5ARFA

Smyd2 in complex with small molecule inhibitor compound-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (Bay-598) for the Protein Lysine Methyltransferase Smyd2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-LYSINE METHYLTRANSFERASE SMYD2
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5arfA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5arfA01
4GA2A 5M72A 2P58C 5FZSA 4QENA 4B94A 2NC9A 4APOA 4HOSA 2UY1B 2OOEA 3F9YA 4I17A 4AM9A 4QEOA 1NZNA 2JLBA 3M53A 5G04J 3PE3A 1MT6A 2LSVA 2MHKA 2ONDA 4GZ5A 3Q49B 2Y4TA 1N6AA 4JA9A 4YPEA 3KMTA 4J8FA 2VYIA 5CPRB 3CVLA 3SZ7A 5JHNA 4U0UA 5TTFA 3MO5A 4HOQA 4IJDA 4N3CA 2Q7FA 2KCKA 5CHEE 1XNFA 5JIYA 1IYGA 4I51A 4GA1A 4C1QA 4U0SA 4F3VA 3NF1A 3OS5A 3SF4A 2R3AA 2C0MA 2FO7A 1KLXA 3CVPA 5FTPA 4JL0A 3UUXA 1MVXA 2FI7A 2YHCA 1MUFA 5ARFA 5JJ6A 5F59A 3KD7A 3KS2A 4O6FA 2RFIA 3CK7A 4YNPA 2F69A 5HI7A 1E96B 2WPVA 4I2ZA 3RKVA 3ZPJA 3SWCA 3U4TA 2XCCA 3BO5A 2UWJG 3CVQA 4XIFA 3OOIA 4N3BA 5T5GA 5BNWA 1ZBPA 3TG5A 5T0MA 3MV3B 3CVNA 4Z4PA 3AS5A 2VQ2A 4G1TA 4RG6A 3LCAA 2FF4A 3LY8A 4UI9K 4GPKA 4O30A 2KATA 4NRHB 2R5SA 5FZRA 1HH8A 2LNIA 3ASDA 3OXGA 4YPAA 3M59A 5F5EA 4RZ0A 4KYOB 4IN3B 4XI9A 3EDTB 3IEGA 5D0QD 4A1SA 2PQRA 5AYWD 3ZGQA 3ASHA 3U3WA 2YQ8A 5EX0A 5LSZA 2XEVA 3ZHEB 2BQZA 4YPUA 4J8EA 2VSNA 1N6CA 1QQEA 3OPEA 1ELWA 2HO1A 1TJCA 3QWPA 1W3BA 2QFCA 5T0KA 3CKCA 5F6LA 5EX3A 4N3AA 3LY7A 2AVPA 4KBQA 5TEGA 3QDNA 3PE4A 4U07A 4UI9J 3M57A 4GYYA 3QWWA 1YA0A 5FJYA 5DIZA 2I6HA 5G05J 4WUYA 4U04A 2PQNA 4UQXA 3MKRA 3FFLA 2VSYA 3FWVA 4NVQA 3KMJA 4Y6WA 4UQYA 4GCNA 3VTYA 4H12A 2L6JA 3IHXA 2PZIA 3AS4A 2VGXB 3LY9A 3S7FA 3TAXA 4J7FA 3R9AB 3CEQA 2E2EA 3FPDA 3MO0A 4NJ5A 4GZ3A 4GA0A 5TH7A 5FT9A 4NQ0A 4I9EA 4H7XA 4UQZA 3UPVA 3URZA 4BTBA 3CK8A 4MI0A 2QPWA 3RQ4A 4CGVA 3PDNA 3MA5A 3Q15A 4EQFA 5G05C 2PL2A 2XCBA 4J83A 2XPIA 1ML9A 4LDGA 4HOUA 4XI0A 3RIBA 5G04C 1B89A 4Y6CA 3MEKA 2FBNA 5CCLA 3DALA 5A6CA 3ESKA 3VV0A 3HNAA 3K5KA 4ME2A 3M56A 3LPZA 4AU7A 1NA0A 4ABNA 3TGOA 4GYWA 2IFUA 3FP3A 3LYAA 2VGYA 5EG2A 5FZQA 3WXXA 1WAO1 3KMAA 2LSUA 4JLGA 1PC2A 3CBOA 5JJ0A 1QZ2A 5JJTA 4J7IA 4G25A 4BWRA 1O9SA 3OXFA 3ZN3A 3OXLA 2KCLA 4BTAA 3ASGA 2UY1A 4BT8A 1H3IA 3ASFA 3UQ3A 3RU0A 4N2SA 4N2QA 1MVHA 2IF4A 4RG9A 4JHRA 3CV0A 4YVQC 3RO2A 1OUVA 1N3JA 4J0UA 2FEZA 4GCOA 4FMUA 3ZFWA 4GZ6A 2W5YA 3N71A 4MI5A 2KC7A 3RJWA 5KJNA 3JYSA 5EKQD 3HYMB 4J8OA 3K9IA 2HYZA 4WNGA 3F9WA 3M5AA 2Y4UA 3CBMA 3RO3A 3LKUA 4JDSA 3GZ2A 3Q47B 3VTXA 4LEUA 3KAEA 3S7DA 4U0ZA 2DBAA 2XGSA 5D0OD 4YNMA 1HZ4A 5AYFA 4I2WA 4KXKB 4W9RA 2XGMA 4CGWA 4I1AA 4WNDA 3CBPA 4WNEA 4BT9A 2J9QA 2HR2A 5LCWJ 1ZU2A 4IJ8A 3M54A 5BT1A 3ZHEA 2G46A 1NA3A 2IGQA 4JA7A 2C0LA 1XQHA 4BUPA 3ULQA 2V5FA 5BW8C 3VUZA 1FCHA 4G24A 1PEGA 5C1DA 2WQHA 3Q5MA 4CDRA 5HQ8A 4G2VA 1KT0A 5CCMA 1P5QA 2C2LA 3RAYA 2VGXA 5LCWC 5JJ7A 3GYZA 3MV2B 5DBKA 3MO2A 4I9CA 2W5ZA 3F9ZA 4G23A 4WNFA 5ARGA 5KJMA 4HORA 3GZ1A 2XGOA 4E47A 3O48A 3CK9A 4UI9C 4G26A 3GW4A 4YVOA 5KJKA 1Y8MA 4GYOA 1KT1A 4HOTA 2JV0A 3E4BA 3BEEA 3DB5A 3M55A 1ELRA 4YNDA 3AS8A 3SW9A 3QKYA 4QEPA 1ZKKA 4AIFA 1IHGA 3TG4A 3QOUA 3QWVA 4N5CA 2O8JA 3F9XA 5LSXA 4H7YA 2BUGA 5A7DB 1WM5A 3CKBA 3Q4AB 3EP0A 3M58A 4J8DA 2GW1A 3RJVA 5JINA 1HXIA 3S8PA 5F6KC 4N39A 2KCVA 5KJLA 3S7BA 1A17A 4AY6A 4AY5A 3S7JA
chains in the Genus database with same CATH superfamily
1H0AA 4TRQA 5D66A 2UY1B 3DXMG 4QQIA 1WY6A 3PNTB 3B13A 3I4RB 5J08A 5G04J 3RRNB 2ONDA 3Q49B 1ZB1A 2Y4TA 2ZIRA 1OWOA 4J8YA 4GU5A 3NBNB 3CVLA 1MZCA 2WXIA 3FEYA 4FHKA 3RK6A 4HOQA 4KT6B 1D8EA 2IONA 2Q7FA 4K5AB 2KCKA 5CHEE 1XNFA 3FUHA 2J07A 1IYGA 4GTPA 2VTBA 4GA1A 4F3VA 3NF1A 3SF4A 4LERA 3CVPA 3EHNA 4MLPA 4LRZA 2CHXA 5FTPA 1BD8A 2FI7A 2L0TB 3HXCA 4CEMA 3Q9NC 1HS6A 2XPYA 3KS2A 5IY5E 3SBSA 2RFIA 2H6HA 3CK7A 3CQCB 4FLHA 5ANLA 4I2ZA 3RKVA 3ZPJA 3SWCA 2FULA 3C98A 1N4RA 3BO5A 2UWJG 3ZUVB 3OOIA 4N3BA 5T5GA 2ETBA 3I5PA 3TG5A 1LD7A 3AS5A 4UWGA 2FF4A 3LY8A 2QYJA 4GPKA 2R5SA 3PZ2A 1HH8A 2LNIA 4EHMA 4YPAA 3M59A 3J5PA 4GMRA 4IN3B 3EDTB 3UI2A 3IEGA 2V0PA 5LSZA 5FQ8A 2BQZA 1HX8A 3UIPC 1HF8A 4YDEA 4XEIG 5AQ9A 3QWPA 4DX6D 2HM8A 1EYHA 3QJZA 3UX4A 5T0KA 3V2OA 3CKCA 4UWHA 5E75A 2RKKA 4D10C 3PE4A 4U07A 3MKQB 2AXVA 1FVFA 3FH7A 5AENA 3EIJA 3CHMA 3UKRG 3E33A 3PREA 3QAQA 4LNUD 4GTRA 4JEUA 4O1PA 1KZOA 4OVVA 3CR3A 3LVQE 4CT4A 1NFIE 2J4BA 5EYLA 2NSZA 3Q79A 1S63A 4ATZD 3T5XA 3ZXPA 1MHQA 4BFRA 4URKA 1SW6A 5ENSD 1WG0A 4NQ0A 3FTSA 4ILIA 4UQZA 1H2TC 1YYHA 3UPVA 3FUFA 3URZA 5KWDA 3F6QA 2DYSE 4L9PA 3L9TA 5G05C 2PL2A 4ACKA 3C5RA 2XCBA 3PZ4A 4K0RA 2ETCA 2XPIA 1TNBA 4ATGA 2M63A 5G04C 1TYQG 1EF1C 2WXKA 1FPPA 5CERB 2A5UA 3ESKA 3HNAA 3LPZA 3D9PA 1PAQA 3I4GA 3ZYKA 1NA0A 2R05A 1TNYA 4E85A 1MX4A 3FP3A 1IKND 3LYAA 1H6OA 2P9KG 4OVUA 2P9NG 1PC2A 1QZ2A 1H6KA 3ULYA 1E7VA 3ZN3A 2KCLA 2Y1LE 1H3IA 2IF4A 3AU4A 5KNHD 4JHRA 4YVQC 3RO2A 3MKQA 2WM9A 4GTSA 2P9LG 3R7RA 4I6GA 5LOZA 3IBEA 2X38A 2KC7A 5T3RA 1N11A 3HYMB 4J8OA 3UKUG 4BSXA 4WNGA 3RSEG 1QBQA 2Y4UA 1QNFA 4NURA 4JDSA 4B8CB 4MKTA 2XEEA 2ZISA 2GRQB 3S7DA 5D0OD 3U64A 2OEVA 4F7AA 5ANRA 1Z3YA 4WNDA 3CBPA 3FDHA 3EUVA 1JUQA 3TWUA 5KCMA 1WDYA 3ZHEA 3FUMA 1IQRA 5FQ4A 2AWIA 3ZRHA 4BETA 3FTXA 1XQHA 2V5FA 5BW8C 1EPUA 2LAHA 2WXLA 3SNXA 3JXIA 4G24A 3UTMA 2DCPA 1KT0A 1P5QA 5AAOA 2H6GA 4TUMA 4FA6A 2VGXA 2E0IA 5DBKA 3AG3E 4I9CA 3F9ZA 4G26A 1Z3XA 4N5QA 4C9BB 5EILA 3DRAA 4YVOA 2X6IA 4JD2G 3E4BA 3APDA 3M55A 4AP2A 3AS8A 3QKYA 3Q9UC 2I2OA 3SBTB 3LXUX 4RSYA 4A3TA 4U8HA 4AIFA 4EBAA 4XX5A 3QWVA 4N5CA 4L1BA 3FTYA 1MYOA 3G2SA 3IKOB 4H7YA 3Q4AB 4IYPA 2OVBA 3DPYA 1K3ZD 3RJVA 3S8PA 4DRXE 1A17A 3UM1A 3FU0A 3S7JA 5AN8A 4APFA 4GA2A 5FZSA 2DYRE 5CECB 3AU5A 4CRWA 3F9YA 4I17A 3UXGA 2XHEA 3QB2A 3DSSA 1LD8A 4BERA 2MHKA 4TXQA 4GTMA 4JW1A 2QC9A 4J8FA 2VYIA 1U2VG 5CPRB 2IO3C 3CVVA 4IJDA 3E37A 2LUHA 2XPZA 4V3IA 2VSXE 2RFMA 5FIOA 4C1QA 5ENOD 2J09A 1BU9A 3SFZA 2IY0C 3R7QA 1BPOA 3HIZA 1JWFA 1N54A 1KLXA 1YMPA 1V54E 2H6FA 4JL0A 4AXHA 5KNGA 1SZ9A 4M3OA 3LS8A 2YHCA 3W9GA 1MUFA 1L5JA 2GRMA 4HI8A 5JJ6A 2YINA 4EZJA 3TWTA 2LXMA 4G11A 3ZYQA 5HI7A 4LSZE 3CHOA 2WPVA 1TNOA 3U4TA 3CVYA 4UWLA 2R02A 1IXVA 1ZBPA 3TWXA 3P1UA 4Z4PA 3IV0A 3NOCD 4TXPA 3P2BA 4TV3A 4G1TA 4RG6A 3U9WA 4KZ0A 2BTDA 3APCA 4UI9K 4NRHB 2XRZA 5FZRA 3HHMA 3ASDA 3OXGA 5F5EA 4RZ0A 3FUEA 4KYOB 4HRLA 3BU8A 3B95A 1TNUA 4HXIA 4DPRA 3CHRA 2V5QC 4ACLA 3D9KA 1N94A 4J8EA 1QQEA 3B7TA 1ELWA 5BPPA 3MGBA 2JEKA 1OWLA 1W3BA 4U95D 4O1OA 2QFCA 3D9IA 5F6LA 3LY7A 3RAUA 2AVPA 2R03A 2IEJA 4KBQA 3QDNA 4RVBA 3ULEG 4UI9J 3M57A 3EHMA 4DK5A 3UIOC 3CVUA 1YA0A 5FJYA 2GROB 2I6HA 3ZW3A 5G05J 2Y3AA 4WUYA 4ZHBA 3MKRA 3B7UX 3FFLA 3FWVA 4NVQA 1HO8A 2CFUA 4Y6WA 2AXUA 3RRUA 1BI8B 1DCEA 4GCNA 4BX8A 3TWSA 2DZOA 4Q69A 3IHXA 1DVPA 3AS4A 4HLLA 3U66A 4Q94A 3LEWA 4J7FA 2VSOE 1UN9A 4PUCA 3MO0A 4NJ5A 4GZ3A 4GA0A 1K1AA 3EU9A 5FT9A 4AJWA 1A5EA 4H7XA 4RLYA 3PVLA 3CVXA 2QPWA 3UT8A 3RQ4A 4CGVA 3SQVA 2V4HC 3MA5A 1TNZA 5G55A 1UOHA 3TL5A 5B3SE 5CCLA 4OYSA 5A6CA 2WXHA 2BEDA 5CMWA 4ME2A 3IXEA 3M56A 2ZGGA 3D9OA 1IHBA 2OEWA 3TGOA 3HDXA 4TUUA 2IFUA 4K5BA 5FZQA 1INZA 3WXXA 4LUNU 2B0OE 4L2YA 4XZ4A 3ESLA 5CEAA 2WXQA 2VJ8A 3KMAA 1E8WA 3CBOA 4ANWA 4BWRA 3OXFA 5BXUA 3ASGA 2UY1A 3ASFA 4N2SA 4N2QA 3TWVA 2Y69E 2RG8A 3G2VA 3CV0A 3JQ0A 4ZFHA 4KZCA 1HE8A 3HXFA 4J0UA 4GCOA 3ZYMA 3ZFWA 3DSVA 3EU5A 4UUCA 4HI9A 3D9LA 4MI5A 1AWCB 5AARA 3CBMA 3RO3A 3PUKA 3GZ2A 4KVMA 3VTXA 2KZTB 2J08A 5BV1A 4DLOA 3TWQA 3G2TA 4I2WA 2DVWA 4W9RA 4MS6A 2ILRA 2X6HA 4AV7A 3SO8A 2HE0A 4JHJA 2GRPB 3HVEA 4OAVB 2HR2A 2QZAA 5A23A 5LCWJ 3FY4A 4IJ8A 3M54A 2IO2C 5BT1A 2IGQA 3D9JA 2C0LA 3C72A 4CDMA 1UN8A 4BUPA 3B7RL 5JHBA 4HVBA 3VUZA 1PEGA 5HQ8A 4CDRA 4G2VA 2C2LA 2WXGA 3LVRE 3QC1A 3RAYA 2DZNA 4YDOA 2RD0A 2BF0X 3BG0B 3MO2A 4A3VA 4G23A 5ARGA 5KJMA 4DX2A 4HORA 4E47A 5T8IA 3O48A 1TN7A 3J5QB 5LP0A 1Y6IA 1MJ0A 4A63B 2GRLA 2YNQA 2WXFA 3GW4A 3L22A 5EYPF 4JVSA 4HOTA 3DB5A 3IHYA 3G2WA 1BLXB 3SI5A 4I43A 5KBAA 1HG5A 4ILHB 1IHGA 4DUIA 5ITZF 3QOUA 5HS0A 3FTVA 2WMOA 3F9XA 1H2UA 3EP0A 4LCTA 2XEHA 2GW1A 3NQPA 2MYOA 3CHPA 2L9BA 2KCVA 5KJLA 3SD5A 3ZEFA 3S7BA 3FUKA 4AY6A 1U3CA 4B93B 2P58C 4QENA 4B94A 2NC9A 1RZ4A 2L0IA 4APOA 4HOSA 4F1SA 5B1AE 4FJYA 3UMVA 2JLBA 1MT6A 1G3NB 2LSVA 3FHEA 4GZ5A 1N6AA 3PZ1A 1TN6A 3MZLB 1N0RA 5AQ7A 1JWGA 2X6JA 5JHNA 2AXZA 4U0UA 4FHJA 3MO5A 1O1TA 4DX1A 1KZPA 3FUJA 4I51A 3E34A 4O60A 3LDZA 2R3AA 1O5MA 1JCSA 3HRAA 5LX8A 1SA5A 3L08A 3UUXA 3NZUA 1N4PA 3T5VA 5BV0A 2XS8A 5ARFA 5F59A 3QNKA 3KD7A 4OAUC 1OXJA 4YNPA 2F69A 3ONKA 1DC2A 1E96B 2AJAA 2XCCA 3CVQA 2EIKE 1U3DA 4WWNA 1X5BA 2A4ZA 3EIQC 1ELKA 4BESA 5E76A 2OVFA 4F53A 3DSWA 3DSUA 2WXPA 3B7SA 2J4DA 4O30A 4JC8A 1TJFA 3SY2A 5EIBE 1JCRA 5D0QD 2OCCE 4A1SA 2PQRA 5B1BE 2OV8A 1D8DA 3ZGQA 2LO6A 2WXOA 4U7EB 2YQ8A 3NB2A 2XEVA 4YPUA 2VSNA 4WWPA 5AJLA 3CVWA 2WVIA 2HO1A 2LXLA 2I1JA 4G8LA 2LAIA 4JHKA 3DXKG 3MCXA 3T8MA 5EX3A 3DSTA 4N3AA 2R2LA 4PS3A 5TEGA 4GYYA 4DLQA 4C48B 4GMJA 3NAWA 3QWWA 5DIZA 3SFYA 1S64A 1H6PA 3TJPA 4E6HA 1TR4A 4U04A 3E32A 4UQXA 2VSYA 3L16A 3KMJA 1N9AA 2WXRA 3TXNA 5EN5D 3L17A 4UQYA 3VTYA 4X8QA 3BG1B 2F8YA 1XGWA 2PZIA 3SHFA 1Q2ZA 2VGXB 4WWOA 2EIJE 3LY9A 1LTXA 3TAXA 3TXMA 3HXEA 3R9AB 1NI1A 3CEQA 4C0MA 5TH7A 3Q75A 2CG2A 5FQ6A 4U63A 2AW6A 3ZKJA 1OWPA 3CK8A 2RFAA 3HXDA 3FH8A 2DIWA 3UM3A 4I1OB 4EQFA 2CHWA 3D3MA 4G8KA 2BKKB 3PS6A 4JPSA 4J83A 3DWLG 4LDGA 4HOUA 3D9HA 1B89A 3MYVA 1AP7A 3MEKA 2X3MA 1H2VC 3LJNA 3VV0A 3K5KA 4DX7D 4U96D 3ZU7B 2X6FA 5EG2A 2PM6A 3ZVVA 1WAO1 2XZDG 2WQ7A 5JJTA 3OXLA 3ASNE 1MVHA 4MRUA 2PNNA 3PZDA 4JB8P 2XQ0A 4RG9A 3T9KA 5ENPD 2P9IG 3QK0A 3CHSA 1N3JA 2FEZA 2EIME 1O1SA 4CDNA 2R59A 1JPLA 3RJWA 5EDSA 5KJNA 2WQ6A 1MQSA 3UINC 2EILE 1DNPA 3F9WA 2F37A 4QFVA 1X81A 3DEOA 5C2YA 1N4SA 3Q47B 2IOLA 3JXJA 5AYFA 4NACA 4HQDA 2XGMA 3NOGD 3CGHA 5CRUA 1HFAA 3CSFA 1SZAA 4WNEA 4YDWA 4Z68A 1ZU2A 2ZGDA 4L7TA 4J7WA 1E8XA 4FP7A 4GTOA 1N0QA 1NA3A 4JA7A 1SVXA 3MJWA 3OAWA 3EHQA 3UT4A 3L54A 1FCHA 4M7CA 3Q5MA 5ENNA 2I1KA 3LJ3A 1LF8A 5CCMA 4KVOA 1NP7A 2ZXWE 4XKBA 5JA4D 5LCWC 5JJ7A 1UG3A 3GYZA 1NL4A 3T8KA 2WXMA 2A5EA 4HBDA 1E90A 4GTVA 3ZNGA 2XGOA 2WMNA 5J90A 3V31A 4UI9C 4LNBA 2WXNA 2JABA 1FT1A 2XRYA 1N52A 4J6IA 1Y8MA 3PEUB 4GYOA 4FC8A 1KT1A 4EBAG 2JV0A 2VTBB 1BI7B 3BEEA 1N4QA 1ELRA 4YNDA 4EPZA 4QEPA 1TN8A 3HVEB 4ILGA 5H7PA 4C0EA 4YDYA 2O8JA 4FADA 3L6AA 3DBSA 2XENA 5HKPA 1MX6A 3FEXA 5LFAA 4DI3A 3CKBA 3ZIMA 3M58A 1V55E 5CMYA 1UJJA 5JINA 1OWMA 3FUDA 2P9PG 4F1PA 5F6KC 4N39A 3X2QE 3FU6A 5M72A 3JUIA 1OCZE 3D9NA 2OOEA 1FT2A 2GRNB 4AM9A 4QEOA 1VDYA 1NZNA 3M53A 3AJIA 3TWRA 3G2UA 3PE3A 2F8XK 4FULA 2B6CA 4HS2A 2NXPA 3FU3A 4JA9A 4YPEA 3KMTA 4BX9A 3SZ7A 5TTFA 3AG2E 4CCAA 4N3CA 3PNLB 5JIYA 4U0SA 2WB2A 3OS5A 2P2CP 2C0MA 3ASOE 1Z5SC 2FO7A 4FLBA 3KEZA 2CFZA 2DWZA 4I1MA 4L23A 1E7UA 3V79K 1MVXA 3UM2A 4MBGA 3TWWA 1GW6A 3L13A 4O6FA 4BEPA 1D9SA 3VLDA 4A1GA 2QYUA 5ENQD 4LG6A 5AQAA 2P9UG 4FJZA 4XIFA 4JEHA 5JHAA 5BUZA 5BNWA 3KSLA 5T0MA 2P9SG 3MV3B 3CVNA 4A55A 1Z6TA 2VQ2A 2WXJA 4B8AA 3ML9A 4UWKA 2KZTA 3LCAA 4GTTA 2V4LA 2KATA 4Q96A 3R9MA 2MRIA 2NYJA 3C3QA 4XI9A 1HU3A 3ONLA 3W9FA 3Q78A 5AYWD 3O4ZA 3QARA 4JZYA 4ANVA 3ASHA 3U3WA 5EX0A 3ZHEB 1UW4B 1N6CA 3OPEA 2I9CA 1TJCA 4XE0A 3JCKC 3AAAC 3CIAA 1K1BA 3DPDA 2EQXA 4JXTA 4F6RD 4EZLA 2CHZA 2EINE 5AIJA 4AOFA 1RW2A 3C3RA 2PQNA 2H6IA 3PUJA 3ZYLA 4PH4B 3ISMC 4H12A 2L6JA 5AJDA 4BY6A 3PH0C 2F0YA 4K5CA 4PS7A 3UT7A 3FUNA 4UWFA 3S7FA 4K03A 2XZTG 4L2LA 3EJNA 3KSQA 1OWNA 2E2EA 2V8SE 3FPDA 3FUIA 3E30A 4GAAA 1DCQA 4NIKA 4U8VD 4I9EA 3IHVA 4DJAA 4BTBA 2ZU6B 3VLEA 4MI0A 4GB9A 5FWQA 2GGFA 1S0PA 4HFGA 3PDNA 3Q15A 4IRUA 1FVHA 4DI4A 1JCQA 3HG0D 3FTZA 3ZXSA 2VGEA 3OTNA 1ML9A 3JQ1A 4XI0A 3RIBA 2PM7A 4GMLA 2KXPC 4Y6CA 2FBNA 3NZSA 3DALA 1HG2A 4PS8A 4EECA 2J49A 1TEZA 3Q73A 3CLJA 2J8SD 4AU7A 2KBXA 4EZKA 4ABNA 4GYWA 4ANXA 5CBNA 5HRYA 3RRMB 2VGYA 3ABLE 4PDXA 1QYMA 4J8SA 2IQCA 3L82A 4HRMB 5BXOA 2LSUA 1YCSB 4JLGA 3VLFA 3V2XA 5JJ0A 4J7IA 1IQUA 3FULA 3ENEA 4G25A 1O9SA 1MX2A 1N95A 4BTAA 4BT8A 2YHEA 3UQ3A 3RU0A 2IU1A 2X6KA 3AG1E 4BSZB 3BUAA 2BKGA 3GZSA 4LNGA 4KMOA 4GPMA 1OUVA 4FMUA 4GZ6A 2Y0BG 1O1RA 2W5YA 5CBOA 3N71A 4I6EA 4IULA 2R17C 3JYSA 4R7LA 4I6JA 5EKQD 2MOWA 3FTUA 3K9IA 2HYZA 3SGHA 3M5AA 3BQOA 3Q7AA 3LKUA 4RQIA 4LEUA 4FU3A 4TXRA 3V30A 3KAEA 4U0ZA 2DBAA 4XKCA 3I3NA 2XGSA 2GRRB 2XS1A 4YNMA 1HZ4A 4HLEA 3B7BA 4KXKB 1S70B 3C3OA 4I1AA 4CGWA 3ML8A 3PZ3A 1OY3D 3EHRA 4BT9A 2J9QA 1OCCE 3JUEA 1PY1A 3FTWA 1OT8A 3APFA 5AQBA 3HXBA 4B89A 3D9MA 2G46A 2IOSA 2ETAA 3KEAA 3ULQA 3AG4E 1KPSB 5C1DA 2WQHA 4CT0A 1OCRE 5ENTD 4AVXA 4CYMD 1OCOE 3PRZA 5G2NA 5ENRD 3DEPA 4HNAD 3CHQA 3MV2B 4ANUA 2QY7A 1SQMA 2W5ZA 3UM0A 4WNFA 4HB5A 2KM4A 3ABME 3GZ1A 3CQGB 3CK9A 5D2MC 1UJKA 5KJKA 3WG7E 3SFXA 5T4YA 5FQ7A 4GZDA 3FU5A 2IJGX 3PEVB 4GTQA 5JMND 3SW9A 1ZKKA 1E8YA 3FH5A 4B0ZA 3TG4A 4CZ2D 3Q7FA 5FINA 1EDUA 5LSXA 2L6BA 2BUGA 5A7DB 5EIDA 1WM5A 1SA4A 3CSTA 3ABKE 2CG3A 4U8YD 1K8KG 3MX3A 4J8DA 4AEZC 1E8ZA 1H19A 1HXIA 4WAFA 2FO1E 4GZCA 3DSXA 5CRVA 4HRNA 4DX5D 5CEDB 4AY5A 4P29A 3S2AA
chains in the Genus database with same CATH topology
4GA2A 1H0AA 4TRQA 5M72A 2P58C 3JUIA 5FZSA 4QENA 4B94A 2NC9A 2L0IA 4APOA 4HOSA 2UY1B 3AU5A 3D9NA 4F1SA 1WY6A 4CRWA 3PNTB 4FJYA 2OOEA 3F9YA 4I17A 3UMVA 3B13A 4AM9A 4QEOA 3I4RB 1VDYA 1NZNA 2JLBA 5J08A 3M53A 2XHEA 5G04J 3G2UA 3PE3A 3QB2A 1MT6A 3RRNB 2LSVA 2MHKA 2ONDA 4FULA 3FHEA 4GZ5A 4HS2A 3Q49B 2Y4TA 1OWOA 2NXPA 1N6AA 4JW1A 3FU3A 3MZLB 4JA9A 4YPEA 3KMTA 4BX9A 4GU5A 1JWGA 4J8FA 2VYIA 5CPRB 3CVLA 2X6JA 3SZ7A 2AXZA 2WXIA 3FEYA 4U0UA 5JHNA 5TTFA 4FHJA 4FHKA 3RK6A 4HOQA 3MO5A 4KT6B 3CVVA 4CCAA 4IJDA 4N3CA 2IONA 2Q7FA 2XPZA 3PNLB 2KCKA 4V3IA 2VSXE 1XNFA 5CHEE 3FUHA 5JIYA 2J07A 3FUJA 2VTBA 1IYGA 4I51A 4GA1A 4C1QA 4U0SA 2WB2A 2J09A 4F3VA 3LDZA 3NF1A 3OS5A 3SF4A 3SFZA 2R3AA 3R7QA 2C0MA 1BPOA 3HIZA 1JWFA 1N54A 1KLXA 2FO7A 3CVPA 4FLBA 4LERA 3EHNA 3KEZA 5LX8A 2CFZA 4I1MA 4MLPA 4L23A 1E7UA 3L08A 4LRZA 2CHXA 5FTPA 4JL0A 4AXHA 3UUXA 1MVXA 1SZ9A 3NZUA 2FI7A 2L0TB 4M3OA 3T5VA 5BV0A 3LS8A 2YHCA 4CEMA 1MUFA 5ARFA 1L5JA 2GRMA 5JJ6A 5F59A 3QNKA 2XPYA 2YINA 1HS6A 1GW6A 3KD7A 3KS2A 4EZJA 3L13A 4O6FA 3VLDA 3SBSA 2RFIA 3CK7A 3CQCB 4G11A 4YNPA 4A1GA 4FLHA 2F69A 3ZYQA 5ANLA 3ONKA 5HI7A 1E96B 3CHOA 2WPVA 4I2ZA 3RKVA 3ZPJA 3SWCA 3U4TA 2FULA 4FJZA 2XCCA 3C98A 3BO5A 2UWJG 3CVQA 4XIFA 3CVYA 3OOIA 4UWLA 4N3BA 5T5GA 4JEHA 5JHAA 1U3DA 4WWNA 5BUZA 5BNWA 1X5BA 1ZBPA 3I5PA 3TG5A 3P1UA 5T0MA 2A4ZA 3EIQC 3MV3B 1ELKA 3CVNA 4Z4PA 3IV0A 4A55A 1Z6TA 3P2BA 3AS5A 2VQ2A 2WXJA 4TV3A 4B8AA 4UWGA 3ML9A 2OVFA 5E76A 4F53A 4G1TA 4RG6A 4UWKA 2KZTA 3LCAA 4KZ0A 3U9WA 2FF4A 3LY8A 2WXPA 3B7SA 2V4LA 2BTDA 3APCA 4UI9K 4GPKA 2J4DA 4O30A 2KATA 4NRHB 2XRZA 2R5SA 5FZRA 3HHMA 4Q96A 1HH8A 2LNIA 2MRIA 4JC8A 3ASDA 3OXGA 1TJFA 4YPAA 3M59A 5F5EA 4RZ0A 3FUEA 4KYOB 4IN3B 4XI9A 3EDTB 3IEGA 1HU3A 3ONLA 4HXIA 5D0QD 4DPRA 4A1SA 2PQRA 5AYWD 3CHRA 2OV8A 3ZGQA 3O4ZA 3QARA 2V0PA 4JZYA 4ANVA 2LO6A 3ASHA 3U3WA 2WXOA 4ACLA 2YQ8A 5EX0A 5LSZA 5FQ8A 2XEVA 3ZHEB 2BQZA 1HX8A 1UW4B 3D9KA 4YPUA 4J8EA 1HF8A 2VSNA 1N6CA 1QQEA 4WWPA 5AJLA 3CVWA 2WVIA 3OPEA 3B7TA 1ELWA 2HO1A 2I9CA 5BPPA 2I1JA 1TJCA 3MGBA 2JEKA 1OWLA 3QWPA 1W3BA 2HM8A 1EYHA 2LAIA 4XE0A 3JCKC 4JHKA 2QFCA 3QJZA 3D9IA 3UX4A 5T0KA 3MCXA 3CKCA 3T8MA 5F6LA 4UWHA 3CIAA 5EX3A 4N3AA 3LY7A 2AVPA 5E75A 4PS3A 4KBQA 3DPDA 5TEGA 2EQXA 3QDNA 4RVBA 4JXTA 4D10C 3PE4A 4U07A 3MKQB 4UI9J 3M57A 3EHMA 4DK5A 4GYYA 4DLQA 2AXVA 1FVFA 3QWWA 1YA0A 3FH7A 4GMJA 5DIZA 2CHZA 5FJYA 4EZLA 3CVUA 5AIJA 3TJPA 2I6HA 3ZW3A 5G05J 4AOFA 2Y3AA 4E6HA 4WUYA 4U04A 5AENA 3EIJA 2PQNA 4UQXA 3MKRA 3B7UX 3CHMA 3FFLA 2VSYA 3FWVA 3PUJA 4NVQA 1HO8A 2CFUA 3L16A 4PH4B 3ZYLA 3KMJA 3PREA 3QAQA 2WXRA 4Y6WA 3TXNA 2AXUA 3L17A 4UQYA 3RRUA 4GCNA 4JEUA 3VTYA 4H12A 2L6JA 4BX8A 3BG1B 4OVVA 3CR3A 3LVQE 5AJDA 4Q69A 1XGWA 2PZIA 3SHFA 1DVPA 3AS4A 3PH0C 2VGXB 4PS7A 4WWOA 3UT7A 4BY6A 3U66A 3FUNA 2J4BA 3LY9A 4Q94A 4UWFA 3S7FA 3LEWA 3TAXA 3TXMA 2NSZA 4K03A 4J7FA 3R9AB 3T5XA 2VSOE 1UN9A 3EJNA 4L2LA 4PUCA 1OWNA 3CEQA 2E2EA 2V8SE 3FPDA 3MO0A 4NJ5A 4GZ3A 4GA0A 1MHQA 3FUIA 4C0MA 5TH7A 4BFRA 4URKA 4GAAA 5FT9A 4AJWA 2CG2A 4NQ0A 5FQ6A 3FTSA 4H7XA 2AW6A 3IHVA 4I9EA 4ILIA 1H2TC 4U63A 4UQZA 3UPVA 3FUFA 4DJAA 1OWPA 3URZA 4BTBA 2ZU6B 3VLEA 3CK8A 3PVLA 4MI0A 4GB9A 3CVXA 5FWQA 2QPWA 3UT8A 3RQ4A 4CGVA 2GGFA 3FH8A 1S0PA 4HFGA 2DIWA 3PDNA 3MA5A 3Q15A 4I1OB 4EQFA 2CHWA 3D3MA 4IRUA 1FVHA 4DI4A 5G05C 3PS6A 2PL2A 4JPSA 4ACKA 2XCBA 3FTZA 5G55A 3ZXSA 4J83A 4K0RA 3OTNA 2XPIA 1ML9A 4LDGA 4HOUA 3JQ1A 4XI0A 3RIBA 4ATGA 2M63A 1B89A 5G04C 2PM7A 3MYVA 4GMLA 4Y6CA 3TL5A 3MEKA 2FBNA 3NZSA 2X3MA 5CCLA 1EF1C 2WXKA 3DALA 1H2VC 1HG2A 4OYSA 4PS8A 2A5UA 5A6CA 3ESKA 2WXHA 4EECA 2J49A 3VV0A 3HNAA 5CMWA 3K5KA 4ME2A 1TEZA 3M56A 3CLJA 3LPZA 3D9PA 1PAQA 3D9OA 3I4GA 1NA0A 3ZYKA 4ABNA 4EZKA 4AU7A 3TGOA 3HDXA 4E85A 4GYWA 4TUUA 2IFUA 4ANXA 3FP3A 2X6FA 3LYAA 3RRMB 2VGYA 4OVUA 5EG2A 5FZQA 1INZA 4PDXA 3WXXA 2PM6A 3ZVVA 4J8SA 1WAO1 2IQCA 4LUNU 4L2YA 4XZ4A 3ESLA 2WXQA 2VJ8A 3KMAA 2LSUA 1E8WA 4JLGA 1PC2A 2WQ7A 3CBOA 3VLFA 1QZ2A 4ANWA 5JJ0A 5JJTA 4J7IA 1IQUA 1H6KA 3FULA 3ENEA 4G25A 1E7VA 4BWRA 1O9SA 3OXFA 3ZN3A 3OXLA 2KCLA 4BTAA 3ASGA 2UY1A 4BT8A 1H3IA 3ASFA 2YHEA 3UQ3A 3RU0A 4N2SA 2IU1A 4N2QA 1MVHA 2IF4A 3AU4A 4MRUA 2X6KA 2RG8A 3PZDA 3GZSA 2XQ0A 4RG9A 3G2VA 4JHRA 3CV0A 3JQ0A 4YVQC 4KMOA 4KZCA 3RO2A 1OUVA 1HE8A 3QK0A 3CHSA 1N3JA 4J0UA 3MKQA 2FEZA 2WM9A 4GCOA 4FMUA 3ZYMA 4CT4A 3R7RA 4GZ6A 4I6GA 3ZFWA 2W5YA 5LOZA 4CDNA 3D9LA 3IBEA 3N71A 2R59A 2X38A 4I6EA 4IULA 4MI5A 2R17C 2KC7A 1JPLA 3RJWA 5EDSA 5KJNA 3JYSA 4R7LA 4I6JA 5EKQD 2MOWA 3HYMB 5T3RA 2WQ6A 4J8OA 3FTUA 3K9IA 3IHXA 1MQSA 4BSXA 2HYZA 4WNGA 3SGHA 1DNPA 3F9WA 4QFVA 3M5AA 2Y4UA 5C2YA 3CBMA 1QNFA 3RO3A 3LKUA 4NURA 3PUKA 4B8CB 3GZ2A 2IOLA 3Q47B 4JDSA 4MKTA 4KVMA 3VTXA 4LEUA 4FU3A 2KZTB 2J08A 3KAEA 4U0ZA 3S7DA 2DBAA 4XKCA 3I3NA 4DLOA 2XGSA 5D0OD 5BV1A 4YNMA 1HZ4A 5AYFA 4HLEA 3G2TA 3U64A 4I2WA 4KXKB 4W9RA 4NACA 4MS6A 2XGMA 4F7AA 2ILRA 3CGHA 5ANRA 2X6HA 1Z3YA 4CGWA 4I1AA 4AV7A 4WNDA 3ML8A 1HFAA 3CSFA 3CBPA 1SZAA 4WNEA 4BT9A 4JHJA 2J9QA 3FDHA 3HVEA 1PY1A 2HR2A 3FTWA 1JUQA 5A23A 5LCWJ 3FY4A 5KCMA 1ZU2A 4IJ8A 3APFA 3M54A 4L7TA 5BT1A 1E8XA 3ZHEA 4B89A 3FUMA 3D9MA 1IQRA 4FP7A 2G46A 5FQ4A 2AWIA 1NA3A 2IOSA 2IGQA 4JA7A 3D9JA 2C0LA 3ZRHA 3FTXA 4CDMA 3MJWA 1UN8A 1XQHA 4BUPA 3B7RL 3OAWA 5JHBA 4HVBA 3ULQA 3UT4A 2V5FA 5BW8C 3VUZA 1EPUA 3L54A 1FCHA 2LAHA 2WXLA 3SNXA 4G24A 1PEGA 5C1DA 2WQHA 3Q5MA 5ENNA 4CT0A 2I1KA 3LJ3A 4CDRA 4G2VA 5HQ8A 2DCPA 1KT0A 1LF8A 5CCMA 1P5QA 4KVOA 2C2LA 2WXGA 3LVRE 3QC1A 1NP7A 3RAYA 4XKBA 4AVXA 2VGXA 4FA6A 2E0IA 5LCWC 3PRZA 5JJ7A 5G2NA 1UG3A 2RD0A 3GYZA 2BF0X 3CHQA 3BG0B 3MV2B 5DBKA 4ANUA 2WXMA 2QY7A 4I9CA 3MO2A 4A3VA 1SQMA 2W5ZA 3F9ZA 4G23A 1E90A 4WNFA 2KM4A 5ARGA 5KJMA 4HORA 3GZ1A 2XGOA 2WMNA 4E47A 5T8IA 5J90A 3CQGB 3O48A 5LP0A 1Y6IA 3CK9A 4UI9C 1UJKA 2GRLA 2WXFA 2YNQA 2WXNA 4G26A 1Z3XA 3GW4A 4C9BB 2XRYA 3L22A 1N52A 4YVOA 5KJKA 4J6IA 1Y8MA 2X6IA 3PEUB 4FC8A 1KT1A 4GYOA 4JVSA 4EBAG 4HOTA 2JV0A 2VTBB 3E4BA 3BEEA 3DB5A 5T4YA 5FQ7A 4GZDA 3APDA 3FU5A 1ELRA 3M55A 2IJGX 3IHYA 3G2WA 4AP2A 3PEVB 3AS8A 4YNDA 3SW9A 3QKYA 4EPZA 4QEPA 3SI5A 2I2OA 3HVEB 4I43A 4ILGA 3SBTB 1ZKKA 3LXUX 4RSYA 4A3TA 1HG5A 4U8HA 4ILHB 4AIFA 1E8YA 4XX5A 1IHGA 4C0EA 3FH5A 4B0ZA 3TG4A 4EBAA 3QOUA 3QWVA 4N5CA 4L1BA 3FTVA 3FTYA 3G2SA 2O8JA 2WMOA 4FADA 3F9XA 3L6AA 1EDUA 5LSXA 3IKOB 4H7YA 3DBSA 2BUGA 5A7DB 1H2UA 3FEXA 5LFAA 4DI3A 1WM5A 3CKBA 3Q4AB 4IYPA 3EP0A 4LCTA 2OVBA 3CSTA 3ZIMA 3M58A 2CG3A 3MX3A 5CMYA 4J8DA 4AEZC 1E8ZA 1H19A 2GW1A 3RJVA 1UJJA 5JINA 1HXIA 1OWMA 3NQPA 4WAFA 3S8PA 3FUDA 4GZCA 3CHPA 5F6KC 2L9BA 4N39A 2KCVA 5KJLA 3SD5A 3ZEFA 3FU6A 3S7BA 3FUKA 1A17A 4AY6A 3FU0A 4AY5A 3S7JA 4P29A 4APFA 3S2AA 1U3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GA2 A;  5M72 A;  2P58 C;  5FZS A;  4QEN A;  4B94 A;  2NC9 A;  4APO A;  4HOS A;  2UY1 B;  2OOE A;  3F9Y A;  4I17 A;  4AM9 A;  4QEO A;  1NZN A;  2JLB A;  3M53 A;  5G04 J;  3PE3 A;  1MT6 A;  2LSV A;  2MHK A;  2OND A;  4GZ5 A;  3Q49 B;  2Y4T A;  1N6A A;  4JA9 A;  4YPE A;  3KMT A;  4J8F A;  2VYI A;  5CPR B;  3CVL A;  3SZ7 A;  5JHN A;  4U0U A;  5TTF A;  3MO5 A;  4HOQ A;  4IJD A;  4N3C A;  2Q7F A;  2KCK A;  5CHE E;  1XNF A;  5JIY A;  1IYG A;  4I51 A;  4GA1 A;  4C1Q A;  4U0S A;  4F3V A;  3NF1 A;  3OS5 A;  3SF4 A;  2R3A A;  2C0M A;  2FO7 A;  1KLX A;  3CVP A;  5FTP A;  4JL0 A;  3UUX A;  1MVX A;  2FI7 A;  2YHC A;  1MUF A;  5ARF A;  5JJ6 A;  5F59 A;  3KD7 A;  3KS2 A;  4O6F A;  2RFI A;  3CK7 A;  4YNP A;  2F69 A;  5HI7 A;  1E96 B;  2WPV A;  4I2Z A;  3RKV A;  3ZPJ A;  3SWC A;  3U4T A;  2XCC A;  3BO5 A;  2UWJ G;  3CVQ A;  4XIF A;  3OOI A;  4N3B A;  5T5G A;  5BNW A;  1ZBP A;  3TG5 A;  5T0M A;  3MV3 B;  3CVN A;  4Z4P A;  3AS5 A;  2VQ2 A;  4G1T A;  4RG6 A;  3LCA A;  2FF4 A;  3LY8 A;  4UI9 K;  4GPK A;  4O30 A;  2KAT A;  4NRH B;  2R5S A;  5FZR A;  1HH8 A;  2LNI A;  3ASD A;  3OXG A;  4YPA A;  3M59 A;  5F5E A;  4RZ0 A;  4KYO B;  4IN3 B;  4XI9 A;  3EDT B;  3IEG A;  5D0Q D;  4A1S A;  2PQR A;  5AYW D;  3ZGQ A;  3ASH A;  3U3W A;  2YQ8 A;  5EX0 A;  5LSZ A;  2XEV A;  3ZHE B;  2BQZ A;  4YPU A;  4J8E A;  2VSN A;  1N6C A;  1QQE A;  3OPE A;  1ELW A;  2HO1 A;  1TJC A;  3QWP A;  1W3B A;  2QFC A;  5T0K A;  3CKC A;  5F6L A;  5EX3 A;  4N3A A;  3LY7 A;  2AVP A;  4KBQ A;  5TEG A;  3QDN A;  3PE4 A;  4U07 A;  4UI9 J;  3M57 A;  4GYY A;  3QWW A;  1YA0 A;  5FJY A;  5DIZ A;  2I6H A;  5G05 J;  4WUY A;  4U04 A;  2PQN A;  4UQX A;  3MKR A;  3FFL A;  2VSY A;  3FWV A;  4NVQ A;  3KMJ A;  4Y6W A;  4UQY A;  4GCN A;  3VTY A;  4H12 A;  2L6J A;  3IHX A;  2PZI A;  3AS4 A;  2VGX B;  3LY9 A;  3S7F A;  3TAX A;  4J7F A;  3R9A B;  3CEQ A;  2E2E A;  3FPD A;  3MO0 A;  4NJ5 A;  4GZ3 A;  4GA0 A;  5TH7 A;  5FT9 A;  4NQ0 A;  4I9E A;  4H7X A;  4UQZ A;  3UPV A;  3URZ A;  4BTB A;  3CK8 A;  4MI0 A;  2QPW A;  3RQ4 A;  4CGV A;  3PDN A;  3MA5 A;  3Q15 A;  4EQF A;  5G05 C;  2PL2 A;  2XCB A;  4J83 A;  2XPI A;  1ML9 A;  4LDG A;  4HOU A;  4XI0 A;  3RIB A;  5G04 C;  1B89 A;  4Y6C A;  3MEK A;  2FBN A;  5CCL A;  3DAL A;  5A6C A;  3ESK A;  3VV0 A;  3HNA A;  3K5K A;  4ME2 A;  3M56 A;  3LPZ A;  4AU7 A;  1NA0 A;  4ABN A;  3TGO A;  4GYW A;  2IFU A;  3FP3 A;  3LYA A;  2VGY A;  5EG2 A;  5FZQ A;  3WXX A;  1WAO 1;  3KMA A;  2LSU A;  4JLG A;  1PC2 A;  3CBO A;  5JJ0 A;  1QZ2 A;  5JJT A;  4J7I A;  4G25 A;  4BWR A;  1O9S A;  3OXF A;  3ZN3 A;  3OXL A;  2KCL A;  4BTA A;  3ASG A;  2UY1 A;  4BT8 A;  1H3I A;  3ASF A;  3UQ3 A;  3RU0 A;  4N2S A;  4N2Q A;  1MVH A;  2IF4 A;  4RG9 A;  4JHR A;  3CV0 A;  4YVQ C;  3RO2 A;  1OUV A;  1N3J A;  4J0U A;  2FEZ A;  4GCO A;  4FMU A;  3ZFW A;  4GZ6 A;  2W5Y A;  3N71 A;  4MI5 A;  2KC7 A;  3RJW A;  5KJN A;  3JYS A;  5EKQ D;  3HYM B;  4J8O A;  3K9I A;  2HYZ A;  4WNG A;  3F9W A;  3M5A A;  2Y4U A;  3CBM A;  3RO3 A;  3LKU A;  4JDS A;  3GZ2 A;  3Q47 B;  3VTX A;  4LEU A;  3KAE A;  3S7D A;  4U0Z A;  2DBA A;  2XGS A;  5D0O D;  4YNM A;  1HZ4 A;  5AYF A;  4I2W A;  4KXK B;  4W9R A;  2XGM A;  4CGW A;  4I1A A;  4WND A;  3CBP A;  4WNE A;  4BT9 A;  2J9Q A;  2HR2 A;  5LCW J;  1ZU2 A;  4IJ8 A;  3M54 A;  5BT1 A;  3ZHE A;  2G46 A;  1NA3 A;  2IGQ A;  4JA7 A;  2C0L A;  1XQH A;  4BUP A;  3ULQ A;  2V5F A;  5BW8 C;  3VUZ A;  1FCH A;  4G24 A;  1PEG A;  5C1D A;  2WQH A;  3Q5M A;  4CDR A;  5HQ8 A;  4G2V A;  1KT0 A;  5CCM A;  1P5Q A;  2C2L A;  3RAY A;  2VGX A;  5LCW C;  5JJ7 A;  3GYZ A;  3MV2 B;  5DBK A;  3MO2 A;  4I9C A;  2W5Z A;  3F9Z A;  4G23 A;  4WNF A;  5ARG A;  5KJM A;  4HOR A;  3GZ1 A;  2XGO A;  4E47 A;  3O48 A;  3CK9 A;  4UI9 C;  4G26 A;  3GW4 A;  4YVO A;  5KJK A;  1Y8M A;  4GYO A;  1KT1 A;  4HOT A;  2JV0 A;  3E4B A;  3BEE A;  3DB5 A;  3M55 A;  1ELR A;  4YND A;  3AS8 A;  3SW9 A;  3QKY A;  4QEP A;  1ZKK A;  4AIF A;  1IHG A;  3TG4 A;  3QOU A;  3QWV A;  4N5C A;  2O8J A;  3F9X A;  5LSX A;  4H7Y A;  2BUG A;  5A7D B;  1WM5 A;  3CKB A;  3Q4A B;  3EP0 A;  3M58 A;  4J8D A;  2GW1 A;  3RJV A;  5JIN A;  1HXI A;  3S8P A;  5F6K C;  4N39 A;  2KCV A;  5KJL A;  3S7B A;  1A17 A;  4AY6 A;  4AY5 A;  3S7J A; 
#chains in the Genus database with same CATH topology
 1H0A A;  4TRQ A;  5D66 A;  2UY1 B;  3DXM G;  4QQI A;  1WY6 A;  3PNT B;  3B13 A;  3I4R B;  5J08 A;  5G04 J;  3RRN B;  2OND A;  3Q49 B;  1ZB1 A;  2Y4T A;  2ZIR A;  1OWO A;  4J8Y A;  4GU5 A;  3NBN B;  3CVL A;  1MZC A;  2WXI A;  3FEY A;  4FHK A;  3RK6 A;  4HOQ A;  4KT6 B;  1D8E A;  2ION A;  2Q7F A;  4K5A B;  2KCK A;  5CHE E;  1XNF A;  3FUH A;  2J07 A;  1IYG A;  4GTP A;  2VTB A;  4GA1 A;  4F3V A;  3NF1 A;  3SF4 A;  4LER A;  3CVP A;  3EHN A;  4MLP A;  4LRZ A;  2CHX A;  5FTP A;  1BD8 A;  2FI7 A;  2L0T B;  3HXC A;  4CEM A;  3Q9N C;  1HS6 A;  2XPY A;  3KS2 A;  5IY5 E;  3SBS A;  2RFI A;  2H6H A;  3CK7 A;  3CQC B;  4FLH A;  5ANL A;  4I2Z A;  3RKV A;  3ZPJ A;  3SWC A;  2FUL A;  3C98 A;  1N4R A;  3BO5 A;  2UWJ G;  3ZUV B;  3OOI A;  4N3B A;  5T5G A;  2ETB A;  3I5P A;  3TG5 A;  1LD7 A;  3AS5 A;  4UWG A;  2FF4 A;  3LY8 A;  2QYJ A;  4GPK A;  2R5S A;  3PZ2 A;  1HH8 A;  2LNI A;  4EHM A;  4YPA A;  3M59 A;  3J5P A;  4GMR A;  4IN3 B;  3EDT B;  3UI2 A;  3IEG A;  2V0P A;  5LSZ A;  5FQ8 A;  2BQZ A;  1HX8 A;  3UIP C;  1HF8 A;  4YDE A;  4XEI G;  5AQ9 A;  3QWP A;  4DX6 D;  2HM8 A;  1EYH A;  3QJZ A;  3UX4 A;  5T0K A;  3V2O A;  3CKC A;  4UWH A;  5E75 A;  2RKK A;  4D10 C;  3PE4 A;  4U07 A;  3MKQ B;  2AXV A;  1FVF A;  3FH7 A;  5AEN A;  3EIJ A;  3CHM A;  3UKR G;  3E33 A;  3PRE A;  3QAQ A;  4LNU D;  4GTR A;  4JEU A;  4O1P A;  1KZO A;  4OVV A;  3CR3 A;  3LVQ E;  4CT4 A;  1NFI E;  2J4B A;  5EYL A;  2NSZ A;  3Q79 A;  1S63 A;  4ATZ D;  3T5X A;  3ZXP A;  1MHQ A;  4BFR A;  4URK A;  1SW6 A;  5ENS D;  1WG0 A;  4NQ0 A;  3FTS A;  4ILI A;  4UQZ A;  1H2T C;  1YYH A;  3UPV A;  3FUF A;  3URZ A;  5KWD A;  3F6Q A;  2DYS E;  4L9P A;  3L9T A;  5G05 C;  2PL2 A;  4ACK A;  3C5R A;  2XCB A;  3PZ4 A;  4K0R A;  2ETC A;  2XPI A;  1TNB A;  4ATG A;  2M63 A;  5G04 C;  1TYQ G;  1EF1 C;  2WXK A;  1FPP A;  5CER B;  2A5U A;  3ESK A;  3HNA A;  3LPZ A;  3D9P A;  1PAQ A;  3I4G A;  3ZYK A;  1NA0 A;  2R05 A;  1TNY A;  4E85 A;  1MX4 A;  3FP3 A;  1IKN D;  3LYA A;  1H6O A;  2P9K G;  4OVU A;  2P9N G;  1PC2 A;  1QZ2 A;  1H6K A;  3ULY A;  1E7V A;  3ZN3 A;  2KCL A;  2Y1L E;  1H3I A;  2IF4 A;  3AU4 A;  5KNH D;  4JHR A;  4YVQ C;  3RO2 A;  3MKQ A;  2WM9 A;  4GTS A;  2P9L G;  3R7R A;  4I6G A;  5LOZ A;  3IBE A;  2X38 A;  2KC7 A;  5T3R A;  1N11 A;  3HYM B;  4J8O A;  3UKU G;  4BSX A;  4WNG A;  3RSE G;  1QBQ A;  2Y4U A;  1QNF A;  4NUR A;  4JDS A;  4B8C B;  4MKT A;  2XEE A;  2ZIS A;  2GRQ B;  3S7D A;  5D0O D;  3U64 A;  2OEV A;  4F7A A;  5ANR A;  1Z3Y A;  4WND A;  3CBP A;  3FDH A;  3EUV A;  1JUQ A;  3TWU A;  5KCM A;  1WDY A;  3ZHE A;  3FUM A;  1IQR A;  5FQ4 A;  2AWI A;  3ZRH A;  4BET A;  3FTX A;  1XQH A;  2V5F A;  5BW8 C;  1EPU A;  2LAH A;  2WXL A;  3SNX A;  3JXI A;  4G24 A;  3UTM A;  2DCP A;  1KT0 A;  1P5Q A;  5AAO A;  2H6G A;  4TUM A;  4FA6 A;  2VGX A;  2E0I A;  5DBK A;  3AG3 E;  4I9C A;  3F9Z A;  4G26 A;  1Z3X A;  4N5Q A;  4C9B B;  5EIL A;  3DRA A;  4YVO A;  2X6I A;  4JD2 G;  3E4B A;  3APD A;  3M55 A;  4AP2 A;  3AS8 A;  3QKY A;  3Q9U C;  2I2O A;  3SBT B;  3LXU X;  4RSY A;  4A3T A;  4U8H A;  4AIF A;  4EBA A;  4XX5 A;  3QWV A;  4N5C A;  4L1B A;  3FTY A;  1MYO A;  3G2S A;  3IKO B;  4H7Y A;  3Q4A B;  4IYP A;  2OVB A;  3DPY A;  1K3Z D;  3RJV A;  3S8P A;  4DRX E;  1A17 A;  3UM1 A;  3FU0 A;  3S7J A;  5AN8 A;  4APF A;  4GA2 A;  5FZS A;  2DYR E;  5CEC B;  3AU5 A;  4CRW A;  3F9Y A;  4I17 A;  3UXG A;  2XHE A;  3QB2 A;  3DSS A;  1LD8 A;  4BER A;  2MHK A;  4TXQ A;  4GTM A;  4JW1 A;  2QC9 A;  4J8F A;  2VYI A;  1U2V G;  5CPR B;  2IO3 C;  3CVV A;  4IJD A;  3E37 A;  2LUH A;  2XPZ A;  4V3I A;  2VSX E;  2RFM A;  5FIO A;  4C1Q A;  5ENO D;  2J09 A;  1BU9 A;  3SFZ A;  2IY0 C;  3R7Q A;  1BPO A;  3HIZ A;  1JWF A;  1N54 A;  1KLX A;  1YMP A;  1V54 E;  2H6F A;  4JL0 A;  4AXH A;  5KNG A;  1SZ9 A;  4M3O A;  3LS8 A;  2YHC A;  3W9G A;  1MUF A;  1L5J A;  2GRM A;  4HI8 A;  5JJ6 A;  2YIN A;  4EZJ A;  3TWT A;  2LXM A;  4G11 A;  3ZYQ A;  5HI7 A;  4LSZ E;  3CHO A;  2WPV A;  1TNO A;  3U4T A;  3CVY A;  4UWL A;  2R02 A;  1IXV A;  1ZBP A;  3TWX A;  3P1U A;  4Z4P A;  3IV0 A;  3NOC D;  4TXP A;  3P2B A;  4TV3 A;  4G1T A;  4RG6 A;  3U9W A;  4KZ0 A;  2BTD A;  3APC A;  4UI9 K;  4NRH B;  2XRZ A;  5FZR A;  3HHM A;  3ASD A;  3OXG A;  5F5E A;  4RZ0 A;  3FUE A;  4KYO B;  4HRL A;  3BU8 A;  3B95 A;  1TNU A;  4HXI A;  4DPR A;  3CHR A;  2V5Q C;  4ACL A;  3D9K A;  1N94 A;  4J8E A;  1QQE A;  3B7T A;  1ELW A;  5BPP A;  3MGB A;  2JEK A;  1OWL A;  1W3B A;  4U95 D;  4O1O A;  2QFC A;  3D9I A;  5F6L A;  3LY7 A;  3RAU A;  2AVP A;  2R03 A;  2IEJ A;  4KBQ A;  3QDN A;  4RVB A;  3ULE G;  4UI9 J;  3M57 A;  3EHM A;  4DK5 A;  3UIO C;  3CVU A;  1YA0 A;  5FJY A;  2GRO B;  2I6H A;  3ZW3 A;  5G05 J;  2Y3A A;  4WUY A;  4ZHB A;  3MKR A;  3B7U X;  3FFL A;  3FWV A;  4NVQ A;  1HO8 A;  2CFU A;  4Y6W A;  2AXU A;  3RRU A;  1BI8 B;  1DCE A;  4GCN A;  4BX8 A;  3TWS A;  2DZO A;  4Q69 A;  3IHX A;  1DVP A;  3AS4 A;  4HLL A;  3U66 A;  4Q94 A;  3LEW A;  4J7F A;  2VSO E;  1UN9 A;  4PUC A;  3MO0 A;  4NJ5 A;  4GZ3 A;  4GA0 A;  1K1A A;  3EU9 A;  5FT9 A;  4AJW A;  1A5E A;  4H7X A;  4RLY A;  3PVL A;  3CVX A;  2QPW A;  3UT8 A;  3RQ4 A;  4CGV A;  3SQV A;  2V4H C;  3MA5 A;  1TNZ A;  5G55 A;  1UOH A;  3TL5 A;  5B3S E;  5CCL A;  4OYS A;  5A6C A;  2WXH A;  2BED A;  5CMW A;  4ME2 A;  3IXE A;  3M56 A;  2ZGG A;  3D9O A;  1IHB A;  2OEW A;  3TGO A;  3HDX A;  4TUU A;  2IFU A;  4K5B A;  5FZQ A;  1INZ A;  3WXX A;  4LUN U;  2B0O E;  4L2Y A;  4XZ4 A;  3ESL A;  5CEA A;  2WXQ A;  2VJ8 A;  3KMA A;  1E8W A;  3CBO A;  4ANW A;  4BWR A;  3OXF A;  5BXU A;  3ASG A;  2UY1 A;  3ASF A;  4N2S A;  4N2Q A;  3TWV A;  2Y69 E;  2RG8 A;  3G2V A;  3CV0 A;  3JQ0 A;  4ZFH A;  4KZC A;  1HE8 A;  3HXF A;  4J0U A;  4GCO A;  3ZYM A;  3ZFW A;  3DSV A;  3EU5 A;  4UUC A;  4HI9 A;  3D9L A;  4MI5 A;  1AWC B;  5AAR A;  3CBM A;  3RO3 A;  3PUK A;  3GZ2 A;  4KVM A;  3VTX A;  2KZT B;  2J08 A;  5BV1 A;  4DLO A;  3TWQ A;  3G2T A;  4I2W A;  2DVW A;  4W9R A;  4MS6 A;  2ILR A;  2X6H A;  4AV7 A;  3SO8 A;  2HE0 A;  4JHJ A;  2GRP B;  3HVE A;  4OAV B;  2HR2 A;  2QZA A;  5A23 A;  5LCW J;  3FY4 A;  4IJ8 A;  3M54 A;  2IO2 C;  5BT1 A;  2IGQ A;  3D9J A;  2C0L A;  3C72 A;  4CDM A;  1UN8 A;  4BUP A;  3B7R L;  5JHB A;  4HVB A;  3VUZ A;  1PEG A;  5HQ8 A;  4CDR A;  4G2V A;  2C2L A;  2WXG A;  3LVR E;  3QC1 A;  3RAY A;  2DZN A;  4YDO A;  2RD0 A;  2BF0 X;  3BG0 B;  3MO2 A;  4A3V A;  4G23 A;  5ARG A;  5KJM A;  4DX2 A;  4HOR A;  4E47 A;  5T8I A;  3O48 A;  1TN7 A;  3J5Q B;  5LP0 A;  1Y6I A;  1MJ0 A;  4A63 B;  2GRL A;  2YNQ A;  2WXF A;  3GW4 A;  3L22 A;  5EYP F;  4JVS A;  4HOT A;  3DB5 A;  3IHY A;  3G2W A;  1BLX B;  3SI5 A;  4I43 A;  5KBA A;  1HG5 A;  4ILH B;  1IHG A;  4DUI A;  5ITZ F;  3QOU A;  5HS0 A;  3FTV A;  2WMO A;  3F9X A;  1H2U A;  3EP0 A;  4LCT A;  2XEH A;  2GW1 A;  3NQP A;  2MYO A;  3CHP A;  2L9B A;  2KCV A;  5KJL A;  3SD5 A;  3ZEF A;  3S7B A;  3FUK A;  4AY6 A;  1U3C A;  4B93 B;  2P58 C;  4QEN A;  4B94 A;  2NC9 A;  1RZ4 A;  2L0I A;  4APO A;  4HOS A;  4F1S A;  5B1A E;  4FJY A;  3UMV A;  2JLB A;  1MT6 A;  1G3N B;  2LSV A;  3FHE A;  4GZ5 A;  1N6A A;  3PZ1 A;  1TN6 A;  3MZL B;  1N0R A;  5AQ7 A;  1JWG A;  2X6J A;  5JHN A;  2AXZ A;  4U0U A;  4FHJ A;  3MO5 A;  1O1T A;  4DX1 A;  1KZP A;  3FUJ A;  4I51 A;  3E34 A;  4O60 A;  3LDZ A;  2R3A A;  1O5M A;  1JCS A;  3HRA A;  5LX8 A;  1SA5 A;  3L08 A;  3UUX A;  3NZU A;  1N4P A;  3T5V A;  5BV0 A;  2XS8 A;  5ARF A;  5F59 A;  3QNK A;  3KD7 A;  4OAU C;  1OXJ A;  4YNP A;  2F69 A;  3ONK A;  1DC2 A;  1E96 B;  2AJA A;  2XCC A;  3CVQ A;  2EIK E;  1U3D A;  4WWN A;  1X5B A;  2A4Z A;  3EIQ C;  1ELK A;  4BES A;  5E76 A;  2OVF A;  4F53 A;  3DSW A;  3DSU A;  2WXP A;  3B7S A;  2J4D A;  4O30 A;  4JC8 A;  1TJF A;  3SY2 A;  5EIB E;  1JCR A;  5D0Q D;  2OCC E;  4A1S A;  2PQR A;  5B1B E;  2OV8 A;  1D8D A;  3ZGQ A;  2LO6 A;  2WXO A;  4U7E B;  2YQ8 A;  3NB2 A;  2XEV A;  4YPU A;  2VSN A;  4WWP A;  5AJL A;  3CVW A;  2WVI A;  2HO1 A;  2LXL A;  2I1J A;  4G8L A;  2LAI A;  4JHK A;  3DXK G;  3MCX A;  3T8M A;  5EX3 A;  3DST A;  4N3A A;  2R2L A;  4PS3 A;  5TEG A;  4GYY A;  4DLQ A;  4C48 B;  4GMJ A;  3NAW A;  3QWW A;  5DIZ A;  3SFY A;  1S64 A;  1H6P A;  3TJP A;  4E6H A;  1TR4 A;  4U04 A;  3E32 A;  4UQX A;  2VSY A;  3L16 A;  3KMJ A;  1N9A A;  2WXR A;  3TXN A;  5EN5 D;  3L17 A;  4UQY A;  3VTY A;  4X8Q A;  3BG1 B;  2F8Y A;  1XGW A;  2PZI A;  3SHF A;  1Q2Z A;  2VGX B;  4WWO A;  2EIJ E;  3LY9 A;  1LTX A;  3TAX A;  3TXM A;  3HXE A;  3R9A B;  1NI1 A;  3CEQ A;  4C0M A;  5TH7 A;  3Q75 A;  2CG2 A;  5FQ6 A;  4U63 A;  2AW6 A;  3ZKJ A;  1OWP A;  3CK8 A;  2RFA A;  3HXD A;  3FH8 A;  2DIW A;  3UM3 A;  4I1O B;  4EQF A;  2CHW A;  3D3M A;  4G8K A;  2BKK B;  3PS6 A;  4JPS A;  4J83 A;  3DWL G;  4LDG A;  4HOU A;  3D9H A;  1B89 A;  3MYV A;  1AP7 A;  3MEK A;  2X3M A;  1H2V C;  3LJN A;  3VV0 A;  3K5K A;  4DX7 D;  4U96 D;  3ZU7 B;  2X6F A;  5EG2 A;  2PM6 A;  3ZVV A;  1WAO 1;  2XZD G;  2WQ7 A;  5JJT A;  3OXL A;  3ASN E;  1MVH A;  4MRU A;  2PNN A;  3PZD A;  4JB8 P;  2XQ0 A;  4RG9 A;  3T9K A;  5ENP D;  2P9I G;  3QK0 A;  3CHS A;  1N3J A;  2FEZ A;  2EIM E;  1O1S A;  4CDN A;  2R59 A;  1JPL A;  3RJW A;  5EDS A;  5KJN A;  2WQ6 A;  1MQS A;  3UIN C;  2EIL E;  1DNP A;  3F9W A;  2F37 A;  4QFV A;  1X81 A;  3DEO A;  5C2Y A;  1N4S A;  3Q47 B;  2IOL A;  3JXJ A;  5AYF A;  4NAC A;  4HQD A;  2XGM A;  3NOG D;  3CGH A;  5CRU A;  1HFA A;  3CSF A;  1SZA A;  4WNE A;  4YDW A;  4Z68 A;  1ZU2 A;  2ZGD A;  4L7T A;  4J7W A;  1E8X A;  4FP7 A;  4GTO A;  1N0Q A;  1NA3 A;  4JA7 A;  1SVX A;  3MJW A;  3OAW A;  3EHQ A;  3UT4 A;  3L54 A;  1FCH A;  4M7C A;  3Q5M A;  5ENN A;  2I1K A;  3LJ3 A;  1LF8 A;  5CCM A;  4KVO A;  1NP7 A;  2ZXW E;  4XKB A;  5JA4 D;  5LCW C;  5JJ7 A;  1UG3 A;  3GYZ A;  1NL4 A;  3T8K A;  2WXM A;  2A5E A;  4HBD A;  1E90 A;  4GTV A;  3ZNG A;  2XGO A;  2WMN A;  5J90 A;  3V31 A;  4UI9 C;  4LNB A;  2WXN A;  2JAB A;  1FT1 A;  2XRY A;  1N52 A;  4J6I A;  1Y8M A;  3PEU B;  4GYO A;  4FC8 A;  1KT1 A;  4EBA G;  2JV0 A;  2VTB B;  1BI7 B;  3BEE A;  1N4Q A;  1ELR A;  4YND A;  4EPZ A;  4QEP A;  1TN8 A;  3HVE B;  4ILG A;  5H7P A;  4C0E A;  4YDY A;  2O8J A;  4FAD A;  3L6A A;  3DBS A;  2XEN A;  5HKP A;  1MX6 A;  3FEX A;  5LFA A;  4DI3 A;  3CKB A;  3ZIM A;  3M58 A;  1V55 E;  5CMY A;  1UJJ A;  5JIN A;  1OWM A;  3FUD A;  2P9P G;  4F1P A;  5F6K C;  4N39 A;  3X2Q E;  3FU6 A;  5M72 A;  3JUI A;  1OCZ E;  3D9N A;  2OOE A;  1FT2 A;  2GRN B;  4AM9 A;  4QEO A;  1VDY A;  1NZN A;  3M53 A;  3AJI A;  3TWR A;  3G2U A;  3PE3 A;  2F8X K;  4FUL A;  2B6C A;  4HS2 A;  2NXP A;  3FU3 A;  4JA9 A;  4YPE A;  3KMT A;  4BX9 A;  3SZ7 A;  5TTF A;  3AG2 E;  4CCA A;  4N3C A;  3PNL B;  5JIY A;  4U0S A;  2WB2 A;  3OS5 A;  2P2C P;  2C0M A;  3ASO E;  1Z5S C;  2FO7 A;  4FLB A;  3KEZ A;  2CFZ A;  2DWZ A;  4I1M A;  4L23 A;  1E7U A;  3V79 K;  1MVX A;  3UM2 A;  4MBG A;  3TWW A;  1GW6 A;  3L13 A;  4O6F A;  4BEP A;  1D9S A;  3VLD A;  4A1G A;  2QYU A;  5ENQ D;  4LG6 A;  5AQA A;  2P9U G;  4FJZ A;  4XIF A;  4JEH A;  5JHA A;  5BUZ A;  5BNW A;  3KSL A;  5T0M A;  2P9S G;  3MV3 B;  3CVN A;  4A55 A;  1Z6T A;  2VQ2 A;  2WXJ A;  4B8A A;  3ML9 A;  4UWK A;  2KZT A;  3LCA A;  4GTT A;  2V4L A;  2KAT A;  4Q96 A;  3R9M A;  2MRI A;  2NYJ A;  3C3Q A;  4XI9 A;  1HU3 A;  3ONL A;  3W9F A;  3Q78 A;  5AYW D;  3O4Z A;  3QAR A;  4JZY A;  4ANV A;  3ASH A;  3U3W A;  5EX0 A;  3ZHE B;  1UW4 B;  1N6C A;  3OPE A;  2I9C A;  1TJC A;  4XE0 A;  3JCK C;  3AAA C;  3CIA A;  1K1B A;  3DPD A;  2EQX A;  4JXT A;  4F6R D;  4EZL A;  2CHZ A;  2EIN E;  5AIJ A;  4AOF A;  1RW2 A;  3C3R A;  2PQN A;  2H6I A;  3PUJ A;  3ZYL A;  4PH4 B;  3ISM C;  4H12 A;  2L6J A;  5AJD A;  4BY6 A;  3PH0 C;  2F0Y A;  4K5C A;  4PS7 A;  3UT7 A;  3FUN A;  4UWF A;  3S7F A;  4K03 A;  2XZT G;  4L2L A;  3EJN A;  3KSQ A;  1OWN A;  2E2E A;  2V8S E;  3FPD A;  3FUI A;  3E30 A;  4GAA A;  1DCQ A;  4NIK A;  4U8V D;  4I9E A;  3IHV A;  4DJA A;  4BTB A;  2ZU6 B;  3VLE A;  4MI0 A;  4GB9 A;  5FWQ A;  2GGF A;  1S0P A;  4HFG A;  3PDN A;  3Q15 A;  4IRU A;  1FVH A;  4DI4 A;  1JCQ A;  3HG0 D;  3FTZ A;  3ZXS A;  2VGE A;  3OTN A;  1ML9 A;  3JQ1 A;  4XI0 A;  3RIB A;  2PM7 A;  4GML A;  2KXP C;  4Y6C A;  2FBN A;  3NZS A;  3DAL A;  1HG2 A;  4PS8 A;  4EEC A;  2J49 A;  1TEZ A;  3Q73 A;  3CLJ A;  2J8S D;  4AU7 A;  2KBX A;  4EZK A;  4ABN A;  4GYW A;  4ANX A;  5CBN A;  5HRY A;  3RRM B;  2VGY A;  3ABL E;  4PDX A;  1QYM A;  4J8S A;  2IQC A;  3L82 A;  4HRM B;  5BXO A;  2LSU A;  1YCS B;  4JLG A;  3VLF A;  3V2X A;  5JJ0 A;  4J7I A;  1IQU A;  3FUL A;  3ENE A;  4G25 A;  1O9S A;  1MX2 A;  1N95 A;  4BTA A;  4BT8 A;  2YHE A;  3UQ3 A;  3RU0 A;  2IU1 A;  2X6K A;  3AG1 E;  4BSZ B;  3BUA A;  2BKG A;  3GZS A;  4LNG A;  4KMO A;  4GPM A;  1OUV A;  4FMU A;  4GZ6 A;  2Y0B G;  1O1R A;  2W5Y A;  5CBO A;  3N71 A;  4I6E A;  4IUL A;  2R17 C;  3JYS A;  4R7L A;  4I6J A;  5EKQ D;  2MOW A;  3FTU A;  3K9I A;  2HYZ A;  3SGH A;  3M5A A;  3BQO A;  3Q7A A;  3LKU A;  4RQI A;  4LEU A;  4FU3 A;  4TXR A;  3V30 A;  3KAE A;  4U0Z A;  2DBA A;  4XKC A;  3I3N A;  2XGS A;  2GRR B;  2XS1 A;  4YNM A;  1HZ4 A;  4HLE A;  3B7B A;  4KXK B;  1S70 B;  3C3O A;  4I1A A;  4CGW A;  3ML8 A;  3PZ3 A;  1OY3 D;  3EHR A;  4BT9 A;  2J9Q A;  1OCC E;  3JUE A;  1PY1 A;  3FTW A;  1OT8 A;  3APF A;  5AQB A;  3HXB A;  4B89 A;  3D9M A;  2G46 A;  2IOS A;  2ETA A;  3KEA A;  3ULQ A;  3AG4 E;  1KPS B;  5C1D A;  2WQH A;  4CT0 A;  1OCR E;  5ENT D;  4AVX A;  4CYM D;  1OCO E;  3PRZ A;  5G2N A;  5ENR D;  3DEP A;  4HNA D;  3CHQ A;  3MV2 B;  4ANU A;  2QY7 A;  1SQM A;  2W5Z A;  3UM0 A;  4WNF A;  4HB5 A;  2KM4 A;  3ABM E;  3GZ1 A;  3CQG B;  3CK9 A;  5D2M C;  1UJK A;  5KJK A;  3WG7 E;  3SFX A;  5T4Y A;  5FQ7 A;  4GZD A;  3FU5 A;  2IJG X;  3PEV B;  4GTQ A;  5JMN D;  3SW9 A;  1ZKK A;  1E8Y A;  3FH5 A;  4B0Z A;  3TG4 A;  4CZ2 D;  3Q7F A;  5FIN A;  1EDU A;  5LSX A;  2L6B A;  2BUG A;  5A7D B;  5EID A;  1WM5 A;  1SA4 A;  3CST A;  3ABK E;  2CG3 A;  4U8Y D;  1K8K G;  3MX3 A;  4J8D A;  4AEZ C;  1E8Z A;  1H19 A;  1HXI A;  4WAF A;  2FO1 E;  4GZC A;  3DSX A;  5CRV A;  4HRN A;  4DX5 D;  5CED B;  4AY5 A;  4P29 A;  3S2A A; 
#chains in the Genus database with same CATH homology
 4GA2 A;  1H0A A;  4TRQ A;  5M72 A;  2P58 C;  3JUI A;  5FZS A;  4QEN A;  4B94 A;  2NC9 A;  2L0I A;  4APO A;  4HOS A;  2UY1 B;  3AU5 A;  3D9N A;  4F1S A;  1WY6 A;  4CRW A;  3PNT B;  4FJY A;  2OOE A;  3F9Y A;  4I17 A;  3UMV A;  3B13 A;  4AM9 A;  4QEO A;  3I4R B;  1VDY A;  1NZN A;  2JLB A;  5J08 A;  3M53 A;  2XHE A;  5G04 J;  3G2U A;  3PE3 A;  3QB2 A;  1MT6 A;  3RRN B;  2LSV A;  2MHK A;  2OND A;  4FUL A;  3FHE A;  4GZ5 A;  4HS2 A;  3Q49 B;  2Y4T A;  1OWO A;  2NXP A;  1N6A A;  4JW1 A;  3FU3 A;  3MZL B;  4JA9 A;  4YPE A;  3KMT A;  4BX9 A;  4GU5 A;  1JWG A;  4J8F A;  2VYI A;  5CPR B;  3CVL A;  2X6J A;  3SZ7 A;  2AXZ A;  2WXI A;  3FEY A;  4U0U A;  5JHN A;  5TTF A;  4FHJ A;  4FHK A;  3RK6 A;  4HOQ A;  3MO5 A;  4KT6 B;  3CVV A;  4CCA A;  4IJD A;  4N3C A;  2ION A;  2Q7F A;  2XPZ A;  3PNL B;  2KCK A;  4V3I A;  2VSX E;  1XNF A;  5CHE E;  3FUH A;  5JIY A;  2J07 A;  3FUJ A;  2VTB A;  1IYG A;  4I51 A;  4GA1 A;  4C1Q A;  4U0S A;  2WB2 A;  2J09 A;  4F3V A;  3LDZ A;  3NF1 A;  3OS5 A;  3SF4 A;  3SFZ A;  2R3A A;  3R7Q A;  2C0M A;  1BPO A;  3HIZ A;  1JWF A;  1N54 A;  1KLX A;  2FO7 A;  3CVP A;  4FLB A;  4LER A;  3EHN A;  3KEZ A;  5LX8 A;  2CFZ A;  4I1M A;  4MLP A;  4L23 A;  1E7U A;  3L08 A;  4LRZ A;  2CHX A;  5FTP A;  4JL0 A;  4AXH A;  3UUX A;  1MVX A;  1SZ9 A;  3NZU A;  2FI7 A;  2L0T B;  4M3O A;  3T5V A;  5BV0 A;  3LS8 A;  2YHC A;  4CEM A;  1MUF A;  5ARF A;  1L5J A;  2GRM A;  5JJ6 A;  5F59 A;  3QNK A;  2XPY A;  2YIN A;  1HS6 A;  1GW6 A;  3KD7 A;  3KS2 A;  4EZJ A;  3L13 A;  4O6F A;  3VLD A;  3SBS A;  2RFI A;  3CK7 A;  3CQC B;  4G11 A;  4YNP A;  4A1G A;  4FLH A;  2F69 A;  3ZYQ A;  5ANL A;  3ONK A;  5HI7 A;  1E96 B;  3CHO A;  2WPV A;  4I2Z A;  3RKV A;  3ZPJ A;  3SWC A;  3U4T A;  2FUL A;  4FJZ A;  2XCC A;  3C98 A;  3BO5 A;  2UWJ G;  3CVQ A;  4XIF A;  3CVY A;  3OOI A;  4UWL A;  4N3B A;  5T5G A;  4JEH A;  5JHA A;  1U3D A;  4WWN A;  5BUZ A;  5BNW A;  1X5B A;  1ZBP A;  3I5P A;  3TG5 A;  3P1U A;  5T0M A;  2A4Z A;  3EIQ C;  3MV3 B;  1ELK A;  3CVN A;  4Z4P A;  3IV0 A;  4A55 A;  1Z6T A;  3P2B A;  3AS5 A;  2VQ2 A;  2WXJ A;  4TV3 A;  4B8A A;  4UWG A;  3ML9 A;  2OVF A;  5E76 A;  4F53 A;  4G1T A;  4RG6 A;  4UWK A;  2KZT A;  3LCA A;  4KZ0 A;  3U9W A;  2FF4 A;  3LY8 A;  2WXP A;  3B7S A;  2V4L A;  2BTD A;  3APC A;  4UI9 K;  4GPK A;  2J4D A;  4O30 A;  2KAT A;  4NRH B;  2XRZ A;  2R5S A;  5FZR A;  3HHM A;  4Q96 A;  1HH8 A;  2LNI A;  2MRI A;  4JC8 A;  3ASD A;  3OXG A;  1TJF A;  4YPA A;  3M59 A;  5F5E A;  4RZ0 A;  3FUE A;  4KYO B;  4IN3 B;  4XI9 A;  3EDT B;  3IEG A;  1HU3 A;  3ONL A;  4HXI A;  5D0Q D;  4DPR A;  4A1S A;  2PQR A;  5AYW D;  3CHR A;  2OV8 A;  3ZGQ A;  3O4Z A;  3QAR A;  2V0P A;  4JZY A;  4ANV A;  2LO6 A;  3ASH A;  3U3W A;  2WXO A;  4ACL A;  2YQ8 A;  5EX0 A;  5LSZ A;  5FQ8 A;  2XEV A;  3ZHE B;  2BQZ A;  1HX8 A;  1UW4 B;  3D9K A;  4YPU A;  4J8E A;  1HF8 A;  2VSN A;  1N6C A;  1QQE A;  4WWP A;  5AJL A;  3CVW A;  2WVI A;  3OPE A;  3B7T A;  1ELW A;  2HO1 A;  2I9C A;  5BPP A;  2I1J A;  1TJC A;  3MGB A;  2JEK A;  1OWL A;  3QWP A;  1W3B A;  2HM8 A;  1EYH A;  2LAI A;  4XE0 A;  3JCK C;  4JHK A;  2QFC A;  3QJZ A;  3D9I A;  3UX4 A;  5T0K A;  3MCX A;  3CKC A;  3T8M A;  5F6L A;  4UWH A;  3CIA A;  5EX3 A;  4N3A A;  3LY7 A;  2AVP A;  5E75 A;  4PS3 A;  4KBQ A;  3DPD A;  5TEG A;  2EQX A;  3QDN A;  4RVB A;  4JXT A;  4D10 C;  3PE4 A;  4U07 A;  3MKQ B;  4UI9 J;  3M57 A;  3EHM A;  4DK5 A;  4GYY A;  4DLQ A;  2AXV A;  1FVF A;  3QWW A;  1YA0 A;  3FH7 A;  4GMJ A;  5DIZ A;  2CHZ A;  5FJY A;  4EZL A;  3CVU A;  5AIJ A;  3TJP A;  2I6H A;  3ZW3 A;  5G05 J;  4AOF A;  2Y3A A;  4E6H A;  4WUY A;  4U04 A;  5AEN A;  3EIJ A;  2PQN A;  4UQX A;  3MKR A;  3B7U X;  3CHM A;  3FFL A;  2VSY A;  3FWV A;  3PUJ A;  4NVQ A;  1HO8 A;  2CFU A;  3L16 A;  4PH4 B;  3ZYL A;  3KMJ A;  3PRE A;  3QAQ A;  2WXR A;  4Y6W A;  3TXN A;  2AXU A;  3L17 A;  4UQY A;  3RRU A;  4GCN A;  4JEU A;  3VTY A;  4H12 A;  2L6J A;  4BX8 A;  3BG1 B;  4OVV A;  3CR3 A;  3LVQ E;  5AJD A;  4Q69 A;  1XGW A;  2PZI A;  3SHF A;  1DVP A;  3AS4 A;  3PH0 C;  2VGX B;  4PS7 A;  4WWO A;  3UT7 A;  4BY6 A;  3U66 A;  3FUN A;  2J4B A;  3LY9 A;  4Q94 A;  4UWF A;  3S7F A;  3LEW A;  3TAX A;  3TXM A;  2NSZ A;  4K03 A;  4J7F A;  3R9A B;  3T5X A;  2VSO E;  1UN9 A;  3EJN A;  4L2L A;  4PUC A;  1OWN A;  3CEQ A;  2E2E A;  2V8S E;  3FPD A;  3MO0 A;  4NJ5 A;  4GZ3 A;  4GA0 A;  1MHQ A;  3FUI A;  4C0M A;  5TH7 A;  4BFR A;  4URK A;  4GAA A;  5FT9 A;  4AJW A;  2CG2 A;  4NQ0 A;  5FQ6 A;  3FTS A;  4H7X A;  2AW6 A;  3IHV A;  4I9E A;  4ILI A;  1H2T C;  4U63 A;  4UQZ A;  3UPV A;  3FUF A;  4DJA A;  1OWP A;  3URZ A;  4BTB A;  2ZU6 B;  3VLE A;  3CK8 A;  3PVL A;  4MI0 A;  4GB9 A;  3CVX A;  5FWQ A;  2QPW A;  3UT8 A;  3RQ4 A;  4CGV A;  2GGF A;  3FH8 A;  1S0P A;  4HFG A;  2DIW A;  3PDN A;  3MA5 A;  3Q15 A;  4I1O B;  4EQF A;  2CHW A;  3D3M A;  4IRU A;  1FVH A;  4DI4 A;  5G05 C;  3PS6 A;  2PL2 A;  4JPS A;  4ACK A;  2XCB A;  3FTZ A;  5G55 A;  3ZXS A;  4J83 A;  4K0R A;  3OTN A;  2XPI A;  1ML9 A;  4LDG A;  4HOU A;  3JQ1 A;  4XI0 A;  3RIB A;  4ATG A;  2M63 A;  1B89 A;  5G04 C;  2PM7 A;  3MYV A;  4GML A;  4Y6C A;  3TL5 A;  3MEK A;  2FBN A;  3NZS A;  2X3M A;  5CCL A;  1EF1 C;  2WXK A;  3DAL A;  1H2V C;  1HG2 A;  4OYS A;  4PS8 A;  2A5U A;  5A6C A;  3ESK A;  2WXH A;  4EEC A;  2J49 A;  3VV0 A;  3HNA A;  5CMW A;  3K5K A;  4ME2 A;  1TEZ A;  3M56 A;  3CLJ A;  3LPZ A;  3D9P A;  1PAQ A;  3D9O A;  3I4G A;  1NA0 A;  3ZYK A;  4ABN A;  4EZK A;  4AU7 A;  3TGO A;  3HDX A;  4E85 A;  4GYW A;  4TUU A;  2IFU A;  4ANX A;  3FP3 A;  2X6F A;  3LYA A;  3RRM B;  2VGY A;  4OVU A;  5EG2 A;  5FZQ A;  1INZ A;  4PDX A;  3WXX A;  2PM6 A;  3ZVV A;  4J8S A;  1WAO 1;  2IQC A;  4LUN U;  4L2Y A;  4XZ4 A;  3ESL A;  2WXQ A;  2VJ8 A;  3KMA A;  2LSU A;  1E8W A;  4JLG A;  1PC2 A;  2WQ7 A;  3CBO A;  3VLF A;  1QZ2 A;  4ANW A;  5JJ0 A;  5JJT A;  4J7I A;  1IQU A;  1H6K A;  3FUL A;  3ENE A;  4G25 A;  1E7V A;  4BWR A;  1O9S A;  3OXF A;  3ZN3 A;  3OXL A;  2KCL A;  4BTA A;  3ASG A;  2UY1 A;  4BT8 A;  1H3I A;  3ASF A;  2YHE A;  3UQ3 A;  3RU0 A;  4N2S A;  2IU1 A;  4N2Q A;  1MVH A;  2IF4 A;  3AU4 A;  4MRU A;  2X6K A;  2RG8 A;  3PZD A;  3GZS A;  2XQ0 A;  4RG9 A;  3G2V A;  4JHR A;  3CV0 A;  3JQ0 A;  4YVQ C;  4KMO A;  4KZC A;  3RO2 A;  1OUV A;  1HE8 A;  3QK0 A;  3CHS A;  1N3J A;  4J0U A;  3MKQ A;  2FEZ A;  2WM9 A;  4GCO A;  4FMU A;  3ZYM A;  4CT4 A;  3R7R A;  4GZ6 A;  4I6G A;  3ZFW A;  2W5Y A;  5LOZ A;  4CDN A;  3D9L A;  3IBE A;  3N71 A;  2R59 A;  2X38 A;  4I6E A;  4IUL A;  4MI5 A;  2R17 C;  2KC7 A;  1JPL A;  3RJW A;  5EDS A;  5KJN A;  3JYS A;  4R7L A;  4I6J A;  5EKQ D;  2MOW A;  3HYM B;  5T3R A;  2WQ6 A;  4J8O A;  3FTU A;  3K9I A;  3IHX A;  1MQS A;  4BSX A;  2HYZ A;  4WNG A;  3SGH A;  1DNP A;  3F9W A;  4QFV A;  3M5A A;  2Y4U A;  5C2Y A;  3CBM A;  1QNF A;  3RO3 A;  3LKU A;  4NUR A;  3PUK A;  4B8C B;  3GZ2 A;  2IOL A;  3Q47 B;  4JDS A;  4MKT A;  4KVM A;  3VTX A;  4LEU A;  4FU3 A;  2KZT B;  2J08 A;  3KAE A;  4U0Z A;  3S7D A;  2DBA A;  4XKC A;  3I3N A;  4DLO A;  2XGS A;  5D0O D;  5BV1 A;  4YNM A;  1HZ4 A;  5AYF A;  4HLE A;  3G2T A;  3U64 A;  4I2W A;  4KXK B;  4W9R A;  4NAC A;  4MS6 A;  2XGM A;  4F7A A;  2ILR A;  3CGH A;  5ANR A;  2X6H A;  1Z3Y A;  4CGW A;  4I1A A;  4AV7 A;  4WND A;  3ML8 A;  1HFA A;  3CSF A;  3CBP A;  1SZA A;  4WNE A;  4BT9 A;  4JHJ A;  2J9Q A;  3FDH A;  3HVE A;  1PY1 A;  2HR2 A;  3FTW A;  1JUQ A;  5A23 A;  5LCW J;  3FY4 A;  5KCM A;  1ZU2 A;  4IJ8 A;  3APF A;  3M54 A;  4L7T A;  5BT1 A;  1E8X A;  3ZHE A;  4B89 A;  3FUM A;  3D9M A;  1IQR A;  4FP7 A;  2G46 A;  5FQ4 A;  2AWI A;  1NA3 A;  2IOS A;  2IGQ A;  4JA7 A;  3D9J A;  2C0L A;  3ZRH A;  3FTX A;  4CDM A;  3MJW A;  1UN8 A;  1XQH A;  4BUP A;  3B7R L;  3OAW A;  5JHB A;  4HVB A;  3ULQ A;  3UT4 A;  2V5F A;  5BW8 C;  3VUZ A;  1EPU A;  3L54 A;  1FCH A;  2LAH A;  2WXL A;  3SNX A;  4G24 A;  1PEG A;  5C1D A;  2WQH A;  3Q5M A;  5ENN A;  4CT0 A;  2I1K A;  3LJ3 A;  4CDR A;  4G2V A;  5HQ8 A;  2DCP A;  1KT0 A;  1LF8 A;  5CCM A;  1P5Q A;  4KVO A;  2C2L A;  2WXG A;  3LVR E;  3QC1 A;  1NP7 A;  3RAY A;  4XKB A;  4AVX A;  2VGX A;  4FA6 A;  2E0I A;  5LCW C;  3PRZ A;  5JJ7 A;  5G2N A;  1UG3 A;  2RD0 A;  3GYZ A;  2BF0 X;  3CHQ A;  3BG0 B;  3MV2 B;  5DBK A;  4ANU A;  2WXM A;  2QY7 A;  4I9C A;  3MO2 A;  4A3V A;  1SQM A;  2W5Z A;  3F9Z A;  4G23 A;  1E90 A;  4WNF A;  2KM4 A;  5ARG A;  5KJM A;  4HOR A;  3GZ1 A;  2XGO A;  2WMN A;  4E47 A;  5T8I A;  5J90 A;  3CQG B;  3O48 A;  5LP0 A;  1Y6I A;  3CK9 A;  4UI9 C;  1UJK A;  2GRL A;  2WXF A;  2YNQ A;  2WXN A;  4G26 A;  1Z3X A;  3GW4 A;  4C9B B;  2XRY A;  3L22 A;  1N52 A;  4YVO A;  5KJK A;  4J6I A;  1Y8M A;  2X6I A;  3PEU B;  4FC8 A;  1KT1 A;  4GYO A;  4JVS A;  4EBA G;  4HOT A;  2JV0 A;  2VTB B;  3E4B A;  3BEE A;  3DB5 A;  5T4Y A;  5FQ7 A;  4GZD A;  3APD A;  3FU5 A;  1ELR A;  3M55 A;  2IJG X;  3IHY A;  3G2W A;  4AP2 A;  3PEV B;  3AS8 A;  4YND A;  3SW9 A;  3QKY A;  4EPZ A;  4QEP A;  3SI5 A;  2I2O A;  3HVE B;  4I43 A;  4ILG A;  3SBT B;  1ZKK A;  3LXU X;  4RSY A;  4A3T A;  1HG5 A;  4U8H A;  4ILH B;  4AIF A;  1E8Y A;  4XX5 A;  1IHG A;  4C0E A;  3FH5 A;  4B0Z A;  3TG4 A;  4EBA A;  3QOU A;  3QWV A;  4N5C A;  4L1B A;  3FTV A;  3FTY A;  3G2S A;  2O8J A;  2WMO A;  4FAD A;  3F9X A;  3L6A A;  1EDU A;  5LSX A;  3IKO B;  4H7Y A;  3DBS A;  2BUG A;  5A7D B;  1H2U A;  3FEX A;  5LFA A;  4DI3 A;  1WM5 A;  3CKB A;  3Q4A B;  4IYP A;  3EP0 A;  4LCT A;  2OVB A;  3CST A;  3ZIM A;  3M58 A;  2CG3 A;  3MX3 A;  5CMY A;  4J8D A;  4AEZ C;  1E8Z A;  1H19 A;  2GW1 A;  3RJV A;  1UJJ A;  5JIN A;  1HXI A;  1OWM A;  3NQP A;  4WAF A;  3S8P A;  3FUD A;  4GZC A;  3CHP A;  5F6K C;  2L9B A;  4N39 A;  2KCV A;  5KJL A;  3SD5 A;  3ZEF A;  3FU6 A;  3S7B A;  3FUK A;  1A17 A;  4AY6 A;  3FU0 A;  4AY5 A;  3S7J A;  4P29 A;  4APF A;  3S2A A;  1U3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...