;  1W3B A;  3CHP A;  1MVH A;  1EPU A;  5FQ6 A;  3TGO A;  4CRW A;  1LF8 A;  4MKT A;  2W5Z A;  2GRM A;  1KT0 A;  2WXF A;  3L54 A;  4BX8 A;  2CFU A;  3HNA A;  4QEP A;  3SBT B;  3RRN B;  5C1D A;  3ZYK A;  2M63 A;  3CK8 A;  3QJZ A;  5T3R A;  2BUG A;  4CDR A;  2DBA A;  5AJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...