3TG4A

Structure of smyd2 in complex with sam
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
427
structure length
427
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 145
structure length 427
sequence length 427
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg4A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg4A01
3MV2B 4N2SA 1B89A 2PZIA 1MVXA 3M53A 3S7DA 3BO5A 3GZ2A 3RKVA 5A6CA 4YVOA 3ASDA 3Q15A 2FO7A 1PEGA 3RJWA 4H7YA 2XGSA 4GA1A 3M5AA 4BT8A 4I2ZA 2LSUA 5TTFA 2LNIA 4H12A 3OXGA 4CGVA 3BEEA 3HNAA 4GCOA 3OXLA 1HXIA 5EG2A 4BT9A 3MO0A 4J7IA 4XI9A 3Q47B 3RO3A 3ULQA 5JJ6A 4G26A 3GZ1A 2UWJG 3MA5A 4JL0A 5LCWC 3DB5A 4I9EA 4N2QA 4UQYA 3CEQA 3ESKA 5LSZA 5C1DA 3AS4A 2Q7FA 3KMJA 4HORA 3MO5A 2BUGA 1H3IA 3CKCA 4U04A 3VV0A 3SF4A 5AYWD 1NZNA 3CVQA 4APOA 2VGXB 5LSXA 4G24A 4E47A 3FFLA 5FZRA 3K5KA 5ARGA 1MUFA 3Q5MA 5JJ7A 3NF1A 4WNDA 3RO2A 2ONDA 4RG6A 4HOSA 3CK9A 5FJYA 1YA0A 5CCMA 5BNWA 4AY6A 4G23A 5D0OD 5JJ0A 3ZPJA 4YPEA 4LDGA 4IJ8A 3PE4A 3CVNA 3TG4A 3SW9A 2FEZA 4BWRA 4HOQA 1ZBPA 1QZ2A 4RZ0A 4IJDA 2YQ8A 2HO1A 3CV0A 4KBQA 5FTPA 2KCLA 5G04J 4QENA 2VYIA 2O8JA 1ELRA 2C2LA 2LSVA 1ZKKA 2WPVA 3FWVA 5JHNA 5A7DB 4LEUA 5JIYA 5DIZA 4U07A 2R5SA 4G25A 3M56A 4GYOA 5BW8C 1TJCA 3QWVA 5M72A 3LKUA 4J0UA 3LYAA 4CGWA 1NA0A 4EQFA 4JA9A 5TH7A 3UQ3A 2HR2A 3GYZA 4AM9A 2VSNA 5CHEE 3EDTB 4HOTA 2MHKA 5FT9A 4YPAA 3OPEA 4WNEA 3PDNA 3S7JA 5F6KC 5TEGA 1Y8MA 4J8OA 4RG9A 3S7BA 3FP3A 3AS8A 4YNMA 5G05J 3M59A 4J83A 4J8DA 2F69A 3ASHA 4G1TA 3OS5A 2UY1A 5D0QD 3LY8A 4U0SA 2FBNA 5KJMA 3F9YA 2DBAA 1NA3A 4WUYA 5CPRB 3MKRA 4GYWA 3CBMA 5T0KA 4NQ0A 1OUVA 4I9CA 5JJTA 3MV3B 4KYOB 2C0LA 1FCHA 4UI9J 3MEKA 1ELWA 5ARFA 1WM5A 4GA0A 1P5QA 3GW4A 2PL2A 1KLXA 1O9SA 3RAYA 4MI5A 3ZFWA 3F9WA 2OOEA 5KJLA 4YNPA 4UQZA 4JLGA 3WXXA 2KCKA 3QOUA 3KMAA 1PC2A 2P58C 3RJVA 4G2VA 4BUPA 4GYYA 4GZ6A 2UY1B 3ZHEA 3K9IA 5EKQD 2PQRA 3N71A 2KATA 3M54A 4AU7A 5F59A 4NJ5A 1KT1A 2KC7A 3CK8A 3VTYA 3JYSA 4H7XA 4O30A 2XGMA 4AY5A 2FI7A 2VGYA 3QKYA 3TGOA 3R9AB 4A1SA 2PQNA 5HI7A 3CBOA 2L6JA 4YPUA 1N3JA 1E96B 1N6AA 2W5YA 4N5CA 5EX0A 4FMUA 4ME2A 5EX3A 2E2EA 3OXFA 2IF4A 3QWPA 3DALA 4Y6CA 3EP0A 2C0MA 1QQEA 4F3VA 5G04C 2FF4A 4N3AA 3ZHEB 3U3WA 3CBPA 3RIBA 3RQ4A 1W3BA 2HYZA 3LPZA 1HZ4A 3LY9A 3UUXA 5CCLA 1WAO1 2XGOA 3CVLA 3VTXA 2KCVA 5FZQA 2IFUA 3E4BA 4Y6WA 4J8FA 1MVHA 4Z4PA 2BQZA 4UQXA 4WNFA 3S7FA 4GCNA 1HH8A 4I2WA 3KS2A 3F9ZA 5LCWJ 3IHXA 4U0UA 2QPWA 2VGXA 4AIFA 3KAEA 4JHRA 4O6FA 2RFIA 1ML9A 3QWWA 4J8EA 3Q4AB 4JA7A 3OOIA 4MI0A 3UPVA 4BTAA 3PE3A 4NVQA 3CK7A 2W5ZA 2IGQA 4J7FA 3LCAA 5BT1A 3KMTA 5G05C 4KXKB 5KJNA 3IEGA 3MO2A 4N39A 4JDSA 1ZU2A 3ZN3A 1XNFA 3ASFA 2YHCA 4N3BA 3TG5A 4QEOA 4CDRA 3U4TA 2AVPA 4UI9K 3F9XA 1N6CA 3O48A 4WNGA 3RU0A 3KD7A 2G46A 3VUZA 4ABNA 3URZA 2NC9A 2V5FA 4YNDA 2R3AA 3ZGQA 3M55A 5FZSA 3HYMB 5HQ8A 5AYFA 3AS5A 4UI9C 4GZ3A 2VSYA 4I1AA 3M57A 4W9RA 5F5EA 4C1QA 5KJKA 3FPDA 4GZ5A 5T5GA 3SZ7A 2VQ2A 2XCBA 4GA2A 5DBKA 3TAXA 2QFCA 3S8PA 4HOUA 2Y4TA 3LY7A 5F6LA 5JINA 4GPKA 4I51A 3CVPA 3CKBA 4QEPA 4U0ZA 4BTBA 1A17A 2Y4UA 2JV0A 4NRHB 2XEVA 2JLBA 3Q49B 1XQHA 3SWCA 3ASGA 1IHGA 1KT0A 1IYGA 2XCCA 4YVQC 3QDNA 1MT6A 2GW1A 2I6HA 2XPIA 3M58A 4XI0A 4B94A 5T0MA 2J9QA 4N3CA 4I17A 2WQHA 4XIFA 4IN3B
chains in the Genus database with same CATH superfamily
2L6BA 2V5QC 2F8YA 3JCKC 3LJ3A 3Q15A 2FO7A 3E32A 1PEGA 4H7YA 2XGSA 3QJZA 4WWOA 3M5AA 4HLLA 1JCQA 3FU0A 3KSLA 2LNIA 1E7UA 2VSXE 2XPYA 1WG0A 3PRZA 3OXLA 4GTOA 4C48B 2DZNA 3C5RA 1Y6IA 2BKGA 2OVBA 3L22A 2BTDA 1IQUA 4UWLA 4HRNA 2UWJG 2B0OE 4K5BA 4I9EA 5CRUA 3X2QE 2FULA 1OWOA 2AWIA 4N2QA 1KPSB 3CEQA 4UWGA 5LSZA 5C1DA 3JQ1A 4B8CB 1IXVA 5BUZA 1MQSA 4DX1A 4URKA 3TWVA 4PS8A 4AEZC 2GRNB 1MX4A 2L9BA 3P1UA 3NB2A 3SF4A 3QK0A 5AYWD 3CVQA 4APOA 2VGXB 4G24A 4E47A 3K5KA 3LS8A 3ZRHA 2CG2A 5ARGA 1MUFA 3Q5MA 3ENEA 2H6HA 2WXRA 2ONDA 4RG6A 4NURA 3D9JA 1YCSB 3FUJA 3MKQA 5CCMA 1N9AA 3I4GA 1RZ4A 5D0OD 5JJ0A 4YDOA 5EYLA 2P2CP 4IYPA 4IJ8A 2WXGA 3CVNA 1OWMA 3TG4A 2F8XK 3KEZA 4BWRA 3S2AA 2VSOE 3CVUA 4IJDA 1YYHA 2NYJA 5G04J 3CQCB 2C2LA 2WPVA 4HVBA 5A7DB 4LEUA 3G2TA 3C3QA 2OCCE 4XEIG 3M56A 2XRZA 1UN8A 3D9OA 5BW8C 2J49A 3PEVB 1V54E 3ASOE 3J5QB 1D8EA 4L2YA 3UQ3A 5J90A 3DEPA 4AM9A 3TWXA 1LTXA 4L23A 4BY6A 4E6HA 2MHKA 2F0YA 4OVVA 4YPAA 4TUMA 2OVFA 3ABKE 5ANLA 4J8OA 4LRZA 4YDYA 2JABA 5JHAA 3FH7A 4ANWA 4AOFA 3M59A 1O5MA 3ZYLA 3HXEA 3ASHA 4G1TA 2UY1A 3LY8A 4F1SA 4CEMA 4KMOA 3ISMC 5AQ7A 5FINA 1NA3A 3L54A 2WXPA 3ZYQA 3CBMA 5T0KA 1NFIE 4DLOA 5CERB 3ZNGA 3DSWA 4GA0A 3GW4A 4I6GA 4OAVB 2OOEA 1BI8B 1TYQG 1EPUA 2MYOA 1OCZE 3UTMA 1G3NB 3PZ1A 2KCKA 3KMAA 2I9CA 2P58C 4GU5A 4GTMA 3FUFA 1A5EA 1PAQA 2KATA 1SA4A 4TUUA 1TJFA 5F59A 4GB9A 3UIPC 3SFYA 5JHBA 2VGYA 3QKYA 4V3IA 2L6JA 4YPUA 1N3JA 3TWWA 4GMRA 4ME2A 4GAAA 4C9BB 1X5BA 1E7VA 2LXMA 2X38A 3TXNA 4Y6CA 2NSZA 1H2TC 3MKQB 2CFZA 4NIKA 1RW2A 4FJZA 1NL4A 2C0MA 4F3VA 4F6RD 2FF4A 4HFGA 3RRUA 3V79K 5BXOA 1UW4B 3LPZA 3UIOC 2RG8A 4YDWA 3UUXA 3NAWA 1OXJA 4YDEA 3FH5A 3CVLA 2KCVA 3MYVA 2IFUA 3E4BA 2EIJE 2GRRB 4WNFA 4U63A 1OWNA 3KS2A 3T5XA 2P9PG 4AIFA 4HI8A 3KAEA 5ENNA 1FT1A 4GZCA 1EF1C 3SO8A 5H7PA 1QNFA 4ACKA 3UPVA 1OCRE 2R03A 3T5VA 2EILE 2W5ZA 2F37A 3QC1A 4LERA 4J7FA 4GTTA 4HI9A 1HG5A 3IEGA 5G55A 3O4ZA 1N94A 3CIAA 1HS6A 2YHCA 4QEOA 3UMVA 3U4TA 1N0RA 4UI9K 2RFMA 3KD7A 2ZXWE 3CVVA 4ABNA 2R3AA 3EHNA 5FIOA 1QBQA 3OAWA 3ZGQA 4CYMD 4BETA 2HM8A 3AS5A 1GW6A 4GZ3A 3UM1A 1IKND 2I1JA 1UG3A 4PS3A 4DK5A 2EIKE 4WWPA 2R05A 4CT4A 4O60A 2XCBA 4GA2A 3LY7A 4QFVA 2OEWA 4GPKA 4QEPA 4U0ZA 2I1KA 5D66A 3DPDA 2JLBA 4JHKA 3CVXA 2HE0A 3FU5A 4YVQC 3QDNA 3JXIA 5CEDB 1N95A 3SD5A 3EIQC 4GTQA 4JB8P 5T0MA 3NQPA 4Q69A 1N4QA 2XS8A 3SNXA 4HXIA 3MV2B 2ZIRA 2PZIA 3M53A 4Z68A 3BO5A 3GZ2A 2ZU6B 3HDXA 3RKVA 4HRLA 4FULA 5AQ9A 5A6CA 1E8ZA 4ZHBA 4I2ZA 3FTUA 1OWLA 4FHJA 4L1BA 3OXGA 3BEEA 4ATZD 3HNAA 1WDYA 4UWFA 4GMLA 5KCMA 1HXIA 5EG2A 4TXQA 4J7IA 5JJ6A 2CFUA 4G26A 2P9NG 4JEUA 4JD2G 3FUKA 3DB5A 5C2YA 4UQYA 3B13A 4X8QA 4Q94A 4KZ0A 3TWSA 4IULA 3IHYA 4HORA 4C0EA 2BUGA 4EECA 3APCA 3CKCA 4PS7A 1KZOA 3VV0A 4GTVA 3AG1E 1NZNA 4UUCA 3SGHA 4MRUA 1E8XA 3GZSA 5FQ8A 4DX2A 4BSXA 4ILIA 5JJ7A 2XZTG 4WNDA 4KZCA 4B0ZA 4FC8A 4RVBA 4BSZB 5FJYA 3DBSA 2X6IA 2KBXA 4FLHA 4AY6A 3SFXA 1S64A 1TR4A 4LDGA 1ZB1A 4U8HA 4PH4B 5J08A 3HXFA 3SW9A 4HOQA 2IO3C 2LAHA 3CGHA 1QZ2A 1WY6A 1FT2A 3CV0A 2DIWA 1K1BA 3J5PA 5AQAA 2DCPA 4QENA 3CQGB 2O8JA 1ELRA 4PDXA 1FPPA 1S70B 2KXPC 5E75A 1S63A 4U07A 2R02A 3AG3E 1NI1A 4BESA 3UINC 5M72A 3LKUA 5EN5D 3U64A 4EQFA 1H2VC 5TH7A 1IHBA 2YNQA 5FQ4A 2IJGX 3Q7AA 4PUCA 4WAFA 3OTNA 3EU9A 3OPEA 2XQ0A 5F6KC 2R2LA 1Y8MA 1FVFA 4RG9A 3IXEA 1UJKA 3ML9A 4AJWA 2Y3AA 4YNMA 5T8IA 3RRMB 3IHVA 2ETCA 3KEAA 4RSYA 3OS5A 4FHKA 4EPZA 1O1TA 3T8MA 2FBNA 5KJMA 4GYWA 3BU8A 3EU5A 3IV0A 1HFAA 3ML8A 4I9CA 3MV3B 1TN7A 3BQOA 4UWHA 1P5QA 4L2LA 3AU5A 3R7QA 4MI5A 3D9LA 2P9LG 4BX9A 3DSTA 3HIZA 3L13A 4MKTA 3L17A 3TWTA 4NACA 4DJAA 5AAOA 1PC2A 4XE0A 5BPPA 4G2VA 1N0QA 2AW6A 5ENOD 3K9IA 1N52A 5EKQD 4B89A 2PQRA 3TJPA 2IOLA 4JVSA 5AJLA 4OVUA 3M54A 3CLJA 1TNBA 4ATGA 1UJJA 1MJ0A 3P2BA 2X6HA 5LX8A 3JYSA 1LD8A 3WG7E 1JCRA 3Q73A 2FI7A 3TGOA 4A1SA 5HI7A 4FLBA 3ZXSA 2X6JA 4AP2A 4N5CA 4J6IA 4HS2A 5EX0A 4FMUA 4JXTA 4I6JA 3LXUX 1AWCB 2P9IG 3NZUA 2IF4A 4LG6A 4HRMB 3G2WA 1HU3A 3DPYA 3ZHEB 4ILHB 1MYOA 3RQ4A 3D9MA 3LY9A 1HO8A 1E90A 1WAO1 4KVOA 4Y6WA 2BQZA 1JCSA 3SBTB 2QPWA 4JHRA 3AU4A 4J7WA 4MS6A 4O1PA 5CBOA 3BG1B 5AENA 2CHXA 3ZKJA 4J8EA 3I5PA 3Q4AB 5CBNA 4MI0A 4DX6D 4F53A 4O1OA 4BTAA 1TNOA 3CK7A 5ENQD 2WXNA 3LCAA 2AXVA 5BT1A 5BV0A 5ANRA 3FUIA 2PNNA 4LNUD 4N3BA 3T9KA 4BFRA 3F9XA 4WNGA 1K8KG 4HQDA 4XX5A 2DZOA 3TXMA 1HE8A 3MZLB 4BEPA 2NC9A 2V5FA 4A63B 1K1AA 3HRAA 3FUDA 4K5CA 2QYUA 1YMPA 2VSYA 2P9SG 4W9RA 5F5EA 3E33A 2XS1A 4GZ5A 4K03A 4AXHA 4APFA 5CRVA 3HG0D 5BV1A 2VQ2A 3TAXA 2QFCA 2Y4TA 3MGBA 4CDNA 3EUVA 5JINA 5ENTD 2IOSA 3CVPA 3SY2A 3EHRA 4FADA 4GTRA 4NRHB 3PUJA 3CHMA 3FTYA 1IHGA 1N4RA 1UOHA 3UM3A 4DI3A 3ULEG 2GW1A 2I6HA 3LDZA 4HNAD 2WM9A 3Q7FA 2IO2C 3V31A 4IN3B 2AXZA 1U3DA 1SZAA 1MVXA 3CHSA 3I3NA 2J8SD 3ASDA 3PNTB 3RJWA 3FTWA 4D10C 4GA1A 4I1OB 3SHFA 5B1BE 2GRPB 4B93B 1OT8A 1SZ9A 4CGVA 4N5QA 1L5JA 1X81A 4GCOA 1TNYA 3TL5A 3UT7A 3VLEA 3E37A 3FUEA 4WWNA 5JA4D 3Q78A 5T3RA 3MO0A 4GTPA 1AP7A 4XI9A 3Q47B 3ULQA 3FTVA 3CHOA 3GZ1A 3CR3A 5LCWC 3PEUB 3FU3A 3FU6A 4HBDA 3AS4A 2Q7FA 5HRYA 3DXKG 3FTZA 3FTXA 3NBNB 2I2OA 3QNKA 5A23A 2J08A 1BD8A 3VLDA 3ZW3A 3L6AA 5LSXA 5AQBA 5FZRA 2WXHA 4AV7A 2WXMA 3UKUG 4HOSA 3CK9A 3DSUA 1YA0A 4G23A 2X6KA 1N11A 2WXOA 2XEEA 1OWPA 2MRIA 4YPEA 5B1AE 3E34A 1SQMA 2FEZA 1ZBPA 3ULYA 2YQ8A 2HO1A 1NP7A 4KBQA 3BG0B 3ABME 4U95D 2IU1A 2VYIA 1O1SA 2LSVA 3RSEG 5LOZA 3RAUA 5JIYA 3PNLB 5D2MC 5DIZA 3TWRA 4GYOA 1TJCA 5FQ6A 4CGWA 4GPMA 4JA9A 1Q2ZA 4HLEA 4CCAA 2HR2A 3GYZA 3FUNA 2VSNA 2WVIA 3C98A 4HOTA 2DVWA 5FT9A 3ABLE 2J07A 3W9FA 2P9KG 2DWZA 3FP3A 4F7AA 3FY4A 1EYHA 5CECB 3KSQA 2F69A 2EQXA 1INZA 5D0QD 2GRMA 2VTBA 2DBAA 5CPRB 3MKRA 4DX5D 2R59A 4F1PA 1OUVA 3PH0C 4UWKA 4BERA 3ZU7B 3MEKA 2FO1E 5ARFA 3PS6A 2Y69E 4L7TA 3V30A 2PL2A 1TNUA 1O9SA 4MLPA 1EDUA 3F9WA 5KJLA 5EIDA 4YNPA 5FQ7A 1MX2A 1N4PA 3PVLA 3RJVA 4LNGA 2L0TB 3FEYA 4BUPA 4JC8A 4U8VD 3UM0A 5B3SE 4OYSA 3ZHEA 2EINE 4KT6B 4B8AA 3ZYMA 3N71A 3PREA 3CSTA 3SFZA 2QC9A 2X3MA 4NJ5A 1KT1A 2X6FA 2KC7A 3Q75A 3CK8A 3VTYA 3ASNE 4G8LA 2A4ZA 4U7EB 4ZFHA 4O30A 4AY5A 2H6IA 2PQNA 3CBOA 2WXQA 3E30A 4EHMA 3FTSA 3U9WA 3ZVVA 2W5YA 4I1MA 5EX3A 2E2EA 3OXFA 2A5EA 2E0IA 5CEAA 3DALA 3MJWA 1IQRA 4DUIA 3Q9NC 4C0MA 1QQEA 2WMNA 2BF0X 3ONLA 3RIBA 1OCOE 4A1GA 1HZ4A 2KM4A 1DNPA 4LSZE 5CCLA 2XGOA 2V4HC 5FWQA 2ZGDA 5FZQA 3EIJA 1MZCA 2GRQB 2V8SE 4LCTA 2RFAA 3CSFA 3UKRG 2WXKA 5LCWJ 2ZGGA 3IHXA 3D9PA 3AJIA 5AJDA 3EJNA 2J4BA 3G2UA 3ZYKA 2QY7A 3W9GA 4EZJA 1Z6TA 3QWWA 2KZTA 3B7RL 4JA7A 5CMWA 5LFAA 3IBEA 3V2XA 3ONKA 3KMTA 4XZ4A 4M7CA 5G05C 3AG2E 2R17C 3MO2A 4JDSA 4TV3A 1ZU2A 3D9IA 4FJYA 4CDRA 2LUHA 2AVPA 2ETAA 1N6CA 3O48A 2G46A 3VUZA 3D9KA 4LUNU 4YNDA 3SI5A 4GZDA 5FZSA 3TWUA 3T8KA 5HQ8A 1Z3YA 5AYFA 2V0PA 4UI9C 2ZISA 4I1AA 3ESLA 3G2SA 5ITZF 4JHJA 3M57A 3UX4A 4ACLA 4C1QA 2VTBB 2YHEA 5KJKA 3FPDA 3CHQA 4AVXA 4ANVA 4RQIA 2DYSE 3JXJA 1V55E 3TWQA 1S0PA 1DVPA 4I51A 3CKBA 5EILA 1HX8A 4BTBA 2GROB 2Y4UA 2XEVA 1Z5SC 3Q49B 3SWCA 4JEHA 2XEHA 4JPSA 2YINA 2V4LA 3FULA 1KT0A 4I6EA 4EBAA 4G8KA 3M58A 4XI0A 4B94A 2OV8A 2J9QA 4E85A 1LF8A 4N3CA 4I17A 4DLQA 2XENA 3AG4E 2WQHA 4XIFA 3RRNB 4N2SA 1B89A 3L08A 3LVQE 2P9UG 3S7DA 5BXUA 3UT8A 3NOCD 2CHZA 3V2OA 4L9PA 2WMOA 4YVOA 3DEOA 1JUQA 2RD0A 3ZIMA 3UI2A 4BT8A 5IY5E 5HKPA 2LSUA 5TTFA 1U3CA 3HVEB 4H12A 4FU3A 2WXJA 3PUKA 2M63A 4BT9A 3FUMA 3BUAA 1MX6A 2IY0C 2IONA 5HS0A 3RO3A 1N54A 3C3RA 4KVMA 4CZ2D 3LJNA 1HF8A 3MA5A 4JL0A 2XZDG 4DX7D 2A5UA 4K0RA 1H19A 3ESKA 3KMJA 4RLYA 3MCXA 3MO5A 4U96D 1H3IA 4U04A 2RKKA 1MHQA 3PZ2A 4QQIA 1JWFA 1H6OA 3FFLA 3QAQA 3HXDA 5JMND 4ANXA 1VDYA 2KZTB 5AIJA 3NF1A 3RO2A 3DSVA 5AARA 1TN8A 3B7BA 3HXBA 1DCQA 2B6CA 2AJAA 5BNWA 3DSSA 1SW6A 1OY3D 3ZPJA 1QYMA 3SQVA 2Y1LE 3L9TA 3PE4A 3FDHA 3D9HA 4RZ0A 3HHMA 5EIBE 4TXRA 5AN8A 5FTPA 2KCLA 1TEZA 3MX3A 3APFA 1SA5A 1BLXB 5LP0A 1ZKKA 5KNHD 3FWVA 5JHNA 1JPLA 2H6FA 5KNGA 2R5SA 4G25A 2QZAA 3QARA 4J8YA 1D9SA 3QWVA 4J0UA 3LYAA 2AXUA 3NZSA 1NA0A 4JW1A 5G2NA 2BKKB 2WXLA 5E76A 1KZPA 5CHEE 3EDTB 1FVHA 4EZKA 3ZXPA 3DRAA 3CVWA 4WNEA 3PDNA 3S7JA 5TEGA 2WQ6A 4CT0A 3FH8A 3S7BA 1U2VG 2CG3A 2GGFA 3AS8A 3FEXA 5T4YA 5G05J 3UT4A 2BEDA 2L0IA 3QB2A 1H2UA 4J83A 3B7UX 4J8DA 4OAUC 1O1RA 4U0SA 3EHQA 2WB2A 1TN6A 3F9YA 4WUYA 4NQ0A 3F6QA 5JJTA 3APDA 4KYOB 2C0LA 1K3ZD 1FCHA 4JZYA 4UI9J 3VLFA 1ELWA 4XKCA 1WM5A 2GRLA 1KLXA 3RAYA 3ZFWA 1Z3XA 3C72A 2DYRE 4UQZA 3L16A 4BX8A 3JQ0A 4JLGA 3WXXA 4DRXE 2NXPA 4LNBA 3ZEFA 3QOUA 2EIME 4GYYA 2XPZA 3DWLG 4GZ6A 2UY1B 2JEKA 5KBAA 4R7LA 5KWDA 3JUIA 4AU7A 4FP7A 3UM2A 3LEWA 4H7XA 2XGMA 4CDMA 3R9AB 5ENSD 1BU9A 1E96B 1N6AA 3B7TA 2VGEA 3AAAC 2QYJA 5EDSA 1E8WA 1DC2A 1D8DA 3QWPA 3PZDA 3UXGA 3EP0A 2VJ8A 3D9NA 3EHMA 2IEJA 5G04C 2IQCA 4N3AA 3U3WA 3CBPA 1W3BA 2HYZA 4G11A 1DCEA 3I4RB 2XRYA 4J8SA 4A55A 4XKBA 4MBGA 3VTXA 4A3VA 3R7RA 5ENPD 4J8FA 3PZ3A 1MVHA 1LD7A 4Z4PA 3DXMG 4UQXA 3S7FA 4GCNA 4IRUA 1HH8A 4I2WA 3F9ZA 4U0UA 2MOWA 2VGXA 1E8YA 4ILGA 5CMYA 4EZLA 3DSXA 4ANUA 1TNZA 4O6FA 2WXFA 2RFIA 1ML9A 3D3MA 3OOIA 3PE3A 4NVQA 3IKOB 4Q96A 2OEVA 2IGQA 2WXIA 4GMJA 2PM7A 1OCCE 4KXKB 4DPRA 5KJNA 3B7SA 4N39A 3ZN3A 1XNFA 3ASFA 2LXLA 4TRQA 3TG5A 1PY1A 3RK6A 4U8YD 2J4DA 3SBSA 3RU0A 2CHWA 3ZUVB 1ELKA 3URZA 5EYPF 3FUHA 1HG2A 4GTSA 3LVRE 2ETBA 1XGWA 3M55A 3HYMB 4M3OA 1H6PA 1UN9A 2PM6A 4FA6A 4P29A 2Y0BG 1JWGA 5T5GA 3C3OA 3SZ7A 4CRWA 1N4SA 5DBKA 3CHRA 3S8PA 4HOUA 5F6LA 3B95A 5ENRD 4HB5A 4EBAG 3CVYA 2LO6A 3JUEA 4I43A 2LAIA 1A17A 3PZ4A 1BPOA 2JV0A 3HVEA 3HXCA 1XQHA 3NOGD 3G2VA 3ASGA 2WQ7A 1H0AA 1IYGA 2J09A 4K5AB 2XCCA 3Q9UC 1BI7B 1MT6A 1SVXA 3FHEA 4DI4A 1H6KA 3Q79A 2XPIA 4TXPA 4A3TA 3U66A 2ILRA 3R9MA 3CHPA 2H6GA 3L82A 2XHEA
chains in the Genus database with same CATH topology
3MV2B 3RRNB 1U3DA 4N2SA 1SZAA 1B89A 3L08A 2PZIA 3LVQE 1MVXA 3M53A 3S7DA 3BO5A 3CHSA 3GZ2A 2ZU6B 3HDXA 3RKVA 3UT8A 4FULA 4HXIA 2CHZA 3JCKC 3LJ3A 2WMOA 3I3NA 5A6CA 4YVOA 3ASDA 3Q15A 3PNTB 1JUQA 1E8ZA 2FO7A 2RD0A 1PEGA 3ZIMA 3RJWA 3FTWA 4D10C 4H7YA 2XGSA 4GA1A 3QJZA 4WWOA 4I1OB 3M5AA 3SHFA 4BT8A 4I2ZA 2LSUA 3FTUA 3FU0A 5TTFA 1OWLA 4FHJA 1SZ9A 2LNIA 1E7UA 1U3CA 4L1BA 3HVEB 4H12A 2VSXE 2XPYA 3OXGA 4CGVA 3BEEA 4FU3A 1L5JA 3HNAA 4GCOA 3PRZA 3OXLA 4UWFA 2WXJA 3TL5A 3UT7A 4GMLA 5KCMA 3VLEA 3PUKA 1HXIA 2M63A 3FUEA 4WWNA 5EG2A 5T3RA 4BT9A 3FUMA 3MO0A 4J7IA 1Y6IA 2IONA 2OVBA 3L22A 4XI9A 2BTDA 3Q47B 3RO3A 1IQUA 3ULQA 1N54A 4UWLA 5JJ6A 2CFUA 4KVMA 3FTVA 3CHOA 1HF8A 4G26A 4JEUA 3GZ1A 2UWJG 3MA5A 3CR3A 4JL0A 3FUKA 5LCWC 3DB5A 4I9EA 5C2YA 2FULA 1OWOA 2AWIA 3PEUB 4N2QA 3FU3A 2A5UA 3FU6A 4K0RA 1H19A 3B13A 4UQYA 3CEQA 3ESKA 4Q94A 4UWGA 4KZ0A 5LSZA 5C1DA 3AS4A 2Q7FA 3JQ1A 3FTZA 3IHYA 4IULA 4B8CB 1MQSA 3MCXA 4C0EA 5BUZA 4URKA 4HORA 3MO5A 2BUGA 4EECA 1H3IA 3APCA 4PS8A 4AEZC 3FTXA 3CKCA 4U04A 4PS7A 2I2OA 2L9BA 1MHQA 3VV0A 3P1UA 3SF4A 3QK0A 3QNKA 5A23A 5AYWD 1JWFA 1NZNA 2J08A 3CVQA 3VLDA 2VGXB 4APOA 3L6AA 3ZW3A 5LSXA 4G24A 4E47A 3SGHA 3FFLA 3QAQA 4MRUA 5FZRA 3K5KA 3LS8A 2WXHA 1E8XA 3ZRHA 4AV7A 2CG2A 5ARGA 2WXMA 3GZSA 3Q5MA 1VDYA 5FQ8A 4ANXA 4BSXA 1MUFA 4ILIA 5JJ7A 3ENEA 2KZTB 5AIJA 3NF1A 2WXRA 4WNDA 3RO2A 2ONDA 4RG6A 4KZCA 4HOSA 3CK9A 4B0ZA 4NURA 3D9JA 4FC8A 4RVBA 5FJYA 3DBSA 3FUJA 1YA0A 3MKQA 5CCMA 2X6IA 4FLHA 5BNWA 4AY6A 4YNMA 4G23A 2X6KA 3I4GA 2WXOA 5D0OD 5JJ0A 1OWPA 2MRIA 3ZPJA 4YPEA 4IYPA 4LDGA 4U8HA 2WXGA 4PH4B 4IJ8A 3PE4A 5J08A 3CVNA 3FDHA 1SQMA 1OWMA 3TG4A 3SW9A 2FEZA 3KEZA 4BWRA 4HOQA 2LAHA 3CGHA 1ZBPA 1QZ2A 2VSOE 1WY6A 3S2AA 3CVUA 4RZ0A 3HHMA 2YQ8A 4IJDA 2HO1A 1NP7A 3CV0A 4KBQA 5FTPA 3BG0B 2DIWA 2KCLA 5G04J 1TEZA 3MX3A 2DCPA 3APFA 2IU1A 4QENA 2VYIA 3CQGB 3CQCB 2O8JA 5LP0A 1ELRA 2C2LA 2LSVA 4PDXA 1ZKKA 2WPVA 5LOZA 4HVBA 3FWVA 5JHNA 5A7DB 1JPLA 4LEUA 3G2TA 5E75A 3PNLB 5JIYA 5DIZA 4U07A 2R5SA 4G25A 2XRZA 3M56A 3QARA 1UN8A 3D9OA 4GYOA 5BW8C 1TJCA 3QWVA 2J49A 5M72A 3LKUA 4J0UA 5FQ6A 3LYAA 4CGWA 3PEVB 3U64A 2AXUA 3NZSA 1NA0A 4JW1A 4EQFA 1H2VC 5G2NA 4JA9A 5TH7A 4HLEA 4CCAA 4L2YA 3UQ3A 2YNQA 2HR2A 2IJGX 5FQ4A 5J90A 3GYZA 4AM9A 4PUCA 2WXLA 3FUNA 5E76A 2VSNA 2WVIA 4L23A 4BY6A 3C98A 4E6HA 5CHEE 3EDTB 4HOTA 2MHKA 5FT9A 4WAFA 1FVHA 4EZKA 4OVVA 3CVWA 4YPAA 2J07A 3OTNA 3OPEA 4WNEA 3PDNA 2OVFA 2XQ0A 3S7JA 5ANLA 5F6KC 5TEGA 1Y8MA 2WQ6A 4CT0A 4J8OA 4LRZA 1FVFA 4RG9A 3FH8A 1UJKA 3ML9A 3FH7A 3S7BA 5JHAA 3FP3A 4AJWA 4ANWA 2Y3AA 4F7AA 2GGFA 2CG3A 1EYHA 3AS8A 3FEXA 3FY4A 5T4YA 5G05J 4AOFA 5T8IA 3UT4A 3RRMB 3IHVA 3ZYLA 2L0IA 3M59A 3QB2A 1H2UA 4J83A 3B7UX 4J8DA 2F69A 3ASHA 2EQXA 4RSYA 4G1TA 1INZA 3OS5A 2UY1A 5D0QD 3LY8A 4U0SA 4F1SA 4FHKA 4EPZA 2WB2A 4CEMA 4KMOA 2GRMA 3T8MA 2FBNA 5KJMA 2VTBA 3F9YA 2DBAA 1NA3A 4WUYA 5CPRB 3L54A 3MKRA 2WXPA 3ZYQA 4GYWA 3CBMA 5T0KA 3IV0A 1HFAA 2R59A 3ML8A 4NQ0A 1OUVA 4I9CA 3PH0C 4UWKA 5JJTA 3MV3B 3APDA 4KYOB 2C0LA 1FCHA 4DLOA 4JZYA 4UI9J 3VLFA 3MEKA 1ELWA 4UWHA 5ARFA 4XKCA 3PS6A 1WM5A 2GRLA 4GA0A 4L7TA 1P5QA 3GW4A 2PL2A 4I6GA 4L2LA 1KLXA 1O9SA 3RAYA 3AU5A 3R7QA 3ZFWA 4MLPA 1EDUA 1Z3XA 3D9LA 4BX9A 4MI5A 3F9WA 3HIZA 3L13A 2OOEA 4MKTA 5KJLA 4YNPA 1EPUA 4UQZA 5FQ7A 3L16A 4BX8A 3JQ0A 4JLGA 3PVLA 3L17A 3WXXA 2NXPA 4NACA 2KCKA 3ZEFA 3QOUA 4DJAA 3KMAA 2I9CA 1PC2A 4XE0A 2P58C 3RJVA 5BPPA 4G2VA 4GU5A 2L0TB 3FEYA 4GYYA 4BUPA 2XPZA 4GZ6A 4JC8A 2AW6A 2UY1B 3FUFA 4OYSA 3ZHEA 4KT6B 4B8AA 2JEKA 3K9IA 1N52A 5EKQD 4B89A 3ZYMA 2PQRA 3TJPA 2IOLA 3N71A 4JVSA 3PREA 4R7LA 5AJLA 1PAQA 2KATA 3KMJA 4OVUA 3CSTA 3CLJA 4TUUA 3SFZA 3JUIA 3M54A 1TJFA 4AU7A 4FP7A 2X3MA 4ATGA 1UJJA 3P2BA 4NJ5A 1KT1A 5F59A 2X6FA 2X6HA 2KC7A 3CK8A 3VTYA 5LX8A 4GB9A 3JYSA 3LEWA 4H7XA 2A4ZA 5JHBA 2XGMA 4O30A 4AY5A 2FI7A 2VGYA 4CDMA 3QKYA 3TGOA 3R9AB 4V3IA 2PQNA 5HI7A 4A1SA 2L6JA 3CBOA 4FLBA 1N3JA 1E96B 2WXQA 4YPUA 3ZXSA 3FTSA 3U9WA 3ZVVA 1N6AA 3B7TA 2X6JA 4AP2A 2W5YA 4N5CA 4J6IA 4HS2A 5EX0A 4I1MA 4FMUA 4ME2A 4JXTA 4GAAA 5EX3A 4C9BB 4I6JA 5EDSA 2E2EA 1X5BA 1E8WA 3LXUX 3OXFA 3NZUA 2E0IA 2IF4A 1E7VA 3QWPA 3DALA 3PZDA 2X38A 3TXNA 3MJWA 4Y6CA 1IQRA 2NSZA 1H2TC 3MKQB 3G2WA 2CFZA 3EP0A 1HU3A 2VJ8A 3D9NA 4C0MA 4FJZA 3EHMA 2C0MA 1QQEA 4F3VA 2WMNA 2IQCA 2FF4A 5G04C 4HFGA 4N3AA 3RRUA 3ZHEB 3U3WA 4ILHB 2BF0X 3ONLA 3CBPA 3RIBA 3RQ4A 1W3BA 2HYZA 1UW4B 3LPZA 3D9MA 4G11A 1HZ4A 2KM4A 4A1GA 3LY9A 2RG8A 1DNPA 3UUXA 3I4RB 2XRYA 1HO8A 4J8SA 5CCLA 1E90A 1WAO1 4A55A 4XKBA 3FH5A 2XGOA 5FWQA 4EZLA 3CVLA 3VTXA 2KCVA 4A3VA 4KVOA 3EIJA 3MYVA 5FZQA 2IFUA 3E4BA 2V8SE 4LCTA 4Y6WA 3CSFA 4J8FA 3R7RA 1MVHA 4Z4PA 2BQZA 4UQXA 4WNFA 4U63A 3S7FA 4GCNA 1OWNA 4IRUA 1HH8A 4I2WA 3KS2A 3F9ZA 3SBTB 3T5XA 2WXKA 5LCWJ 3IHXA 4U0UA 2QPWA 2MOWA 3D9PA 2VGXA 5AJDA 4AIFA 1E8YA 3KAEA 4ILGA 4JHRA 3EJNA 3AU4A 2J4BA 3G2UA 5CMYA 5ENNA 3ZYKA 4ANUA 4O6FA 4MS6A 2WXFA 2QY7A 4GZCA 3BG1B 1EF1C 4EZJA 2RFIA 1ML9A 3D3MA 5AENA 1QNFA 1Z6TA 2CHXA 3QWWA 2KZTA 4J8EA 3I5PA 3B7RL 3Q4AB 4JA7A 5CMWA 3OOIA 4MI0A 4ACKA 3UPVA 4F53A 4BTAA 5LFAA 3IBEA 3PE3A 3T5VA 4NVQA 3IKOB 4Q96A 3CK7A 2W5ZA 2IGQA 3QC1A 4LERA 4J7FA 2WXNA 3LCAA 2AXVA 2WXIA 3ONKA 4GMJA 4XZ4A 1HG5A 2PM7A 5BT1A 5G05C 3KMTA 4KXKB 4DPRA 2R17C 3IEGA 5G55A 3B7SA 5ANRA 3O4ZA 5BV0A 5KJNA 3MO2A 4N39A 4JDSA 4TV3A 1ZU2A 3CIAA 3FUIA 3ZN3A 1XNFA 1HS6A 3ASFA 2YHCA 4TRQA 4N3BA 3TG5A 1PY1A 3RK6A 3UMVA 3D9IA 4FJYA 4CDRA 3U4TA 4BFRA 2J4DA 4QEOA 2AVPA 4UI9K 3F9XA 1N6CA 3SBSA 3O48A 4WNGA 3RU0A 3KD7A 2G46A 3VUZA 4XX5A 3TXMA 3CVVA 1HE8A 2CHWA 3MZLB 3D9KA 1ELKA 4ABNA 4LUNU 3URZA 2NC9A 2V5FA 4YNDA 3FUDA 3FUHA 2R3AA 1HG2A 3LVRE 3EHNA 3SI5A 1XGWA 3OAWA 4GZDA 3ZGQA 3M55A 5FZSA 3HYMB 5HQ8A 1Z3YA 4M3OA 2HM8A 5AYFA 3AS5A 2V0PA 1GW6A 4GZ3A 4UI9C 2VSYA 3ESLA 4I1AA 3G2SA 4JHJA 3M57A 4W9RA 1UN9A 3UX4A 4ACLA 5F5EA 2PM6A 4C1QA 2VTBB 4FA6A 2YHEA 5KJKA 4P29A 2I1JA 3FPDA 1JWGA 3CHQA 4GZ5A 4K03A 4APFA 4AXHA 5T5GA 1UG3A 4PS3A 3SZ7A 4DK5A 4WWPA 4AVXA 4CRWA 4CT4A 5BV1A 2VQ2A 2XCBA 4GA2A 5DBKA 4ANVA 3CHRA 3TAXA 2QFCA 3S8PA 4HOUA 2Y4TA 3LY7A 3MGBA 4QFVA 4CDNA 1S0PA 5F6LA 5JINA 4GPKA 4EBAG 1DVPA 2IOSA 4I51A 3CVPA 3CVYA 2LO6A 3CKBA 1HX8A 4QEPA 4I43A 4U0ZA 2I1KA 4BTBA 2LAIA 1A17A 4FADA 2Y4UA 3DPDA 1BPOA 4NRHB 2XEVA 2JV0A 3HVEA 2JLBA 4JHKA 3CVXA 3Q49B 1XQHA 3SWCA 3G2VA 4JEHA 3ASGA 2WQ7A 1H0AA 3PUJA 3CHMA 4JPSA 2YINA 2V4LA 3FTYA 1IHGA 1KT0A 3FULA 1IYGA 2J09A 3FU5A 2XCCA 4YVQC 4I6EA 3QDNA 4EBAA 3FHEA 4DI4A 1H6KA 4DI3A 1MT6A 2GW1A 2I6HA 2XPIA 3LDZA 3EIQC 3SD5A 4A3TA 3M58A 4XI0A 4B94A 2OV8A 2WM9A 5T0MA 3NQPA 4Q69A 3U66A 2J9QA 2ILRA 4E85A 1LF8A 3CHPA 4N3CA 4I17A 4DLQA 3SNXA 2XHEA 2WQHA 4XIFA 4IN3B 2AXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MV2 B;  4N2S A;  1B89 A;  2PZI A;  1MVX A;  3M53 A;  3S7D A;  3BO5 A;  3GZ2 A;  3RKV A;  5A6C A;  4YVO A;  3ASD A;  3Q15 A;  2FO7 A;  1PEG A;  3RJW A;  4H7Y A;  2XGS A;  4GA1 A;  3M5A A;  4BT8 A;  4I2Z A;  2LSU A;  5TTF A;  2LNI A;  4H12 A;  3OXG A;  4CGV A;  3BEE A;  3HNA A;  4GCO A;  3OXL A;  1HXI A;  5EG2 A;  4BT9 A;  3MO0 A;  4J7I A;  4XI9 A;  3Q47 B;  3RO3 A;  3ULQ A;  5JJ6 A;  4G26 A;  3GZ1 A;  2UWJ G;  3MA5 A;  4JL0 A;  5LCW C;  3DB5 A;  4I9E A;  4N2Q A;  4UQY A;  3CEQ A;  3ESK A;  5LSZ A;  5C1D A;  3AS4 A;  2Q7F A;  3KMJ A;  4HOR A;  3MO5 A;  2BUG A;  1H3I A;  3CKC A;  4U04 A;  3VV0 A;  3SF4 A;  5AYW D;  1NZN A;  3CVQ A;  4APO A;  2VGX B;  5LSX A;  4G24 A;  4E47 A;  3FFL A;  5FZR A;  3K5K A;  5ARG A;  1MUF A;  3Q5M A;  5JJ7 A;  3NF1 A;  4WND A;  3RO2 A;  2OND A;  4RG6 A;  4HOS A;  3CK9 A;  5FJY A;  1YA0 A;  5CCM A;  5BNW A;  4AY6 A;  4G23 A;  5D0O D;  5JJ0 A;  3ZPJ A;  4YPE A;  4LDG A;  4IJ8 A;  3PE4 A;  3CVN A;  3TG4 A;  3SW9 A;  2FEZ A;  4BWR A;  4HOQ A;  1ZBP A;  1QZ2 A;  4RZ0 A;  4IJD A;  2YQ8 A;  2HO1 A;  3CV0 A;  4KBQ A;  5FTP A;  2KCL A;  5G04 J;  4QEN A;  2VYI A;  2O8J A;  1ELR A;  2C2L A;  2LSV A;  1ZKK A;  2WPV A;  3FWV A;  5JHN A;  5A7D B;  4LEU A;  5JIY A;  5DIZ A;  4U07 A;  2R5S A;  4G25 A;  3M56 A;  4GYO A;  5BW8 C;  1TJC A;  3QWV A;  5M72 A;  3LKU A;  4J0U A;  3LYA A;  4CGW A;  1NA0 A;  4EQF A;  4JA9 A;  5TH7 A;  3UQ3 A;  2HR2 A;  3GYZ A;  4AM9 A;  2VSN A;  5CHE E;  3EDT B;  4HOT A;  2MHK A;  5FT9 A;  4YPA A;  3OPE A;  4WNE A;  3PDN A;  3S7J A;  5F6K C;  5TEG A;  1Y8M A;  4J8O A;  4RG9 A;  3S7B A;  3FP3 A;  3AS8 A;  4YNM A;  5G05 J;  3M59 A;  4J83 A;  4J8D A;  2F69 A;  3ASH A;  4G1T A;  3OS5 A;  2UY1 A;  5D0Q D;  3LY8 A;  4U0S A;  2FBN A;  5KJM A;  3F9Y A;  2DBA A;  1NA3 A;  4WUY A;  5CPR B;  3MKR A;  4GYW A;  3CBM A;  5T0K A;  4NQ0 A;  1OUV A;  4I9C A;  5JJT A;  3MV3 B;  4KYO B;  2C0L A;  1FCH A;  4UI9 J;  3MEK A;  1ELW A;  5ARF A;  1WM5 A;  4GA0 A;  1P5Q A;  3GW4 A;  2PL2 A;  1KLX A;  1O9S A;  3RAY A;  4MI5 A;  3ZFW A;  3F9W A;  2OOE A;  5KJL A;  4YNP A;  4UQZ A;  4JLG A;  3WXX A;  2KCK A;  3QOU A;  3KMA A;  1PC2 A;  2P58 C;  3RJV A;  4G2V A;  4BUP A;  4GYY A;  4GZ6 A;  2UY1 B;  3ZHE A;  3K9I A;  5EKQ D;  2PQR A;  3N71 A;  2KAT A;  3M54 A;  4AU7 A;  5F59 A;  4NJ5 A;  1KT1 A;  2KC7 A;  3CK8 A;  3VTY A;  3JYS A;  4H7X A;  4O30 A;  2XGM A;  4AY5 A;  2FI7 A;  2VGY A;  3QKY A;  3TGO A;  3R9A B;  4A1S A;  2PQN A;  5HI7 A;  3CBO A;  2L6J A;  4YPU A;  1N3J A;  1E96 B;  1N6A A;  2W5Y A;  4N5C A;  5EX0 A;  4FMU A;  4ME2 A;  5EX3 A;  2E2E A;  3OXF A;  2IF4 A;  3QWP A;  3DAL A;  4Y6C A;  3EP0 A;  2C0M A;  1QQE A;  4F3V A;  5G04 C;  2FF4 A;  4N3A A;  3ZHE B;  3U3W A;  3CBP A;  3RIB A;  3RQ4 A;  1W3B A;  2HYZ A;  3LPZ A;  1HZ4 A;  3LY9 A;  3UUX A;  5CCL A;  1WAO 1;  2XGO A;  3CVL A;  3VTX A;  2KCV A;  5FZQ A;  2IFU A;  3E4B A;  4Y6W A;  4J8F A;  1MVH A;  4Z4P A;  2BQZ A;  4UQX A;  4WNF A;  3S7F A;  4GCN A;  1HH8 A;  4I2W A;  3KS2 A;  3F9Z A;  5LCW J;  3IHX A;  4U0U A;  2QPW A;  2VGX A;  4AIF A;  3KAE A;  4JHR A;  4O6F A;  2RFI A;  1ML9 A;  3QWW A;  4J8E A;  3Q4A B;  4JA7 A;  3OOI A;  4MI0 A;  3UPV A;  4BTA A;  3PE3 A;  4NVQ A;  3CK7 A;  2W5Z A;  2IGQ A;  4J7F A;  3LCA A;  5BT1 A;  3KMT A;  5G05 C;  4KXK B;  5KJN A;  3IEG A;  3MO2 A;  4N39 A;  4JDS A;  1ZU2 A;  3ZN3 A;  1XNF A;  3ASF A;  2YHC A;  4N3B A;  3TG5 A;  4QEO A;  4CDR A;  3U4T A;  2AVP A;  4UI9 K;  3F9X A;  1N6C A;  3O48 A;  4WNG A;  3RU0 A;  3KD7 A;  2G46 A;  3VUZ A;  4ABN A;  3URZ A;  2NC9 A;  2V5F A;  4YND A;  2R3A A;  3ZGQ A;  3M55 A;  5FZS A;  3HYM B;  5HQ8 A;  5AYF A;  3AS5 A;  4UI9 C;  4GZ3 A;  2VSY A;  4I1A A;  3M57 A;  4W9R A;  5F5E A;  4C1Q A;  5KJK A;  3FPD A;  4GZ5 A;  5T5G A;  3SZ7 A;  2VQ2 A;  2XCB A;  4GA2 A;  5DBK A;  3TAX A;  2QFC A;  3S8P A;  4HOU A;  2Y4T A;  3LY7 A;  5F6L A;  5JIN A;  4GPK A;  4I51 A;  3CVP A;  3CKB A;  4QEP A;  4U0Z A;  4BTB A;  1A17 A;  2Y4U A;  2JV0 A;  4NRH B;  2XEV A;  2JLB A;  3Q49 B;  1XQH A;  3SWC A;  3ASG A;  1IHG A;  1KT0 A;  1IYG A;  2XCC A;  4YVQ C;  3QDN A;  1MT6 A;  2GW1 A;  2I6H A;  2XPI A;  3M58 A;  4XI0 A;  4B94 A;  5T0M A;  2J9Q A;  4N3C A;  4I17 A;  2WQH A;  4XIF A;  4IN3 B; 
#chains in the Genus database with same CATH topology
 2L6B A;  2V5Q C;  2F8Y A;  3JCK C;  3LJ3 A;  3Q15 A;  2FO7 A;  3E32 A;  1PEG A;  4H7Y A;  2XGS A;  3QJZ A;  4WWO A;  3M5A A;  4HLL A;  1JCQ A;  3FU0 A;  3KSL A;  2LNI A;  1E7U A;  2VSX E;  2XPY A;  1WG0 A;  3PRZ A;  3OXL A;  4GTO A;  4C48 B;  2DZN A;  3C5R A;  1Y6I A;  2BKG A;  2OVB A;  3L22 A;  2BTD A;  1IQU A;  4UWL A;  4HRN A;  2UWJ G;  2B0O E;  4K5B A;  4I9E A;  5CRU A;  3X2Q E;  2FUL A;  1OWO A;  2AWI A;  4N2Q A;  1KPS B;  3CEQ A;  4UWG A;  5LSZ A;  5C1D A;  3JQ1 A;  4B8C B;  1IXV A;  5BUZ A;  1MQS A;  4DX1 A;  4URK A;  3TWV A;  4PS8 A;  4AEZ C;  2GRN B;  1MX4 A;  2L9B A;  3P1U A;  3NB2 A;  3SF4 A;  3QK0 A;  5AYW D;  3CVQ A;  4APO A;  2VGX B;  4G24 A;  4E47 A;  3K5K A;  3LS8 A;  3ZRH A;  2CG2 A;  5ARG A;  1MUF A;  3Q5M A;  3ENE A;  2H6H A;  2WXR A;  2OND A;  4RG6 A;  4NUR A;  3D9J A;  1YCS B;  3FUJ A;  3MKQ A;  5CCM A;  1N9A A;  3I4G A;  1RZ4 A;  5D0O D;  5JJ0 A;  4YDO A;  5EYL A;  2P2C P;  4IYP A;  4IJ8 A;  2WXG A;  3CVN A;  1OWM A;  3TG4 A;  2F8X K;  3KEZ A;  4BWR A;  3S2A A;  2VSO E;  3CVU A;  4IJD A;  1YYH A;  2NYJ A;  5G04 J;  3CQC B;  2C2L A;  2WPV A;  4HVB A;  5A7D B;  4LEU A;  3G2T A;  3C3Q A;  2OCC E;  4XEI G;  3M56 A;  2XRZ A;  1UN8 A;  3D9O A;  5BW8 C;  2J49 A;  3PEV B;  1V54 E;  3ASO E;  3J5Q B;  1D8E A;  4L2Y A;  3UQ3 A;  5J90 A;  3DEP A;  4AM9 A;  3TWX A;  1LTX A;  4L23 A;  4BY6 A;  4E6H A;  2MHK A;  2F0Y A;  4OVV A;  4YPA A;  4TUM A;  2OVF A;  3ABK E;  5ANL A;  4J8O A;  4LRZ A;  4YDY A;  2JAB A;  5JHA A;  3FH7 A;  4ANW A;  4AOF A;  3M59 A;  1O5M A;  3ZYL A;  3HXE A;  3ASH A;  4G1T A;  2UY1 A;  3LY8 A;  4F1S A;  4CEM A;  4KMO A;  3ISM C;  5AQ7 A;  5FIN A;  1NA3 A;  3L54 A;  2WXP A;  3ZYQ A;  3CBM A;  5T0K A;  1NFI E;  4DLO A;  5CER B;  3ZNG A;  3DSW A;  4GA0 A;  3GW4 A;  4I6G A;  4OAV B;  2OOE A;  1BI8 B;  1TYQ G;  1EPU A;  2MYO A;  1OCZ E;  3UTM A;  1G3N B;  3PZ1 A;  2KCK A;  3KMA A;  2I9C A;  2P58 C;  4GU5 A;  4GTM A;  3FUF A;  1A5E A;  1PAQ A;  2KAT A;  1SA4 A;  4TUU A;  1TJF A;  5F59 A;  4GB9 A;  3UIP C;  3SFY A;  5JHB A;  2VGY A;  3QKY A;  4V3I A;  2L6J A;  4YPU A;  1N3J A;  3TWW A;  4GMR A;  4ME2 A;  4GAA A;  4C9B B;  1X5B A;  1E7V A;  2LXM A;  2X38 A;  3TXN A;  4Y6C A;  2NSZ A;  1H2T C;  3MKQ B;  2CFZ A;  4NIK A;  1RW2 A;  4FJZ A;  1NL4 A;  2C0M A;  4F3V A;  4F6R D;  2FF4 A;  4HFG A;  3RRU A;  3V79 K;  5BXO A;  1UW4 B;  3LPZ A;  3UIO C;  2RG8 A;  4YDW A;  3UUX A;  3NAW A;  1OXJ A;  4YDE A;  3FH5 A;  3CVL A;  2KCV A;  3MYV A;  2IFU A;  3E4B A;  2EIJ E;  2GRR B;  4WNF A;  4U63 A;  1OWN A;  3KS2 A;  3T5X A;  2P9P G;  4AIF A;  4HI8 A;  3KAE A;  5ENN A;  1FT1 A;  4GZC A;  1EF1 C;  3SO8 A;  5H7P A;  1QNF A;  4ACK A;  3UPV A;  1OCR E;  2R03 A;  3T5V A;  2EIL E;  2W5Z A;  2F37 A;  3QC1 A;  4LER A;  4J7F A;  4GTT A;  4HI9 A;  1HG5 A;  3IEG A;  5G55 A;  3O4Z A;  1N94 A;  3CIA A;  1HS6 A;  2YHC A;  4QEO A;  3UMV A;  3U4T A;  1N0R A;  4UI9 K;  2RFM A;  3KD7 A;  2ZXW E;  3CVV A;  4ABN A;  2R3A A;  3EHN A;  5FIO A;  1QBQ A;  3OAW A;  3ZGQ A;  4CYM D;  4BET A;  2HM8 A;  3AS5 A;  1GW6 A;  4GZ3 A;  3UM1 A;  1IKN D;  2I1J A;  1UG3 A;  4PS3 A;  4DK5 A;  2EIK E;  4WWP A;  2R05 A;  4CT4 A;  4O60 A;  2XCB A;  4GA2 A;  3LY7 A;  4QFV A;  2OEW A;  4GPK A;  4QEP A;  4U0Z A;  2I1K A;  5D66 A;  3DPD A;  2JLB A;  4JHK A;  3CVX A;  2HE0 A;  3FU5 A;  4YVQ C;  3QDN A;  3JXI A;  5CED B;  1N95 A;  3SD5 A;  3EIQ C;  4GTQ A;  4JB8 P;  5T0M A;  3NQP A;  4Q69 A;  1N4Q A;  2XS8 A;  3SNX A;  4HXI A;  3MV2 B;  2ZIR A;  2PZI A;  3M53 A;  4Z68 A;  3BO5 A;  3GZ2 A;  2ZU6 B;  3HDX A;  3RKV A;  4HRL A;  4FUL A;  5AQ9 A;  5A6C A;  1E8Z A;  4ZHB A;  4I2Z A;  3FTU A;  1OWL A;  4FHJ A;  4L1B A;  3OXG A;  3BEE A;  4ATZ D;  3HNA A;  1WDY A;  4UWF A;  4GML A;  5KCM A;  1HXI A;  5EG2 A;  4TXQ A;  4J7I A;  5JJ6 A;  2CFU A;  4G26 A;  2P9N G;  4JEU A;  4JD2 G;  3FUK A;  3DB5 A;  5C2Y A;  4UQY A;  3B13 A;  4X8Q A;  4Q94 A;  4KZ0 A;  3TWS A;  4IUL A;  3IHY A;  4HOR A;  4C0E A;  2BUG A;  4EEC A;  3APC A;  3CKC A;  4PS7 A;  1KZO A;  3VV0 A;  4GTV A;  3AG1 E;  1NZN A;  4UUC A;  3SGH A;  4MRU A;  1E8X A;  3GZS A;  5FQ8 A;  4DX2 A;  4BSX A;  4ILI A;  5JJ7 A;  2XZT G;  4WND A;  4KZC A;  4B0Z A;  4FC8 A;  4RVB A;  4BSZ B;  5FJY A;  3DBS A;  2X6I A;  2KBX A;  4FLH A;  4AY6 A;  3SFX A;  1S64 A;  1TR4 A;  4LDG A;  1ZB1 A;  4U8H A;  4PH4 B;  5J08 A;  3HXF A;  3SW9 A;  4HOQ A;  2IO3 C;  2LAH A;  3CGH A;  1QZ2 A;  1WY6 A;  1FT2 A;  3CV0 A;  2DIW A;  1K1B A;  3J5P A;  5AQA A;  2DCP A;  4QEN A;  3CQG B;  2O8J A;  1ELR A;  4PDX A;  1FPP A;  1S70 B;  2KXP C;  5E75 A;  1S63 A;  4U07 A;  2R02 A;  3AG3 E;  1NI1 A;  4BES A;  3UIN C;  5M72 A;  3LKU A;  5EN5 D;  3U64 A;  4EQF A;  1H2V C;  5TH7 A;  1IHB A;  2YNQ A;  5FQ4 A;  2IJG X;  3Q7A A;  4PUC A;  4WAF A;  3OTN A;  3EU9 A;  3OPE A;  2XQ0 A;  5F6K C;  2R2L A;  1Y8M A;  1FVF A;  4RG9 A;  3IXE A;  1UJK A;  3ML9 A;  4AJW A;  2Y3A A;  4YNM A;  5T8I A;  3RRM B;  3IHV A;  2ETC A;  3KEA A;  4RSY A;  3OS5 A;  4FHK A;  4EPZ A;  1O1T A;  3T8M A;  2FBN A;  5KJM A;  4GYW A;  3BU8 A;  3EU5 A;  3IV0 A;  1HFA A;  3ML8 A;  4I9C A;  3MV3 B;  1TN7 A;  3BQO A;  4UWH A;  1P5Q A;  4L2L A;  3AU5 A;  3R7Q A;  4MI5 A;  3D9L A;  2P9L G;  4BX9 A;  3DST A;  3HIZ A;  3L13 A;  4MKT A;  3L17 A;  3TWT A;  4NAC A;  4DJA A;  5AAO A;  1PC2 A;  4XE0 A;  5BPP A;  4G2V A;  1N0Q A;  2AW6 A;  5ENO D;  3K9I A;  1N52 A;  5EKQ D;  4B89 A;  2PQR A;  3TJP A;  2IOL A;  4JVS A;  5AJL A;  4OVU A;  3M54 A;  3CLJ A;  1TNB A;  4ATG A;  1UJJ A;  1MJ0 A;  3P2B A;  2X6H A;  5LX8 A;  3JYS A;  1LD8 A;  3WG7 E;  1JCR A;  3Q73 A;  2FI7 A;  3TGO A;  4A1S A;  5HI7 A;  4FLB A;  3ZXS A;  2X6J A;  4AP2 A;  4N5C A;  4J6I A;  4HS2 A;  5EX0 A;  4FMU A;  4JXT A;  4I6J A;  3LXU X;  1AWC B;  2P9I G;  3NZU A;  2IF4 A;  4LG6 A;  4HRM B;  3G2W A;  1HU3 A;  3DPY A;  3ZHE B;  4ILH B;  1MYO A;  3RQ4 A;  3D9M A;  3LY9 A;  1HO8 A;  1E90 A;  1WAO 1;  4KVO A;  4Y6W A;  2BQZ A;  1JCS A;  3SBT B;  2QPW A;  4JHR A;  3AU4 A;  4J7W A;  4MS6 A;  4O1P A;  5CBO A;  3BG1 B;  5AEN A;  2CHX A;  3ZKJ A;  4J8E A;  3I5P A;  3Q4A B;  5CBN A;  4MI0 A;  4DX6 D;  4F53 A;  4O1O A;  4BTA A;  1TNO A;  3CK7 A;  5ENQ D;  2WXN A;  3LCA A;  2AXV A;  5BT1 A;  5BV0 A;  5ANR A;  3FUI A;  2PNN A;  4LNU D;  4N3B A;  3T9K A;  4BFR A;  3F9X A;  4WNG A;  1K8K G;  4HQD A;  4XX5 A;  2DZO A;  3TXM A;  1HE8 A;  3MZL B;  4BEP A;  2NC9 A;  2V5F A;  4A63 B;  1K1A A;  3HRA A;  3FUD A;  4K5C A;  2QYU A;  1YMP A;  2VSY A;  2P9S G;  4W9R A;  5F5E A;  3E33 A;  2XS1 A;  4GZ5 A;  4K03 A;  4AXH A;  4APF A;  5CRV A;  3HG0 D;  5BV1 A;  2VQ2 A;  3TAX A;  2QFC A;  2Y4T A;  3MGB A;  4CDN A;  3EUV A;  5JIN A;  5ENT D;  2IOS A;  3CVP A;  3SY2 A;  3EHR A;  4FAD A;  4GTR A;  4NRH B;  3PUJ A;  3CHM A;  3FTY A;  1IHG A;  1N4R A;  1UOH A;  3UM3 A;  4DI3 A;  3ULE G;  2GW1 A;  2I6H A;  3LDZ A;  4HNA D;  2WM9 A;  3Q7F A;  2IO2 C;  3V31 A;  4IN3 B;  2AXZ A;  1U3D A;  1SZA A;  1MVX A;  3CHS A;  3I3N A;  2J8S D;  3ASD A;  3PNT B;  3RJW A;  3FTW A;  4D10 C;  4GA1 A;  4I1O B;  3SHF A;  5B1B E;  2GRP B;  4B93 B;  1OT8 A;  1SZ9 A;  4CGV A;  4N5Q A;  1L5J A;  1X81 A;  4GCO A;  1TNY A;  3TL5 A;  3UT7 A;  3VLE A;  3E37 A;  3FUE A;  4WWN A;  5JA4 D;  3Q78 A;  5T3R A;  3MO0 A;  4GTP A;  1AP7 A;  4XI9 A;  3Q47 B;  3ULQ A;  3FTV A;  3CHO A;  3GZ1 A;  3CR3 A;  5LCW C;  3PEU B;  3FU3 A;  3FU6 A;  4HBD A;  3AS4 A;  2Q7F A;  5HRY A;  3DXK G;  3FTZ A;  3FTX A;  3NBN B;  2I2O A;  3QNK A;  5A23 A;  2J08 A;  1BD8 A;  3VLD A;  3ZW3 A;  3L6A A;  5LSX A;  5AQB A;  5FZR A;  2WXH A;  4AV7 A;  2WXM A;  3UKU G;  4HOS A;  3CK9 A;  3DSU A;  1YA0 A;  4G23 A;  2X6K A;  1N11 A;  2WXO A;  2XEE A;  1OWP A;  2MRI A;  4YPE A;  5B1A E;  3E34 A;  1SQM A;  2FEZ A;  1ZBP A;  3ULY A;  2YQ8 A;  2HO1 A;  1NP7 A;  4KBQ A;  3BG0 B;  3ABM E;  4U95 D;  2IU1 A;  2VYI A;  1O1S A;  2LSV A;  3RSE G;  5LOZ A;  3RAU A;  5JIY A;  3PNL B;  5D2M C;  5DIZ A;  3TWR A;  4GYO A;  1TJC A;  5FQ6 A;  4CGW A;  4GPM A;  4JA9 A;  1Q2Z A;  4HLE A;  4CCA A;  2HR2 A;  3GYZ A;  3FUN A;  2VSN A;  2WVI A;  3C98 A;  4HOT A;  2DVW A;  5FT9 A;  3ABL E;  2J07 A;  3W9F A;  2P9K G;  2DWZ A;  3FP3 A;  4F7A A;  3FY4 A;  1EYH A;  5CEC B;  3KSQ A;  2F69 A;  2EQX A;  1INZ A;  5D0Q D;  2GRM A;  2VTB A;  2DBA A;  5CPR B;  3MKR A;  4DX5 D;  2R59 A;  4F1P A;  1OUV A;  3PH0 C;  4UWK A;  4BER A;  3ZU7 B;  3MEK A;  2FO1 E;  5ARF A;  3PS6 A;  2Y69 E;  4L7T A;  3V30 A;  2PL2 A;  1TNU A;  1O9S A;  4MLP A;  1EDU A;  3F9W A;  5KJL A;  5EID A;  4YNP A;  5FQ7 A;  1MX2 A;  1N4P A;  3PVL A;  3RJV A;  4LNG A;  2L0T B;  3FEY A;  4BUP A;  4JC8 A;  4U8V D;  3UM0 A;  5B3S E;  4OYS A;  3ZHE A;  2EIN E;  4KT6 B;  4B8A A;  3ZYM A;  3N71 A;  3PRE A;  3CST A;  3SFZ A;  2QC9 A;  2X3M A;  4NJ5 A;  1KT1 A;  2X6F A;  2KC7 A;  3Q75 A;  3CK8 A;  3VTY A;  3ASN E;  4G8L A;  2A4Z A;  4U7E B;  4ZFH A;  4O30 A;  4AY5 A;  2H6I A;  2PQN A;  3CBO A;  2WXQ A;  3E30 A;  4EHM A;  3FTS A;  3U9W A;  3ZVV A;  2W5Y A;  4I1M A;  5EX3 A;  2E2E A;  3OXF A;  2A5E A;  2E0I A;  5CEA A;  3DAL A;  3MJW A;  1IQR A;  4DUI A;  3Q9N C;  4C0M A;  1QQE A;  2WMN A;  2BF0 X;  3ONL A;  3RIB A;  1OCO E;  4A1G A;  1HZ4 A;  2KM4 A;  1DNP A;  4LSZ E;  5CCL A;  2XGO A;  2V4H C;  5FWQ A;  2ZGD A;  5FZQ A;  3EIJ A;  1MZC A;  2GRQ B;  2V8S E;  4LCT A;  2RFA A;  3CSF A;  3UKR G;  2WXK A;  5LCW J;  2ZGG A;  3IHX A;  3D9P A;  3AJI A;  5AJD A;  3EJN A;  2J4B A;  3G2U A;  3ZYK A;  2QY7 A;  3W9G A;  4EZJ A;  1Z6T A;  3QWW A;  2KZT A;  3B7R L;  4JA7 A;  5CMW A;  5LFA A;  3IBE A;  3V2X A;  3ONK A;  3KMT A;  4XZ4 A;  4M7C A;  5G05 C;  3AG2 E;  2R17 C;  3MO2 A;  4JDS A;  4TV3 A;  1ZU2 A;  3D9I A;  4FJY A;  4CDR A;  2LUH A;  2AVP A;  2ETA A;  1N6C A;  3O48 A;  2G46 A;  3VUZ A;  3D9K A;  4LUN U;  4YND A;  3SI5 A;  4GZD A;  5FZS A;  3TWU A;  3T8K A;  5HQ8 A;  1Z3Y A;  5AYF A;  2V0P A;  4UI9 C;  2ZIS A;  4I1A A;  3ESL A;  3G2S A;  5ITZ F;  4JHJ A;  3M57 A;  3UX4 A;  4ACL A;  4C1Q A;  2VTB B;  2YHE A;  5KJK A;  3FPD A;  3CHQ A;  4AVX A;  4ANV A;  4RQI A;  2DYS E;  3JXJ A;  1V55 E;  3TWQ A;  1S0P A;  1DVP A;  4I51 A;  3CKB A;  5EIL A;  1HX8 A;  4BTB A;  2GRO B;  2Y4U A;  2XEV A;  1Z5S C;  3Q49 B;  3SWC A;  4JEH A;  2XEH A;  4JPS A;  2YIN A;  2V4L A;  3FUL A;  1KT0 A;  4I6E A;  4EBA A;  4G8K A;  3M58 A;  4XI0 A;  4B94 A;  2OV8 A;  2J9Q A;  4E85 A;  1LF8 A;  4N3C A;  4I17 A;  4DLQ A;  2XEN A;  3AG4 E;  2WQH A;  4XIF A;  3RRN B;  4N2S A;  1B89 A;  3L08 A;  3LVQ E;  2P9U G;  3S7D A;  5BXU A;  3UT8 A;  3NOC D;  2CHZ A;  3V2O A;  4L9P A;  2WMO A;  4YVO A;  3DEO A;  1JUQ A;  2RD0 A;  3ZIM A;  3UI2 A;  4BT8 A;  5IY5 E;  5HKP A;  2LSU A;  5TTF A;  1U3C A;  3HVE B;  4H12 A;  4FU3 A;  2WXJ A;  3PUK A;  2M63 A;  4BT9 A;  3FUM A;  3BUA A;  1MX6 A;  2IY0 C;  2ION A;  5HS0 A;  3RO3 A;  1N54 A;  3C3R A;  4KVM A;  4CZ2 D;  3LJN A;  1HF8 A;  3MA5 A;  4JL0 A;  2XZD G;  4DX7 D;  2A5U A;  4K0R A;  1H19 A;  3ESK A;  3KMJ A;  4RLY A;  3MCX A;  3MO5 A;  4U96 D;  1H3I A;  4U04 A;  2RKK A;  1MHQ A;  3PZ2 A;  4QQI A;  1JWF A;  1H6O A;  3FFL A;  3QAQ A;  3HXD A;  5JMN D;  4ANX A;  1VDY A;  2KZT B;  5AIJ A;  3NF1 A;  3RO2 A;  3DSV A;  5AAR A;  1TN8 A;  3B7B A;  3HXB A;  1DCQ A;  2B6C A;  2AJA A;  5BNW A;  3DSS A;  1SW6 A;  1OY3 D;  3ZPJ A;  1QYM A;  3SQV A;  2Y1L E;  3L9T A;  3PE4 A;  3FDH A;  3D9H A;  4RZ0 A;  3HHM A;  5EIB E;  4TXR A;  5AN8 A;  5FTP A;  2KCL A;  1TEZ A;  3MX3 A;  3APF A;  1SA5 A;  1BLX B;  5LP0 A;  1ZKK A;  5KNH D;  3FWV A;  5JHN A;  1JPL A;  2H6F A;  5KNG A;  2R5S A;  4G25 A;  2QZA A;  3QAR A;  4J8Y A;  1D9S A;  3QWV A;  4J0U A;  3LYA A;  2AXU A;  3NZS A;  1NA0 A;  4JW1 A;  5G2N A;  2BKK B;  2WXL A;  5E76 A;  1KZP A;  5CHE E;  3EDT B;  1FVH A;  4EZK A;  3ZXP A;  3DRA A;  3CVW A;  4WNE A;  3PDN A;  3S7J A;  5TEG A;  2WQ6 A;  4CT0 A;  3FH8 A;  3S7B A;  1U2V G;  2CG3 A;  2GGF A;  3AS8 A;  3FEX A;  5T4Y A;  5G05 J;  3UT4 A;  2BED A;  2L0I A;  3QB2 A;  1H2U A;  4J83 A;  3B7U X;  4J8D A;  4OAU C;  1O1R A;  4U0S A;  3EHQ A;  2WB2 A;  1TN6 A;  3F9Y A;  4WUY A;  4NQ0 A;  3F6Q A;  5JJT A;  3APD A;  4KYO B;  2C0L A;  1K3Z D;  1FCH A;  4JZY A;  4UI9 J;  3VLF A;  1ELW A;  4XKC A;  1WM5 A;  2GRL A;  1KLX A;  3RAY A;  3ZFW A;  1Z3X A;  3C72 A;  2DYR E;  4UQZ A;  3L16 A;  4BX8 A;  3JQ0 A;  4JLG A;  3WXX A;  4DRX E;  2NXP A;  4LNB A;  3ZEF A;  3QOU A;  2EIM E;  4GYY A;  2XPZ A;  3DWL G;  4GZ6 A;  2UY1 B;  2JEK A;  5KBA A;  4R7L A;  5KWD A;  3JUI A;  4AU7 A;  4FP7 A;  3UM2 A;  3LEW A;  4H7X A;  2XGM A;  4CDM A;  3R9A B;  5ENS D;  1BU9 A;  1E96 B;  1N6A A;  3B7T A;  2VGE A;  3AAA C;  2QYJ A;  5EDS A;  1E8W A;  1DC2 A;  1D8D A;  3QWP A;  3PZD A;  3UXG A;  3EP0 A;  2VJ8 A;  3D9N A;  3EHM A;  2IEJ A;  5G04 C;  2IQC A;  4N3A A;  3U3W A;  3CBP A;  1W3B A;  2HYZ A;  4G11 A;  1DCE A;  3I4R B;  2XRY A;  4J8S A;  4A55 A;  4XKB A;  4MBG A;  3VTX A;  4A3V A;  3R7R A;  5ENP D;  4J8F A;  3PZ3 A;  1MVH A;  1LD7 A;  4Z4P A;  3DXM G;  4UQX A;  3S7F A;  4GCN A;  4IRU A;  1HH8 A;  4I2W A;  3F9Z A;  4U0U A;  2MOW A;  2VGX A;  1E8Y A;  4ILG A;  5CMY A;  4EZL A;  3DSX A;  4ANU A;  1TNZ A;  4O6F A;  2WXF A;  2RFI A;  1ML9 A;  3D3M A;  3OOI A;  3PE3 A;  4NVQ A;  3IKO B;  4Q96 A;  2OEV A;  2IGQ A;  2WXI A;  4GMJ A;  2PM7 A;  1OCC E;  4KXK B;  4DPR A;  5KJN A;  3B7S A;  4N39 A;  3ZN3 A;  1XNF A;  3ASF A;  2LXL A;  4TRQ A;  3TG5 A;  1PY1 A;  3RK6 A;  4U8Y D;  2J4D A;  3SBS A;  3RU0 A;  2CHW A;  3ZUV B;  1ELK A;  3URZ A;  5EYP F;  3FUH A;  1HG2 A;  4GTS A;  3LVR E;  2ETB A;  1XGW A;  3M55 A;  3HYM B;  4M3O A;  1H6P A;  1UN9 A;  2PM6 A;  4FA6 A;  4P29 A;  2Y0B G;  1JWG A;  5T5G A;  3C3O A;  3SZ7 A;  4CRW A;  1N4S A;  5DBK A;  3CHR A;  3S8P A;  4HOU A;  5F6L A;  3B95 A;  5ENR D;  4HB5 A;  4EBA G;  3CVY A;  2LO6 A;  3JUE A;  4I43 A;  2LAI A;  1A17 A;  3PZ4 A;  1BPO A;  2JV0 A;  3HVE A;  3HXC A;  1XQH A;  3NOG D;  3G2V A;  3ASG A;  2WQ7 A;  1H0A A;  1IYG A;  2J09 A;  4K5A B;  2XCC A;  3Q9U C;  1BI7 B;  1MT6 A;  1SVX A;  3FHE A;  4DI4 A;  1H6K A;  3Q79 A;  2XPI A;  4TXP A;  4A3T A;  3U66 A;  2ILR A;  3R9M A;  3CHP A;  2H6G A;  3L82 A;  2XHE A; 
#chains in the Genus database with same CATH homology
 3MV2 B;  3RRN B;  1U3D A;  4N2S A;  1SZA A;  1B89 A;  3L08 A;  2PZI A;  3LVQ E;  1MVX A;  3M53 A;  3S7D A;  3BO5 A;  3CHS A;  3GZ2 A;  2ZU6 B;  3HDX A;  3RKV A;  3UT8 A;  4FUL A;  4HXI A;  2CHZ A;  3JCK C;  3LJ3 A;  2WMO A;  3I3N A;  5A6C A;  4YVO A;  3ASD A;  3Q15 A;  3PNT B;  1JUQ A;  1E8Z A;  2FO7 A;  2RD0 A;  1PEG A;  3ZIM A;  3RJW A;  3FTW A;  4D10 C;  4H7Y A;  2XGS A;  4GA1 A;  3QJZ A;  4WWO A;  4I1O B;  3M5A A;  3SHF A;  4BT8 A;  4I2Z A;  2LSU A;  3FTU A;  3FU0 A;  5TTF A;  1OWL A;  4FHJ A;  1SZ9 A;  2LNI A;  1E7U A;  1U3C A;  4L1B A;  3HVE B;  4H12 A;  2VSX E;  2XPY A;  3OXG A;  4CGV A;  3BEE A;  4FU3 A;  1L5J A;  3HNA A;  4GCO A;  3PRZ A;  3OXL A;  4UWF A;  2WXJ A;  3TL5 A;  3UT7 A;  4GML A;  5KCM A;  3VLE A;  3PUK A;  1HXI A;  2M63 A;  3FUE A;  4WWN A;  5EG2 A;  5T3R A;  4BT9 A;  3FUM A;  3MO0 A;  4J7I A;  1Y6I A;  2ION A;  2OVB A;  3L22 A;  4XI9 A;  2BTD A;  3Q47 B;  3RO3 A;  1IQU A;  3ULQ A;  1N54 A;  4UWL A;  5JJ6 A;  2CFU A;  4KVM A;  3FTV A;  3CHO A;  1HF8 A;  4G26 A;  4JEU A;  3GZ1 A;  2UWJ G;  3MA5 A;  3CR3 A;  4JL0 A;  3FUK A;  5LCW C;  3DB5 A;  4I9E A;  5C2Y A;  2FUL A;  1OWO A;  2AWI A;  3PEU B;  4N2Q A;  3FU3 A;  2A5U A;  3FU6 A;  4K0R A;  1H19 A;  3B13 A;  4UQY A;  3CEQ A;  3ESK A;  4Q94 A;  4UWG A;  4KZ0 A;  5LSZ A;  5C1D A;  3AS4 A;  2Q7F A;  3JQ1 A;  3FTZ A;  3IHY A;  4IUL A;  4B8C B;  1MQS A;  3MCX A;  4C0E A;  5BUZ A;  4URK A;  4HOR A;  3MO5 A;  2BUG A;  4EEC A;  1H3I A;  3APC A;  4PS8 A;  4AEZ C;  3FTX A;  3CKC A;  4U04 A;  4PS7 A;  2I2O A;  2L9B A;  1MHQ A;  3VV0 A;  3P1U A;  3SF4 A;  3QK0 A;  3QNK A;  5A23 A;  5AYW D;  1JWF A;  1NZN A;  2J08 A;  3CVQ A;  3VLD A;  2VGX B;  4APO A;  3L6A A;  3ZW3 A;  5LSX A;  4G24 A;  4E47 A;  3SGH A;  3FFL A;  3QAQ A;  4MRU A;  5FZR A;  3K5K A;  3LS8 A;  2WXH A;  1E8X A;  3ZRH A;  4AV7 A;  2CG2 A;  5ARG A;  2WXM A;  3GZS A;  3Q5M A;  1VDY A;  5FQ8 A;  4ANX A;  4BSX A;  1MUF A;  4ILI A;  5JJ7 A;  3ENE A;  2KZT B;  5AIJ A;  3NF1 A;  2WXR A;  4WND A;  3RO2 A;  2OND A;  4RG6 A;  4KZC A;  4HOS A;  3CK9 A;  4B0Z A;  4NUR A;  3D9J A;  4FC8 A;  4RVB A;  5FJY A;  3DBS A;  3FUJ A;  1YA0 A;  3MKQ A;  5CCM A;  2X6I A;  4FLH A;  5BNW A;  4AY6 A;  4YNM A;  4G23 A;  2X6K A;  3I4G A;  2WXO A;  5D0O D;  5JJ0 A;  1OWP A;  2MRI A;  3ZPJ A;  4YPE A;  4IYP A;  4LDG A;  4U8H A;  2WXG A;  4PH4 B;  4IJ8 A;  3PE4 A;  5J08 A;  3CVN A;  3FDH A;  1SQM A;  1OWM A;  3TG4 A;  3SW9 A;  2FEZ A;  3KEZ A;  4BWR A;  4HOQ A;  2LAH A;  3CGH A;  1ZBP A;  1QZ2 A;  2VSO E;  1WY6 A;  3S2A A;  3CVU A;  4RZ0 A;  3HHM A;  2YQ8 A;  4IJD A;  2HO1 A;  1NP7 A;  3CV0 A;  4KBQ A;  5FTP A;  3BG0 B;  2DIW A;  2KCL A;  5G04 J;  1TEZ A;  3MX3 A;  2DCP A;  3APF A;  2IU1 A;  4QEN A;  2VYI A;  3CQG B;  3CQC B;  2O8J A;  5LP0 A;  1ELR A;  2C2L A;  2LSV A;  4PDX A;  1ZKK A;  2WPV A;  5LOZ A;  4HVB A;  3FWV A;  5JHN A;  5A7D B;  1JPL A;  4LEU A;  3G2T A;  5E75 A;  3PNL B;  5JIY A;  5DIZ A;  4U07 A;  2R5S A;  4G25 A;  2XRZ A;  3M56 A;  3QAR A;  1UN8 A;  3D9O A;  4GYO A;  5BW8 C;  1TJC A;  3QWV A;  2J49 A;  5M72 A;  3LKU A;  4J0U A;  5FQ6 A;  3LYA A;  4CGW A;  3PEV B;  3U64 A;  2AXU A;  3NZS A;  1NA0 A;  4JW1 A;  4EQF A;  1H2V C;  5G2N A;  4JA9 A;  5TH7 A;  4HLE A;  4CCA A;  4L2Y A;  3UQ3 A;  2YNQ A;  2HR2 A;  2IJG X;  5FQ4 A;  5J90 A;  3GYZ A;  4AM9 A;  4PUC A;  2WXL A;  3FUN A;  5E76 A;  2VSN A;  2WVI A;  4L23 A;  4BY6 A;  3C98 A;  4E6H A;  5CHE E;  3EDT B;  4HOT A;  2MHK A;  5FT9 A;  4WAF A;  1FVH A;  4EZK A;  4OVV A;  3CVW A;  4YPA A;  2J07 A;  3OTN A;  3OPE A;  4WNE A;  3PDN A;  2OVF A;  2XQ0 A;  3S7J A;  5ANL A;  5F6K C;  5TEG A;  1Y8M A;  2WQ6 A;  4CT0 A;  4J8O A;  4LRZ A;  1FVF A;  4RG9 A;  3FH8 A;  1UJK A;  3ML9 A;  3FH7 A;  3S7B A;  5JHA A;  3FP3 A;  4AJW A;  4ANW A;  2Y3A A;  4F7A A;  2GGF A;  2CG3 A;  1EYH A;  3AS8 A;  3FEX A;  3FY4 A;  5T4Y A;  5G05 J;  4AOF A;  5T8I A;  3UT4 A;  3RRM B;  3IHV A;  3ZYL A;  2L0I A;  3M59 A;  3QB2 A;  1H2U A;  4J83 A;  3B7U X;  4J8D A;  2F69 A;  3ASH A;  2EQX A;  4RSY A;  4G1T A;  1INZ A;  3OS5 A;  2UY1 A;  5D0Q D;  3LY8 A;  4U0S A;  4F1S A;  4FHK A;  4EPZ A;  2WB2 A;  4CEM A;  4KMO A;  2GRM A;  3T8M A;  2FBN A;  5KJM A;  2VTB A;  3F9Y A;  2DBA A;  1NA3 A;  4WUY A;  5CPR B;  3L54 A;  3MKR A;  2WXP A;  3ZYQ A;  4GYW A;  3CBM A;  5T0K A;  3IV0 A;  1HFA A;  2R59 A;  3ML8 A;  4NQ0 A;  1OUV A;  4I9C A;  3PH0 C;  4UWK A;  5JJT A;  3MV3 B;  3APD A;  4KYO B;  2C0L A;  1FCH A;  4DLO A;  4JZY A;  4UI9 J;  3VLF A;  3MEK A;  1ELW A;  4UWH A;  5ARF A;  4XKC A;  3PS6 A;  1WM5 A;  2GRL A;  4GA0 A;  4L7T A;  1P5Q A;  3GW4 A;  2PL2 A;  4I6G A;  4L2L A;  1KLX A;  1O9S A;  3RAY A;  3AU5 A;  3R7Q A;  3ZFW A;  4MLP A;  1EDU A;  1Z3X A;  3D9L A;  4BX9 A;  4MI5 A;  3F9W A;  3HIZ A;  3L13 A;  2OOE A;  4MKT A;  5KJL A;  4YNP A;  1EPU A;  4UQZ A;  5FQ7 A;  3L16 A;  4BX8 A;  3JQ0 A;  4JLG A;  3PVL A;  3L17 A;  3WXX A;  2NXP A;  4NAC A;  2KCK A;  3ZEF A;  3QOU A;  4DJA A;  3KMA A;  2I9C A;  1PC2 A;  4XE0 A;  2P58 C;  3RJV A;  5BPP A;  4G2V A;  4GU5 A;  2L0T B;  3FEY A;  4GYY A;  4BUP A;  2XPZ A;  4GZ6 A;  4JC8 A;  2AW6 A;  2UY1 B;  3FUF A;  4OYS A;  3ZHE A;  4KT6 B;  4B8A A;  2JEK A;  3K9I A;  1N52 A;  5EKQ D;  4B89 A;  3ZYM A;  2PQR A;  3TJP A;  2IOL A;  3N71 A;  4JVS A;  3PRE A;  4R7L A;  5AJL A;  1PAQ A;  2KAT A;  3KMJ A;  4OVU A;  3CST A;  3CLJ A;  4TUU A;  3SFZ A;  3JUI A;  3M54 A;  1TJF A;  4AU7 A;  4FP7 A;  2X3M A;  4ATG A;  1UJJ A;  3P2B A;  4NJ5 A;  1KT1 A;  5F59 A;  2X6F A;  2X6H A;  2KC7 A;  3CK8 A;  3VTY A;  5LX8 A;  4GB9 A;  3JYS A;  3LEW A;  4H7X A;  2A4Z A;  5JHB A;  2XGM A;  4O30 A;  4AY5 A;  2FI7 A;  2VGY A;  4CDM A;  3QKY A;  3TGO A;  3R9A B;  4V3I A;  2PQN A;  5HI7 A;  4A1S A;  2L6J A;  3CBO A;  4FLB A;  1N3J A;  1E96 B;  2WXQ A;  4YPU A;  3ZXS A;  3FTS A;  3U9W A;  3ZVV A;  1N6A A;  3B7T A;  2X6J A;  4AP2 A;  2W5Y A;  4N5C A;  4J6I A;  4HS2 A;  5EX0 A;  4I1M A;  4FMU A;  4ME2 A;  4JXT A;  4GAA A;  5EX3 A;  4C9B B;  4I6J A;  5EDS A;  2E2E A;  1X5B A;  1E8W A;  3LXU X;  3OXF A;  3NZU A;  2E0I A;  2IF4 A;  1E7V A;  3QWP A;  3DAL A;  3PZD A;  2X38 A;  3TXN A;  3MJW A;  4Y6C A;  1IQR A;  2NSZ A;  1H2T C;  3MKQ B;  3G2W A;  2CFZ A;  3EP0 A;  1HU3 A;  2VJ8 A;  3D9N A;  4C0M A;  4FJZ A;  3EHM A;  2C0M A;  1QQE A;  4F3V A;  2WMN A;  2IQC A;  2FF4 A;  5G04 C;  4HFG A;  4N3A A;  3RRU A;  3ZHE B;  3U3W A;  4ILH B;  2BF0 X;  3ONL A;  3CBP A;  3RIB A;  3RQ4 A;  1W3B A;  2HYZ A;  1UW4 B;  3LPZ A;  3D9M A;  4G11 A;  1HZ4 A;  2KM4 A;  4A1G A;  3LY9 A;  2RG8 A;  1DNP A;  3UUX A;  3I4R B;  2XRY A;  1HO8 A;  4J8S A;  5CCL A;  1E90 A;  1WAO 1;  4A55 A;  4XKB A;  3FH5 A;  2XGO A;  5FWQ A;  4EZL A;  3CVL A;  3VTX A;  2KCV A;  4A3V A;  4KVO A;  3EIJ A;  3MYV A;  5FZQ A;  2IFU A;  3E4B A;  2V8S E;  4LCT A;  4Y6W A;  3CSF A;  4J8F A;  3R7R A;  1MVH A;  4Z4P A;  2BQZ A;  4UQX A;  4WNF A;  4U63 A;  3S7F A;  4GCN A;  1OWN A;  4IRU A;  1HH8 A;  4I2W A;  3KS2 A;  3F9Z A;  3SBT B;  3T5X A;  2WXK A;  5LCW J;  3IHX A;  4U0U A;  2QPW A;  2MOW A;  3D9P A;  2VGX A;  5AJD A;  4AIF A;  1E8Y A;  3KAE A;  4ILG A;  4JHR A;  3EJN A;  3AU4 A;  2J4B A;  3G2U A;  5CMY A;  5ENN A;  3ZYK A;  4ANU A;  4O6F A;  4MS6 A;  2WXF A;  2QY7 A;  4GZC A;  3BG1 B;  1EF1 C;  4EZJ A;  2RFI A;  1ML9 A;  3D3M A;  5AEN A;  1QNF A;  1Z6T A;  2CHX A;  3QWW A;  2KZT A;  4J8E A;  3I5P A;  3B7R L;  3Q4A B;  4JA7 A;  5CMW A;  3OOI A;  4MI0 A;  4ACK A;  3UPV A;  4F53 A;  4BTA A;  5LFA A;  3IBE A;  3PE3 A;  3T5V A;  4NVQ A;  3IKO B;  4Q96 A;  3CK7 A;  2W5Z A;  2IGQ A;  3QC1 A;  4LER A;  4J7F A;  2WXN A;  3LCA A;  2AXV A;  2WXI A;  3ONK A;  4GMJ A;  4XZ4 A;  1HG5 A;  2PM7 A;  5BT1 A;  5G05 C;  3KMT A;  4KXK B;  4DPR A;  2R17 C;  3IEG A;  5G55 A;  3B7S A;  5ANR A;  3O4Z A;  5BV0 A;  5KJN A;  3MO2 A;  4N39 A;  4JDS A;  4TV3 A;  1ZU2 A;  3CIA A;  3FUI A;  3ZN3 A;  1XNF A;  1HS6 A;  3ASF A;  2YHC A;  4TRQ A;  4N3B A;  3TG5 A;  1PY1 A;  3RK6 A;  3UMV A;  3D9I A;  4FJY A;  4CDR A;  3U4T A;  4BFR A;  2J4D A;  4QEO A;  2AVP A;  4UI9 K;  3F9X A;  1N6C A;  3SBS A;  3O48 A;  4WNG A;  3RU0 A;  3KD7 A;  2G46 A;  3VUZ A;  4XX5 A;  3TXM A;  3CVV A;  1HE8 A;  2CHW A;  3MZL B;  3D9K A;  1ELK A;  4ABN A;  4LUN U;  3URZ A;  2NC9 A;  2V5F A;  4YND A;  3FUD A;  3FUH A;  2R3A A;  1HG2 A;  3LVR E;  3EHN A;  3SI5 A;  1XGW A;  3OAW A;  4GZD A;  3ZGQ A;  3M55 A;  5FZS A;  3HYM B;  5HQ8 A;  1Z3Y A;  4M3O A;  2HM8 A;  5AYF A;  3AS5 A;  2V0P A;  1GW6 A;  4GZ3 A;  4UI9 C;  2VSY A;  3ESL A;  4I1A A;  3G2S A;  4JHJ A;  3M57 A;  4W9R A;  1UN9 A;  3UX4 A;  4ACL A;  5F5E A;  2PM6 A;  4C1Q A;  2VTB B;  4FA6 A;  2YHE A;  5KJK A;  4P29 A;  2I1J A;  3FPD A;  1JWG A;  3CHQ A;  4GZ5 A;  4K03 A;  4APF A;  4AXH A;  5T5G A;  1UG3 A;  4PS3 A;  3SZ7 A;  4DK5 A;  4WWP A;  4AVX A;  4CRW A;  4CT4 A;  5BV1 A;  2VQ2 A;  2XCB A;  4GA2 A;  5DBK A;  4ANV A;  3CHR A;  3TAX A;  2QFC A;  3S8P A;  4HOU A;  2Y4T A;  3LY7 A;  3MGB A;  4QFV A;  4CDN A;  1S0P A;  5F6L A;  5JIN A;  4GPK A;  4EBA G;  1DVP A;  2IOS A;  4I51 A;  3CVP A;  3CVY A;  2LO6 A;  3CKB A;  1HX8 A;  4QEP A;  4I43 A;  4U0Z A;  2I1K A;  4BTB A;  2LAI A;  1A17 A;  4FAD A;  2Y4U A;  3DPD A;  1BPO A;  4NRH B;  2XEV A;  2JV0 A;  3HVE A;  2JLB A;  4JHK A;  3CVX A;  3Q49 B;  1XQH A;  3SWC A;  3G2V A;  4JEH A;  3ASG A;  2WQ7 A;  1H0A A;  3PUJ A;  3CHM A;  4JPS A;  2YIN A;  2V4L A;  3FTY A;  1IHG A;  1KT0 A;  3FUL A;  1IYG A;  2J09 A;  3FU5 A;  2XCC A;  4YVQ C;  4I6E A;  3QDN A;  4EBA A;  3FHE A;  4DI4 A;  1H6K A;  4DI3 A;  1MT6 A;  2GW1 A;  2I6H A;  2XPI A;  3LDZ A;  3EIQ C;  3SD5 A;  4A3T A;  3M58 A;  4XI0 A;  4B94 A;  2OV8 A;  2WM9 A;  5T0M A;  3NQP A;  4Q69 A;  3U66 A;  2J9Q A;  2ILR A;  4E85 A;  1LF8 A;  3CHP A;  4N3C A;  4I17 A;  4DLQ A;  3SNX A;  2XHE A;  2WQH A;  4XIF A;  4IN3 B;  2AXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...