5ARFA

Smyd2 in complex with small molecule inhibitor compound-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5arfA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5arfA01
3BEEA 4U0ZA 3QDNA 3CVNA 3URZA 4GYWA 2VQ2A 2XCBA 3ZHEA 3CVLA 2FO7A 2LSVA 2UWJG 1NA3A 3K9IA 2AVPA 3M58A 1N6CA 4YVQC 5A7DB 2OOEA 3PDNA 4U0SA 3S8PA 5TH7A 1HH8A 4GCOA 2KATA 5CPRB 4UQYA 2HYZA 5CCLA 3S7DA 3UPVA 4AM9A 3GYZA 3S7FA 4RG9A 4HOUA 3JYSA 2XGOA 3RU0A 5AYWD 2RFIA 4APOA 3TG4A 4I9EA 2C0LA 3F9XA 4J8OA 3AS4A 4N3BA 3ZPJA 4IN3B 4WNFA 4GCNA 3OXLA 4YPEA 5AYFA 3S7BA 1Y8MA 4I17A 4GYYA 5LCWJ 2YQ8A 3CK9A 4I2WA 2IGQA 2FBNA 1O9SA 5ARFA 5D0OD 3Q5MA 5F6LA 2VSNA 4WNGA 2PZIA 3OXGA 4QEPA 3DB5A 4QENA 4JA9A 2W5ZA 3VUZA 5JIYA 3RJWA 2LSUA 5DBKA 3E4BA 4LEUA 4U0UA 1MT6A 3QKYA 3K5KA 4GYOA 2PL2A 2BUGA 5HI7A 4UI9K 5EX0A 4G24A 4G25A 4Z4PA 3OOIA 5C1DA 3VTYA 3QOUA 4H7YA 4GPKA 4IJ8A 4W9RA 3KMTA 4NJ5A 4UI9C 2Y4UA 3PE4A 3LY9A 2PQNA 4IJDA 3CBMA 3QWWA 2FI7A 1E96B 3LYAA 3M55A 3FP3A 4HOQA 4UQXA 5EX3A 5FZSA 5BW8C 5KJNA 2G46A 2HO1A 3RO3A 4HORA 3QWPA 3ZGQA 4NRHB 4E47A 3SWCA 3AS5A 1B89A 4BTAA 5M72A 1WAO1 4XI9A 4ABNA 4KXKB 4CGVA 4H7XA 4KBQA 3LY8A 3Q47B 3F9ZA 5LSZA 3CV0A 3ZFWA 5F59A 4J8DA 4N3CA 4GA0A 4YNDA 4GA1A 4GZ5A 4J8FA 4N3AA 4H12A 2NC9A 4N39A 4Y6WA 5EKQD 3M54A 3IEGA 4BTBA 5JJ6A 4U04A 4N2SA 5D0QD 1OUVA 3WXXA 4JA7A 1HXIA 5T5GA 2VGXB 3CEQA 2XGSA 5JJ7A 3NF1A 3BO5A 3O48A 4AU7A 5CHEE 4YNMA 2VGXA 3RAYA 4JHRA 3ESKA 3Q15A 1MVHA 5F5EA 4NQ0A 3IHXA 3M53A 3EDTB 4XI0A 3TG5A 1FCHA 3UQ3A 4AY5A 5BT1A 3HNAA 4G23A 2VSYA 4WNDA 1IHGA 1N6AA 3RO2A 4I2ZA 3DALA 1ELRA 2KCVA 4C1QA 3SW9A 2R3AA 3OXFA 1ZBPA 2V5FA 3U3WA 5KJMA 3LKUA 1H3IA 5LSXA 2WQHA 5CCMA 1W3BA 2DBAA 4B94A 2IF4A 2I6HA 1IYGA 3KS2A 1QQEA 5TTFA 2XGMA 5G05C 2L6JA 1ELWA 2XCCA 4CDRA 3CK7A 2PQRA 1KT0A 3ASGA 3CBOA 4GZ6A 4I51A 4LDGA 1XQHA 3LPZA 4J7FA 2Q7FA 3MKRA 3RJVA 2ONDA 3MV3B 3M59A 2J9QA 2XEVA 1A17A 4RZ0A 1MUFA 3MV2B 4UI9J 1ZU2A 4I9CA 5ARGA 2KC7A 5JJ0A 4U07A 4G26A 2YHCA 1NZNA 3QWVA 4KYOB 5TEGA 3Q49B 3FFLA 5FZQA 4A1SA 3RKVA 4JLGA 4BUPA 3GZ1A 4YVOA 2UY1B 3CVPA 4F3VA 2W5YA 3MA5A 2JLBA 3N71A 3F9WA 2JV0A 5F6KC 4G2VA 5FZRA 5A6CA 2UY1A 3CKCA 4AIFA 1WM5A 3VTXA 5G04C 4I1AA 3AS8A 3MO2A 4YPUA 4O6FA 5BNWA 3KMJA 2R5SA 3FWVA 1QZ2A 1ZKKA 1HZ4A 4Y6CA 1P5QA 5G04J 4N5CA 5LCWC 4GA2A 3ZN3A 3MO0A 2XPIA 3ASHA 3M57A 3ASFA 3M5AA 3M56A 4GZ3A 1YA0A 3TGOA 5FT9A 2WPVA 1N3JA 3ULQA 2Y4TA 3KD7A 5JJTA 2C2LA 3R9AB 3KAEA 4HOSA 4BT8A 4BT9A 2MHKA 3GZ2A 4WUYA 1NA0A 2GW1A 3HYMB 4O30A 4ME2A 5KJKA 1KLXA 3GW4A 4MI0A 4G1TA 4HOTA 3MO5A 4CGWA 3CKBA 3FPDA 5T0MA 3F9YA 3LCAA 5DIZA 5EG2A 3MEKA 2C0MA 3S7JA 1XNFA 3OPEA 4J7IA 1ML9A 1PC2A 2QFCA 3CVQA 3LY7A 4AY6A 4UQZA 5FJYA 5KJLA 2FEZA 3RQ4A 5T0KA 4J83A 2E2EA 2VYIA 3ASDA 2BQZA 4J8EA 2IFUA 3EP0A 4JDSA 1TJCA 4QEOA 3VV0A 5G05J 2FF4A 3CK8A 4EQFA 3SZ7A 2KCKA 5JHNA 2F69A 3Q4AB 5FTPA 4XIFA 4N2QA 3PE3A 5JINA 4YNPA 4J0UA 2KCLA 2HR2A 4YPAA 4JL0A 2O8JA 3RIBA 4MI5A 1KT1A 4NVQA 4RG6A 4WNEA 3SF4A 2LNIA 2P58C 3OS5A 1MVXA 2VGYA 3TAXA 3UUXA 4FMUA 2QPWA 3ZHEB 1PEGA 4BWRA 3CBPA 3KMAA 3U4TA 5HQ8A
chains in the Genus database with same CATH superfamily
3ZIMA 1U3DA 5EDSA 3CHQA 4JB8P 3LS8A 3K9IA 2AVPA 3DXKG 3M58A 3SI5A 4U0SA 2WXHA 4I6GA 3RRNB 5CPRB 1UN8A 4JZYA 5CCLA 2WM9A 5J08A 2H6FA 2P2CP 2J07A 4RG9A 3HVEA 4TXQA 2IO2C 1HG2A 1HE8A 4TUUA 3B7RL 1H0AA 4APOA 4RQIA 4I9EA 4ILIA 2DCPA 3F9XA 4GU5A 3ZXPA 4JXTA 4YPEA 1DCEA 1Y8MA 5BXOA 3PUJA 5ARFA 3FULA 4FHJA 4B8CB 3Q5MA 3DSXA 2V4HC 3DB5A 2VJ8A 4JA9A 4I1OB 1TR4A 2LSUA 4GTTA 4PH4B 2ZGGA 1OWLA 3B7BA 4GTSA 5ENNA 3D9IA 3EU5A 4M7CA 1NP7A 5G55A 5KNHD 3ASOE 2WXLA 2RFMA 4IYPA 3EU9A 4U8VD 1SZAA 3J5QB 4G25A 5FQ7A 2RD0A 4H7YA 2DVWA 3PZ2A 4W9RA 3PE4A 5BXUA 3LY9A 3ZVVA 2JABA 3DBSA 2X3MA 1Z5SC 1E96B 3LJ3A 3CQCB 4HOQA 3RK6A 4I6EA 2QY7A 5EX3A 5FZSA 1N4PA 3X2QE 2G46A 3RO3A 4HORA 5LFAA 4NRHB 4Q69A 3AS5A 4XE0A 1TN7A 3ESLA 3CSFA 3UXGA 1A5EA 3C98A 4GMLA 5JA4D 4CRWA 4KBQA 1Q2ZA 4OVVA 1EPUA 2QYJA 2LXLA 3Q47B 3FEXA 3ZFWA 2OEVA 4K0RA 5F59A 4GA1A 4GZ5A 3UM0A 3I4GA 4K03A 5B1AE 1ELKA 5EKQD 3M54A 4FLBA 3SNXA 4E6HA 3IEGA 3JUEA 5BV0A 4BTBA 3TJPA 3KSQA 4L1BA 3D9MA 2CHXA 4CCAA 1LF8A 4AP2A 3TL5A 1EF1C 3EHMA 5JJ7A 1JUQA 3O48A 2OCCE 3RAYA 3ESKA 3Q15A 1SA5A 5F5EA 3IHXA 2L6BA 3T8KA 3ZRHA 3JUIA 3HNAA 4G23A 1DNPA 2J8SD 4I2ZA 3E37A 3SW9A 4TRQA 2XPZA 5IY5E 1ZBPA 4J8YA 2BEDA 2X38A 4YDWA 1H3IA 3NB2A 3QNKA 5LSXA 3DXMG 4B94A 5J90A 2DYRE 3E33A 2I6HA 1IYGA 3KS2A 1Z3YA 4U8HA 5TTFA 5H7PA 2I1JA 3ZYMA 5FINA 3U9WA 1E8ZA 1ELWA 5T3RA 3ABKE 3HXDA 2PQRA 5ENQD 1KT0A 3UIOC 4LDGA 4RVBA 3LPZA 4KVMA 3RJVA 2X6FA 1X5BA 4L9PA 2J9QA 3RAUA 2XEVA 1A17A 3D9LA 1TYQG 3PNTB 3MV2B 1UJKA 4I9CA 4HVBA 2KC7A 4U07A 3E32A 3BG1B 3QWVA 2P9SG 5TEGA 3SQVA 1QYMA 3UTMA 4JLGA 1SVXA 3FUDA 4BUPA 4YVOA 3CVPA 5EIDA 3UM2A 4F3VA 2IEJA 4CT0A 2WXPA 2JEKA 4K5BA 5F6KC 4GTRA 2OVBA 3FTVA 5A6CA 4UUCA 4DI3A 1WY6A 1N9AA 1FT2A 3HIZA 5G04C 3FUNA 1N4QA 4DLOA 5B1BE 2XRYA 3AS8A 3OTNA 2HM8A 1H6PA 4HLLA 3ZXSA 1Z3XA 4JVSA 1XGWA 4LCTA 2XPIA 2AXUA 3ASHA 1N0QA 3ASFA 4GZ3A 4QFVA 3S2AA 2KZTB 3ULYA 5JJTA 4AXHA 2C2LA 3R9AB 3KAEA 1FT1A 3BU8A 3HG0D 4BERA 3D3MA 2VSOE 2MHKA 4BX9A 3ENEA 2F0YA 1UJJA 5T8IA 1NA0A 4O30A 3C72A 2RFAA 4CGWA 3CKBA 3LCAA 5DIZA 1HFAA 1MX2A 3OPEA 3CGHA 3LY7A 1PY1A 4AY6A 2QYUA 5KJLA 1E7VA 1Z6TA 2E2EA 1N11A 2VYIA 3ASDA 1TN6A 2IY0C 4CZ2D 4QEOA 2B0OE 2WXRA 3PS6A 5CEDB 2IOSA 5FTPA 4BEPA 2HE0A 3L08A 4TXRA 4UWKA 2HR2A 2XQ0A 4JL0A 3V30A 1SA4A 4C9BB 4EZJA 3ASNE 4RG6A 4FJYA 3OS5A 2XEHA 3CHOA 1MVXA 3CVXA 2QPWA 3ZHEB 5ENSD 1KPSB 3U4TA 2ILRA 3MYVA 3VLFA 5JHAA 4F6RD 3SFYA 2H6GA 3QDNA 4UWHA 4QQIA 1YCSB 3CVLA 5KBAA 1NA3A 3I5PA 4YVQC 3EJNA 3S8PA 2R2LA 2WVIA 4JC8A 4MRUA 3S7DA 3UPVA 3ZEFA 5KNGA 2PNNA 3Q78A 1S70B 3TG4A 4BFRA 4J8OA 3AS4A 3ZPJA 4GCNA 5FQ4A 5AYFA 2R17C 4GAAA 3S7BA 4I17A 2ZGDA 2YQ8A 2ZXWE 2J49A 1O9SA 5D0OD 5A23A 4WNGA 4AV7A 2XS8A 4L2YA 3SGHA 3O4ZA 4QEPA 4K5CA 3R7RA 4EPZA 4QENA 2KBXA 3VUZA 3T5VA 3PREA 3NOGD 5HRYA 5DBKA 4BSXA 4KZ0A 4HI8A 2FO1E 3G2VA 1OWOA 3FEYA 4V3IA 5ENTD 2BUGA 3JQ1A 1E8WA 4PS8A 1WDYA 5HI7A 4UI9K 5CMWA 4BSZB 1E7UA 4ANVA 4G24A 2Y69E 4Z4PA 1MX4A 4GMJA 1HX8A 1JCSA 3SBTB 5EILA 3W9GA 4LNGA 5E76A 5CBOA 4Q94A 2BTDA 4IJDA 5AQ7A 2IOLA 2WXOA 3TWQA 3Q7FA 3CHRA 2GRMA 1VDYA 2FI7A 3ULEG 2L0TB 5KJNA 1IQRA 4URKA 3DWLG 3KEAA 2HO1A 3L16A 1TJFA 1B89A 3ZYKA 4BTAA 3PEUB 4EZKA 3D9KA 3JCKC 3ABLE 1IHBA 2ZISA 4CDMA 1NI1A 4XI9A 4ABNA 2AXZA 3ML9A 5E75A 4FULA 4J8DA 4GA0A 5LX8A 4J8FA 4YDYA 1OCZE 4N3AA 1K8KG 4Y6WA 4FA6A 5JJ6A 1HF8A 2P9UG 4U04A 2R05A 4ANWA 3KSLA 3WXXA 1DVPA 5T5GA 2VGXB 1JPLA 3IHYA 3TWWA 2WXFA 2XGSA 5CECB 3NF1A 2EIJE 4JHRA 1OXJA 1MVHA 5AIJA 3M53A 3AG3E 4HB5A 3CLJA 4JPSA 1WG0A 4XI0A 3TG5A 1K3ZD 3JQ0A 3PZDA 1FCHA 2WXMA 2VSYA 4WNDA 1IHGA 2DWZA 3B13A 3ABME 1TNYA 3JXJA 2V5FA 4BETA 2V4LA 4J8SA 1W3BA 4FP7A 2DBAA 2XS1A 2XENA 3R7QA 4HBDA 4HQDA 4HFGA 2XCCA 4CDRA 3CK7A 3FTWA 3ZUVB 3AG2E 4WWNA 3UT7A 4OAUC 3TXMA 1XQHA 3FU0A 3TWSA 2J08A 3UKRG 3KMAA 3L6AA 4RZ0A 1DC2A 1ZU2A 3TWXA 3DPYA 1OCCE 1NZNA 3CVYA 4HRNA 3T5XA 1FVFA 5ENRD 4F1SA 3MA5A 2BKKB 3N71A 1V55E 3F9WA 2EIME 5FZRA 3AG4E 5KCMA 3QB2A 4I1AA 1RW2A 3KEZA 5CMYA 3MO2A 4YPUA 3HVEB 4EECA 2CG3A 2WMNA 2I2OA 3FUFA 1ZKKA 1TNZA 1TEZA 2A5EA 5LCWC 3ZN3A 3LVRE 2QZAA 4LSZE 3M5AA 2A4ZA 2X6IA 3TGOA 5FT9A 2WPVA 5BUZA 4U95D 2Y4TA 3KD7A 4ACKA 4CT4A 2YNQA 2VTBA 5CRUA 4BT8A 1N94A 4TUMA 2KZTA 3LEWA 3LJNA 3FU5A 4L23A 1BLXB 2GW1A 2WXGA 4RLYA 4ME2A 1K1AA 1JWGA 3GW4A 4HOTA 3SFXA 4HXIA 3FPDA 2I9CA 3QC1A 3NZUA 2DYSE 3I3NA 5EG2A 1EYHA 5AN8A 3MEKA 2C0MA 3SFZA 3L82A 1PC2A 2P9IG 4DX7D 2QFCA 3FUEA 3ONKA 5FJYA 2J4DA 3RQ4A 3FTSA 3UT8A 3AU4A 2V0PA 2H6HA 4JDSA 4FHKA 3VV0A 2FF4A 2X6JA 3CK8A 3EHRA 4EQFA 1O1TA 4GTPA 1QNFA 2LAIA 2KCKA 3Q4AB 4WWPA 1OY3D 4N2QA 4A63B 4A55A 4YNPA 3AU5A 1OCOE 4KVOA 3ISMC 3L13A 3RIBA 4BX8A 3HHMA 4JD2G 1L5JA 3B7UX 1DCQA 4A3TA 2XPYA 3CBPA 3L22A 5HQ8A 4U0ZA 3UM1A 4C0MA 3Q9UC 4GYWA 2XCBA 3ZHEA 2LSVA 2UWJG 4LERA 4B89A 1SW6A 3CHMA 1N6CA 3PDNA 5TH7A 1O5MA 4GCOA 2KATA 1MJ0A 3UMVA 2HYZA 3ZKJA 2B6CA 4AM9A 1OWNA 1LD8A 2GROB 3G2WA 4HOUA 4HI9A 4LRZA 2XGOA 3RU0A 4ATGA 2RFIA 3BG0B 1UN9A 1PAQA 3V2OA 2C0LA 2IJGX 2AXVA 3B7SA 4IN3B 4WNFA 2R02A 4GYYA 5LCWJ 3APCA 3CK9A 4I2WA 3UX4A 2IGQA 2FBNA 2VSNA 4G8LA 2CG2A 2AW6A 2EILE 3G2TA 3RJWA 5AARA 4F7AA 3E4BA 4NURA 4DX2A 4FJZA 4NACA 2VSXE 3FH7A 4U0UA 2YINA 4KMOA 2PL2A 4AVXA 1UW4B 2LUHA 4F53A 2XZDG 1YYHA 5EX0A 4UWLA 3DSSA 2V8SE 3Q7AA 4PS3A 5B3SE 3WG7E 3UI2A 3OOIA 3FU3A 3VTYA 4DI4A 4LG6A 2DIWA 4NJ5A 3SHFA 4UI9C 2Y4UA 1FVHA 3R9MA 4I6JA 1NFIE 2FULA 4JHKA 2PQNA 1H2VC 1MHQA 3VLDA 4K5AB 1EDUA 2ZIRA 4DK5A 3CBMA 3LYAA 3M55A 1BU9A 3QK0A 4UQXA 2L9BA 2IO3C 5BW8C 5EYLA 1E8XA 2GRLA 2IU1A 2RG8A 3ZGQA 1N0RA 4ANUA 4E47A 3SWCA 4FC8A 4DX6D 2DZNA 2Y3AA 5HKPA 4KXKB 3LY8A 3GZSA 3CHSA 5LOZA 3PVLA 4P29A 3DRAA 3IBEA 3QJZA 5AJDA 1D8EA 4YNDA 3JXIA 5BV1A 4H12A 4GB9A 2NC9A 4N39A 1MQSA 2J4BA 2R59A 2E0IA 1OWMA 3FUHA 4MBGA 4XZ4A 3NOCD 4JA7A 1HXIA 2YHEA 3FUIA 3CEQA 2DZOA 1N95A 5KWDA 5LP0A 4AU7A 2WXQA 5CHEE 2VGXA 3FTYA 3PZ4A 4X8QA 4A1GA 2GRPB 4D10C 5BT1A 3FU6A 3PZ1A 3RO2A 2LAHA 3DALA 1E8YA 2KCVA 4C1QA 2R3AA 4U8YD 2ETBA 3BUAA 5KJMA 1RZ4A 2GRRB 4F1PA 3CSTA 3P2BA 3CQGB 2XGMA 4AOFA 2L6JA 3UINC 5AQAA 5ANLA 3V2XA 4U96D 2WQ6A 4JEUA 3QAQA 2BF0X 3ASGA 2GGFA 4EBAA 1JWFA 3L54A 3MKRA 3FH8A 2ONDA 3TXNA 4UI9J 3ZW3A 3ZYQA 3T9KA 5ARGA 5FWQA 5JJ0A 1Y6IA 2YHCA 3CR3A 4G26A 2ETCA 4CDNA 3FTUA 3Q49B 3FFLA 1QBQA 4I1MA 5FZQA 4A1SA 5FQ6A 2WXJA 5ENOD 4ILGA 2UY1B 4ANXA 3B95A 3C3QA 2W5YA 2IONA 3Q75A 3FUMA 2JV0A 1HS6A 4G2VA 1OCRE 3P1UA 2GRQB 4AIFA 1WM5A 2WXKA 1U2VG 3FTXA 3C3OA 3VTXA 2V5QC 1O1SA 2Y1LE 3CIAA 1G3NB 4DRXE 3I4RB 4TV3A 3QARA 2WXNA 1S63A 3E30A 5CBNA 3DSVA 1P5QA 4N5CA 5EYPF 1N4RA 3MO0A 4C0EA 3NQPA 3M56A 1K1BA 3CVWA 4N5QA 3HXFA 2ZU6B 3G2UA 4OYSA 5AENA 4J6IA 2EQXA 1OWPA 4UWFA 4HOSA 4BT9A 3NAWA 3GZ2A 4WUYA 5CERB 1S64A 2X6HA 5FIOA 3MKQB 2KM4A 4HRLA 3CHPA 3EIJA 4KZCA 1HO8A 5KJKA 4XX5A 4G1TA 4XKCA 3PUKA 1SQMA 5T0MA 3F9YA 2PM7A 3MGBA 3J5PA 3SO8A 1OT8A 1XNFA 5G2NA 1ML9A 1HG5A 4YDOA 2FEZA 4J83A 1LD7A 5JMND 3AAAC 3ML8A 4GTOA 2OV8A 1TJCA 2ETAA 4TXPA 4Q96A 5ANRA 3V79K 3SZ7A 5JHNA 4PDXA 3D9HA 3ZNGA 4DJAA 3D9PA 1JCRA 4PS7A 2MYOA 4YDEA 4KT6B 3PE3A 4U7EB 5T4YA 4YPAA 2O8JA 1KT1A 4WNEA 3APFA 3SF4A 2LNIA 3HXEA 3HXBA 2VGYA 4FMUA 3CVVA 4ACLA 2XEEA 3BEEA 3TWUA 1IQUA 2H6IA 3CVNA 1S0PA 3U64A 3URZA 2VQ2A 2FO7A 2R03A 2MOWA 4JW1A 5A7DB 2OOEA 1HH8A 5AQ9A 3L17A 2F8YA 5JHBA 4UQYA 4CYMD 1GW6A 1MZCA 3TWTA 1MX6A 3GYZA 3S7FA 3UKUG 4GTQA 4XEIG 2X6KA 3L9TA 3JYSA 1KZOA 5AYWD 3IXEA 2RKKA 4WWOA 4GTMA 4MLPA 4N3BA 2CHWA 2AWIA 1MYOA 4J7WA 2AJAA 3OXLA 2M63A 2L0IA 5F6LA 4GPMA 3DSTA 4C48B 2PZIA 2I1KA 3OXGA 4E85A 2W5ZA 3Q79A 5JIYA 2WMOA 1AWCB 4HLEA 4ZHBA 1H6KA 1O1RA 3D9OA 4LEUA 3BQOA 1MT6A 3QKYA 3K5KA 3DEPA 4GYOA 4I43A 5D2MC 1V54E 2LXMA 1E90A 3DPDA 4DLQA 5HS0A 2XRZA 1BPOA 2Y0BG 5C1DA 4BY6A 1X81A 2J09A 3PRZA 3E34A 3QOUA 4GPKA 4IJ8A 4PUCA 3KMTA 2KXPC 3W9FA 1TN8A 1AP7A 3MCXA 1JCQA 3HDXA 3FH5A 2GRNB 3QWWA 3ZU7B 2CFZA 3FP3A 3T8MA 1N52A 5BPPA 3FHEA 3RRMB 5EIBE 3FTZA 4B8AA 5FQ8A 1BI8B 2F37A 3QWPA 3IV0A 1TNBA 1D9SA 5M72A 1WAO1 2LO6A 4A3VA 1NL4A 4APFA 4WAFA 3LXUX 3ZYLA 1TNUA 2P9KG 4CGVA 4H7XA 4HS2A 2EINE 3F9ZA 5LSZA 4R7LA 3CV0A 1ZB1A 3HRAA 1SZ9A 4N3CA 3EIQC 1IKND 5EN5D 4JEHA 4JHJA 4FADA 1D8DA 2XHEA 3PEVB 3HXCA 3DSWA 4N2SA 1YMPA 5D0QD 1OUVA 4B93B 4BESA 3BO5A 5AAOA 2MRIA 4YNMA 3SBSA 1LTXA 2VTBB 1TNOA 2F8XK 2CHZA 4NQ0A 2QC9A 3EDTB 2NYJA 3B7TA 4AY5A 3UQ3A 1N6AA 4AEZC 1HU3A 1N54A 1ELRA 3U66A 3UIPC 3RSEG 3APDA 2WXIA 1H19A 3OXFA 2OVFA 3CVUA 3U3WA 2NXPA 3LKUA 3EHNA 3Q9NC 3NZSA 4U63A 2WQHA 5CCMA 3MX3A 4L2LA 2A5UA 4OVUA 2IF4A 2P9PG 1QQEA 5G05C 3UT4A 2P9NG 3LDZA 3F6QA 4B0ZA 3G2SA 3CBOA 4GZ6A 4I51A 4J7FA 2Q7FA 4DUIA 3TWRA 4GZDA 3NBNB 3MV3B 3M59A 3FY4A 3PH0C 4LNBA 1MUFA 2NSZA 2IQCA 5CEAA 2PM6A 3Q73A 4HRMB 3C3RA 5C2YA 4KYOB 3IHVA 3RKVA 3AJIA 3D9NA 3GZ1A 3RRUA 4OAVB 3ONLA 2JLBA 4O60A 2UY1A 3CKCA 5AJLA 3PNLB 4FU3A 4EBAG 2EIKE 4DPRA 3SD5A 1N4SA 4O6FA 3TWVA 5BNWA 3KMJA 2R5SA 4LUNU 3FUJA 3DEOA 1QZ2A 3FWVA 1HZ4A 4Y6CA 5ITZF 4MKTA 5G04J 4GA2A 4DX5D 3EHQA 2CFUA 3M57A 1YA0A 3UM3A 2P9LG 3FUKA 4GTVA 1N3JA 4O1OA 3EUVA 3ULQA 4NIKA 4EHMA 4MS6A 1BD8A 4IRUA 1UOHA 1H2TC 1H2UA 3PZ3A 1H6OA 3LVQE 2WB2A 1FPPA 3HYMB 3SY2A 3OAWA 1KLXA 4DX1A 4ZFHA 3AG1E 4MI0A 3FDHA 3MO5A 3MKQA 4RSYA 4M3OA 1U3CA 2XZTG 4GMRA 1BI7B 3S7JA 4J7IA 4CEMA 4G8KA 3CVQA 3DSUA 4UQZA 3D9JA 5T0KA 4XKBA 4AJWA 2BQZA 4J8EA 2VGEA 3MZLB 2IFUA 3EP0A 2WQ7A 3V31A 4ATZD 5G05J 2BKGA 3C5RA 3IKOB 1INZA 4ILHB 4GZCA 3MJWA 2F69A 5D66A 4G11A 4XIFA 4HNAD 5JINA 5ENPD 4J0UA 2KCLA 1KZPA 1IXVA 4MI5A 4NVQA 2P58C 1UG3A 4EZLA 4UWGA 5CRVA 3TAXA 4IULA 3UUXA 3VLEA 5AQBA 4LNUD 1PEGA 4BWRA 4Z68A 4L7TA 4FLHA 4O1PA 2OEWA
chains in the Genus database with same CATH topology
3BEEA 3MYVA 3VLFA 3ZIMA 1IQUA 5JHAA 4U0ZA 4C0MA 3QDNA 1U3DA 3CVNA 1S0PA 3CHQA 3U64A 5EDSA 3URZA 4UWHA 4GYWA 2VQ2A 2XCBA 3ZHEA 3CVLA 2FO7A 2LSVA 2UWJG 1NA3A 3LS8A 3K9IA 4LERA 4B89A 3I5PA 2AVPA 3CHMA 3M58A 4JW1A 2MOWA 1N6CA 4YVQC 5A7DB 2OOEA 3PDNA 3EJNA 4U0SA 2WXHA 3SI5A 5TH7A 3S8PA 1HH8A 4GCOA 3L17A 4I6GA 2KATA 2WVIA 3RRNB 5CPRB 5JHBA 4UQYA 3UMVA 1UN8A 1GW6A 2HYZA 4JZYA 4JC8A 4MRUA 5CCLA 3S7DA 3UPVA 4AM9A 2WM9A 5J08A 3ZEFA 3GYZA 3S7FA 1OWNA 3G2WA 2J07A 4RG9A 3HVEA 4HOUA 1HG2A 1HE8A 4TUUA 3B7RL 4LRZA 2X6KA 3JYSA 1H0AA 2XGOA 5AYWD 3RU0A 4ATGA 3BG0B 4APOA 3TG4A 1UN9A 2RFIA 4I9EA 1PAQA 4ILIA 2C0LA 2DCPA 4WWOA 2IJGX 4BFRA 4MLPA 3F9XA 4J8OA 3AS4A 4N3BA 2CHWA 2AXVA 3ZPJA 2AWIA 3B7SA 4GU5A 4IN3B 4WNFA 4JXTA 4GCNA 5FQ4A 3OXLA 4YPEA 5AYFA 2R17C 4GAAA 1Y8MA 3S7BA 4I17A 4GYYA 5LCWJ 2YQ8A 3APCA 3CK9A 4I2WA 3PUJA 3UX4A 2IGQA 2M63A 2J49A 2FBNA 1O9SA 2L0IA 5ARFA 3FULA 4FHJA 5D0OD 3Q5MA 4B8CB 5F6LA 2VSNA 2CG2A 5A23A 4WNGA 2PZIA 2I1KA 3OXGA 4AV7A 4L2YA 3SGHA 3O4ZA 4E85A 3DB5A 4QEPA 2AW6A 3R7RA 4EPZA 4QENA 3G2TA 2VJ8A 4JA9A 2W5ZA 3VUZA 3T5VA 2WMOA 3RJWA 5JIYA 3PREA 4I1OB 2LSUA 4PH4B 5DBKA 4F7AA 3E4BA 4BSXA 4HLEA 4KZ0A 4NURA 4FJZA 4NACA 1H6KA 1OWLA 2VSXE 5ENNA 3D9IA 3D9OA 3FH7A 3G2VA 4LEUA 4U0UA 1NP7A 1MT6A 3QKYA 3K5KA 1OWOA 5G55A 2YINA 3FEYA 4GYOA 2PL2A 4I43A 4KMOA 4V3IA 2BUGA 3JQ1A 4AVXA 1E8WA 1UW4B 4PS8A 2WXLA 5HI7A 4F53A 4UI9K 4IYPA 1E90A 5EX0A 3DPDA 5CMWA 4DLQA 4UWLA 2V8SE 1E7UA 1SZAA 4G24A 4ANVA 4PS3A 2XRZA 1BPOA 4G25A 4Z4PA 5FQ7A 4GMJA 3OOIA 5C1DA 1HX8A 3FU3A 4BY6A 2J09A 3PRZA 3VTYA 2RD0A 4DI4A 3QOUA 4H7YA 4GPKA 3SBTB 4IJ8A 2DIWA 4PUCA 4W9RA 3KMTA 4NJ5A 3SHFA 4UI9C 2Y4UA 3PE4A 1FVHA 4I6JA 2FULA 4JHKA 3MCXA 5E76A 4Q94A 2BTDA 3LY9A 2PQNA 1H2VC 1MHQA 3HDXA 3VLDA 4IJDA 2IOLA 3ZVVA 2WXOA 1EDUA 3DBSA 2X3MA 3CHRA 3FH5A 4DK5A 2GRMA 3CBMA 3QWWA 1VDYA 2FI7A 1E96B 3LYAA 3M55A 3LJ3A 2CFZA 3CQCB 3FP3A 1N52A 3QK0A 4HOQA 2L9BA 4I6EA 4UQXA 2QY7A 5EX3A 3RK6A 5BPPA 2L0TB 5FZSA 3FHEA 5BW8C 3RRMB 5KJNA 3FTZA 1IQRA 4B8AA 4URKA 5FQ8A 2G46A 2HO1A 1E8XA 3L16A 1TJFA 2GRLA 2IU1A 3QWPA 3RO3A 3IV0A 2RG8A 5LFAA 3ZGQA 4NRHB 4ANUA 4Q69A 4E47A 3SWCA 3AS5A 1B89A 3ZYKA 4FC8A 4BTAA 5M72A 3PEUB 4EZKA 1WAO1 3D9KA 2LO6A 2Y3AA 4XE0A 3JCKC 4A3VA 4APFA 4WAFA 3LXUX 4CDMA 3ZYLA 4XI9A 3ESLA 3CSFA 4ABNA 2AXZA 4KXKB 3ML9A 3C98A 4GMLA 5E75A 4CRWA 4CGVA 4H7XA 4KBQA 1EPUA 4OVVA 4HS2A 3LY8A 3GZSA 3Q47B 3CHSA 3FEXA 5LOZA 3F9ZA 5LSZA 3PVLA 4P29A 4R7LA 3CV0A 4FULA 3ZFWA 3IBEA 3QJZA 4K0RA 5AJDA 5F59A 4J8DA 1SZ9A 4N3CA 4GA0A 5LX8A 4YNDA 4GA1A 3EIQC 4GZ5A 4J8FA 5BV1A 3I4GA 4N3AA 4K03A 4H12A 4GB9A 4JEHA 2NC9A 4JHJA 4N39A 4Y6WA 1MQSA 1ELKA 2J4BA 4FADA 5EKQD 2R59A 3M54A 4FLBA 2E0IA 3SNXA 2XHEA 3IEGA 4E6HA 5BV0A 3PEVB 4BTBA 1OWMA 3FUHA 5JJ6A 3TJPA 1HF8A 4U04A 4FA6A 4L1BA 4N2SA 3D9MA 5D0QD 1OUVA 2CHXA 4XZ4A 4ANWA 4CCAA 3WXXA 4JA7A 1HXIA 1DVPA 1LF8A 2VGXB 4AP2A 2YHEA 3FUIA 3TL5A 5T5GA 3CEQA 1JPLA 1EF1C 3IHYA 2WXFA 2XGSA 3EHMA 5JJ7A 3T8MA 3NF1A 1JUQA 3BO5A 3O48A 5LP0A 4AU7A 2WXQA 5CHEE 2MRIA 4YNMA 3SBSA 2VGXA 3FTYA 3RAYA 2VTBB 4JHRA 3ESKA 3Q15A 1MVHA 5F5EA 2CHZA 4NQ0A 4A1GA 5AIJA 3IHXA 3EDTB 3M53A 3ZRHA 3CLJA 4JPSA 4XI0A 3B7TA 3TG5A 3JUIA 3JQ0A 3PZDA 1FCHA 2WXMA 3UQ3A 4AY5A 4D10C 5BT1A 3FU6A 3HNAA 4G23A 2VSYA 1DNPA 1IHGA 4WNDA 1N6AA 3RO2A 2LAHA 4AEZC 3B13A 4I2ZA 3DALA 1HU3A 1N54A 1ELRA 3U66A 1E8YA 2KCVA 4C1QA 3APDA 2WXIA 1H19A 3OXFA 2XPZA 4TRQA 2R3AA 3SW9A 2OVFA 1ZBPA 2V5FA 3CVUA 3U3WA 2X38A 5KJMA 2V4LA 2NXPA 3LKUA 1H3IA 3EHNA 3QNKA 3NZSA 5LSXA 4U63A 2WQHA 4J8SA 5CCMA 1W3BA 3MX3A 4FP7A 2DBAA 4L2LA 4B94A 2A5UA 4OVUA 5J90A 2IF4A 3CSTA 2I6HA 3P2BA 3R7QA 1IYGA 3CQGB 3KS2A 1QQEA 1Z3YA 4U8HA 2XGMA 5G05C 5TTFA 2I1JA 3UT4A 3ZYMA 4AOFA 4HFGA 3U9WA 1E8ZA 2L6JA 1ELWA 2XCCA 5T3RA 3CK7A 4CDRA 3LDZA 3FTWA 5ANLA 3G2SA 2PQRA 4B0ZA 2WQ6A 4JEUA 3QAQA 1KT0A 2BF0X 3ASGA 2GGFA 4EBAA 3CBOA 4GZ6A 4WWNA 1JWFA 4I51A 4LDGA 3UT7A 3TXMA 4RVBA 3L54A 3LPZA 1XQHA 4KVMA 4J7FA 2Q7FA 3MKRA 2X6FA 3FH8A 3RJVA 4GZDA 2ONDA 1X5BA 3FU0A 3MV3B 3M59A 3FY4A 2J08A 2J9QA 3PH0C 2XEVA 1A17A 3D9LA 3L6AA 3TXNA 3PNTB 4RZ0A 1MUFA 2NSZA 3MV2B 4UI9J 2IQCA 1UJKA 1ZU2A 3ZW3A 2PM6A 4I9CA 4HVBA 3ZYQA 5ARGA 2KC7A 5FWQA 5JJ0A 4U07A 1Y6IA 2YHCA 1NZNA 3CR3A 4G26A 5C2YA 3BG1B 3QWVA 4KYOB 3CVYA 4CDNA 3FTUA 5TEGA 3Q49B 3FFLA 3IHVA 4I1MA 5FZQA 4A1SA 3RKVA 5FQ6A 4JLGA 3T5XA 1FVFA 2WXJA 3FUDA 4BUPA 3D9NA 3GZ1A 3RRUA 4ILGA 2UY1B 3CVPA 4YVOA 4ANXA 4F3VA 3ONLA 2W5YA 4CT0A 4F1SA 3MA5A 2IONA 2WXPA 2JLBA 2JEKA 3N71A 3F9WA 3FUMA 2JV0A 5F6KC 1HS6A 2OVBA 3FTVA 4G2VA 5FZRA 5A6CA 3P1UA 4DI3A 1WY6A 2UY1A 3CKCA 4AIFA 1WM5A 5AJLA 2WXKA 5KCMA 3FTXA 3VTXA 3HIZA 5G04C 3FUNA 3QB2A 3PNLB 4HORA 4I1AA 3CIAA 4FU3A 4DLOA 4EBAG 4DPRA 2XRYA 3SD5A 3AS8A 3I4RB 3OTNA 4TV3A 3KEZA 5CMYA 3MO2A 4YPUA 2HM8A 4O6FA 3QARA 2WXNA 3HVEB 5BNWA 3KMJA 2R5SA 4LUNU 3ZXSA 4EECA 2CG3A 2WMNA 3FWVA 1QZ2A 3FUJA 1Z3XA 2I2OA 3FUFA 4JVSA 1HZ4A 1XGWA 1ZKKA 4Y6CA 1P5QA 4MKTA 1TEZA 5G04J 4N5CA 5LCWC 4GA2A 3ZN3A 4LCTA 3MO0A 4C0EA 2XPIA 3LVRE 2AXUA 2CFUA 3ASHA 3NQPA 3ASFA 3M57A 3M5AA 3M56A 4GZ3A 4QFVA 2A4ZA 1YA0A 2X6IA 3S2AA 3CVWA 3TGOA 2KZTB 3FUKA 2ZU6B 5FT9A 2WPVA 3G2UA 1N3JA 5BUZA 4OYSA 3ULQA 2Y4TA 3KD7A 5AENA 5JJTA 4AXHA 4J6IA 2EQXA 2C2LA 1OWPA 3KAEA 4UWFA 3R9AB 4ACKA 4MS6A 4CT4A 2YNQA 4IRUA 2VTBA 4HOSA 4BT8A 1H2TC 4BT9A 1H2UA 3D3MA 2VSOE 2KZTA 2MHKA 3GZ2A 3LEWA 4WUYA 2X6HA 3ENEA 4BX9A 1UJJA 3MKQB 3FU5A 1NA0A 3LVQE 4L23A 5T8IA 2WB2A 2KM4A 2GW1A 3HYMB 3OAWA 3CHPA 2WXGA 4O30A 3EIJA 4KZCA 1HO8A 4ME2A 5KJKA 1KLXA 1JWGA 4XX5A 3GW4A 4MI0A 3FDHA 4G1TA 4HOTA 4XKCA 3MO5A 3MKQA 4HXIA 3PUKA 4RSYA 4CGWA 3CKBA 1SQMA 4M3OA 3FPDA 2I9CA 3F9YA 5T0MA 1U3CA 3LCAA 3NZUA 3QC1A 5DIZA 2PM7A 3I3NA 5EG2A 3MGBA 1EYHA 1HFAA 3MEKA 2C0MA 3S7JA 3SFZA 1XNFA 5G2NA 3OPEA 4CEMA 1ML9A 1PC2A 4J7IA 2QFCA 1HG5A 3CVQA 3CGHA 3FUEA 3LY7A 1PY1A 4AY6A 4UQZA 3ONKA 5FJYA 1E7VA 2FEZA 1Z6TA 2J4DA 3D9JA 3FTSA 5KJLA 4J83A 5T0KA 3RQ4A 2E2EA 3UT8A 3AU4A 2V0PA 2VYIA 4XKBA 4AJWA 3ASDA 2BQZA 4J8EA 3MZLB 2IFUA 3EP0A 2WQ7A 3ML8A 4JDSA 2OV8A 1TJCA 4QEOA 4FHKA 3VV0A 5G05J 2WXRA 2FF4A 2X6JA 3CK8A 3IKOB 4EQFA 3PS6A 4Q96A 1INZA 5ANRA 3SZ7A 1QNFA 2LAIA 2KCKA 2IOSA 4ILHB 5JHNA 4GZCA 4PDXA 3MJWA 4DJAA 3D9PA 2F69A 3Q4AB 5FTPA 4G11A 4WWPA 4PS7A 4XIFA 4N2QA 4KT6B 3PE3A 5JINA 3L08A 4A55A 4YNPA 4J0UA 4UWKA 3AU5A 5T4YA 2KCLA 4KVOA 2HR2A 4YPAA 2XQ0A 4JL0A 3L13A 2O8JA 4C9BB 3RIBA 4EZJA 4MI5A 1KT1A 4NVQA 4BX8A 4RG6A 3HHMA 4FJYA 4WNEA 3APFA 3SF4A 1L5JA 3B7UX 2LNIA 2P58C 1UG3A 4EZLA 3OS5A 4UWGA 3CHOA 1MVXA 2VGYA 4L7TA 3TAXA 4IULA 3UUXA 3VLEA 4A3TA 4FMUA 3CVXA 2XPYA 2QPWA 3ZHEB 3CVVA 1PEGA 4ACLA 4BWRA 3CBPA 3KMAA 3U4TA 2ILRA 4FLHA 3L22A 5HQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BEE A;  4U0Z A;  3QDN A;  3CVN A;  3URZ A;  4GYW A;  2VQ2 A;  2XCB A;  3ZHE A;  3CVL A;  2FO7 A;  2LSV A;  2UWJ G;  1NA3 A;  3K9I A;  2AVP A;  3M58 A;  1N6C A;  4YVQ C;  5A7D B;  2OOE A;  3PDN A;  4U0S A;  3S8P A;  5TH7 A;  1HH8 A;  4GCO A;  2KAT A;  5CPR B;  4UQY A;  2HYZ A;  5CCL A;  3S7D A;  3UPV A;  4AM9 A;  3GYZ A;  3S7F A;  4RG9 A;  4HOU A;  3JYS A;  2XGO A;  3RU0 A;  5AYW D;  2RFI A;  4APO A;  3TG4 A;  4I9E A;  2C0L A;  3F9X A;  4J8O A;  3AS4 A;  4N3B A;  3ZPJ A;  4IN3 B;  4WNF A;  4GCN A;  3OXL A;  4YPE A;  5AYF A;  3S7B A;  1Y8M A;  4I17 A;  4GYY A;  5LCW J;  2YQ8 A;  3CK9 A;  4I2W A;  2IGQ A;  2FBN A;  1O9S A;  5ARF A;  5D0O D;  3Q5M A;  5F6L A;  2VSN A;  4WNG A;  2PZI A;  3OXG A;  4QEP A;  3DB5 A;  4QEN A;  4JA9 A;  2W5Z A;  3VUZ A;  5JIY A;  3RJW A;  2LSU A;  5DBK A;  3E4B A;  4LEU A;  4U0U A;  1MT6 A;  3QKY A;  3K5K A;  4GYO A;  2PL2 A;  2BUG A;  5HI7 A;  4UI9 K;  5EX0 A;  4G24 A;  4G25 A;  4Z4P A;  3OOI A;  5C1D A;  3VTY A;  3QOU A;  4H7Y A;  4GPK A;  4IJ8 A;  4W9R A;  3KMT A;  4NJ5 A;  4UI9 C;  2Y4U A;  3PE4 A;  3LY9 A;  2PQN A;  4IJD A;  3CBM A;  3QWW A;  2FI7 A;  1E96 B;  3LYA A;  3M55 A;  3FP3 A;  4HOQ A;  4UQX A;  5EX3 A;  5FZS A;  5BW8 C;  5KJN A;  2G46 A;  2HO1 A;  3RO3 A;  4HOR A;  3QWP A;  3ZGQ A;  4NRH B;  4E47 A;  3SWC A;  3AS5 A;  1B89 A;  4BTA A;  5M72 A;  1WAO 1;  4XI9 A;  4ABN A;  4KXK B;  4CGV A;  4H7X A;  4KBQ A;  3LY8 A;  3Q47 B;  3F9Z A;  5LSZ A;  3CV0 A;  3ZFW A;  5F59 A;  4J8D A;  4N3C A;  4GA0 A;  4YND A;  4GA1 A;  4GZ5 A;  4J8F A;  4N3A A;  4H12 A;  2NC9 A;  4N39 A;  4Y6W A;  5EKQ D;  3M54 A;  3IEG A;  4BTB A;  5JJ6 A;  4U04 A;  4N2S A;  5D0Q D;  1OUV A;  3WXX A;  4JA7 A;  1HXI A;  5T5G A;  2VGX B;  3CEQ A;  2XGS A;  5JJ7 A;  3NF1 A;  3BO5 A;  3O48 A;  4AU7 A;  5CHE E;  4YNM A;  2VGX A;  3RAY A;  4JHR A;  3ESK A;  3Q15 A;  1MVH A;  5F5E A;  4NQ0 A;  3IHX A;  3M53 A;  3EDT B;  4XI0 A;  3TG5 A;  1FCH A;  3UQ3 A;  4AY5 A;  5BT1 A;  3HNA A;  4G23 A;  2VSY A;  4WND A;  1IHG A;  1N6A A;  3RO2 A;  4I2Z A;  3DAL A;  1ELR A;  2KCV A;  4C1Q A;  3SW9 A;  2R3A A;  3OXF A;  1ZBP A;  2V5F A;  3U3W A;  5KJM A;  3LKU A;  1H3I A;  5LSX A;  2WQH A;  5CCM A;  1W3B A;  2DBA A;  4B94 A;  2IF4 A;  2I6H A;  1IYG A;  3KS2 A;  1QQE A;  5TTF A;  2XGM A;  5G05 C;  2L6J A;  1ELW A;  2XCC A;  4CDR A;  3CK7 A;  2PQR A;  1KT0 A;  3ASG A;  3CBO A;  4GZ6 A;  4I51 A;  4LDG A;  1XQH A;  3LPZ A;  4J7F A;  2Q7F A;  3MKR A;  3RJV A;  2OND A;  3MV3 B;  3M59 A;  2J9Q A;  2XEV A;  1A17 A;  4RZ0 A;  1MUF A;  3MV2 B;  4UI9 J;  1ZU2 A;  4I9C A;  5ARG A;  2KC7 A;  5JJ0 A;  4U07 A;  4G26 A;  2YHC A;  1NZN A;  3QWV A;  4KYO B;  5TEG A;  3Q49 B;  3FFL A;  5FZQ A;  4A1S A;  3RKV A;  4JLG A;  4BUP A;  3GZ1 A;  4YVO A;  2UY1 B;  3CVP A;  4F3V A;  2W5Y A;  3MA5 A;  2JLB A;  3N71 A;  3F9W A;  2JV0 A;  5F6K C;  4G2V A;  5FZR A;  5A6C A;  2UY1 A;  3CKC A;  4AIF A;  1WM5 A;  3VTX A;  5G04 C;  4I1A A;  3AS8 A;  3MO2 A;  4YPU A;  4O6F A;  5BNW A;  3KMJ A;  2R5S A;  3FWV A;  1QZ2 A;  1ZKK A;  1HZ4 A;  4Y6C A;  1P5Q A;  5G04 J;  4N5C A;  5LCW C;  4GA2 A;  3ZN3 A;  3MO0 A;  2XPI A;  3ASH A;  3M57 A;  3ASF A;  3M5A A;  3M56 A;  4GZ3 A;  1YA0 A;  3TGO A;  5FT9 A;  2WPV A;  1N3J A;  3ULQ A;  2Y4T A;  3KD7 A;  5JJT A;  2C2L A;  3R9A B;  3KAE A;  4HOS A;  4BT8 A;  4BT9 A;  2MHK A;  3GZ2 A;  4WUY A;  1NA0 A;  2GW1 A;  3HYM B;  4O30 A;  4ME2 A;  5KJK A;  1KLX A;  3GW4 A;  4MI0 A;  4G1T A;  4HOT A;  3MO5 A;  4CGW A;  3CKB A;  3FPD A;  5T0M A;  3F9Y A;  3LCA A;  5DIZ A;  5EG2 A;  3MEK A;  2C0M A;  3S7J A;  1XNF A;  3OPE A;  4J7I A;  1ML9 A;  1PC2 A;  2QFC A;  3CVQ A;  3LY7 A;  4AY6 A;  4UQZ A;  5FJY A;  5KJL A;  2FEZ A;  3RQ4 A;  5T0K A;  4J83 A;  2E2E A;  2VYI A;  3ASD A;  2BQZ A;  4J8E A;  2IFU A;  3EP0 A;  4JDS A;  1TJC A;  4QEO A;  3VV0 A;  5G05 J;  2FF4 A;  3CK8 A;  4EQF A;  3SZ7 A;  2KCK A;  5JHN A;  2F69 A;  3Q4A B;  5FTP A;  4XIF A;  4N2Q A;  3PE3 A;  5JIN A;  4YNP A;  4J0U A;  2KCL A;  2HR2 A;  4YPA A;  4JL0 A;  2O8J A;  3RIB A;  4MI5 A;  1KT1 A;  4NVQ A;  4RG6 A;  4WNE A;  3SF4 A;  2LNI A;  2P58 C;  3OS5 A;  1MVX A;  2VGY A;  3TAX A;  3UUX A;  4FMU A;  2QPW A;  3ZHE B;  1PEG A;  4BWR A;  3CBP A;  3KMA A;  3U4T A;  5HQ8 A; 
#chains in the Genus database with same CATH topology
 3ZIM A;  1U3D A;  5EDS A;  3CHQ A;  4JB8 P;  3LS8 A;  3K9I A;  2AVP A;  3DXK G;  3M58 A;  3SI5 A;  4U0S A;  2WXH A;  4I6G A;  3RRN B;  5CPR B;  1UN8 A;  4JZY A;  5CCL A;  2WM9 A;  5J08 A;  2H6F A;  2P2C P;  2J07 A;  4RG9 A;  3HVE A;  4TXQ A;  2IO2 C;  1HG2 A;  1HE8 A;  4TUU A;  3B7R L;  1H0A A;  4APO A;  4RQI A;  4I9E A;  4ILI A;  2DCP A;  3F9X A;  4GU5 A;  3ZXP A;  4JXT A;  4YPE A;  1DCE A;  1Y8M A;  5BXO A;  3PUJ A;  5ARF A;  3FUL A;  4FHJ A;  4B8C B;  3Q5M A;  3DSX A;  2V4H C;  3DB5 A;  2VJ8 A;  4JA9 A;  4I1O B;  1TR4 A;  2LSU A;  4GTT A;  4PH4 B;  2ZGG A;  1OWL A;  3B7B A;  4GTS A;  5ENN A;  3D9I A;  3EU5 A;  4M7C A;  1NP7 A;  5G55 A;  5KNH D;  3ASO E;  2WXL A;  2RFM A;  4IYP A;  3EU9 A;  4U8V D;  1SZA A;  3J5Q B;  4G25 A;  5FQ7 A;  2RD0 A;  4H7Y A;  2DVW A;  3PZ2 A;  4W9R A;  3PE4 A;  5BXU A;  3LY9 A;  3ZVV A;  2JAB A;  3DBS A;  2X3M A;  1Z5S C;  1E96 B;  3LJ3 A;  3CQC B;  4HOQ A;  3RK6 A;  4I6E A;  2QY7 A;  5EX3 A;  5FZS A;  1N4P A;  3X2Q E;  2G46 A;  3RO3 A;  4HOR A;  5LFA A;  4NRH B;  4Q69 A;  3AS5 A;  4XE0 A;  1TN7 A;  3ESL A;  3CSF A;  3UXG A;  1A5E A;  3C98 A;  4GML A;  5JA4 D;  4CRW A;  4KBQ A;  1Q2Z A;  4OVV A;  1EPU A;  2QYJ A;  2LXL A;  3Q47 B;  3FEX A;  3ZFW A;  2OEV A;  4K0R A;  5F59 A;  4GA1 A;  4GZ5 A;  3UM0 A;  3I4G A;  4K03 A;  5B1A E;  1ELK A;  5EKQ D;  3M54 A;  4FLB A;  3SNX A;  4E6H A;  3IEG A;  3JUE A;  5BV0 A;  4BTB A;  3TJP A;  3KSQ A;  4L1B A;  3D9M A;  2CHX A;  4CCA A;  1LF8 A;  4AP2 A;  3TL5 A;  1EF1 C;  3EHM A;  5JJ7 A;  1JUQ A;  3O48 A;  2OCC E;  3RAY A;  3ESK A;  3Q15 A;  1SA5 A;  5F5E A;  3IHX A;  2L6B A;  3T8K A;  3ZRH A;  3JUI A;  3HNA A;  4G23 A;  1DNP A;  2J8S D;  4I2Z A;  3E37 A;  3SW9 A;  4TRQ A;  2XPZ A;  5IY5 E;  1ZBP A;  4J8Y A;  2BED A;  2X38 A;  4YDW A;  1H3I A;  3NB2 A;  3QNK A;  5LSX A;  3DXM G;  4B94 A;  5J90 A;  2DYR E;  3E33 A;  2I6H A;  1IYG A;  3KS2 A;  1Z3Y A;  4U8H A;  5TTF A;  5H7P A;  2I1J A;  3ZYM A;  5FIN A;  3U9W A;  1E8Z A;  1ELW A;  5T3R A;  3ABK E;  3HXD A;  2PQR A;  5ENQ D;  1KT0 A;  3UIO C;  4LDG A;  4RVB A;  3LPZ A;  4KVM A;  3RJV A;  2X6F A;  1X5B A;  4L9P A;  2J9Q A;  3RAU A;  2XEV A;  1A17 A;  3D9L A;  1TYQ G;  3PNT B;  3MV2 B;  1UJK A;  4I9C A;  4HVB A;  2KC7 A;  4U07 A;  3E32 A;  3BG1 B;  3QWV A;  2P9S G;  5TEG A;  3SQV A;  1QYM A;  3UTM A;  4JLG A;  1SVX A;  3FUD A;  4BUP A;  4YVO A;  3CVP A;  5EID A;  3UM2 A;  4F3V A;  2IEJ A;  4CT0 A;  2WXP A;  2JEK A;  4K5B A;  5F6K C;  4GTR A;  2OVB A;  3FTV A;  5A6C A;  4UUC A;  4DI3 A;  1WY6 A;  1N9A A;  1FT2 A;  3HIZ A;  5G04 C;  3FUN A;  1N4Q A;  4DLO A;  5B1B E;  2XRY A;  3AS8 A;  3OTN A;  2HM8 A;  1H6P A;  4HLL A;  3ZXS A;  1Z3X A;  4JVS A;  1XGW A;  4LCT A;  2XPI A;  2AXU A;  3ASH A;  1N0Q A;  3ASF A;  4GZ3 A;  4QFV A;  3S2A A;  2KZT B;  3ULY A;  5JJT A;  4AXH A;  2C2L A;  3R9A B;  3KAE A;  1FT1 A;  3BU8 A;  3HG0 D;  4BER A;  3D3M A;  2VSO E;  2MHK A;  4BX9 A;  3ENE A;  2F0Y A;  1UJJ A;  5T8I A;  1NA0 A;  4O30 A;  3C72 A;  2RFA A;  4CGW A;  3CKB A;  3LCA A;  5DIZ A;  1HFA A;  1MX2 A;  3OPE A;  3CGH A;  3LY7 A;  1PY1 A;  4AY6 A;  2QYU A;  5KJL A;  1E7V A;  1Z6T A;  2E2E A;  1N11 A;  2VYI A;  3ASD A;  1TN6 A;  2IY0 C;  4CZ2 D;  4QEO A;  2B0O E;  2WXR A;  3PS6 A;  5CED B;  2IOS A;  5FTP A;  4BEP A;  2HE0 A;  3L08 A;  4TXR A;  4UWK A;  2HR2 A;  2XQ0 A;  4JL0 A;  3V30 A;  1SA4 A;  4C9B B;  4EZJ A;  3ASN E;  4RG6 A;  4FJY A;  3OS5 A;  2XEH A;  3CHO A;  1MVX A;  3CVX A;  2QPW A;  3ZHE B;  5ENS D;  1KPS B;  3U4T A;  2ILR A;  3MYV A;  3VLF A;  5JHA A;  4F6R D;  3SFY A;  2H6G A;  3QDN A;  4UWH A;  4QQI A;  1YCS B;  3CVL A;  5KBA A;  1NA3 A;  3I5P A;  4YVQ C;  3EJN A;  3S8P A;  2R2L A;  2WVI A;  4JC8 A;  4MRU A;  3S7D A;  3UPV A;  3ZEF A;  5KNG A;  2PNN A;  3Q78 A;  1S70 B;  3TG4 A;  4BFR A;  4J8O A;  3AS4 A;  3ZPJ A;  4GCN A;  5FQ4 A;  5AYF A;  2R17 C;  4GAA A;  3S7B A;  4I17 A;  2ZGD A;  2YQ8 A;  2ZXW E;  2J49 A;  1O9S A;  5D0O D;  5A23 A;  4WNG A;  4AV7 A;  2XS8 A;  4L2Y A;  3SGH A;  3O4Z A;  4QEP A;  4K5C A;  3R7R A;  4EPZ A;  4QEN A;  2KBX A;  3VUZ A;  3T5V A;  3PRE A;  3NOG D;  5HRY A;  5DBK A;  4BSX A;  4KZ0 A;  4HI8 A;  2FO1 E;  3G2V A;  1OWO A;  3FEY A;  4V3I A;  5ENT D;  2BUG A;  3JQ1 A;  1E8W A;  4PS8 A;  1WDY A;  5HI7 A;  4UI9 K;  5CMW A;  4BSZ B;  1E7U A;  4ANV A;  4G24 A;  2Y69 E;  4Z4P A;  1MX4 A;  4GMJ A;  1HX8 A;  1JCS A;  3SBT B;  5EIL A;  3W9G A;  4LNG A;  5E76 A;  5CBO A;  4Q94 A;  2BTD A;  4IJD A;  5AQ7 A;  2IOL A;  2WXO A;  3TWQ A;  3Q7F A;  3CHR A;  2GRM A;  1VDY A;  2FI7 A;  3ULE G;  2L0T B;  5KJN A;  1IQR A;  4URK A;  3DWL G;  3KEA A;  2HO1 A;  3L16 A;  1TJF A;  1B89 A;  3ZYK A;  4BTA A;  3PEU B;  4EZK A;  3D9K A;  3JCK C;  3ABL E;  1IHB A;  2ZIS A;  4CDM A;  1NI1 A;  4XI9 A;  4ABN A;  2AXZ A;  3ML9 A;  5E75 A;  4FUL A;  4J8D A;  4GA0 A;  5LX8 A;  4J8F A;  4YDY A;  1OCZ E;  4N3A A;  1K8K G;  4Y6W A;  4FA6 A;  5JJ6 A;  1HF8 A;  2P9U G;  4U04 A;  2R05 A;  4ANW A;  3KSL A;  3WXX A;  1DVP A;  5T5G A;  2VGX B;  1JPL A;  3IHY A;  3TWW A;  2WXF A;  2XGS A;  5CEC B;  3NF1 A;  2EIJ E;  4JHR A;  1OXJ A;  1MVH A;  5AIJ A;  3M53 A;  3AG3 E;  4HB5 A;  3CLJ A;  4JPS A;  1WG0 A;  4XI0 A;  3TG5 A;  1K3Z D;  3JQ0 A;  3PZD A;  1FCH A;  2WXM A;  2VSY A;  4WND A;  1IHG A;  2DWZ A;  3B13 A;  3ABM E;  1TNY A;  3JXJ A;  2V5F A;  4BET A;  2V4L A;  4J8S A;  1W3B A;  4FP7 A;  2DBA A;  2XS1 A;  2XEN A;  3R7Q A;  4HBD A;  4HQD A;  4HFG A;  2XCC A;  4CDR A;  3CK7 A;  3FTW A;  3ZUV B;  3AG2 E;  4WWN A;  3UT7 A;  4OAU C;  3TXM A;  1XQH A;  3FU0 A;  3TWS A;  2J08 A;  3UKR G;  3KMA A;  3L6A A;  4RZ0 A;  1DC2 A;  1ZU2 A;  3TWX A;  3DPY A;  1OCC E;  1NZN A;  3CVY A;  4HRN A;  3T5X A;  1FVF A;  5ENR D;  4F1S A;  3MA5 A;  2BKK B;  3N71 A;  1V55 E;  3F9W A;  2EIM E;  5FZR A;  3AG4 E;  5KCM A;  3QB2 A;  4I1A A;  1RW2 A;  3KEZ A;  5CMY A;  3MO2 A;  4YPU A;  3HVE B;  4EEC A;  2CG3 A;  2WMN A;  2I2O A;  3FUF A;  1ZKK A;  1TNZ A;  1TEZ A;  2A5E A;  5LCW C;  3ZN3 A;  3LVR E;  2QZA A;  4LSZ E;  3M5A A;  2A4Z A;  2X6I A;  3TGO A;  5FT9 A;  2WPV A;  5BUZ A;  4U95 D;  2Y4T A;  3KD7 A;  4ACK A;  4CT4 A;  2YNQ A;  2VTB A;  5CRU A;  4BT8 A;  1N94 A;  4TUM A;  2KZT A;  3LEW A;  3LJN A;  3FU5 A;  4L23 A;  1BLX B;  2GW1 A;  2WXG A;  4RLY A;  4ME2 A;  1K1A A;  1JWG A;  3GW4 A;  4HOT A;  3SFX A;  4HXI A;  3FPD A;  2I9C A;  3QC1 A;  3NZU A;  2DYS E;  3I3N A;  5EG2 A;  1EYH A;  5AN8 A;  3MEK A;  2C0M A;  3SFZ A;  3L82 A;  1PC2 A;  2P9I G;  4DX7 D;  2QFC A;  3FUE A;  3ONK A;  5FJY A;  2J4D A;  3RQ4 A;  3FTS A;  3UT8 A;  3AU4 A;  2V0P A;  2H6H A;  4JDS A;  4FHK A;  3VV0 A;  2FF4 A;  2X6J A;  3CK8 A;  3EHR A;  4EQF A;  1O1T A;  4GTP A;  1QNF A;  2LAI A;  2KCK A;  3Q4A B;  4WWP A;  1OY3 D;  4N2Q A;  4A63 B;  4A55 A;  4YNP A;  3AU5 A;  1OCO E;  4KVO A;  3ISM C;  3L13 A;  3RIB A;  4BX8 A;  3HHM A;  4JD2 G;  1L5J A;  3B7U X;  1DCQ A;  4A3T A;  2XPY A;  3CBP A;  3L22 A;  5HQ8 A;  4U0Z A;  3UM1 A;  4C0M A;  3Q9U C;  4GYW A;  2XCB A;  3ZHE A;  2LSV A;  2UWJ G;  4LER A;  4B89 A;  1SW6 A;  3CHM A;  1N6C A;  3PDN A;  5TH7 A;  1O5M A;  4GCO A;  2KAT A;  1MJ0 A;  3UMV A;  2HYZ A;  3ZKJ A;  2B6C A;  4AM9 A;  1OWN A;  1LD8 A;  2GRO B;  3G2W A;  4HOU A;  4HI9 A;  4LRZ A;  2XGO A;  3RU0 A;  4ATG A;  2RFI A;  3BG0 B;  1UN9 A;  1PAQ A;  3V2O A;  2C0L A;  2IJG X;  2AXV A;  3B7S A;  4IN3 B;  4WNF A;  2R02 A;  4GYY A;  5LCW J;  3APC A;  3CK9 A;  4I2W A;  3UX4 A;  2IGQ A;  2FBN A;  2VSN A;  4G8L A;  2CG2 A;  2AW6 A;  2EIL E;  3G2T A;  3RJW A;  5AAR A;  4F7A A;  3E4B A;  4NUR A;  4DX2 A;  4FJZ A;  4NAC A;  2VSX E;  3FH7 A;  4U0U A;  2YIN A;  4KMO A;  2PL2 A;  4AVX A;  1UW4 B;  2LUH A;  4F53 A;  2XZD G;  1YYH A;  5EX0 A;  4UWL A;  3DSS A;  2V8S E;  3Q7A A;  4PS3 A;  5B3S E;  3WG7 E;  3UI2 A;  3OOI A;  3FU3 A;  3VTY A;  4DI4 A;  4LG6 A;  2DIW A;  4NJ5 A;  3SHF A;  4UI9 C;  2Y4U A;  1FVH A;  3R9M A;  4I6J A;  1NFI E;  2FUL A;  4JHK A;  2PQN A;  1H2V C;  1MHQ A;  3VLD A;  4K5A B;  1EDU A;  2ZIR A;  4DK5 A;  3CBM A;  3LYA A;  3M55 A;  1BU9 A;  3QK0 A;  4UQX A;  2L9B A;  2IO3 C;  5BW8 C;  5EYL A;  1E8X A;  2GRL A;  2IU1 A;  2RG8 A;  3ZGQ A;  1N0R A;  4ANU A;  4E47 A;  3SWC A;  4FC8 A;  4DX6 D;  2DZN A;  2Y3A A;  5HKP A;  4KXK B;  3LY8 A;  3GZS A;  3CHS A;  5LOZ A;  3PVL A;  4P29 A;  3DRA A;  3IBE A;  3QJZ A;  5AJD A;  1D8E A;  4YND A;  3JXI A;  5BV1 A;  4H12 A;  4GB9 A;  2NC9 A;  4N39 A;  1MQS A;  2J4B A;  2R59 A;  2E0I A;  1OWM A;  3FUH A;  4MBG A;  4XZ4 A;  3NOC D;  4JA7 A;  1HXI A;  2YHE A;  3FUI A;  3CEQ A;  2DZO A;  1N95 A;  5KWD A;  5LP0 A;  4AU7 A;  2WXQ A;  5CHE E;  2VGX A;  3FTY A;  3PZ4 A;  4X8Q A;  4A1G A;  2GRP B;  4D10 C;  5BT1 A;  3FU6 A;  3PZ1 A;  3RO2 A;  2LAH A;  3DAL A;  1E8Y A;  2KCV A;  4C1Q A;  2R3A A;  4U8Y D;  2ETB A;  3BUA A;  5KJM A;  1RZ4 A;  2GRR B;  4F1P A;  3CST A;  3P2B A;  3CQG B;  2XGM A;  4AOF A;  2L6J A;  3UIN C;  5AQA A;  5ANL A;  3V2X A;  4U96 D;  2WQ6 A;  4JEU A;  3QAQ A;  2BF0 X;  3ASG A;  2GGF A;  4EBA A;  1JWF A;  3L54 A;  3MKR A;  3FH8 A;  2OND A;  3TXN A;  4UI9 J;  3ZW3 A;  3ZYQ A;  3T9K A;  5ARG A;  5FWQ A;  5JJ0 A;  1Y6I A;  2YHC A;  3CR3 A;  4G26 A;  2ETC A;  4CDN A;  3FTU A;  3Q49 B;  3FFL A;  1QBQ A;  4I1M A;  5FZQ A;  4A1S A;  5FQ6 A;  2WXJ A;  5ENO D;  4ILG A;  2UY1 B;  4ANX A;  3B95 A;  3C3Q A;  2W5Y A;  2ION A;  3Q75 A;  3FUM A;  2JV0 A;  1HS6 A;  4G2V A;  1OCR E;  3P1U A;  2GRQ B;  4AIF A;  1WM5 A;  2WXK A;  1U2V G;  3FTX A;  3C3O A;  3VTX A;  2V5Q C;  1O1S A;  2Y1L E;  3CIA A;  1G3N B;  4DRX E;  3I4R B;  4TV3 A;  3QAR A;  2WXN A;  1S63 A;  3E30 A;  5CBN A;  3DSV A;  1P5Q A;  4N5C A;  5EYP F;  1N4R A;  3MO0 A;  4C0E A;  3NQP A;  3M56 A;  1K1B A;  3CVW A;  4N5Q A;  3HXF A;  2ZU6 B;  3G2U A;  4OYS A;  5AEN A;  4J6I A;  2EQX A;  1OWP A;  4UWF A;  4HOS A;  4BT9 A;  3NAW A;  3GZ2 A;  4WUY A;  5CER B;  1S64 A;  2X6H A;  5FIO A;  3MKQ B;  2KM4 A;  4HRL A;  3CHP A;  3EIJ A;  4KZC A;  1HO8 A;  5KJK A;  4XX5 A;  4G1T A;  4XKC A;  3PUK A;  1SQM A;  5T0M A;  3F9Y A;  2PM7 A;  3MGB A;  3J5P A;  3SO8 A;  1OT8 A;  1XNF A;  5G2N A;  1ML9 A;  1HG5 A;  4YDO A;  2FEZ A;  4J83 A;  1LD7 A;  5JMN D;  3AAA C;  3ML8 A;  4GTO A;  2OV8 A;  1TJC A;  2ETA A;  4TXP A;  4Q96 A;  5ANR A;  3V79 K;  3SZ7 A;  5JHN A;  4PDX A;  3D9H A;  3ZNG A;  4DJA A;  3D9P A;  1JCR A;  4PS7 A;  2MYO A;  4YDE A;  4KT6 B;  3PE3 A;  4U7E B;  5T4Y A;  4YPA A;  2O8J A;  1KT1 A;  4WNE A;  3APF A;  3SF4 A;  2LNI A;  3HXE A;  3HXB A;  2VGY A;  4FMU A;  3CVV A;  4ACL A;  2XEE A;  3BEE A;  3TWU A;  1IQU A;  2H6I A;  3CVN A;  1S0P A;  3U64 A;  3URZ A;  2VQ2 A;  2FO7 A;  2R03 A;  2MOW A;  4JW1 A;  5A7D B;  2OOE A;  1HH8 A;  5AQ9 A;  3L17 A;  2F8Y A;  5JHB A;  4UQY A;  4CYM D;  1GW6 A;  1MZC A;  3TWT A;  1MX6 A;  3GYZ A;  3S7F A;  3UKU G;  4GTQ A;  4XEI G;  2X6K A;  3L9T A;  3JYS A;  1KZO A;  5AYW D;  3IXE A;  2RKK A;  4WWO A;  4GTM A;  4MLP A;  4N3B A;  2CHW A;  2AWI A;  1MYO A;  4J7W A;  2AJA A;  3OXL A;  2M63 A;  2L0I A;  5F6L A;  4GPM A;  3DST A;  4C48 B;  2PZI A;  2I1K A;  3OXG A;  4E85 A;  2W5Z A;  3Q79 A;  5JIY A;  2WMO A;  1AWC B;  4HLE A;  4ZHB A;  1H6K A;  1O1R A;  3D9O A;  4LEU A;  3BQO A;  1MT6 A;  3QKY A;  3K5K A;  3DEP A;  4GYO A;  4I43 A;  5D2M C;  1V54 E;  2LXM A;  1E90 A;  3DPD A;  4DLQ A;  5HS0 A;  2XRZ A;  1BPO A;  2Y0B G;  5C1D A;  4BY6 A;  1X81 A;  2J09 A;  3PRZ A;  3E34 A;  3QOU A;  4GPK A;  4IJ8 A;  4PUC A;  3KMT A;  2KXP C;  3W9F A;  1TN8 A;  1AP7 A;  3MCX A;  1JCQ A;  3HDX A;  3FH5 A;  2GRN B;  3QWW A;  3ZU7 B;  2CFZ A;  3FP3 A;  3T8M A;  1N52 A;  5BPP A;  3FHE A;  3RRM B;  5EIB E;  3FTZ A;  4B8A A;  5FQ8 A;  1BI8 B;  2F37 A;  3QWP A;  3IV0 A;  1TNB A;  1D9S A;  5M72 A;  1WAO 1;  2LO6 A;  4A3V A;  1NL4 A;  4APF A;  4WAF A;  3LXU X;  3ZYL A;  1TNU A;  2P9K G;  4CGV A;  4H7X A;  4HS2 A;  2EIN E;  3F9Z A;  5LSZ A;  4R7L A;  3CV0 A;  1ZB1 A;  3HRA A;  1SZ9 A;  4N3C A;  3EIQ C;  1IKN D;  5EN5 D;  4JEH A;  4JHJ A;  4FAD A;  1D8D A;  2XHE A;  3PEV B;  3HXC A;  3DSW A;  4N2S A;  1YMP A;  5D0Q D;  1OUV A;  4B93 B;  4BES A;  3BO5 A;  5AAO A;  2MRI A;  4YNM A;  3SBS A;  1LTX A;  2VTB B;  1TNO A;  2F8X K;  2CHZ A;  4NQ0 A;  2QC9 A;  3EDT B;  2NYJ A;  3B7T A;  4AY5 A;  3UQ3 A;  1N6A A;  4AEZ C;  1HU3 A;  1N54 A;  1ELR A;  3U66 A;  3UIP C;  3RSE G;  3APD A;  2WXI A;  1H19 A;  3OXF A;  2OVF A;  3CVU A;  3U3W A;  2NXP A;  3LKU A;  3EHN A;  3Q9N C;  3NZS A;  4U63 A;  2WQH A;  5CCM A;  3MX3 A;  4L2L A;  2A5U A;  4OVU A;  2IF4 A;  2P9P G;  1QQE A;  5G05 C;  3UT4 A;  2P9N G;  3LDZ A;  3F6Q A;  4B0Z A;  3G2S A;  3CBO A;  4GZ6 A;  4I51 A;  4J7F A;  2Q7F A;  4DUI A;  3TWR A;  4GZD A;  3NBN B;  3MV3 B;  3M59 A;  3FY4 A;  3PH0 C;  4LNB A;  1MUF A;  2NSZ A;  2IQC A;  5CEA A;  2PM6 A;  3Q73 A;  4HRM B;  3C3R A;  5C2Y A;  4KYO B;  3IHV A;  3RKV A;  3AJI A;  3D9N A;  3GZ1 A;  3RRU A;  4OAV B;  3ONL A;  2JLB A;  4O60 A;  2UY1 A;  3CKC A;  5AJL A;  3PNL B;  4FU3 A;  4EBA G;  2EIK E;  4DPR A;  3SD5 A;  1N4S A;  4O6F A;  3TWV A;  5BNW A;  3KMJ A;  2R5S A;  4LUN U;  3FUJ A;  3DEO A;  1QZ2 A;  3FWV A;  1HZ4 A;  4Y6C A;  5ITZ F;  4MKT A;  5G04 J;  4GA2 A;  4DX5 D;  3EHQ A;  2CFU A;  3M57 A;  1YA0 A;  3UM3 A;  2P9L G;  3FUK A;  4GTV A;  1N3J A;  4O1O A;  3EUV A;  3ULQ A;  4NIK A;  4EHM A;  4MS6 A;  1BD8 A;  4IRU A;  1UOH A;  1H2T C;  1H2U A;  3PZ3 A;  1H6O A;  3LVQ E;  2WB2 A;  1FPP A;  3HYM B;  3SY2 A;  3OAW A;  1KLX A;  4DX1 A;  4ZFH A;  3AG1 E;  4MI0 A;  3FDH A;  3MO5 A;  3MKQ A;  4RSY A;  4M3O A;  1U3C A;  2XZT G;  4GMR A;  1BI7 B;  3S7J A;  4J7I A;  4CEM A;  4G8K A;  3CVQ A;  3DSU A;  4UQZ A;  3D9J A;  5T0K A;  4XKB A;  4AJW A;  2BQZ A;  4J8E A;  2VGE A;  3MZL B;  2IFU A;  3EP0 A;  2WQ7 A;  3V31 A;  4ATZ D;  5G05 J;  2BKG A;  3C5R A;  3IKO B;  1INZ A;  4ILH B;  4GZC A;  3MJW A;  2F69 A;  5D66 A;  4G11 A;  4XIF A;  4HNA D;  5JIN A;  5ENP D;  4J0U A;  2KCL A;  1KZP A;  1IXV A;  4MI5 A;  4NVQ A;  2P58 C;  1UG3 A;  4EZL A;  4UWG A;  5CRV A;  3TAX A;  4IUL A;  3UUX A;  3VLE A;  5AQB A;  4LNU D;  1PEG A;  4BWR A;  4Z68 A;  4L7T A;  4FLH A;  4O1P A;  2OEW A; 
#chains in the Genus database with same CATH homology
 3BEE A;  3MYV A;  3VLF A;  3ZIM A;  1IQU A;  5JHA A;  4U0Z A;  4C0M A;  3QDN A;  1U3D A;  3CVN A;  1S0P A;  3CHQ A;  3U64 A;  5EDS A;  3URZ A;  4UWH A;  4GYW A;  2VQ2 A;  2XCB A;  3ZHE A;  3CVL A;  2FO7 A;  2LSV A;  2UWJ G;  1NA3 A;  3LS8 A;  3K9I A;  4LER A;  4B89 A;  3I5P A;  2AVP A;  3CHM A;  3M58 A;  4JW1 A;  2MOW A;  1N6C A;  4YVQ C;  5A7D B;  2OOE A;  3PDN A;  3EJN A;  4U0S A;  2WXH A;  3SI5 A;  5TH7 A;  3S8P A;  1HH8 A;  4GCO A;  3L17 A;  4I6G A;  2KAT A;  2WVI A;  3RRN B;  5CPR B;  5JHB A;  4UQY A;  3UMV A;  1UN8 A;  1GW6 A;  2HYZ A;  4JZY A;  4JC8 A;  4MRU A;  5CCL A;  3S7D A;  3UPV A;  4AM9 A;  2WM9 A;  5J08 A;  3ZEF A;  3GYZ A;  3S7F A;  1OWN A;  3G2W A;  2J07 A;  4RG9 A;  3HVE A;  4HOU A;  1HG2 A;  1HE8 A;  4TUU A;  3B7R L;  4LRZ A;  2X6K A;  3JYS A;  1H0A A;  2XGO A;  5AYW D;  3RU0 A;  4ATG A;  3BG0 B;  4APO A;  3TG4 A;  1UN9 A;  2RFI A;  4I9E A;  1PAQ A;  4ILI A;  2C0L A;  2DCP A;  4WWO A;  2IJG X;  4BFR A;  4MLP A;  3F9X A;  4J8O A;  3AS4 A;  4N3B A;  2CHW A;  2AXV A;  3ZPJ A;  2AWI A;  3B7S A;  4GU5 A;  4IN3 B;  4WNF A;  4JXT A;  4GCN A;  5FQ4 A;  3OXL A;  4YPE A;  5AYF A;  2R17 C;  4GAA A;  1Y8M A;  3S7B A;  4I17 A;  4GYY A;  5LCW J;  2YQ8 A;  3APC A;  3CK9 A;  4I2W A;  3PUJ A;  3UX4 A;  2IGQ A;  2M63 A;  2J49 A;  2FBN A;  1O9S A;  2L0I A;  5ARF A;  3FUL A;  4FHJ A;  5D0O D;  3Q5M A;  4B8C B;  5F6L A;  2VSN A;  2CG2 A;  5A23 A;  4WNG A;  2PZI A;  2I1K A;  3OXG A;  4AV7 A;  4L2Y A;  3SGH A;  3O4Z A;  4E85 A;  3DB5 A;  4QEP A;  2AW6 A;  3R7R A;  4EPZ A;  4QEN A;  3G2T A;  2VJ8 A;  4JA9 A;  2W5Z A;  3VUZ A;  3T5V A;  2WMO A;  3RJW A;  5JIY A;  3PRE A;  4I1O B;  2LSU A;  4PH4 B;  5DBK A;  4F7A A;  3E4B A;  4BSX A;  4HLE A;  4KZ0 A;  4NUR A;  4FJZ A;  4NAC A;  1H6K A;  1OWL A;  2VSX E;  5ENN A;  3D9I A;  3D9O A;  3FH7 A;  3G2V A;  4LEU A;  4U0U A;  1NP7 A;  1MT6 A;  3QKY A;  3K5K A;  1OWO A;  5G55 A;  2YIN A;  3FEY A;  4GYO A;  2PL2 A;  4I43 A;  4KMO A;  4V3I A;  2BUG A;  3JQ1 A;  4AVX A;  1E8W A;  1UW4 B;  4PS8 A;  2WXL A;  5HI7 A;  4F53 A;  4UI9 K;  4IYP A;  1E90 A;  5EX0 A;  3DPD A;  5CMW A;  4DLQ A;  4UWL A;  2V8S E;  1E7U A;  1SZA A;  4G24 A;  4ANV A;  4PS3 A;  2XRZ A;  1BPO A;  4G25 A;  4Z4P A;  5FQ7 A;  4GMJ A;  3OOI A;  5C1D A;  1HX8 A;  3FU3 A;  4BY6 A;  2J09 A;  3PRZ A;  3VTY A;  2RD0 A;  4DI4 A;  3QOU A;  4H7Y A;  4GPK A;  3SBT B;  4IJ8 A;  2DIW A;  4PUC A;  4W9R A;  3KMT A;  4NJ5 A;  3SHF A;  4UI9 C;  2Y4U A;  3PE4 A;  1FVH A;  4I6J A;  2FUL A;  4JHK A;  3MCX A;  5E76 A;  4Q94 A;  2BTD A;  3LY9 A;  2PQN A;  1H2V C;  1MHQ A;  3HDX A;  3VLD A;  4IJD A;  2IOL A;  3ZVV A;  2WXO A;  1EDU A;  3DBS A;  2X3M A;  3CHR A;  3FH5 A;  4DK5 A;  2GRM A;  3CBM A;  3QWW A;  1VDY A;  2FI7 A;  1E96 B;  3LYA A;  3M55 A;  3LJ3 A;  2CFZ A;  3CQC B;  3FP3 A;  1N52 A;  3QK0 A;  4HOQ A;  2L9B A;  4I6E A;  4UQX A;  2QY7 A;  5EX3 A;  3RK6 A;  5BPP A;  2L0T B;  5FZS A;  3FHE A;  5BW8 C;  3RRM B;  5KJN A;  3FTZ A;  1IQR A;  4B8A A;  4URK A;  5FQ8 A;  2G46 A;  2HO1 A;  1E8X A;  3L16 A;  1TJF A;  2GRL A;  2IU1 A;  3QWP A;  3RO3 A;  3IV0 A;  2RG8 A;  5LFA A;  3ZGQ A;  4NRH B;  4ANU A;  4Q69 A;  4E47 A;  3SWC A;  3AS5 A;  1B89 A;  3ZYK A;  4FC8 A;  4BTA A;  5M72 A;  3PEU B;  4EZK A;  1WAO 1;  3D9K A;  2LO6 A;  2Y3A A;  4XE0 A;  3JCK C;  4A3V A;  4APF A;  4WAF A;  3LXU X;  4CDM A;  3ZYL A;  4XI9 A;  3ESL A;  3CSF A;  4ABN A;  2AXZ A;  4KXK B;  3ML9 A;  3C98 A;  4GML A;  5E75 A;  4CRW A;  4CGV A;  4H7X A;  4KBQ A;  1EPU A;  4OVV A;  4HS2 A;  3LY8 A;  3GZS A;  3Q47 B;  3CHS A;  3FEX A;  5LOZ A;  3F9Z A;  5LSZ A;  3PVL A;  4P29 A;  4R7L A;  3CV0 A;  4FUL A;  3ZFW A;  3IBE A;  3QJZ A;  4K0R A;  5AJD A;  5F59 A;  4J8D A;  1SZ9 A;  4N3C A;  4GA0 A;  5LX8 A;  4YND A;  4GA1 A;  3EIQ C;  4GZ5 A;  4J8F A;  5BV1 A;  3I4G A;  4N3A A;  4K03 A;  4H12 A;  4GB9 A;  4JEH A;  2NC9 A;  4JHJ A;  4N39 A;  4Y6W A;  1MQS A;  1ELK A;  2J4B A;  4FAD A;  5EKQ D;  2R59 A;  3M54 A;  4FLB A;  2E0I A;  3SNX A;  2XHE A;  3IEG A;  4E6H A;  5BV0 A;  3PEV B;  4BTB A;  1OWM A;  3FUH A;  5JJ6 A;  3TJP A;  1HF8 A;  4U04 A;  4FA6 A;  4L1B A;  4N2S A;  3D9M A;  5D0Q D;  1OUV A;  2CHX A;  4XZ4 A;  4ANW A;  4CCA A;  3WXX A;  4JA7 A;  1HXI A;  1DVP A;  1LF8 A;  2VGX B;  4AP2 A;  2YHE A;  3FUI A;  3TL5 A;  5T5G A;  3CEQ A;  1JPL A;  1EF1 C;  3IHY A;  2WXF A;  2XGS A;  3EHM A;  5JJ7 A;  3T8M A;  3NF1 A;  1JUQ A;  3BO5 A;  3O48 A;  5LP0 A;  4AU7 A;  2WXQ A;  5CHE E;  2MRI A;  4YNM A;  3SBS A;  2VGX A;  3FTY A;  3RAY A;  2VTB B;  4JHR A;  3ESK A;  3Q15 A;  1MVH A;  5F5E A;  2CHZ A;  4NQ0 A;  4A1G A;  5AIJ A;  3IHX A;  3EDT B;  3M53 A;  3ZRH A;  3CLJ A;  4JPS A;  4XI0 A;  3B7T A;  3TG5 A;  3JUI A;  3JQ0 A;  3PZD A;  1FCH A;  2WXM A;  3UQ3 A;  4AY5 A;  4D10 C;  5BT1 A;  3FU6 A;  3HNA A;  4G23 A;  2VSY A;  1DNP A;  1IHG A;  4WND A;  1N6A A;  3RO2 A;  2LAH A;  4AEZ C;  3B13 A;  4I2Z A;  3DAL A;  1HU3 A;  1N54 A;  1ELR A;  3U66 A;  1E8Y A;  2KCV A;  4C1Q A;  3APD A;  2WXI A;  1H19 A;  3OXF A;  2XPZ A;  4TRQ A;  2R3A A;  3SW9 A;  2OVF A;  1ZBP A;  2V5F A;  3CVU A;  3U3W A;  2X38 A;  5KJM A;  2V4L A;  2NXP A;  3LKU A;  1H3I A;  3EHN A;  3QNK A;  3NZS A;  5LSX A;  4U63 A;  2WQH A;  4J8S A;  5CCM A;  1W3B A;  3MX3 A;  4FP7 A;  2DBA A;  4L2L A;  4B94 A;  2A5U A;  4OVU A;  5J90 A;  2IF4 A;  3CST A;  2I6H A;  3P2B A;  3R7Q A;  1IYG A;  3CQG B;  3KS2 A;  1QQE A;  1Z3Y A;  4U8H A;  2XGM A;  5G05 C;  5TTF A;  2I1J A;  3UT4 A;  3ZYM A;  4AOF A;  4HFG A;  3U9W A;  1E8Z A;  2L6J A;  1ELW A;  2XCC A;  5T3R A;  3CK7 A;  4CDR A;  3LDZ A;  3FTW A;  5ANL A;  3G2S A;  2PQR A;  4B0Z A;  2WQ6 A;  4JEU A;  3QAQ A;  1KT0 A;  2BF0 X;  3ASG A;  2GGF A;  4EBA A;  3CBO A;  4GZ6 A;  4WWN A;  1JWF A;  4I51 A;  4LDG A;  3UT7 A;  3TXM A;  4RVB A;  3L54 A;  3LPZ A;  1XQH A;  4KVM A;  4J7F A;  2Q7F A;  3MKR A;  2X6F A;  3FH8 A;  3RJV A;  4GZD A;  2OND A;  1X5B A;  3FU0 A;  3MV3 B;  3M59 A;  3FY4 A;  2J08 A;  2J9Q A;  3PH0 C;  2XEV A;  1A17 A;  3D9L A;  3L6A A;  3TXN A;  3PNT B;  4RZ0 A;  1MUF A;  2NSZ A;  3MV2 B;  4UI9 J;  2IQC A;  1UJK A;  1ZU2 A;  3ZW3 A;  2PM6 A;  4I9C A;  4HVB A;  3ZYQ A;  5ARG A;  2KC7 A;  5FWQ A;  5JJ0 A;  4U07 A;  1Y6I A;  2YHC A;  1NZN A;  3CR3 A;  4G26 A;  5C2Y A;  3BG1 B;  3QWV A;  4KYO B;  3CVY A;  4CDN A;  3FTU A;  5TEG A;  3Q49 B;  3FFL A;  3IHV A;  4I1M A;  5FZQ A;  4A1S A;  3RKV A;  5FQ6 A;  4JLG A;  3T5X A;  1FVF A;  2WXJ A;  3FUD A;  4BUP A;  3D9N A;  3GZ1 A;  3RRU A;  4ILG A;  2UY1 B;  3CVP A;  4YVO A;  4ANX A;  4F3V A;  3ONL A;  2W5Y A;  4CT0 A;  4F1S A;  3MA5 A;  2ION A;  2WXP A;  2JLB A;  2JEK A;  3N71 A;  3F9W A;  3FUM A;  2JV0 A;  5F6K C;  1HS6 A;  2OVB A;  3FTV A;  4G2V A;  5FZR A;  5A6C A;  3P1U A;  4DI3 A;  1WY6 A;  2UY1 A;  3CKC A;  4AIF A;  1WM5 A;  5AJL A;  2WXK A;  5KCM A;  3FTX A;  3VTX A;  3HIZ A;  5G04 C;  3FUN A;  3QB2 A;  3PNL B;  4HOR A;  4I1A A;  3CIA A;  4FU3 A;  4DLO A;  4EBA G;  4DPR A;  2XRY A;  3SD5 A;  3AS8 A;  3I4R B;  3OTN A;  4TV3 A;  3KEZ A;  5CMY A;  3MO2 A;  4YPU A;  2HM8 A;  4O6F A;  3QAR A;  2WXN A;  3HVE B;  5BNW A;  3KMJ A;  2R5S A;  4LUN U;  3ZXS A;  4EEC A;  2CG3 A;  2WMN A;  3FWV A;  1QZ2 A;  3FUJ A;  1Z3X A;  2I2O A;  3FUF A;  4JVS A;  1HZ4 A;  1XGW A;  1ZKK A;  4Y6C A;  1P5Q A;  4MKT A;  1TEZ A;  5G04 J;  4N5C A;  5LCW C;  4GA2 A;  3ZN3 A;  4LCT A;  3MO0 A;  4C0E A;  2XPI A;  3LVR E;  2AXU A;  2CFU A;  3ASH A;  3NQP A;  3ASF A;  3M57 A;  3M5A A;  3M56 A;  4GZ3 A;  4QFV A;  2A4Z A;  1YA0 A;  2X6I A;  3S2A A;  3CVW A;  3TGO A;  2KZT B;  3FUK A;  2ZU6 B;  5FT9 A;  2WPV A;  3G2U A;  1N3J A;  5BUZ A;  4OYS A;  3ULQ A;  2Y4T A;  3KD7 A;  5AEN A;  5JJT A;  4AXH A;  4J6I A;  2EQX A;  2C2L A;  1OWP A;  3KAE A;  4UWF A;  3R9A B;  4ACK A;  4MS6 A;  4CT4 A;  2YNQ A;  4IRU A;  2VTB A;  4HOS A;  4BT8 A;  1H2T C;  4BT9 A;  1H2U A;  3D3M A;  2VSO E;  2KZT A;  2MHK A;  3GZ2 A;  3LEW A;  4WUY A;  2X6H A;  3ENE A;  4BX9 A;  1UJJ A;  3MKQ B;  3FU5 A;  1NA0 A;  3LVQ E;  4L23 A;  5T8I A;  2WB2 A;  2KM4 A;  2GW1 A;  3HYM B;  3OAW A;  3CHP A;  2WXG A;  4O30 A;  3EIJ A;  4KZC A;  1HO8 A;  4ME2 A;  5KJK A;  1KLX A;  1JWG A;  4XX5 A;  3GW4 A;  4MI0 A;  3FDH A;  4G1T A;  4HOT A;  4XKC A;  3MO5 A;  3MKQ A;  4HXI A;  3PUK A;  4RSY A;  4CGW A;  3CKB A;  1SQM A;  4M3O A;  3FPD A;  2I9C A;  3F9Y A;  5T0M A;  1U3C A;  3LCA A;  3NZU A;  3QC1 A;  5DIZ A;  2PM7 A;  3I3N A;  5EG2 A;  3MGB A;  1EYH A;  1HFA A;  3MEK A;  2C0M A;  3S7J A;  3SFZ A;  1XNF A;  5G2N A;  3OPE A;  4CEM A;  1ML9 A;  1PC2 A;  4J7I A;  2QFC A;  1HG5 A;  3CVQ A;  3CGH A;  3FUE A;  3LY7 A;  1PY1 A;  4AY6 A;  4UQZ A;  3ONK A;  5FJY A;  1E7V A;  2FEZ A;  1Z6T A;  2J4D A;  3D9J A;  3FTS A;  5KJL A;  4J83 A;  5T0K A;  3RQ4 A;  2E2E A;  3UT8 A;  3AU4 A;  2V0P A;  2VYI A;  4XKB A;  4AJW A;  3ASD A;  2BQZ A;  4J8E A;  3MZL B;  2IFU A;  3EP0 A;  2WQ7 A;  3ML8 A;  4JDS A;  2OV8 A;  1TJC A;  4QEO A;  4FHK A;  3VV0 A;  5G05 J;  2WXR A;  2FF4 A;  2X6J A;  3CK8 A;  3IKO B;  4EQF A;  3PS6 A;  4Q96 A;  1INZ A;  5ANR A;  3SZ7 A;  1QNF A;  2LAI A;  2KCK A;  2IOS A;  4ILH B;  5JHN A;  4GZC A;  4PDX A;  3MJW A;  4DJA A;  3D9P A;  2F69 A;  3Q4A B;  5FTP A;  4G11 A;  4WWP A;  4PS7 A;  4XIF A;  4N2Q A;  4KT6 B;  3PE3 A;  5JIN A;  3L08 A;  4A55 A;  4YNP A;  4J0U A;  4UWK A;  3AU5 A;  5T4Y A;  2KCL A;  4KVO A;  2HR2 A;  4YPA A;  2XQ0 A;  4JL0 A;  3L13 A;  2O8J A;  4C9B B;  3RIB A;  4EZJ A;  4MI5 A;  1KT1 A;  4NVQ A;  4BX8 A;  4RG6 A;  3HHM A;  4FJY A;  4WNE A;  3APF A;  3SF4 A;  1L5J A;  3B7U X;  2LNI A;  2P58 C;  1UG3 A;  4EZL A;  3OS5 A;  4UWG A;  3CHO A;  1MVX A;  2VGY A;  4L7T A;  3TAX A;  4IUL A;  3UUX A;  3VLE A;  4A3T A;  4FMU A;  3CVX A;  2XPY A;  2QPW A;  3ZHE B;  3CVV A;  1PEG A;  4ACL A;  4BWR A;  3CBP A;  3KMA A;  3U4T A;  2ILR A;  4FLH A;  3L22 A;  5HQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...