5ARFA

Smyd2 in complex with small molecule inhibitor compound-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5arfA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5arfA01
4GCNA 2F69A 3LPZA 5FJYA 2HO1A 3SZ7A 4HOTA 1P5QA 3CKBA 3OPEA 3MV2B 4JHRA 3UUXA 2IFUA 1PC2A 4JA9A 2Y4TA 3E4BA 1ELRA 5CCLA 4UQZA 3RU0A 2XGOA 4G2VA 2MHKA 3LCAA 3KMAA 4I17A 1KT1A 4EQFA 3QWWA 3M59A 3F9ZA 3OXLA 4J0UA 4KXKB 3LYAA 3CBPA 3JYSA 4UI9J 4AY6A 3LKUA 5EG2A 3QWPA 3RJVA 2XCCA 4I51A 5DBKA 4WNEA 1MVHA 1KT0A 4JA7A 1NZNA 1HXIA 2VGXB 3OS5A 2L6JA 3AS4A 4KBQA 3CV0A 3MKRA 3M56A 4QENA 3KS2A 3MO2A 4Z4PA 1WM5A 4J8DA 4NQ0A 4GZ5A 2UY1A 2V5FA 3MV3B 3IEGA 3PDNA 4XI9A 4RG9A 5CHEE 5G05J 3CK9A 4N3BA 3CBMA 4Y6CA 1OUVA 1B89A 5JINA 5KJLA 4U0ZA 4J8FA 2PL2A 4H7XA 1FCHA 2XEVA 4GA0A 4AY5A 4GCOA 4YNMA 5KJKA 2FO7A 3BO5A 2JLBA 1XNFA 2BQZA 1KLXA 1MT6A 1IYGA 5G04C 3Q47B 4YPUA 2J9QA 4I1AA 4UI9K 3SWCA 3U3WA 3F9XA 5T0KA 3OXFA 4H7YA 2BUGA 2PZIA 4JL0A 3CK7A 2KCVA 2VQ2A 3K9IA 4XIFA 3RIBA 5F59A 1ELWA 4IJDA 4J7FA 4WUYA 2JV0A 5FZRA 3MA5A 1Y8MA 4LEUA 3ASHA 4GYYA 1IHGA 3AS5A 4YPEA 4B94A 3CVPA 3FFLA 2KCKA 2Y4UA 3QOUA 5LCWC 4AU7A 5F6LA 3SW9A 3URZA 5DIZA 1HH8A 5A6CA 3ZFWA 4ME2A 3HYMB 4NVQA 5FZQA 5JIYA 3OXGA 4BTAA 3BEEA 3VTXA 5T0MA 3M54A 3ZGQA 2NC9A 2UY1B 3M55A 3CVQA 5F6KC 4YNPA 4GA1A 5JJ7A 2P58C 4WNGA 3NF1A 3S7FA 4I2WA 5D0OD 4GZ6A 4YPAA 2YQ8A 5HI7A 2G46A 5FZSA 4QEOA 3ASGA 3GZ1A 2E2EA 4IN3B 3KMTA 3S8PA 2C0MA 4FMUA 2HYZA 5AYFA 3RO2A 5A7DB 2XGMA 4U0UA 1O9SA 5HQ8A 5JHNA 2WQHA 3RKVA 5JJ0A 4BUPA 3M53A 2KATA 4Y6WA 4O30A 3SF4A 4XI0A 3EP0A 2HR2A 5BW8C 5JJ6A 3M5AA 3FP3A 4QEPA 4J8OA 3CVLA 4WNDA 1MUFA 4HORA 3CEQA 3RJWA 3LY9A 1ML9A 2FEZA 3U4TA 2PQNA 3ZN3A 4CGVA 2Q7FA 5EKQD 4CGWA 3QKYA 5KJMA 1NA3A 4UQXA 3VTYA 4UI9C 3S7DA 3TAXA 3FWVA 4CDRA 3GYZA 3EDTB 1WAO1 3M57A 4YVQC 3CK8A 4J8EA 4J83A 3Q5MA 2DBAA 2XGSA 3TG4A 3O48A 5TTFA 2GW1A 2VGYA 5AYWD 3ASFA 4AM9A 1YA0A 4G1TA 5CCMA 2UWJG 3MO0A 2W5ZA 3F9WA 4GPKA 1W3BA 3R9AB 4RG6A 4ABNA 3KD7A 5G05C 3S7JA 3VUZA 3ZHEA 1N6AA 4U04A 3Q4AB 4WNFA 4N3CA 3TG5A 4AIFA 2R3AA 1XQHA 3GW4A 1PEGA 3OOIA 2I6HA 2LNIA 4N39A 3FPDA 4LDGA 4E47A 3GZ2A 5FT9A 3ESKA 3M58A 2LSVA 3VV0A 3CVNA 4BT9A 2OOEA 4C1QA 3KAEA 4W9RA 3IHXA 4HOQA 5ARGA 3LY7A 5LSXA 2FBNA 2KCLA 2QFCA 5EX0A 4G23A 4N2SA 4I2ZA 4N5CA 4G26A 2PQRA 4H12A 2IF4A 2O8JA 3Q15A 3QWVA 5TH7A 5M72A 1ZKKA 3LY8A 5CPRB 2WPVA 2AVPA 5G04J 4G25A 1NA0A 4JDSA 4U07A 3S7BA 3UQ3A 4F3VA 5KJNA 2W5YA 1QZ2A 1TJCA 2C2LA 3WXXA 4KYOB 2IGQA 1E96B 3DB5A 2FI7A 4I9EA 5BT1A 4GYWA 4BT8A 1N6CA 3MEKA 3QDNA 4NRHB 3ZHEB 5T5GA 3DALA 2ONDA 1QQEA 3MO5A 4YNDA 4G24A 4J7IA 3F9YA 3RO3A 3TGOA 3ULQA 5LCWJ 4HOSA 5FTPA 4MI5A 3CKCA 2FF4A 2R5SA 3RAYA 2KC7A 2C0LA 2XCBA 3ASDA 3HNAA 5LSZA 4YVOA 4HOUA 5ARFA 1A17A 5EX3A 4MI0A 3CBOA 5C1DA 4N2QA 2XPIA 5F5EA 3UPVA 5TEGA 2LSUA 2QPWA 3Q49B 4BWRA 4JLGA 4GA2A 1N3JA 4N3AA 2VYIA 3RQ4A 3PE3A 2VGXA 3K5KA 3AS8A 5BNWA 5D0QD 1MVXA 4GZ3A 1ZBPA 3KMJA 3N71A 4A1SA 2VSYA 1H3IA 3ZPJA 4O6FA 1HZ4A 4GYOA 4BTBA 4RZ0A 2YHCA 5JJTA 2VSNA 1ZU2A 4NJ5A 4APOA 2RFIA 4UQYA 3PE4A 4IJ8A 4I9CA 4U0SA
chains in the Genus database with same CATH superfamily
2J49A 2IOLA 4U63A 3LPZA 1OT8A 3DPDA 3C3OA 4MRUA 1P5QA 3MV2B 3B95A 3U64A 2Y4TA 4AV7A 4RLYA 4YDWA 3RU0A 3UI2A 3DSSA 4GTMA 1KPSB 3NZSA 2X6HA 4AP2A 4I17A 1SW6A 2DZNA 4EQFA 1JCSA 3V2OA 2VJ8A 4J0UA 4KXKB 2EIKE 1VDYA 3JYSA 1ZB1A 2GROB 3Q7AA 4TXPA 3G2WA 3CQGB 4I51A 1MVHA 3IHVA 3B7UX 5FWQA 3M56A 3DPYA 1SVXA 3QNKA 4JVSA 1U3CA 2V5FA 3PDNA 1HU3A 4FC8A 4XI9A 4RG9A 4HRNA 3ZEFA 4N3BA 1B89A 5JINA 4H7XA 1WG0A 1YCSB 1OWLA 4OVUA 3FTVA 2FO7A 1XNFA 2BQZA 2IQCA 4UWKA 4HI9A 2YHEA 4YPUA 4I1AA 3ZUVB 3BU8A 1S0PA 1AP7A 1LD7A 4ZHBA 3DRAA 2VQ2A 3B7BA 4NIKA 4ANVA 2A4ZA 3E34A 3PVLA 1ELWA 1SA4A 4IJDA 3JQ1A 4HBDA 2JV0A 4IYPA 1FT1A 4U8YD 4GYYA 4YPEA 3URZA 5DIZA 1HH8A 5A6CA 3E33A 2I1KA 4RQIA 1SZ9A 3FU5A 5JIYA 3VTXA 5T0MA 1E8XA 2Y1LE 2IOSA 3M55A 3DWLG 4HB5A 2J4BA 4TXRA 4UWGA 2L6BA 1MZCA 1RW2A 5AQ7A 3NF1A 4UWHA 3RSEG 5CBNA 5HI7A 2G46A 3AU4A 3ASGA 2ETBA 3GZ1A 3DSTA 2E2EA 1TNBA 3I3NA 4J6IA 3FU6A 3KMTA 1JPLA 3OTNA 2C0MA 1IQUA 4ATGA 4GMJA 1JUQA 1TEZA 5JJ0A 3CQCB 2EINE 4GTSA 3SF4A 1KZOA 4I1OB 3G2VA 3NZUA 2HR2A 5JJ6A 4QEPA 3LXUX 2VSXE 4HORA 3CEQA 3LY9A 2GRLA 3PEVB 4K5AB 4BETA 4U96D 4PS3A 4U8VD 1EDUA 1JCQA 4CGVA 5KJMA 1NA3A 4B8AA 4UQXA 2LUHA 1ELKA 4UI9C 1TNYA 5AARA 3PH0C 1HE8A 1A5EA 4CDRA 2WQ7A 2FO1E 4YVQC 3JQ0A 4J8EA 4EPZA 3CHOA 3FH7A 2VGYA 3L54A 4G1TA 3Q7FA 5CCMA 5EIBE 2UWJG 2W5ZA 2XHEA 4GPKA 5BXUA 3KD7A 4ABNA 5FIOA 2DYRE 5C2YA 3ZHEA 1HS6A 1UJJA 1N4PA 3DSUA 3LVQE 3Q75A 4XKCA 3TG5A 2E0IA 4AIFA 5KNGA 2I6HA 1OY3D 4YDEA 5BXOA 3ASNE 4C48B 3L6AA 2MRIA 5J90A 3SBSA 4BSZB 2H6GA 5FT9A 4FADA 2AWIA 4M3OA 3VV0A 4KZ0A 4GTOA 4JEUA 4C1QA 3KAEA 1H19A 1JCRA 3T9KA 4W9RA 1Q2ZA 4HOQA 4LNBA 5JA4D 5ARGA 3LY7A 3RAUA 1YMPA 2FBNA 2WXNA 4I1MA 2KCLA 3S2AA 4DI3A 2WMNA 2L9BA 2DWZA 5ITZF 1L5JA 3SFZA 3IHYA 4CYMD 2XENA 1TN8A 3QWVA 5TH7A 4O1OA 1OCRE 4G25A 3SHFA 1N54A 3QB2A 4DLQA 4U07A 2NXPA 3UT7A 2W5YA 3UM0A 2IGQA 2I2OA 3DB5A 2FI7A 3SD5A 4I9EA 3TWUA 2RG8A 4GYWA 1HF8A 3KSQA 3ZIMA 1N6CA 3CVUA 2XEEA 3TGOA 2XRYA 5LCWJ 5FTPA 3CKCA 3CHPA 5KBAA 4FJZA 2KC7A 3MJWA 2C0LA 2XCBA 3ASDA 4ZFHA 2WXPA 5LSZA 2XS1A 3HXDA 3CSTA 5ARFA 3W9FA 3CBOA 1UW4B 4B0ZA 1MJ0A 2XPIA 2X6IA 3Q9NC 4BX8A 1HO8A 2QPWA 3Q49B 4PH4B 4GA2A 4N3AA 3RQ4A 3FUMA 1E8WA 1DCEA 2ETAA 3HVEA 5D0QD 5EIDA 2OCCE 1V55E 5B1BE 4A1SA 2J8SD 3PZ2A 3EHRA 5AQBA 3NBNB 4BTBA 3G2TA 5ENOD 4FHJA 3LEWA 2WXIA 4NJ5A 1LTXA 1E8ZA 3FULA 3SFYA 1HX8A 3D9JA 2XS8A 1RZ4A 3Q9UC 4Q69A 3FDHA 2VGEA 5AENA 4GCNA 3JUEA 4DLOA 2F69A 3TXNA 5KCMA 5FJYA 4TV3A 3OPEA 1N4QA 2PNNA 3UUXA 4JA9A 3PZDA 1DC2A 3L22A 4J7WA 3DEPA 1BD8A 2B0OE 2R02A 1IHBA 3Q73A 2R2LA 2LAIA 4OYSA 1KT1A 1O1RA 4ANXA 3AG3E 3F9ZA 4I6JA 4AVXA 3UKRG 4DX1A 2WXRA 3KSLA 3FUKA 5EG2A 2P9LG 4K03A 4EZKA 1INZA 3FUEA 4L7TA 2L6JA 4CZ2D 3KS2A 4GTVA 4WAFA 3NQPA 4BERA 4J8DA 1TN6A 2AXVA 4GZ5A 5EILA 2QY7A 5CHEE 3CBMA 3TXMA 2IU1A 5KJLA 2Y69E 4J8FA 4UUCA 2MOWA 1FCHA 5FINA 4D10C 4GA0A 4AY5A 4GCOA 4YNMA 3FUFA 2OVFA 1QBQA 4TRQA 2QYUA 1KLXA 1D8DA 2FULA 1TNUA 2MYOA 2KZTB 3O4ZA 1N52A 1PAQA 3UKUG 3MX3A 4DX7D 3DSWA 3P1UA 3EIQC 2BKKB 4XIFA 3SFXA 3MA5A 2L0IA 4GTRA 3RRUA 4LEUA 3AS5A 3QJZA 5ENTD 5AN8A 3CVPA 3ONLA 3FFLA 1HG2A 5F6LA 2WXGA 2XPZA 5ENSD 5EYPF 2F0YA 2X6FA 4ME2A 4CEMA 4FP7A 4ANUA 4NVQA 4HRLA 5AQ9A 1O1TA 3OXGA 2DVWA 3PRZA 5JHAA 3SGHA 3ZGQA 3DBSA 2NC9A 5EYLA 3V79K 2UY1B 3FTZA 4KVMA 4MLPA 1K1BA 4GA1A 2DZOA 2P58C 3ZVVA 2CHZA 4I2WA 5D0OD 3LDZA 4GZ6A 1N95A 4IN3B 1JWFA 4C0MA 3J5PA 3CVYA 3BQOA 3KEAA 3JXJA 3OAWA 4U0UA 5HQ8A 3SNXA 2PM7A 4BUPA 3I4GA 3PZ3A 3M53A 2QZAA 4NACA 4Y6WA 3FTXA 1K8KG 3D9KA 4APFA 3FTSA 3PZ1A 4J8OA 3HG0D 1MUFA 3TWRA 2RD0A 2FEZA 4PS8A 3ZN3A 5LP0A 3ABLE 3PEUB 5EN5D 1LF8A 2AJAA 4BEPA 2P9PG 5LFAA 2V4HC 3FWVA 4KT6B 2GRQB 3EDTB 4DRXE 4F1PA 2NYJA 3Q5MA 2WXJA 4AEZC 1N94A 3AU5A 5AYWD 1H6PA 3ASFA 1YA0A 4DX6D 3ZXSA 3MO0A 3F9WA 4RSYA 1W3BA 1IKND 5G05C 3UM2A 3PREA 2I1JA 3S7JA 3VUZA 1N6AA 3B13A 2KXPC 1DCQA 4WNFA 2GRPB 4JZYA 3GW4A 3OOIA 5AQAA 1TNOA 2LNIA 3APFA 4N39A 1TJFA 3EHNA 3ESKA 1H2VC 4I43A 5BPPA 5B3SE 4AOFA 3CVNA 2OOEA 2CFZA 2WQ6A 3ZYMA 5CECB 2WXMA 1OXJA 3IHXA 2F37A 2X3MA 2QFCA 2CHXA 3E30A 1E7VA 3UX4A 3SO8A 2PQRA 3Q15A 5M72A 3D9IA 4KVOA 1NA0A 4N5QA 3S7BA 3DEOA 2ZGGA 4QFVA 3W9GA 2P9UG 4XEIG 2C2LA 4BSXA 1E96B 1E8YA 5BT1A 2IO2C 4JPSA 3FU0A 4G8LA 4U95D 3AG4E 3UIPC 2ONDA 2OV8A 3CHMA 4CDNA 4MI5A 3RAYA 4HLLA 2X6JA 4F6RD 2GGFA 1SQMA 2AXZA 4YVOA 3CSFA 1A17A 4ILHB 3BUAA 3RRNB 3MCXA 3L16A 2ZISA 1S64A 4GZCA 2LO6A 3X2QE 3TWQA 5FQ6A 1UOHA 4JLGA 1N3JA 2VYIA 3PE3A 3K5KA 5BNWA 1MVXA 3B7TA 3EU5A 1O5MA 3KMJA 3D3MA 4K5BA 2F8XK 5E75A 4RZ0A 3BG1B 2YHCA 4R7LA 2VSNA 1ZU2A 1QNFA 4FA6A 1TR4A 3LJNA 3FY4A 2CFUA 1DVPA 4JD2G 2RFMA 1BPOA 5ANLA 4OAVB 3ESLA 2KBXA 2VTBB 3ZYKA 3SQVA 5AIJA 3CGHA 5FQ4A 3SZ7A 4XX5A 4XZ4A 2IFUA 1MHQA 4EHMA 3G2UA 3E4BA 3D9HA 2QYJA 2XGOA 5CEAA 5ANRA 5H7PA 1E7UA 3C98A 4G2VA 2MHKA 3LCAA 3CHQA 3KMAA 1DNPA 3QWWA 4HXIA 1UN8A 3VLFA 3LYAA 3CBPA 4UI9J 4OAUC 3LKUA 3QWPA 3FUDA 3RJVA 3UMVA 1U3DA 2BKGA 5DBKA 4WNEA 5CEDB 4MS6A 3AS4A 3MKRA 4QENA 4EBAG 5T8IA 4PDXA 1FVHA 1WM5A 4NQ0A 1N9AA 2UY1A 3MV3B 3ML9A 3FUNA 5ENPD 4JXTA 2HE0A 4Z68A 5E76A 2ZXWE 2BF0X 3PNLB 2R59A 3ULEG 2PL2A 4DI4A 4B89A 3QAQA 1BU9A 3KEZA 3HXBA 3PUJA 3ML8A 1MT6A 3UTMA 1IYGA 5G04C 3I5PA 4LRZA 3QK0A 2J9QA 4UI9K 3U3WA 3CHSA 4G8KA 3EUVA 2P9NG 3NB2A 2AXUA 2BUGA 5CRUA 5T4YA 1OWMA 3CK7A 4BX9A 2KCVA 3K9IA 3RIBA 3FUIA 4JHJA 5KWDA 2R17C 1Y8MA 3ASHA 4B94A 1IQRA 2KCKA 3HIZA 3TL5A 1TN7A 2AW6A 3HYMB 5AJLA 2IO3C 5FZQA 2IY0C 4RVBA 5CRVA 4FHKA 3L9TA 5A23A 3UINC 2XQ0A 2H6FA 3T5XA 3FHEA 3CVQA 5F6KC 3D9NA 4YNPA 4URKA 4WNGA 2J09A 4E85A 3AG1E 4GAAA 4YPAA 2WM9A 2LXMA 4QEOA 3PNTB 1SZAA 1V54E 3QARA 3GZSA 1MX6A 2HYZA 2WB2A 3CLJA 4YDYA 5A7DB 2XGMA 1O9SA 5JHNA 2WQHA 2NSZA 3RKVA 4GU5A 2P2CP 2KATA 4X8QA 4XI0A 1H0AA 3EP0A 5BW8C 3M5AA 4PUCA 3FP3A 3CVLA 1HFAA 4WNDA 4AJWA 3RJWA 4HS2A 5D66A 2DCPA 3HDXA 1OCCE 2PQNA 4ACKA 3CIAA 5EKQD 5FQ8A 3EHQA 5LOZA 3G2SA 4B8CB 3EU9A 4KMOA 3NOCD 3PS6A 4HFGA 3M57A 1E90A 3D9OA 3CK8A 3QC1A 4J83A 3B7RL 4L2LA 2DBAA 2XGSA 2ETCA 5TTFA 4AM9A 1Z3YA 3FTYA 2Y0BG 4Q96A 5FQ7A 1NI1A 1GW6A 3T8KA 3HXFA 2B6CA 1MQSA 2P9SG 3MGBA 3SBTB 4ANWA 2GRMA 3R9AB 4RG6A 3RRMB 5ENQD 1O1SA 4J8YA 4O1PA 3LJ3A 3ZW3A 3FU3A 3JXIA 3Q4AB 5BV1A 4N3CA 2I9CA 2LAHA 3TWWA 4HI8A 3ABKE 3VLEA 3V2XA 1PEGA 3JCKC 3E32A 3DSXA 4LDGA 1PY1A 3GZ2A 5HS0A 1D9SA 2J07A 4PS7A 3IXEA 1JWGA 2WXFA 2X38A 2X6KA 4BT9A 4A3TA 3ZNGA 1S63A 5EX0A 3DSVA 2R05A 4G23A 2EQXA 4MKTA 1BI8B 4I2ZA 4N5CA 2EILE 4BESA 4G26A 2P9IG 4CCAA 2Y3AA 4LG6A 4HRMB 2WPVA 3APCA 1BLXB 4WWNA 4FU3A 2WXOA 4L23A 3UQ3A 3UIOC 1S70B 2WXLA 5KJNA 5CMYA 4A63B 1QZ2A 1TJCA 4DJAA 4KYOB 2IEJA 3NOGD 4DX2A 3HVEB 3Q79A 2VTBA 4LSZE 3ULYA 3MEKA 3QDNA 4NRHB 4M7CA 4L2YA 3DALA 4L9PA 4TUUA 4LNUD 1QQEA 3FH8A 5HKPA 3MO5A 4DK5A 4YNDA 3ZYQA 3ZXPA 4G24A 3C5RA 4J7IA 3RO3A 4ATZD 4CDMA 1OWNA 2R5SA 2OVBA 2EIME 4BY6A 4K5CA 3HNAA 3C3RA 4LUNU 4HOUA 4B93B 2WXKA 4MI0A 5C1DA 4N2QA 4U7EB 4UWLA 3UPVA 3AAAC 2H6IA 5ENRD 3BG0B 3U66A 2H6HA 2V5QC 2BEDA 4C9BB 4JEHA 4GMLA 4F7AA 4A55A 4A3VA 4GZ3A 2VSOE 4Q94A 1H3IA 4LCTA 3ZPJA 4F1SA 4O6FA 5IY5E 1HZ4A 2OEVA 4GYOA 2WXQA 4U8HA 1OWPA 3Q78A 4K0RA 4UQYA 4YDOA 4FULA 4ACLA 4I9CA 2YNQA 5CERB 4DUIA 4JW1A 4E6HA 5CBOA 2OEWA 2DIWA 2LXLA 2HO1A 2EIJE 4HOTA 3CKBA 4JHRA 3FH5A 1H6KA 1H6OA 2L0TB 1PC2A 4WWOA 4XKBA 1FT2A 1ELRA 1EYHA 5CCLA 2QC9A 4IRUA 3ZU7B 4UQZA 2V8SE 4J8SA 4KZCA 1TYQG 3M59A 2ILRA 4HQDA 3OXLA 3SI5A 3ASOE 4AY6A 5J08A 4GMRA 3TJPA 3MZLB 2V4LA 2ZIRA 2XCCA 3MKQB 3TWSA 4QQIA 1KT0A 5AJDA 4JA7A 1NZNA 1HXIA 2VGXB 4JB8P 3OS5A 4EBAA 4KBQA 3CV0A 3MO2A 3R7QA 5ENNA 4Z4PA 2A5UA 2JABA 4ILGA 4LNGA 3UT4A 4FLHA 3IEGA 2WMOA 5G05J 2BTDA 4HLEA 3CK9A 1N11A 4Y6CA 1OUVA 1YYHA 4U0ZA 1UJKA 2A5EA 3ZYLA 1KZPA 2XEVA 3J5QB 2WVIA 5KJKA 5AAOA 3BO5A 2JLBA 1OCZE 1HG5A 5T3RA 3I4RB 3Q47B 4G11A 3IBEA 4MBGA 3R9MA 2XZDG 3SWCA 2XEHA 3F9XA 5T0KA 2YINA 3OXFA 1SA5A 4H7YA 2PZIA 4JL0A 3FTUA 4HNAD 1FPPA 2M63A 4FLBA 4EECA 1N4RA 5F59A 4J7FA 2R03A 4WUYA 5FZRA 4JC8A 1UN9A 3D9LA 3FEYA 1IHGA 4JHKA 3V31A 2Y4UA 3QOUA 5LCWC 4AU7A 1NL4A 3C3QA 3FUHA 4I6GA 4V3IA 3SW9A 3DXKG 2GRRB 3ZFWA 3EHMA 1EPUA 1AWCB 2PM6A 1MYOA 4BTAA 5JHBA 3BEEA 3RK6A 3M54A 4EZLA 3HRAA 1D8EA 2KZTA 4L1BA 4GTQA 3UT8A 2KM4A 5JJ7A 4NURA 3S7FA 1Z6TA 3APDA 2YQ8A 2RFAA 2CG3A 5FZSA 5LX8A 2WXHA 3HHMA 4UWFA 3UM3A 5EDSA 4EZJA 4LERA 2IJGX 3PUKA 3ABME 3V30A 3S8PA 4FMUA 3IV0A 5AYFA 3RO2A 1LD8A 1OWOA 3LS8A 4DPRA 2XRZA 1WDYA 4BFRA 1U2VG 3AJIA 4O30A 3E37A 3CVXA 4CRWA 4I6EA 1K1AA 3D9MA 4ILIA 4DX5D 1ML9A 3U4TA 1UG3A 3R7RA 4IULA 3L13A 1Y6IA 2Q7FA 4CGWA 3QKYA 5CMWA 3VTYA 5G55A 3S7DA 3TAXA 5KNHD 3FEXA 3GYZA 2V0PA 3P2BA 1WAO1 1QYMA 3ZKJA 3ZRHA 5B1AE 3T5VA 3F6QA 3O48A 3TG4A 2GW1A 4GZDA 2J08A 1H2UA 1N0RA 4C0EA 3MYVA 1NFIE 3FUJA 2XZTG 2XPYA 4U04A 4O60A 3TWTA 1X5BA 3EIJA 2R3AA 1XQHA 4CT4A 1MX4A 1BI7B 3UM1A 3B7SA 3FPDA 2P9KG 4E47A 3CVWA 3M58A 1H2TC 2LSVA 4WWPA 5BV0A 1N0QA 2F8YA 3C72A 5LSXA 1XGWA 1EF1C 3JUIA 2J4DA 4N2SA 3DXMG 2CG2A 3ISMC 1X81A 4GTPA 3U9WA 2IF4A 2O8JA 4H12A 2IONA 2RKKA 3PZ4A 1ZKKA 3LY8A 5CPRB 2AVPA 3SY2A 5G04J 1OCOE 4GB9A 4JDSA 5JMND 5G2NA 1FVFA 5HRYA 5BUZA 4F3VA 1NP7A 3WXXA 5D2MC 2DYSE 3CR3A 4P29A 3L82A 3EJNA 4BT8A 5T5GA 3ZHEB 2ZGDA 3HXEA 3TWXA 1G3NB 2GRNB 3F9YA 3IKOB 3ULQA 4HOSA 1MX2A 1Z5SC 2FF4A 4GTTA 3L17A 3L08A 3AG2E 3D9PA 5EX3A 3WG7E 3LVRE 2HM8A 4OVVA 4F53A 3CHRA 5F5EA 5TEGA 4AXHA 3T8MA 3HXCA 3FTWA 3MKQA 2LSUA 3CVVA 4BWRA 3UXGA 2JEKA 2VGXA 3AS8A 1N4SA 2ZU6B 1WY6A 2CHWA 3ENEA 1ZBPA 3N71A 2VSYA 3TWVA 4FJYA 1IXVA 4XE0A 1TNZA 5JJTA 3ONKA 3VLDA 4HVBA 1K3ZD 4GPMA 4APOA 2RFIA 1Z3XA 4TUMA 3PE4A 4CT0A 4IJ8A 4TXQA 4U0SA 3NAWA 4A1GA
chains in the Genus database with same CATH topology
4JW1A 4E6HA 3ESLA 4GCNA 4DLOA 2J49A 2VTBB 2IOLA 4U63A 3ZYKA 2F69A 3LPZA 3TXNA 5KCMA 5AIJA 3CGHA 3DPDA 2DIWA 5FJYA 2HO1A 4MRUA 4TV3A 5FQ4A 3SZ7A 4HOTA 4XX5A 1P5QA 3CKBA 4XZ4A 3MV2B 3FH5A 1H6KA 2L0TB 4JHRA 2IFUA 1MHQA 1PC2A 3PZDA 4JA9A 4WWOA 3G2UA 2Y4TA 3E4BA 3L22A 1ELRA 4XKBA 1EYHA 4AV7A 5CCLA 4IRUA 4UQZA 3RU0A 2XGOA 5ANRA 2V8SE 4J8SA 1E7UA 3C98A 4G2VA 4KZCA 2MHKA 3NZSA 2X6HA 3LCAA 2LAIA 3CHQA 4AP2A 3KMAA 1DNPA 4I17A 4OYSA 1KT1A 4EQFA 3QWWA 2ILRA 4HXIA 4ANXA 3F9ZA 1UN8A 3M59A 2VJ8A 3OXLA 4I6JA 4J0UA 4KXKB 4AVXA 3VLFA 3LYAA 1VDYA 3JYSA 3SI5A 4UI9J 3CBPA 2WXRA 4AY6A 5J08A 3FUKA 3LKUA 3TJPA 5EG2A 3QWPA 3G2WA 3FUDA 3MZLB 2V4LA 3RJVA 3UMVA 2XCCA 1U3DA 4K03A 3CQGB 3MKQB 4EZKA 4I51A 1INZA 5DBKA 3FUEA 4WNEA 4L7TA 1MVHA 1KT0A 5AJDA 4JA7A 1NZNA 1HXIA 3IHVA 2VGXB 3OS5A 2L6JA 3B7UX 5FWQA 4EBAA 4MS6A 3AS4A 4KBQA 3CV0A 3MKRA 3M56A 4QENA 3KS2A 4EBAG 5T8IA 3MO2A 3R7QA 5ENNA 4WAFA 3NQPA 4PDXA 4Z4PA 1FVHA 2A5UA 4ILGA 1WM5A 4J8DA 4NQ0A 3QNKA 3UT4A 4JVSA 2AXVA 4GZ5A 2UY1A 1U3CA 2V5FA 3MV3B 4FLHA 3IEGA 3PDNA 1HU3A 2QY7A 2WMOA 3ML9A 4FC8A 3FUNA 4RG9A 4XI9A 4JXTA 5CHEE 5G05J 2BTDA 5E76A 3CK9A 4HLEA 3ZEFA 4N3BA 3CBMA 4Y6CA 1OUVA 3TXMA 2BF0X 2IU1A 3PNLB 1B89A 5JINA 5KJLA 4U0ZA 2R59A 4J8FA 1UJKA 2MOWA 2PL2A 3ZYLA 4H7XA 4DI4A 1FCHA 1OWLA 4B89A 2XEVA 3QAQA 4D10C 2WVIA 4GA0A 4OVUA 4AY5A 3FTVA 4GCOA 4YNMA 5KJKA 3FUFA 3KEZA 2FO7A 2OVFA 3BO5A 2JLBA 1XNFA 1HG5A 3PUJA 4TRQA 2BQZA 1KLXA 3ML8A 1MT6A 2FULA 2IQCA 1IYGA 5G04C 5T3RA 3I5PA 3I4RB 4LRZA 4UWKA 2KZTB 3Q47B 4G11A 2YHEA 3IBEA 3QK0A 2J9QA 1N52A 3O4ZA 4YPUA 4I1AA 4UI9K 1PAQA 3SWCA 3U3WA 3CHSA 3F9XA 1S0PA 5T0KA 3MX3A 2YINA 3OXFA 3P1UA 4H7YA 2AXUA 2BUGA 2PZIA 4JL0A 3FTUA 5T4YA 1OWMA 3CK7A 4BX9A 2M63A 2KCVA 2VQ2A 4FLBA 4ANVA 4EECA 3EIQC 3K9IA 2A4ZA 4XIFA 3PVLA 3RIBA 5F59A 1ELWA 3FUIA 4IJDA 4JHJA 4J7FA 4WUYA 3JQ1A 2R17C 2JV0A 5FZRA 4JC8A 1UN9A 3MA5A 4IYPA 2L0IA 3RRUA 1Y8MA 3D9LA 3ASHA 3FEYA 4GYYA 1IHGA 3AS5A 3QJZA 4JHKA 4LEUA 4B94A 3UUXA 4YPEA 1IQRA 3CVPA 3ONLA 3FFLA 2KCKA 2Y4UA 3QOUA 1HG2A 5LCWC 4AU7A 3FUHA 2WXGA 5F6LA 4I6GA 2XPZA 4V3IA 3SW9A 3HIZA 3URZA 3TL5A 5DIZA 1HH8A 5A6CA 3ZFWA 2AW6A 2X6FA 3HYMB 4ME2A 5AJLA 3EHMA 4FP7A 2I1KA 4CEMA 1EPUA 1SZ9A 4ANUA 4NVQA 5FZQA 3FU5A 2PM6A 4RVBA 5JIYA 3OXGA 4BTAA 5JHBA 3BEEA 3VTXA 3RK6A 3PRZA 5T0MA 5JHAA 4FHKA 5A23A 3SGHA 3M54A 3ZGQA 3DBSA 2NC9A 1E8XA 2UY1B 2XQ0A 4EZLA 3T5XA 2IOSA 3M55A 2KZTA 3FTZA 3FHEA 4L1BA 3CVQA 2J4BA 5F6KC 4KVMA 3D9NA 4MLPA 4YNPA 4UWGA 4GA1A 3UT8A 2KM4A 5JJ7A 4NURA 2P58C 3ZVVA 4WNGA 4URKA 2J09A 3NF1A 2CHZA 4E85A 3S7FA 4UWHA 4I2WA 5D0OD 3LDZA 4GAAA 1Z6TA 4GZ6A 3APDA 4YPAA 2YQ8A 2WM9A 5HI7A 2CG3A 2G46A 5FZSA 3AU4A 4QEOA 3ASGA 3GZ1A 5LX8A 2WXHA 2E2EA 4IN3B 1JWFA 3PNTB 3HHMA 4C0MA 1SZAA 4UWFA 3QARA 5EDSA 3I3NA 4J6IA 4EZJA 4LERA 2IJGX 3PUKA 3CVYA 3FU6A 3KMTA 3GZSA 1JPLA 3OTNA 2C0MA 4FMUA 1IQUA 3IV0A 2HYZA 4ATGA 2WB2A 3S8PA 3CLJA 5AYFA 4GMJA 3RO2A 1OWOA 5A7DB 4MI0A 3LS8A 3OAWA 2XGMA 4U0UA 1JUQA 4DPRA 1O9SA 5HQ8A 1TEZA 2WQHA 2XRZA 5JHNA 2NSZA 3RKVA 2PM7A 3CQCB 4GU5A 3SNXA 4BUPA 4BFRA 5JJ0A 3I4GA 3M53A 2KATA 4NACA 4Y6WA 4O30A 3SF4A 3FTXA 4XI0A 4I1OB 1H0AA 3G2VA 3NZUA 3CVXA 4CRWA 3EP0A 2HR2A 5BW8C 3D9KA 4I6EA 4APFA 3D9MA 5JJ6A 3M5AA 4PUCA 3FP3A 3FTSA 4QEPA 4ILIA 4J8OA 3LXUX 3CVLA 1HFAA 2VSXE 4WNDA 4AJWA 4HORA 1MUFA 3CEQA 3RJWA 4HS2A 3LY9A 2GRLA 2DCPA 3PEVB 2RD0A 3HDXA 1ML9A 2FEZA 3U4TA 2PQNA 1UG3A 4PS8A 3R7RA 3ZN3A 4IULA 4ACKA 4PS3A 5LP0A 1EDUA 3PEUB 3CIAA 3L13A 1Y6IA 4CGVA 2Q7FA 5EKQD 4CGWA 3QKYA 5FQ8A 5KJMA 1LF8A 1NA3A 4B8AA 5LOZA 5CMWA 3G2SA 4UQXA 3VTYA 1ELKA 4UI9C 5G55A 3S7DA 5LFAA 4B8CB 3PH0C 1HE8A 3TAXA 3FWVA 3FEXA 4KT6B 3GYZA 4KMOA 4CDRA 2WQ7A 2V0PA 3EDTB 3P2BA 1WAO1 3PS6A 4HFGA 4YVQC 3M57A 1E90A 3JQ0A 3D9OA 3CK8A 3QC1A 4J8EA 3Q5MA 3B7RL 4J83A 4EPZA 4L2LA 2DBAA 3ZRHA 2XGSA 2WXJA 4AEZC 3CHOA 3T5VA 3FH7A 3TG4A 3O48A 5TTFA 3AU5A 2GW1A 2VGYA 5AYWD 3ASFA 4GZDA 2J08A 1YA0A 1Z3YA 3L54A 3FTYA 4G1TA 4Q96A 4AM9A 1H2UA 5CCMA 5FQ7A 1GW6A 4C0EA 3ZXSA 2UWJG 3MO0A 2W5ZA 3F9WA 4RSYA 3MYVA 1MQSA 2XHEA 3MGBA 4GPKA 3SBTB 4ANWA 1W3BA 2GRMA 3R9AB 4RG6A 3KD7A 4ABNA 5G05C 3RRMB 3FUJA 3PREA 2I1JA 3S7JA 5C2YA 3VUZA 3ZHEA 1HS6A 2XPYA 1N6AA 4U04A 1UJJA 3LJ3A 3ZW3A 3B13A 3FU3A 3Q4AB 5BV1A 3LVQE 4XKCA 1X5BA 4WNFA 4N3CA 2I9CA 2LAHA 3EIJA 3TG5A 2E0IA 4AIFA 2R3AA 3VLEA 1XQHA 4CT4A 4JZYA 3GW4A 1PEGA 3OOIA 2I6HA 3JCKC 2LNIA 3APFA 3L6AA 4N39A 3B7SA 2MRIA 3FPDA 5J90A 3SBSA 1TJFA 4LDGA 4E47A 1PY1A 3EHNA 3GZ2A 5FT9A 3CVWA 4FADA 3ESKA 3M58A 2AWIA 2J07A 4PS7A 1H2TC 1H2VC 4I43A 2LSVA 4M3OA 5BPPA 3VV0A 1JWGA 4KZ0A 4WWPA 4AOFA 4JEUA 5BV0A 3CVNA 2WXFA 2X38A 2X6KA 4BT9A 2OOEA 4C1QA 3KAEA 4A3TA 1H19A 2CFZA 2WQ6A 3ZYMA 2WXMA 4W9RA 3IHXA 4HOQA 5ARGA 2X3MA 3LY7A 5LSXA 2FBNA 1XGWA 2WXNA 1EF1C 2KCLA 4I1MA 2QFCA 2CHXA 3S2AA 4DI3A 5EX0A 3JUIA 1E7VA 2J4DA 4G23A 3UX4A 2EQXA 2WMNA 4N2SA 2CG2A 4MKTA 2L9BA 4I2ZA 4N5CA 1L5JA 3SFZA 4G26A 4CCAA 2Y3AA 2PQRA 3U9WA 2IF4A 2O8JA 3IHYA 2IONA 3Q15A 4H12A 3QWVA 5TH7A 3U64A 5M72A 1ZKKA 3LY8A 5CPRB 3D9IA 2WPVA 2AVPA 5G04J 4G25A 1NA0A 4KVOA 4GB9A 1N54A 3QB2A 3SHFA 3APCA 4DLQA 4JDSA 4U07A 2NXPA 4WWNA 3S7BA 4FU3A 2WXOA 4L23A 3UQ3A 5G2NA 1FVFA 5BUZA 2WXLA 3UT7A 4F3VA 1NP7A 5KJNA 2W5YA 4QFVA 5CMYA 1QZ2A 1TJCA 2C2LA 3WXXA 4BSXA 4KYOB 4DJAA 2IGQA 1E96B 2I2OA 3DB5A 3CR3A 4P29A 1E8YA 2FI7A 3SD5A 3HVEB 4I9EA 5BT1A 2RG8A 2VTBA 3EJNA 4GYWA 4BT8A 1HF8A 4JPSA 3ZIMA 1N6CA 3MEKA 3QDNA 3FU0A 4NRHB 3ZHEB 5T5GA 4L2YA 3CVUA 3DALA 4TUUA 2ONDA 1QQEA 3FH8A 2OV8A 3MO5A 3CHMA 4YNDA 3ZYQA 4DK5A 4G24A 4J7IA 3F9YA 4CDNA 3RO3A 3TGOA 3IKOB 3ULQA 2XRYA 5LCWJ 4HOSA 5FTPA 4MI5A 4CDMA 3CKCA 1OWNA 2FF4A 3CHPA 2R5SA 3RAYA 3L17A 2OVBA 4FJZA 2KC7A 3MJWA 2X6JA 2C0LA 3L08A 4BY6A 2XCBA 3ASDA 3HNAA 2GGFA 3D9PA 2WXPA 1SQMA 5LSZA 2AXZA 4YVOA 4LUNU 3CSFA 3CSTA 4HOUA 5ARFA 1A17A 4ILHB 5EX3A 3RRNB 3MCXA 2WXKA 3L16A 3LVRE 2HM8A 3CBOA 4GZCA 1UW4B 4OVVA 4B0ZA 4F53A 5C1DA 4N2QA 3CHRA 2XPIA 4UWLA 5F5EA 3UPVA 5TEGA 3OPEA 2X6IA 3BG0B 4AXHA 3T8MA 4BX8A 3U66A 3FTWA 3MKQA 1HO8A 2LSUA 2LO6A 3CVVA 2QPWA 3Q49B 4BWRA 4PH4B 5FQ6A 4JLGA 4GA2A 1N3JA 4C9BB 4JEHA 4GMLA 4N3AA 2JEKA 2VYIA 3PE3A 3RQ4A 3FUMA 2VGXA 1E8WA 3AS8A 4F7AA 3K5KA 4A55A 2ZU6B 5BNWA 3HVEA 5D0QD 1MVXA 1WY6A 3B7TA 4A3VA 2CHWA 3ENEA 4GZ3A 2VSOE 1ZBPA 3KMJA 3D3MA 3N71A 2VSYA 4LCTA 4Q94A 4FJYA 3ZPJA 4A1SA 1H3IA 4F1SA 4O6FA 5E75A 1HZ4A 4XE0A 4GYOA 4BTBA 4RZ0A 3BG1B 2WXQA 2YHCA 3G2TA 4R7LA 2VSNA 1ZU2A 3LEWA 3ONKA 2WXIA 1QNFA 4FHJA 4U8HA 5JJTA 3VLDA 4NJ5A 4HVBA 1E8ZA 1OWPA 3FULA 4FA6A 4APOA 4K0RA 2RFIA 4UQYA 1HX8A 4FULA 3D9JA 1Z3XA 3FY4A 2CFUA 1DVPA 3PE4A 4ACLA 4CT0A 4Q69A 4I9CA 2YNQA 4IJ8A 1BPOA 3FDHA 4U0SA 5AENA 5ANLA 4A1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCN A;  2F69 A;  3LPZ A;  5FJY A;  2HO1 A;  3SZ7 A;  4HOT A;  1P5Q A;  3CKB A;  3OPE A;  3MV2 B;  4JHR A;  3UUX A;  2IFU A;  1PC2 A;  4JA9 A;  2Y4T A;  3E4B A;  1ELR A;  5CCL A;  4UQZ A;  3RU0 A;  2XGO A;  4G2V A;  2MHK A;  3LCA A;  3KMA A;  4I17 A;  1KT1 A;  4EQF A;  3QWW A;  3M59 A;  3F9Z A;  3OXL A;  4J0U A;  4KXK B;  3LYA A;  3CBP A;  3JYS A;  4UI9 J;  4AY6 A;  3LKU A;  5EG2 A;  3QWP A;  3RJV A;  2XCC A;  4I51 A;  5DBK A;  4WNE A;  1MVH A;  1KT0 A;  4JA7 A;  1NZN A;  1HXI A;  2VGX B;  3OS5 A;  2L6J A;  3AS4 A;  4KBQ A;  3CV0 A;  3MKR A;  3M56 A;  4QEN A;  3KS2 A;  3MO2 A;  4Z4P A;  1WM5 A;  4J8D A;  4NQ0 A;  4GZ5 A;  2UY1 A;  2V5F A;  3MV3 B;  3IEG A;  3PDN A;  4XI9 A;  4RG9 A;  5CHE E;  5G05 J;  3CK9 A;  4N3B A;  3CBM A;  4Y6C A;  1OUV A;  1B89 A;  5JIN A;  5KJL A;  4U0Z A;  4J8F A;  2PL2 A;  4H7X A;  1FCH A;  2XEV A;  4GA0 A;  4AY5 A;  4GCO A;  4YNM A;  5KJK A;  2FO7 A;  3BO5 A;  2JLB A;  1XNF A;  2BQZ A;  1KLX A;  1MT6 A;  1IYG A;  5G04 C;  3Q47 B;  4YPU A;  2J9Q A;  4I1A A;  4UI9 K;  3SWC A;  3U3W A;  3F9X A;  5T0K A;  3OXF A;  4H7Y A;  2BUG A;  2PZI A;  4JL0 A;  3CK7 A;  2KCV A;  2VQ2 A;  3K9I A;  4XIF A;  3RIB A;  5F59 A;  1ELW A;  4IJD A;  4J7F A;  4WUY A;  2JV0 A;  5FZR A;  3MA5 A;  1Y8M A;  4LEU A;  3ASH A;  4GYY A;  1IHG A;  3AS5 A;  4YPE A;  4B94 A;  3CVP A;  3FFL A;  2KCK A;  2Y4U A;  3QOU A;  5LCW C;  4AU7 A;  5F6L A;  3SW9 A;  3URZ A;  5DIZ A;  1HH8 A;  5A6C A;  3ZFW A;  4ME2 A;  3HYM B;  4NVQ A;  5FZQ A;  5JIY A;  3OXG A;  4BTA A;  3BEE A;  3VTX A;  5T0M A;  3M54 A;  3ZGQ A;  2NC9 A;  2UY1 B;  3M55 A;  3CVQ A;  5F6K C;  4YNP A;  4GA1 A;  5JJ7 A;  2P58 C;  4WNG A;  3NF1 A;  3S7F A;  4I2W A;  5D0O D;  4GZ6 A;  4YPA A;  2YQ8 A;  5HI7 A;  2G46 A;  5FZS A;  4QEO A;  3ASG A;  3GZ1 A;  2E2E A;  4IN3 B;  3KMT A;  3S8P A;  2C0M A;  4FMU A;  2HYZ A;  5AYF A;  3RO2 A;  5A7D B;  2XGM A;  4U0U A;  1O9S A;  5HQ8 A;  5JHN A;  2WQH A;  3RKV A;  5JJ0 A;  4BUP A;  3M53 A;  2KAT A;  4Y6W A;  4O30 A;  3SF4 A;  4XI0 A;  3EP0 A;  2HR2 A;  5BW8 C;  5JJ6 A;  3M5A A;  3FP3 A;  4QEP A;  4J8O A;  3CVL A;  4WND A;  1MUF A;  4HOR A;  3CEQ A;  3RJW A;  3LY9 A;  1ML9 A;  2FEZ A;  3U4T A;  2PQN A;  3ZN3 A;  4CGV A;  2Q7F A;  5EKQ D;  4CGW A;  3QKY A;  5KJM A;  1NA3 A;  4UQX A;  3VTY A;  4UI9 C;  3S7D A;  3TAX A;  3FWV A;  4CDR A;  3GYZ A;  3EDT B;  1WAO 1;  3M57 A;  4YVQ C;  3CK8 A;  4J8E A;  4J83 A;  3Q5M A;  2DBA A;  2XGS A;  3TG4 A;  3O48 A;  5TTF A;  2GW1 A;  2VGY A;  5AYW D;  3ASF A;  4AM9 A;  1YA0 A;  4G1T A;  5CCM A;  2UWJ G;  3MO0 A;  2W5Z A;  3F9W A;  4GPK A;  1W3B A;  3R9A B;  4RG6 A;  4ABN A;  3KD7 A;  5G05 C;  3S7J A;  3VUZ A;  3ZHE A;  1N6A A;  4U04 A;  3Q4A B;  4WNF A;  4N3C A;  3TG5 A;  4AIF A;  2R3A A;  1XQH A;  3GW4 A;  1PEG A;  3OOI A;  2I6H A;  2LNI A;  4N39 A;  3FPD A;  4LDG A;  4E47 A;  3GZ2 A;  5FT9 A;  3ESK A;  3M58 A;  2LSV A;  3VV0 A;  3CVN A;  4BT9 A;  2OOE A;  4C1Q A;  3KAE A;  4W9R A;  3IHX A;  4HOQ A;  5ARG A;  3LY7 A;  5LSX A;  2FBN A;  2KCL A;  2QFC A;  5EX0 A;  4G23 A;  4N2S A;  4I2Z A;  4N5C A;  4G26 A;  2PQR A;  4H12 A;  2IF4 A;  2O8J A;  3Q15 A;  3QWV A;  5TH7 A;  5M72 A;  1ZKK A;  3LY8 A;  5CPR B;  2WPV A;  2AVP A;  5G04 J;  4G25 A;  1NA0 A;  4JDS A;  4U07 A;  3S7B A;  3UQ3 A;  4F3V A;  5KJN A;  2W5Y A;  1QZ2 A;  1TJC A;  2C2L A;  3WXX A;  4KYO B;  2IGQ A;  1E96 B;  3DB5 A;  2FI7 A;  4I9E A;  5BT1 A;  4GYW A;  4BT8 A;  1N6C A;  3MEK A;  3QDN A;  4NRH B;  3ZHE B;  5T5G A;  3DAL A;  2OND A;  1QQE A;  3MO5 A;  4YND A;  4G24 A;  4J7I A;  3F9Y A;  3RO3 A;  3TGO A;  3ULQ A;  5LCW J;  4HOS A;  5FTP A;  4MI5 A;  3CKC A;  2FF4 A;  2R5S A;  3RAY A;  2KC7 A;  2C0L A;  2XCB A;  3ASD A;  3HNA A;  5LSZ A;  4YVO A;  4HOU A;  5ARF A;  1A17 A;  5EX3 A;  4MI0 A;  3CBO A;  5C1D A;  4N2Q A;  2XPI A;  5F5E A;  3UPV A;  5TEG A;  2LSU A;  2QPW A;  3Q49 B;  4BWR A;  4JLG A;  4GA2 A;  1N3J A;  4N3A A;  2VYI A;  3RQ4 A;  3PE3 A;  2VGX A;  3K5K A;  3AS8 A;  5BNW A;  5D0Q D;  1MVX A;  4GZ3 A;  1ZBP A;  3KMJ A;  3N71 A;  4A1S A;  2VSY A;  1H3I A;  3ZPJ A;  4O6F A;  1HZ4 A;  4GYO A;  4BTB A;  4RZ0 A;  2YHC A;  5JJT A;  2VSN A;  1ZU2 A;  4NJ5 A;  4APO A;  2RFI A;  4UQY A;  3PE4 A;  4IJ8 A;  4I9C A;  4U0S A; 
#chains in the Genus database with same CATH topology
 2J49 A;  2IOL A;  4U63 A;  3LPZ A;  1OT8 A;  3DPD A;  3C3O A;  4MRU A;  1P5Q A;  3MV2 B;  3B95 A;  3U64 A;  2Y4T A;  4AV7 A;  4RLY A;  4YDW A;  3RU0 A;  3UI2 A;  3DSS A;  4GTM A;  1KPS B;  3NZS A;  2X6H A;  4AP2 A;  4I17 A;  1SW6 A;  2DZN A;  4EQF A;  1JCS A;  3V2O A;  2VJ8 A;  4J0U A;  4KXK B;  2EIK E;  1VDY A;  3JYS A;  1ZB1 A;  2GRO B;  3Q7A A;  4TXP A;  3G2W A;  3CQG B;  4I51 A;  1MVH A;  3IHV A;  3B7U X;  5FWQ A;  3M56 A;  3DPY A;  1SVX A;  3QNK A;  4JVS A;  1U3C A;  2V5F A;  3PDN A;  1HU3 A;  4FC8 A;  4XI9 A;  4RG9 A;  4HRN A;  3ZEF A;  4N3B A;  1B89 A;  5JIN A;  4H7X A;  1WG0 A;  1YCS B;  1OWL A;  4OVU A;  3FTV A;  2FO7 A;  1XNF A;  2BQZ A;  2IQC A;  4UWK A;  4HI9 A;  2YHE A;  4YPU A;  4I1A A;  3ZUV B;  3BU8 A;  1S0P A;  1AP7 A;  1LD7 A;  4ZHB A;  3DRA A;  2VQ2 A;  3B7B A;  4NIK A;  4ANV A;  2A4Z A;  3E34 A;  3PVL A;  1ELW A;  1SA4 A;  4IJD A;  3JQ1 A;  4HBD A;  2JV0 A;  4IYP A;  1FT1 A;  4U8Y D;  4GYY A;  4YPE A;  3URZ A;  5DIZ A;  1HH8 A;  5A6C A;  3E33 A;  2I1K A;  4RQI A;  1SZ9 A;  3FU5 A;  5JIY A;  3VTX A;  5T0M A;  1E8X A;  2Y1L E;  2IOS A;  3M55 A;  3DWL G;  4HB5 A;  2J4B A;  4TXR A;  4UWG A;  2L6B A;  1MZC A;  1RW2 A;  5AQ7 A;  3NF1 A;  4UWH A;  3RSE G;  5CBN A;  5HI7 A;  2G46 A;  3AU4 A;  3ASG A;  2ETB A;  3GZ1 A;  3DST A;  2E2E A;  1TNB A;  3I3N A;  4J6I A;  3FU6 A;  3KMT A;  1JPL A;  3OTN A;  2C0M A;  1IQU A;  4ATG A;  4GMJ A;  1JUQ A;  1TEZ A;  5JJ0 A;  3CQC B;  2EIN E;  4GTS A;  3SF4 A;  1KZO A;  4I1O B;  3G2V A;  3NZU A;  2HR2 A;  5JJ6 A;  4QEP A;  3LXU X;  2VSX E;  4HOR A;  3CEQ A;  3LY9 A;  2GRL A;  3PEV B;  4K5A B;  4BET A;  4U96 D;  4PS3 A;  4U8V D;  1EDU A;  1JCQ A;  4CGV A;  5KJM A;  1NA3 A;  4B8A A;  4UQX A;  2LUH A;  1ELK A;  4UI9 C;  1TNY A;  5AAR A;  3PH0 C;  1HE8 A;  1A5E A;  4CDR A;  2WQ7 A;  2FO1 E;  4YVQ C;  3JQ0 A;  4J8E A;  4EPZ A;  3CHO A;  3FH7 A;  2VGY A;  3L54 A;  4G1T A;  3Q7F A;  5CCM A;  5EIB E;  2UWJ G;  2W5Z A;  2XHE A;  4GPK A;  5BXU A;  3KD7 A;  4ABN A;  5FIO A;  2DYR E;  5C2Y A;  3ZHE A;  1HS6 A;  1UJJ A;  1N4P A;  3DSU A;  3LVQ E;  3Q75 A;  4XKC A;  3TG5 A;  2E0I A;  4AIF A;  5KNG A;  2I6H A;  1OY3 D;  4YDE A;  5BXO A;  3ASN E;  4C48 B;  3L6A A;  2MRI A;  5J90 A;  3SBS A;  4BSZ B;  2H6G A;  5FT9 A;  4FAD A;  2AWI A;  4M3O A;  3VV0 A;  4KZ0 A;  4GTO A;  4JEU A;  4C1Q A;  3KAE A;  1H19 A;  1JCR A;  3T9K A;  4W9R A;  1Q2Z A;  4HOQ A;  4LNB A;  5JA4 D;  5ARG A;  3LY7 A;  3RAU A;  1YMP A;  2FBN A;  2WXN A;  4I1M A;  2KCL A;  3S2A A;  4DI3 A;  2WMN A;  2L9B A;  2DWZ A;  5ITZ F;  1L5J A;  3SFZ A;  3IHY A;  4CYM D;  2XEN A;  1TN8 A;  3QWV A;  5TH7 A;  4O1O A;  1OCR E;  4G25 A;  3SHF A;  1N54 A;  3QB2 A;  4DLQ A;  4U07 A;  2NXP A;  3UT7 A;  2W5Y A;  3UM0 A;  2IGQ A;  2I2O A;  3DB5 A;  2FI7 A;  3SD5 A;  4I9E A;  3TWU A;  2RG8 A;  4GYW A;  1HF8 A;  3KSQ A;  3ZIM A;  1N6C A;  3CVU A;  2XEE A;  3TGO A;  2XRY A;  5LCW J;  5FTP A;  3CKC A;  3CHP A;  5KBA A;  4FJZ A;  2KC7 A;  3MJW A;  2C0L A;  2XCB A;  3ASD A;  4ZFH A;  2WXP A;  5LSZ A;  2XS1 A;  3HXD A;  3CST A;  5ARF A;  3W9F A;  3CBO A;  1UW4 B;  4B0Z A;  1MJ0 A;  2XPI A;  2X6I A;  3Q9N C;  4BX8 A;  1HO8 A;  2QPW A;  3Q49 B;  4PH4 B;  4GA2 A;  4N3A A;  3RQ4 A;  3FUM A;  1E8W A;  1DCE A;  2ETA A;  3HVE A;  5D0Q D;  5EID A;  2OCC E;  1V55 E;  5B1B E;  4A1S A;  2J8S D;  3PZ2 A;  3EHR A;  5AQB A;  3NBN B;  4BTB A;  3G2T A;  5ENO D;  4FHJ A;  3LEW A;  2WXI A;  4NJ5 A;  1LTX A;  1E8Z A;  3FUL A;  3SFY A;  1HX8 A;  3D9J A;  2XS8 A;  1RZ4 A;  3Q9U C;  4Q69 A;  3FDH A;  2VGE A;  5AEN A;  4GCN A;  3JUE A;  4DLO A;  2F69 A;  3TXN A;  5KCM A;  5FJY A;  4TV3 A;  3OPE A;  1N4Q A;  2PNN A;  3UUX A;  4JA9 A;  3PZD A;  1DC2 A;  3L22 A;  4J7W A;  3DEP A;  1BD8 A;  2B0O E;  2R02 A;  1IHB A;  3Q73 A;  2R2L A;  2LAI A;  4OYS A;  1KT1 A;  1O1R A;  4ANX A;  3AG3 E;  3F9Z A;  4I6J A;  4AVX A;  3UKR G;  4DX1 A;  2WXR A;  3KSL A;  3FUK A;  5EG2 A;  2P9L G;  4K03 A;  4EZK A;  1INZ A;  3FUE A;  4L7T A;  2L6J A;  4CZ2 D;  3KS2 A;  4GTV A;  4WAF A;  3NQP A;  4BER A;  4J8D A;  1TN6 A;  2AXV A;  4GZ5 A;  5EIL A;  2QY7 A;  5CHE E;  3CBM A;  3TXM A;  2IU1 A;  5KJL A;  2Y69 E;  4J8F A;  4UUC A;  2MOW A;  1FCH A;  5FIN A;  4D10 C;  4GA0 A;  4AY5 A;  4GCO A;  4YNM A;  3FUF A;  2OVF A;  1QBQ A;  4TRQ A;  2QYU A;  1KLX A;  1D8D A;  2FUL A;  1TNU A;  2MYO A;  2KZT B;  3O4Z A;  1N52 A;  1PAQ A;  3UKU G;  3MX3 A;  4DX7 D;  3DSW A;  3P1U A;  3EIQ C;  2BKK B;  4XIF A;  3SFX A;  3MA5 A;  2L0I A;  4GTR A;  3RRU A;  4LEU A;  3AS5 A;  3QJZ A;  5ENT D;  5AN8 A;  3CVP A;  3ONL A;  3FFL A;  1HG2 A;  5F6L A;  2WXG A;  2XPZ A;  5ENS D;  5EYP F;  2F0Y A;  2X6F A;  4ME2 A;  4CEM A;  4FP7 A;  4ANU A;  4NVQ A;  4HRL A;  5AQ9 A;  1O1T A;  3OXG A;  2DVW A;  3PRZ A;  5JHA A;  3SGH A;  3ZGQ A;  3DBS A;  2NC9 A;  5EYL A;  3V79 K;  2UY1 B;  3FTZ A;  4KVM A;  4MLP A;  1K1B A;  4GA1 A;  2DZO A;  2P58 C;  3ZVV A;  2CHZ A;  4I2W A;  5D0O D;  3LDZ A;  4GZ6 A;  1N95 A;  4IN3 B;  1JWF A;  4C0M A;  3J5P A;  3CVY A;  3BQO A;  3KEA A;  3JXJ A;  3OAW A;  4U0U A;  5HQ8 A;  3SNX A;  2PM7 A;  4BUP A;  3I4G A;  3PZ3 A;  3M53 A;  2QZA A;  4NAC A;  4Y6W A;  3FTX A;  1K8K G;  3D9K A;  4APF A;  3FTS A;  3PZ1 A;  4J8O A;  3HG0 D;  1MUF A;  3TWR A;  2RD0 A;  2FEZ A;  4PS8 A;  3ZN3 A;  5LP0 A;  3ABL E;  3PEU B;  5EN5 D;  1LF8 A;  2AJA A;  4BEP A;  2P9P G;  5LFA A;  2V4H C;  3FWV A;  4KT6 B;  2GRQ B;  3EDT B;  4DRX E;  4F1P A;  2NYJ A;  3Q5M A;  2WXJ A;  4AEZ C;  1N94 A;  3AU5 A;  5AYW D;  1H6P A;  3ASF A;  1YA0 A;  4DX6 D;  3ZXS A;  3MO0 A;  3F9W A;  4RSY A;  1W3B A;  1IKN D;  5G05 C;  3UM2 A;  3PRE A;  2I1J A;  3S7J A;  3VUZ A;  1N6A A;  3B13 A;  2KXP C;  1DCQ A;  4WNF A;  2GRP B;  4JZY A;  3GW4 A;  3OOI A;  5AQA A;  1TNO A;  2LNI A;  3APF A;  4N39 A;  1TJF A;  3EHN A;  3ESK A;  1H2V C;  4I43 A;  5BPP A;  5B3S E;  4AOF A;  3CVN A;  2OOE A;  2CFZ A;  2WQ6 A;  3ZYM A;  5CEC B;  2WXM A;  1OXJ A;  3IHX A;  2F37 A;  2X3M A;  2QFC A;  2CHX A;  3E30 A;  1E7V A;  3UX4 A;  3SO8 A;  2PQR A;  3Q15 A;  5M72 A;  3D9I A;  4KVO A;  1NA0 A;  4N5Q A;  3S7B A;  3DEO A;  2ZGG A;  4QFV A;  3W9G A;  2P9U G;  4XEI G;  2C2L A;  4BSX A;  1E96 B;  1E8Y A;  5BT1 A;  2IO2 C;  4JPS A;  3FU0 A;  4G8L A;  4U95 D;  3AG4 E;  3UIP C;  2OND A;  2OV8 A;  3CHM A;  4CDN A;  4MI5 A;  3RAY A;  4HLL A;  2X6J A;  4F6R D;  2GGF A;  1SQM A;  2AXZ A;  4YVO A;  3CSF A;  1A17 A;  4ILH B;  3BUA A;  3RRN B;  3MCX A;  3L16 A;  2ZIS A;  1S64 A;  4GZC A;  2LO6 A;  3X2Q E;  3TWQ A;  5FQ6 A;  1UOH A;  4JLG A;  1N3J A;  2VYI A;  3PE3 A;  3K5K A;  5BNW A;  1MVX A;  3B7T A;  3EU5 A;  1O5M A;  3KMJ A;  3D3M A;  4K5B A;  2F8X K;  5E75 A;  4RZ0 A;  3BG1 B;  2YHC A;  4R7L A;  2VSN A;  1ZU2 A;  1QNF A;  4FA6 A;  1TR4 A;  3LJN A;  3FY4 A;  2CFU A;  1DVP A;  4JD2 G;  2RFM A;  1BPO A;  5ANL A;  4OAV B;  3ESL A;  2KBX A;  2VTB B;  3ZYK A;  3SQV A;  5AIJ A;  3CGH A;  5FQ4 A;  3SZ7 A;  4XX5 A;  4XZ4 A;  2IFU A;  1MHQ A;  4EHM A;  3G2U A;  3E4B A;  3D9H A;  2QYJ A;  2XGO A;  5CEA A;  5ANR A;  5H7P A;  1E7U A;  3C98 A;  4G2V A;  2MHK A;  3LCA A;  3CHQ A;  3KMA A;  1DNP A;  3QWW A;  4HXI A;  1UN8 A;  3VLF A;  3LYA A;  3CBP A;  4UI9 J;  4OAU C;  3LKU A;  3QWP A;  3FUD A;  3RJV A;  3UMV A;  1U3D A;  2BKG A;  5DBK A;  4WNE A;  5CED B;  4MS6 A;  3AS4 A;  3MKR A;  4QEN A;  4EBA G;  5T8I A;  4PDX A;  1FVH A;  1WM5 A;  4NQ0 A;  1N9A A;  2UY1 A;  3MV3 B;  3ML9 A;  3FUN A;  5ENP D;  4JXT A;  2HE0 A;  4Z68 A;  5E76 A;  2ZXW E;  2BF0 X;  3PNL B;  2R59 A;  3ULE G;  2PL2 A;  4DI4 A;  4B89 A;  3QAQ A;  1BU9 A;  3KEZ A;  3HXB A;  3PUJ A;  3ML8 A;  1MT6 A;  3UTM A;  1IYG A;  5G04 C;  3I5P A;  4LRZ A;  3QK0 A;  2J9Q A;  4UI9 K;  3U3W A;  3CHS A;  4G8K A;  3EUV A;  2P9N G;  3NB2 A;  2AXU A;  2BUG A;  5CRU A;  5T4Y A;  1OWM A;  3CK7 A;  4BX9 A;  2KCV A;  3K9I A;  3RIB A;  3FUI A;  4JHJ A;  5KWD A;  2R17 C;  1Y8M A;  3ASH A;  4B94 A;  1IQR A;  2KCK A;  3HIZ A;  3TL5 A;  1TN7 A;  2AW6 A;  3HYM B;  5AJL A;  2IO3 C;  5FZQ A;  2IY0 C;  4RVB A;  5CRV A;  4FHK A;  3L9T A;  5A23 A;  3UIN C;  2XQ0 A;  2H6F A;  3T5X A;  3FHE A;  3CVQ A;  5F6K C;  3D9N A;  4YNP A;  4URK A;  4WNG A;  2J09 A;  4E85 A;  3AG1 E;  4GAA A;  4YPA A;  2WM9 A;  2LXM A;  4QEO A;  3PNT B;  1SZA A;  1V54 E;  3QAR A;  3GZS A;  1MX6 A;  2HYZ A;  2WB2 A;  3CLJ A;  4YDY A;  5A7D B;  2XGM A;  1O9S A;  5JHN A;  2WQH A;  2NSZ A;  3RKV A;  4GU5 A;  2P2C P;  2KAT A;  4X8Q A;  4XI0 A;  1H0A A;  3EP0 A;  5BW8 C;  3M5A A;  4PUC A;  3FP3 A;  3CVL A;  1HFA A;  4WND A;  4AJW A;  3RJW A;  4HS2 A;  5D66 A;  2DCP A;  3HDX A;  1OCC E;  2PQN A;  4ACK A;  3CIA A;  5EKQ D;  5FQ8 A;  3EHQ A;  5LOZ A;  3G2S A;  4B8C B;  3EU9 A;  4KMO A;  3NOC D;  3PS6 A;  4HFG A;  3M57 A;  1E90 A;  3D9O A;  3CK8 A;  3QC1 A;  4J83 A;  3B7R L;  4L2L A;  2DBA A;  2XGS A;  2ETC A;  5TTF A;  4AM9 A;  1Z3Y A;  3FTY A;  2Y0B G;  4Q96 A;  5FQ7 A;  1NI1 A;  1GW6 A;  3T8K A;  3HXF A;  2B6C A;  1MQS A;  2P9S G;  3MGB A;  3SBT B;  4ANW A;  2GRM A;  3R9A B;  4RG6 A;  3RRM B;  5ENQ D;  1O1S A;  4J8Y A;  4O1P A;  3LJ3 A;  3ZW3 A;  3FU3 A;  3JXI A;  3Q4A B;  5BV1 A;  4N3C A;  2I9C A;  2LAH A;  3TWW A;  4HI8 A;  3ABK E;  3VLE A;  3V2X A;  1PEG A;  3JCK C;  3E32 A;  3DSX A;  4LDG A;  1PY1 A;  3GZ2 A;  5HS0 A;  1D9S A;  2J07 A;  4PS7 A;  3IXE A;  1JWG A;  2WXF A;  2X38 A;  2X6K A;  4BT9 A;  4A3T A;  3ZNG A;  1S63 A;  5EX0 A;  3DSV A;  2R05 A;  4G23 A;  2EQX A;  4MKT A;  1BI8 B;  4I2Z A;  4N5C A;  2EIL E;  4BES A;  4G26 A;  2P9I G;  4CCA A;  2Y3A A;  4LG6 A;  4HRM B;  2WPV A;  3APC A;  1BLX B;  4WWN A;  4FU3 A;  2WXO A;  4L23 A;  3UQ3 A;  3UIO C;  1S70 B;  2WXL A;  5KJN A;  5CMY A;  4A63 B;  1QZ2 A;  1TJC A;  4DJA A;  4KYO B;  2IEJ A;  3NOG D;  4DX2 A;  3HVE B;  3Q79 A;  2VTB A;  4LSZ E;  3ULY A;  3MEK A;  3QDN A;  4NRH B;  4M7C A;  4L2Y A;  3DAL A;  4L9P A;  4TUU A;  4LNU D;  1QQE A;  3FH8 A;  5HKP A;  3MO5 A;  4DK5 A;  4YND A;  3ZYQ A;  3ZXP A;  4G24 A;  3C5R A;  4J7I A;  3RO3 A;  4ATZ D;  4CDM A;  1OWN A;  2R5S A;  2OVB A;  2EIM E;  4BY6 A;  4K5C A;  3HNA A;  3C3R A;  4LUN U;  4HOU A;  4B93 B;  2WXK A;  4MI0 A;  5C1D A;  4N2Q A;  4U7E B;  4UWL A;  3UPV A;  3AAA C;  2H6I A;  5ENR D;  3BG0 B;  3U66 A;  2H6H A;  2V5Q C;  2BED A;  4C9B B;  4JEH A;  4GML A;  4F7A A;  4A55 A;  4A3V A;  4GZ3 A;  2VSO E;  4Q94 A;  1H3I A;  4LCT A;  3ZPJ A;  4F1S A;  4O6F A;  5IY5 E;  1HZ4 A;  2OEV A;  4GYO A;  2WXQ A;  4U8H A;  1OWP A;  3Q78 A;  4K0R A;  4UQY A;  4YDO A;  4FUL A;  4ACL A;  4I9C A;  2YNQ A;  5CER B;  4DUI A;  4JW1 A;  4E6H A;  5CBO A;  2OEW A;  2DIW A;  2LXL A;  2HO1 A;  2EIJ E;  4HOT A;  3CKB A;  4JHR A;  3FH5 A;  1H6K A;  1H6O A;  2L0T B;  1PC2 A;  4WWO A;  4XKB A;  1FT2 A;  1ELR A;  1EYH A;  5CCL A;  2QC9 A;  4IRU A;  3ZU7 B;  4UQZ A;  2V8S E;  4J8S A;  4KZC A;  1TYQ G;  3M59 A;  2ILR A;  4HQD A;  3OXL A;  3SI5 A;  3ASO E;  4AY6 A;  5J08 A;  4GMR A;  3TJP A;  3MZL B;  2V4L A;  2ZIR A;  2XCC A;  3MKQ B;  3TWS A;  4QQI A;  1KT0 A;  5AJD A;  4JA7 A;  1NZN A;  1HXI A;  2VGX B;  4JB8 P;  3OS5 A;  4EBA A;  4KBQ A;  3CV0 A;  3MO2 A;  3R7Q A;  5ENN A;  4Z4P A;  2A5U A;  2JAB A;  4ILG A;  4LNG A;  3UT4 A;  4FLH A;  3IEG A;  2WMO A;  5G05 J;  2BTD A;  4HLE A;  3CK9 A;  1N11 A;  4Y6C A;  1OUV A;  1YYH A;  4U0Z A;  1UJK A;  2A5E A;  3ZYL A;  1KZP A;  2XEV A;  3J5Q B;  2WVI A;  5KJK A;  5AAO A;  3BO5 A;  2JLB A;  1OCZ E;  1HG5 A;  5T3R A;  3I4R B;  3Q47 B;  4G11 A;  3IBE A;  4MBG A;  3R9M A;  2XZD G;  3SWC A;  2XEH A;  3F9X A;  5T0K A;  2YIN A;  3OXF A;  1SA5 A;  4H7Y A;  2PZI A;  4JL0 A;  3FTU A;  4HNA D;  1FPP A;  2M63 A;  4FLB A;  4EEC A;  1N4R A;  5F59 A;  4J7F A;  2R03 A;  4WUY A;  5FZR A;  4JC8 A;  1UN9 A;  3D9L A;  3FEY A;  1IHG A;  4JHK A;  3V31 A;  2Y4U A;  3QOU A;  5LCW C;  4AU7 A;  1NL4 A;  3C3Q A;  3FUH A;  4I6G A;  4V3I A;  3SW9 A;  3DXK G;  2GRR B;  3ZFW A;  3EHM A;  1EPU A;  1AWC B;  2PM6 A;  1MYO A;  4BTA A;  5JHB A;  3BEE A;  3RK6 A;  3M54 A;  4EZL A;  3HRA A;  1D8E A;  2KZT A;  4L1B A;  4GTQ A;  3UT8 A;  2KM4 A;  5JJ7 A;  4NUR A;  3S7F A;  1Z6T A;  3APD A;  2YQ8 A;  2RFA A;  2CG3 A;  5FZS A;  5LX8 A;  2WXH A;  3HHM A;  4UWF A;  3UM3 A;  5EDS A;  4EZJ A;  4LER A;  2IJG X;  3PUK A;  3ABM E;  3V30 A;  3S8P A;  4FMU A;  3IV0 A;  5AYF A;  3RO2 A;  1LD8 A;  1OWO A;  3LS8 A;  4DPR A;  2XRZ A;  1WDY A;  4BFR A;  1U2V G;  3AJI A;  4O30 A;  3E37 A;  3CVX A;  4CRW A;  4I6E A;  1K1A A;  3D9M A;  4ILI A;  4DX5 D;  1ML9 A;  3U4T A;  1UG3 A;  3R7R A;  4IUL A;  3L13 A;  1Y6I A;  2Q7F A;  4CGW A;  3QKY A;  5CMW A;  3VTY A;  5G55 A;  3S7D A;  3TAX A;  5KNH D;  3FEX A;  3GYZ A;  2V0P A;  3P2B A;  1WAO 1;  1QYM A;  3ZKJ A;  3ZRH A;  5B1A E;  3T5V A;  3F6Q A;  3O48 A;  3TG4 A;  2GW1 A;  4GZD A;  2J08 A;  1H2U A;  1N0R A;  4C0E A;  3MYV A;  1NFI E;  3FUJ A;  2XZT G;  2XPY A;  4U04 A;  4O60 A;  3TWT A;  1X5B A;  3EIJ A;  2R3A A;  1XQH A;  4CT4 A;  1MX4 A;  1BI7 B;  3UM1 A;  3B7S A;  3FPD A;  2P9K G;  4E47 A;  3CVW A;  3M58 A;  1H2T C;  2LSV A;  4WWP A;  5BV0 A;  1N0Q A;  2F8Y A;  3C72 A;  5LSX A;  1XGW A;  1EF1 C;  3JUI A;  2J4D A;  4N2S A;  3DXM G;  2CG2 A;  3ISM C;  1X81 A;  4GTP A;  3U9W A;  2IF4 A;  2O8J A;  4H12 A;  2ION A;  2RKK A;  3PZ4 A;  1ZKK A;  3LY8 A;  5CPR B;  2AVP A;  3SY2 A;  5G04 J;  1OCO E;  4GB9 A;  4JDS A;  5JMN D;  5G2N A;  1FVF A;  5HRY A;  5BUZ A;  4F3V A;  1NP7 A;  3WXX A;  5D2M C;  2DYS E;  3CR3 A;  4P29 A;  3L82 A;  3EJN A;  4BT8 A;  5T5G A;  3ZHE B;  2ZGD A;  3HXE A;  3TWX A;  1G3N B;  2GRN B;  3F9Y A;  3IKO B;  3ULQ A;  4HOS A;  1MX2 A;  1Z5S C;  2FF4 A;  4GTT A;  3L17 A;  3L08 A;  3AG2 E;  3D9P A;  5EX3 A;  3WG7 E;  3LVR E;  2HM8 A;  4OVV A;  4F53 A;  3CHR A;  5F5E A;  5TEG A;  4AXH A;  3T8M A;  3HXC A;  3FTW A;  3MKQ A;  2LSU A;  3CVV A;  4BWR A;  3UXG A;  2JEK A;  2VGX A;  3AS8 A;  1N4S A;  2ZU6 B;  1WY6 A;  2CHW A;  3ENE A;  1ZBP A;  3N71 A;  2VSY A;  3TWV A;  4FJY A;  1IXV A;  4XE0 A;  1TNZ A;  5JJT A;  3ONK A;  3VLD A;  4HVB A;  1K3Z D;  4GPM A;  4APO A;  2RFI A;  1Z3X A;  4TUM A;  3PE4 A;  4CT0 A;  4IJ8 A;  4TXQ A;  4U0S A;  3NAW A;  4A1G A; 
#chains in the Genus database with same CATH homology
 4JW1 A;  4E6H A;  3ESL A;  4GCN A;  4DLO A;  2J49 A;  2VTB B;  2IOL A;  4U63 A;  3ZYK A;  2F69 A;  3LPZ A;  3TXN A;  5KCM A;  5AIJ A;  3CGH A;  3DPD A;  2DIW A;  5FJY A;  2HO1 A;  4MRU A;  4TV3 A;  5FQ4 A;  3SZ7 A;  4HOT A;  4XX5 A;  1P5Q A;  3CKB A;  4XZ4 A;  3MV2 B;  3FH5 A;  1H6K A;  2L0T B;  4JHR A;  2IFU A;  1MHQ A;  1PC2 A;  3PZD A;  4JA9 A;  4WWO A;  3G2U A;  2Y4T A;  3E4B A;  3L22 A;  1ELR A;  4XKB A;  1EYH A;  4AV7 A;  5CCL A;  4IRU A;  4UQZ A;  3RU0 A;  2XGO A;  5ANR A;  2V8S E;  4J8S A;  1E7U A;  3C98 A;  4G2V A;  4KZC A;  2MHK A;  3NZS A;  2X6H A;  3LCA A;  2LAI A;  3CHQ A;  4AP2 A;  3KMA A;  1DNP A;  4I17 A;  4OYS A;  1KT1 A;  4EQF A;  3QWW A;  2ILR A;  4HXI A;  4ANX A;  3F9Z A;  1UN8 A;  3M59 A;  2VJ8 A;  3OXL A;  4I6J A;  4J0U A;  4KXK B;  4AVX A;  3VLF A;  3LYA A;  1VDY A;  3JYS A;  3SI5 A;  4UI9 J;  3CBP A;  2WXR A;  4AY6 A;  5J08 A;  3FUK A;  3LKU A;  3TJP A;  5EG2 A;  3QWP A;  3G2W A;  3FUD A;  3MZL B;  2V4L A;  3RJV A;  3UMV A;  2XCC A;  1U3D A;  4K03 A;  3CQG B;  3MKQ B;  4EZK A;  4I51 A;  1INZ A;  5DBK A;  3FUE A;  4WNE A;  4L7T A;  1MVH A;  1KT0 A;  5AJD A;  4JA7 A;  1NZN A;  1HXI A;  3IHV A;  2VGX B;  3OS5 A;  2L6J A;  3B7U X;  5FWQ A;  4EBA A;  4MS6 A;  3AS4 A;  4KBQ A;  3CV0 A;  3MKR A;  3M56 A;  4QEN A;  3KS2 A;  4EBA G;  5T8I A;  3MO2 A;  3R7Q A;  5ENN A;  4WAF A;  3NQP A;  4PDX A;  4Z4P A;  1FVH A;  2A5U A;  4ILG A;  1WM5 A;  4J8D A;  4NQ0 A;  3QNK A;  3UT4 A;  4JVS A;  2AXV A;  4GZ5 A;  2UY1 A;  1U3C A;  2V5F A;  3MV3 B;  4FLH A;  3IEG A;  3PDN A;  1HU3 A;  2QY7 A;  2WMO A;  3ML9 A;  4FC8 A;  3FUN A;  4RG9 A;  4XI9 A;  4JXT A;  5CHE E;  5G05 J;  2BTD A;  5E76 A;  3CK9 A;  4HLE A;  3ZEF A;  4N3B A;  3CBM A;  4Y6C A;  1OUV A;  3TXM A;  2BF0 X;  2IU1 A;  3PNL B;  1B89 A;  5JIN A;  5KJL A;  4U0Z A;  2R59 A;  4J8F A;  1UJK A;  2MOW A;  2PL2 A;  3ZYL A;  4H7X A;  4DI4 A;  1FCH A;  1OWL A;  4B89 A;  2XEV A;  3QAQ A;  4D10 C;  2WVI A;  4GA0 A;  4OVU A;  4AY5 A;  3FTV A;  4GCO A;  4YNM A;  5KJK A;  3FUF A;  3KEZ A;  2FO7 A;  2OVF A;  3BO5 A;  2JLB A;  1XNF A;  1HG5 A;  3PUJ A;  4TRQ A;  2BQZ A;  1KLX A;  3ML8 A;  1MT6 A;  2FUL A;  2IQC A;  1IYG A;  5G04 C;  5T3R A;  3I5P A;  3I4R B;  4LRZ A;  4UWK A;  2KZT B;  3Q47 B;  4G11 A;  2YHE A;  3IBE A;  3QK0 A;  2J9Q A;  1N52 A;  3O4Z A;  4YPU A;  4I1A A;  4UI9 K;  1PAQ A;  3SWC A;  3U3W A;  3CHS A;  3F9X A;  1S0P A;  5T0K A;  3MX3 A;  2YIN A;  3OXF A;  3P1U A;  4H7Y A;  2AXU A;  2BUG A;  2PZI A;  4JL0 A;  3FTU A;  5T4Y A;  1OWM A;  3CK7 A;  4BX9 A;  2M63 A;  2KCV A;  2VQ2 A;  4FLB A;  4ANV A;  4EEC A;  3EIQ C;  3K9I A;  2A4Z A;  4XIF A;  3PVL A;  3RIB A;  5F59 A;  1ELW A;  3FUI A;  4IJD A;  4JHJ A;  4J7F A;  4WUY A;  3JQ1 A;  2R17 C;  2JV0 A;  5FZR A;  4JC8 A;  1UN9 A;  3MA5 A;  4IYP A;  2L0I A;  3RRU A;  1Y8M A;  3D9L A;  3ASH A;  3FEY A;  4GYY A;  1IHG A;  3AS5 A;  3QJZ A;  4JHK A;  4LEU A;  4B94 A;  3UUX A;  4YPE A;  1IQR A;  3CVP A;  3ONL A;  3FFL A;  2KCK A;  2Y4U A;  3QOU A;  1HG2 A;  5LCW C;  4AU7 A;  3FUH A;  2WXG A;  5F6L A;  4I6G A;  2XPZ A;  4V3I A;  3SW9 A;  3HIZ A;  3URZ A;  3TL5 A;  5DIZ A;  1HH8 A;  5A6C A;  3ZFW A;  2AW6 A;  2X6F A;  3HYM B;  4ME2 A;  5AJL A;  3EHM A;  4FP7 A;  2I1K A;  4CEM A;  1EPU A;  1SZ9 A;  4ANU A;  4NVQ A;  5FZQ A;  3FU5 A;  2PM6 A;  4RVB A;  5JIY A;  3OXG A;  4BTA A;  5JHB A;  3BEE A;  3VTX A;  3RK6 A;  3PRZ A;  5T0M A;  5JHA A;  4FHK A;  5A23 A;  3SGH A;  3M54 A;  3ZGQ A;  3DBS A;  2NC9 A;  1E8X A;  2UY1 B;  2XQ0 A;  4EZL A;  3T5X A;  2IOS A;  3M55 A;  2KZT A;  3FTZ A;  3FHE A;  4L1B A;  3CVQ A;  2J4B A;  5F6K C;  4KVM A;  3D9N A;  4MLP A;  4YNP A;  4UWG A;  4GA1 A;  3UT8 A;  2KM4 A;  5JJ7 A;  4NUR A;  2P58 C;  3ZVV A;  4WNG A;  4URK A;  2J09 A;  3NF1 A;  2CHZ A;  4E85 A;  3S7F A;  4UWH A;  4I2W A;  5D0O D;  3LDZ A;  4GAA A;  1Z6T A;  4GZ6 A;  3APD A;  4YPA A;  2YQ8 A;  2WM9 A;  5HI7 A;  2CG3 A;  2G46 A;  5FZS A;  3AU4 A;  4QEO A;  3ASG A;  3GZ1 A;  5LX8 A;  2WXH A;  2E2E A;  4IN3 B;  1JWF A;  3PNT B;  3HHM A;  4C0M A;  1SZA A;  4UWF A;  3QAR A;  5EDS A;  3I3N A;  4J6I A;  4EZJ A;  4LER A;  2IJG X;  3PUK A;  3CVY A;  3FU6 A;  3KMT A;  3GZS A;  1JPL A;  3OTN A;  2C0M A;  4FMU A;  1IQU A;  3IV0 A;  2HYZ A;  4ATG A;  2WB2 A;  3S8P A;  3CLJ A;  5AYF A;  4GMJ A;  3RO2 A;  1OWO A;  5A7D B;  4MI0 A;  3LS8 A;  3OAW A;  2XGM A;  4U0U A;  1JUQ A;  4DPR A;  1O9S A;  5HQ8 A;  1TEZ A;  2WQH A;  2XRZ A;  5JHN A;  2NSZ A;  3RKV A;  2PM7 A;  3CQC B;  4GU5 A;  3SNX A;  4BUP A;  4BFR A;  5JJ0 A;  3I4G A;  3M53 A;  2KAT A;  4NAC A;  4Y6W A;  4O30 A;  3SF4 A;  3FTX A;  4XI0 A;  4I1O B;  1H0A A;  3G2V A;  3NZU A;  3CVX A;  4CRW A;  3EP0 A;  2HR2 A;  5BW8 C;  3D9K A;  4I6E A;  4APF A;  3D9M A;  5JJ6 A;  3M5A A;  4PUC A;  3FP3 A;  3FTS A;  4QEP A;  4ILI A;  4J8O A;  3LXU X;  3CVL A;  1HFA A;  2VSX E;  4WND A;  4AJW A;  4HOR A;  1MUF A;  3CEQ A;  3RJW A;  4HS2 A;  3LY9 A;  2GRL A;  2DCP A;  3PEV B;  2RD0 A;  3HDX A;  1ML9 A;  2FEZ A;  3U4T A;  2PQN A;  1UG3 A;  4PS8 A;  3R7R A;  3ZN3 A;  4IUL A;  4ACK A;  4PS3 A;  5LP0 A;  1EDU A;  3PEU B;  3CIA A;  3L13 A;  1Y6I A;  4CGV A;  2Q7F A;  5EKQ D;  4CGW A;  3QKY A;  5FQ8 A;  5KJM A;  1LF8 A;  1NA3 A;  4B8A A;  5LOZ A;  5CMW A;  3G2S A;  4UQX A;  3VTY A;  1ELK A;  4UI9 C;  5G55 A;  3S7D A;  5LFA A;  4B8C B;  3PH0 C;  1HE8 A;  3TAX A;  3FWV A;  3FEX A;  4KT6 B;  3GYZ A;  4KMO A;  4CDR A;  2WQ7 A;  2V0P A;  3EDT B;  3P2B A;  1WAO 1;  3PS6 A;  4HFG A;  4YVQ C;  3M57 A;  1E90 A;  3JQ0 A;  3D9O A;  3CK8 A;  3QC1 A;  4J8E A;  3Q5M A;  3B7R L;  4J83 A;  4EPZ A;  4L2L A;  2DBA A;  3ZRH A;  2XGS A;  2WXJ A;  4AEZ C;  3CHO A;  3T5V A;  3FH7 A;  3TG4 A;  3O48 A;  5TTF A;  3AU5 A;  2GW1 A;  2VGY A;  5AYW D;  3ASF A;  4GZD A;  2J08 A;  1YA0 A;  1Z3Y A;  3L54 A;  3FTY A;  4G1T A;  4Q96 A;  4AM9 A;  1H2U A;  5CCM A;  5FQ7 A;  1GW6 A;  4C0E A;  3ZXS A;  2UWJ G;  3MO0 A;  2W5Z A;  3F9W A;  4RSY A;  3MYV A;  1MQS A;  2XHE A;  3MGB A;  4GPK A;  3SBT B;  4ANW A;  1W3B A;  2GRM A;  3R9A B;  4RG6 A;  3KD7 A;  4ABN A;  5G05 C;  3RRM B;  3FUJ A;  3PRE A;  2I1J A;  3S7J A;  5C2Y A;  3VUZ A;  3ZHE A;  1HS6 A;  2XPY A;  1N6A A;  4U04 A;  1UJJ A;  3LJ3 A;  3ZW3 A;  3B13 A;  3FU3 A;  3Q4A B;  5BV1 A;  3LVQ E;  4XKC A;  1X5B A;  4WNF A;  4N3C A;  2I9C A;  2LAH A;  3EIJ A;  3TG5 A;  2E0I A;  4AIF A;  2R3A A;  3VLE A;  1XQH A;  4CT4 A;  4JZY A;  3GW4 A;  1PEG A;  3OOI A;  2I6H A;  3JCK C;  2LNI A;  3APF A;  3L6A A;  4N39 A;  3B7S A;  2MRI A;  3FPD A;  5J90 A;  3SBS A;  1TJF A;  4LDG A;  4E47 A;  1PY1 A;  3EHN A;  3GZ2 A;  5FT9 A;  3CVW A;  4FAD A;  3ESK A;  3M58 A;  2AWI A;  2J07 A;  4PS7 A;  1H2T C;  1H2V C;  4I43 A;  2LSV A;  4M3O A;  5BPP A;  3VV0 A;  1JWG A;  4KZ0 A;  4WWP A;  4AOF A;  4JEU A;  5BV0 A;  3CVN A;  2WXF A;  2X38 A;  2X6K A;  4BT9 A;  2OOE A;  4C1Q A;  3KAE A;  4A3T A;  1H19 A;  2CFZ A;  2WQ6 A;  3ZYM A;  2WXM A;  4W9R A;  3IHX A;  4HOQ A;  5ARG A;  2X3M A;  3LY7 A;  5LSX A;  2FBN A;  1XGW A;  2WXN A;  1EF1 C;  2KCL A;  4I1M A;  2QFC A;  2CHX A;  3S2A A;  4DI3 A;  5EX0 A;  3JUI A;  1E7V A;  2J4D A;  4G23 A;  3UX4 A;  2EQX A;  2WMN A;  4N2S A;  2CG2 A;  4MKT A;  2L9B A;  4I2Z A;  4N5C A;  1L5J A;  3SFZ A;  4G26 A;  4CCA A;  2Y3A A;  2PQR A;  3U9W A;  2IF4 A;  2O8J A;  3IHY A;  2ION A;  3Q15 A;  4H12 A;  3QWV A;  5TH7 A;  3U64 A;  5M72 A;  1ZKK A;  3LY8 A;  5CPR B;  3D9I A;  2WPV A;  2AVP A;  5G04 J;  4G25 A;  1NA0 A;  4KVO A;  4GB9 A;  1N54 A;  3QB2 A;  3SHF A;  3APC A;  4DLQ A;  4JDS A;  4U07 A;  2NXP A;  4WWN A;  3S7B A;  4FU3 A;  2WXO A;  4L23 A;  3UQ3 A;  5G2N A;  1FVF A;  5BUZ A;  2WXL A;  3UT7 A;  4F3V A;  1NP7 A;  5KJN A;  2W5Y A;  4QFV A;  5CMY A;  1QZ2 A;  1TJC A;  2C2L A;  3WXX A;  4BSX A;  4KYO B;  4DJA A;  2IGQ A;  1E96 B;  2I2O A;  3DB5 A;  3CR3 A;  4P29 A;  1E8Y A;  2FI7 A;  3SD5 A;  3HVE B;  4I9E A;  5BT1 A;  2RG8 A;  2VTB A;  3EJN A;  4GYW A;  4BT8 A;  1HF8 A;  4JPS A;  3ZIM A;  1N6C A;  3MEK A;  3QDN A;  3FU0 A;  4NRH B;  3ZHE B;  5T5G A;  4L2Y A;  3CVU A;  3DAL A;  4TUU A;  2OND A;  1QQE A;  3FH8 A;  2OV8 A;  3MO5 A;  3CHM A;  4YND A;  3ZYQ A;  4DK5 A;  4G24 A;  4J7I A;  3F9Y A;  4CDN A;  3RO3 A;  3TGO A;  3IKO B;  3ULQ A;  2XRY A;  5LCW J;  4HOS A;  5FTP A;  4MI5 A;  4CDM A;  3CKC A;  1OWN A;  2FF4 A;  3CHP A;  2R5S A;  3RAY A;  3L17 A;  2OVB A;  4FJZ A;  2KC7 A;  3MJW A;  2X6J A;  2C0L A;  3L08 A;  4BY6 A;  2XCB A;  3ASD A;  3HNA A;  2GGF A;  3D9P A;  2WXP A;  1SQM A;  5LSZ A;  2AXZ A;  4YVO A;  4LUN U;  3CSF A;  3CST A;  4HOU A;  5ARF A;  1A17 A;  4ILH B;  5EX3 A;  3RRN B;  3MCX A;  2WXK A;  3L16 A;  3LVR E;  2HM8 A;  3CBO A;  4GZC A;  1UW4 B;  4OVV A;  4B0Z A;  4F53 A;  5C1D A;  4N2Q A;  3CHR A;  2XPI A;  4UWL A;  5F5E A;  3UPV A;  5TEG A;  3OPE A;  2X6I A;  3BG0 B;  4AXH A;  3T8M A;  4BX8 A;  3U66 A;  3FTW A;  3MKQ A;  1HO8 A;  2LSU A;  2LO6 A;  3CVV A;  2QPW A;  3Q49 B;  4BWR A;  4PH4 B;  5FQ6 A;  4JLG A;  4GA2 A;  1N3J A;  4C9B B;  4JEH A;  4GML A;  4N3A A;  2JEK A;  2VYI A;  3PE3 A;  3RQ4 A;  3FUM A;  2VGX A;  1E8W A;  3AS8 A;  4F7A A;  3K5K A;  4A55 A;  2ZU6 B;  5BNW A;  3HVE A;  5D0Q D;  1MVX A;  1WY6 A;  3B7T A;  4A3V A;  2CHW A;  3ENE A;  4GZ3 A;  2VSO E;  1ZBP A;  3KMJ A;  3D3M A;  3N71 A;  2VSY A;  4LCT A;  4Q94 A;  4FJY A;  3ZPJ A;  4A1S A;  1H3I A;  4F1S A;  4O6F A;  5E75 A;  1HZ4 A;  4XE0 A;  4GYO A;  4BTB A;  4RZ0 A;  3BG1 B;  2WXQ A;  2YHC A;  3G2T A;  4R7L A;  2VSN A;  1ZU2 A;  3LEW A;  3ONK A;  2WXI A;  1QNF A;  4FHJ A;  4U8H A;  5JJT A;  3VLD A;  4NJ5 A;  4HVB A;  1E8Z A;  1OWP A;  3FUL A;  4FA6 A;  4APO A;  4K0R A;  2RFI A;  4UQY A;  1HX8 A;  4FUL A;  3D9J A;  1Z3X A;  3FY4 A;  2CFU A;  1DVP A;  3PE4 A;  4ACL A;  4CT0 A;  4Q69 A;  4I9C A;  2YNQ A;  4IJ8 A;  1BPO A;  3FDH A;  4U0S A;  5AEN A;  5ANL A;  4A1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...