3TG4A

Structure of smyd2 in complex with sam
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
427
structure length
427
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
total genus 145
structure length 427
sequence length 427
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg4A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg4A01
3QOUA 2JLBA 4YNMA 5DIZA 4MI5A 4BT9A 3LY7A 4H12A 3ASFA 3FWVA 3AS8A 4YPAA 2BQZA 5ARFA 2G46A 4BWRA 3ZPJA 3ASHA 4G24A 4N3CA 4N5CA 1TJCA 4GYYA 3CVNA 2VGXA 4IN3B 2LSVA 3CBOA 1YA0A 3MV3B 5FZRA 4J7IA 1H3IA 3FPDA 4HOQA 2FBNA 1B89A 4G1TA 4NVQA 3RKVA 5F5EA 1MUFA 3OXLA 3BO5A 4UI9K 3OXGA 4JDSA 5AYWD 3M53A 2W5ZA 2XEVA 5CCMA 3AS4A 3GYZA 5FT9A 3FP3A 1XNFA 5TEGA 4GA2A 1IYGA 3S7BA 2ONDA 3SZ7A 2FF4A 3QDNA 1HZ4A 4EQFA 5AYFA 4QEOA 1QQEA 3TG5A 2VYIA 3F9ZA 2W5YA 3IEGA 1MT6A 3VTXA 4GZ5A 5JJ0A 4FMUA 1QZ2A 1ZU2A 4UQZA 4A1SA 5HQ8A 4IJ8A 3ASGA 3LPZA 3Q5MA 2DBAA 3KS2A 4HOTA 4J7FA 5HI7A 3VTYA 2Y4UA 4GYOA 5BT1A 3M55A 4E47A 3RJWA 3O48A 2YHCA 4Y6CA 4AM9A 5KJKA 3MA5A 4GZ6A 2XGSA 3EP0A 3LYAA 2P58C 4NJ5A 4GA1A 4JL0A 4UI9J 1HXIA 2KCLA 3BEEA 5KJNA 2LSUA 4Y6WA 2XCCA 1ELRA 3MEKA 4IJDA 4N39A 4RG9A 3M56A 2BUGA 2XCBA 3PDNA 3LCAA 4G26A 1MVXA 2WPVA 3SWCA 4RG6A 4ME2A 3MKRA 3KMJA 5LSZA 2UY1B 4NRHB 2IF4A 4XI0A 4J83A 3HYMB 3Q4AB 1WAO1 2Y4TA 3RQ4A 5TH7A 3OPEA 2FI7A 3CV0A 2E2EA 3FFLA 1N3JA 4WUYA 2R3AA 2WQHA 2XGMA 4AY5A 2FEZA 3SF4A 2NC9A 3F9YA 4CGWA 5C1DA 5CPRB 3RO3A 4UQXA 4UI9C 1N6AA 4J8OA 2PQNA 2UWJG 3QWPA 4G23A 3CEQA 3DALA 4C1QA 2VSYA 3UUXA 1MVHA 3HNAA 3GZ1A 4YPEA 2C2LA 2FO7A 4J8DA 4KYOB 3S7DA 4GCNA 1ZBPA 4WNDA 2KC7A 2QPWA 4BTAA 5CCLA 3TGOA 1O9SA 5FZSA 3CVQA 4GZ3A 1KLXA 4J0UA 5BW8C 3ZHEB 3KMAA 5G04J 3URZA 3GW4A 3AS5A 4I17A 2R5SA 2F69A 3CK8A 3MO0A 5EKQD 5G05J 4LDGA 1Y8MA 2AVPA 4GA0A 3EDTB 4LEUA 4AY6A 5KJLA 2HO1A 3JYSA 4I9EA 4HOUA 4JHRA 5F59A 5D0QD 2VGYA 3S7FA 3TG4A 4BTBA 4QEPA 3M5AA 3QWVA 5JIYA 3NF1A 4U0SA 3ZHEA 5LSXA 4J8FA 1IHGA 3QKYA 5JJ7A 4QENA 4H7XA 2VSNA 5G04C 3M58A 4I2WA 1XQHA 3F9XA 4JA9A 4O6FA 3VV0A 3LY9A 3CBPA 3OOIA 3LY8A 3KD7A 3Q15A 3LKUA 2I6HA 3IHXA 5FZQA 3M57A 3K9IA 3Q47B 4GCOA 2V5FA 1HH8A 2XPIA 4XI9A 3RO2A 5EG2A 5KJMA 5FJYA 4YVOA 1ZKKA 1ML9A 4BT8A 5F6LA 4N3BA 3E4BA 5T0KA 5EX0A 3U4TA 5BNWA 2C0LA 4U07A 2O8JA 3N71A 3CKCA 4U0ZA 3ZN3A 3S8PA 1OUVA 3MO2A 4GYWA 4I2ZA 3TAXA 5A6CA 3UQ3A 3R9AB 5M72A 3S7JA 1PC2A 2RFIA 3KAEA 4I1AA 3MV2B 4I51A 2VQ2A 4YVQC 1NZNA 3ZFWA 2GW1A 2LNIA 3F9WA 4F3VA 5T5GA 5LCWJ 3ASDA 4H7YA 4J8EA 3OXFA 2PQRA 4YPUA 4W9RA 5JINA 4I9CA 3Q49B 2UY1A 2JV0A 4YNPA 3RAYA 4YNDA 5D0OD 5CHEE 5JJ6A 4WNEA 4APOA 3CKBA 2Q7FA 2C0MA 4N3AA 4U0UA 4RZ0A 1ELWA 4AU7A 5A7DB 3KMTA 3U3WA 2OOEA 3CBMA 4ABNA 4JA7A 3M59A 5EX3A 3CVPA 4G2VA 2MHKA 4AIFA 3RU0A 5F6KC 2HR2A 2KCKA 3DB5A 3VUZA 1E96B 5LCWC 3ESKA 2PL2A 1KT0A 5JHNA 1KT1A 4B94A 2KATA 4G25A 2PZIA 4HORA 4GPKA 3CK9A 4Z4PA 2KCVA 3ZGQA 3M54A 2QFCA 1NA3A 2YQ8A 1PEGA 5FTPA 3PE4A 1A17A 3WXXA 5ARGA 5T0MA 4NQ0A 2L6JA 3UPVA 2IGQA 4CDRA 4HOSA 4JLGA 5JJTA 4N2SA 4CGVA 4UQYA 1FCHA 4KXKB 3OS5A 4XIFA 1WM5A 3K5KA 3CK7A 3MO5A 3SW9A 2HYZA 3QWWA 4KBQA 3PE3A 3ULQA 2XGOA 4O30A 4MI0A 5G05C 3CVLA 3RIBA 2J9QA 5TTFA 4WNFA 4U04A 1NA0A 4WNGA 2IFUA 4BUPA 3RJVA 1W3BA 5DBKA 1N6CA 3GZ2A 1P5QA 4N2QA 2VGXB
chains in the Genus database with same CATH superfamily
1Y6IA 5DIZA 4MI5A 2XPYA 2PNNA 1V54E 2P9KG 2WXOA 3FTVA 3D9PA 3UMVA 2P9PG 3D9LA 4L7TA 4BEPA 2WXNA 4YPAA 2DZOA 2DIWA 4HI8A 1H6KA 3S2AA 3UINC 5FINA 1TJCA 5JMND 1BPOA 3PZ4A 5FZRA 1FT2A 4HOQA 1B89A 2IOSA 3J5QB 3HXFA 2DWZA 4FA6A 3D9HA 3OXGA 3PZ1A 5AYWD 4GMLA 1OCOE 4C0MA 3V2XA 3L22A 3GYZA 4U95D 1E8YA 4JC8A 1SA4A 5FQ4A 1JCRA 3PNTB 4YDYA 3S7BA 3LVRE 1HFAA 4GTPA 2VYIA 4ANWA 4XKBA 5T8IA 1Z5SC 2I2OA 3KSQA 5E76A 4GZ5A 2ETCA 3ZXSA 2WVIA 1QZ2A 3V31A 2I9CA 3U66A 4RVBA 1EDUA 3Q5MA 4NIKA 4TXPA 2IEJA 1PY1A 3AG3E 3R7RA 1L5JA 4HVBA 2ZU6B 4JXTA 3RRUA 3CVWA 2WXLA 3B7TA 2DVWA 3ZYMA 2F8XK 4E47A 1MX4A 1DCQA 3RJWA 3TXMA 1UJKA 1SW6A 3DXMG 3O48A 4DX1A 4Y6CA 5KJKA 3MA5A 5BXUA 4GZ6A 5ENSD 2XRZA 5BXOA 4JL0A 4UI9J 2KCLA 3BEEA 3C72A 4HBDA 2VSXE 2X6FA 3FTWA 3MEKA 3VLEA 4UWLA 2BUGA 4G11A 4DPRA 1MVXA 3FU0A 4ME2A 1N4PA 3Q4AB 5ENTD 1WAO1 3FUNA 3ZVVA 3RRNB 3UM3A 4ATZD 4WUYA 2R3AA 2WQHA 3V2OA 4AY5A 2FEZA 2WXMA 3R9MA 4CGWA 4UI9C 3HHMA 1HG5A 2PQNA 1OCRE 4G23A 2P2CP 1MVHA 2C2LA 4DJAA 5EIBE 2ILRA 3HG0D 3V30A 5B3SE 4ANUA 2H6GA 4B93B 4WNDA 1TNUA 4KVMA 4ACKA 1O9SA 4FU3A 4GZ3A 1KLXA 4J0UA 5JHBA 1WG0A 2QYUA 3ZHEB 3FTUA 4U63A 1YCSB 5G04J 3GW4A 1TN6A 2GGFA 2KZTB 5G05J 3LXUX 2IO2C 4BESA 3D9MA 5EDSA 2HO1A 4J6IA 1O1RA 4U8VD 5ANRA 1EF1C 3UIPC 4C9BB 1HE8A 4JVSA 2P9LG 3ZHEA 4J8FA 2VSOE 3RRMB 3ZEFA 5JJ7A 4AEZC 1OWPA 1G3NB 5G04C 2GRNB 2B0OE 2KZTA 5ENOD 5ENQD 3OOIA 3Q15A 5KWDA 5FZQA 4QQIA 3CHQA 4WWPA 1PAQA 4BY6A 2XPIA 1ZKKA 3ASOE 1MQSA 1ML9A 4XEIG 5EX0A 2C0LA 4I43A 4M3OA 2J4DA 3FEXA 3ML8A 3CKCA 3NOGD 4E6HA 2EILE 1UN9A 3MO2A 5A6CA 5CBOA 2DZNA 3UT4A 1PC2A 3DPDA 4PH4B 1S70B 2KXPC 3L08A 3AG1E 3PUJA 2GW1A 2LNIA 3AJIA 5T5GA 5LCWJ 4H7YA 4BSXA 2ETBA 4IYPA 2BTDA 1BU9A 3PZDA 3ASNE 2UY1A 4YNPA 4YNDA 5CHEE 2RFMA 4CEMA 3APDA 4K5BA 4DI4A 4APOA 3FH7A 1D8DA 3PZ3A 5A7DB 3PH0C 4JA7A 1QYMA 2ZXWE 3L9TA 2ETAA 3D9JA 5F6KC 2L6BA 4J8SA 5CECB 5LCWC 2WXHA 1KT0A 5JHNA 1H2VC 2KATA 4B94A 3ZNGA 4A55A 4HORA 4GPKA 3ZGQA 3CVXA 2LXMA 4CDNA 2QFCA 1NA3A 2YQ8A 3UT8A 1IHBA 5FTPA 3PS6A 3MX3A 4PUCA 4N5QA 3FUKA 2AXZA 3PREA 4HXIA 4CDRA 4JLGA 4GMRA 4CGVA 1WM5A 1LF8A 2AW6A 3QWWA 4L2YA 4KBQA 3ULQA 5CMYA 4O30A 3FTZA 1MX6A 4CZ2D 4DX7D 4HLLA 4OAUC 3Q79A 1TYQG 5ANLA 5JHAA 4R7LA 2I1JA 2IJGX 4BUPA 4APFA 5DBKA 3BO5A 5TH7A 3ISMC 5C2YA 4B8AA 3LY7A 1U2VG 4Q94A 3ULEG 2R02A 3ASFA 4NURA 4WWNA 1DCEA 5CRUA 3AS8A 1KPSB 4CCAA 3SFXA 3QARA 3SFZA 5ARFA 4ACLA 2G46A 4BWRA 2IU1A 1FVHA 3ZPJA 3ASHA 1K1AA 1H6OA 1OXJA 3CVNA 3DPYA 1MX2A 1IKND 4ATGA 4J7IA 3EIQC 5B1BE 4U96D 4B0ZA 4M7CA 5J08A 3DEOA 4CT4A 4UI9K 5HKPA 1O1SA 3AU5A 3M53A 2W5ZA 2VJ8A 4NACA 2MRIA 3AAAC 2CHWA 3ZIMA 3FP3A 2X3MA 4GA2A 3B7SA 4F53A 5EYLA 1RW2A 3SZ7A 1N52A 2FF4A 5D66A 2HM8A 3X2QE 3UM1A 1FVFA 3QDNA 4QEOA 5CMWA 1OCCE 5EIDA 5KBAA 1YMPA 1MT6A 2LXLA 2IQCA 2QZAA 4PS3A 5AQ7A 5KNGA 4L23A 1ZU2A 1S63A 2J4BA 3ASGA 3LPZA 2A4ZA 1UN8A 2XEHA 4EZLA 4BERA 2BKGA 1H2TC 2DYRE 3PZ2A 3KS2A 3UM2A 2V0PA 1WDYA 4FC8A 4J7WA 3NAWA 1O5MA 2Y4UA 5BT1A 1N4RA 2WXIA 3UIOC 4JHKA 2EIJE 3EP0A 4MBGA 2Y3AA 1JCSA 2R59A 4EZJA 4NJ5A 4GA1A 3E34A 5KJNA 2XCCA 3TJPA 3AG4E 2FULA 4RG9A 3M56A 4ZFHA 2XCBA 3LCAA 3SWCA 2CG2A 1EPUA 4RG6A 3ZUVB 2IF4A 4J83A 3HYMB 2AWIA 5LP0A 3RQ4A 1D8EA 1K1BA 1JPLA 2A5UA 3CV0A 1UOHA 2E2EA 3FUJA 1N3JA 4B89A 3CHMA 2XGMA 3ENEA 4XE0A 3TWQA 1N6AA 1OWNA 4GTSA 4F6RD 2UWJG 3TWSA 4A3VA 2KBXA 2V5QC 2OEWA 4ANXA 3C3RA 4YPEA 2FO7A 4U7EB 4GCNA 1ZBPA 4BSZB 2WXJA 2QPWA 2BEDA 4DLOA 1SZAA 3AG2E 4KZ0A 5BW8C 1K8KG 5G2NA 4KMOA 4V3IA 5FQ6A 1HS6A 4P29A 3CGHA 4I17A 4AXHA 3JXJA 5AARA 3P2BA 1OWLA 4GA0A 4LEUA 4AY6A 4L1BA 4JHRA 3DSUA 1DVPA 1V55E 5D0QD 2VGYA 3EHMA 3CIAA 4PS7A 5AQ9A 5J90A 5LSXA 3APCA 3SGHA 4DX6D 5ENNA 3B95A 3G2UA 5BV1A 3M58A 1XQHA 2XZDG 4JA9A 4O6FA 3D9KA 3LY8A 1SVXA 3KD7A 3LKUA 2I6HA 5LX8A 2WMNA 1HU3A 4TXQA 2A5EA 3K9IA 4JPSA 1IXVA 4K0RA 1HH8A 4XI9A 5EG2A 3EHQA 3EHNA 2F8YA 3ZW3A 1N0RA 1TEZA 5F6LA 3DSTA 2GRRB 3BG1B 2CHXA 3U4TA 2FO1E 3ULYA 2O8JA 3ZN3A 3SNXA 2WQ6A 3TAXA 3UQ3A 4FULA 3R9AB 5AQBA 3S7JA 4A3TA 5M72A 2XHEA 1HX8A 2R2LA 3ABME 4I51A 1WY6A 2VQ2A 1NZNA 3ZFWA 3SHFA 2OVBA 3MZLB 1X81A 4F3VA 4OVVA 3OXFA 4QFVA 4FLBA 1TNYA 3IV0A 5JINA 4FHKA 2JV0A 1Z3YA 3IKOB 5JJ6A 5IY5E 4I1OB 3CKBA 3HRAA 4AV7A 4AU7A 4O1OA 3KMTA 5FQ7A 4OAVB 2OOEA 3C3OA 3FY4A 1SA5A 4EHMA 2P9SG 4AIFA 4U8YD 3TWRA 2WXRA 2LUHA 5EN5D 2WB2A 2KM4A 3IHVA 5ITZF 3CHOA 3G2SA 1KT1A 5CRVA 3T8KA 4G25A 3L13A 3CK9A 2KCVA 3CHPA 4HB5A 3M54A 2V4LA 4FJZA 1PEGA 4GTMA 4HLEA 2XS8A 3WXXA 5T0MA 3PEUB 3UPVA 2Y1LE 4HOSA 2P9UG 1FCHA 4YDOA 5ENRD 3FULA 3CK7A 3MO5A 2HYZA 5AJDA 4GB9A 1UW4B 4HRNA 4MI0A 5G05C 2WXFA 5B1AE 3SO8A 3JCKC 3ONLA 4WNFA 3Q75A 2IFUA 3UX4A 2QC9A 1BD8A 4MS6A 4N2QA 3QOUA 2X6IA 2YHEA 2JLBA 4YNMA 4BT9A 2VTBB 4FADA 4H12A 2NYJA 3I5PA 3FWVA 4UWKA 3CLJA 2BKKB 1Z6TA 2BQZA 3JUEA 4F7AA 3HIZA 3I4GA 3EIJA 3C3QA 3QB2A 4MKTA 4G24A 4N3CA 3T8MA 3BUAA 3HVEB 1MJ0A 4J8YA 2ZIRA 4LUNU 4ZHBA 4IN3B 2MYOA 2LSVA 1TNOA 2VTBA 1H3IA 3FPDA 1U3CA 2H6HA 1DC2A 4NVQA 3ZU7B 4PDXA 2PM7A 1MUFA 3OXLA 1Z3XA 4ANVA 4JDSA 2GRQB 2M63A 1NL4A 3CHSA 5AN8A 2XS1A 2XEVA 3AS4A 5FT9A 3HVEA 2YINA 2XRYA 4HI9A 1XNFA 1IYGA 4HQDA 1S64A 3DSWA 3HXBA 4HFGA 3J5PA 4EQFA 5AYFA 3FTXA 3TG5A 2YNQA 2QYJA 5KCMA 4Q69A 3FU3A 5T4YA 3IEGA 4GZDA 1NFIE 2EIKE 1UG3A 2AJAA 4UQZA 5CEAA 4A1SA 3FH5A 5HQ8A 4IJ8A 3ZYLA 3QAQA 3QK0A 1N9AA 2L9BA 1VDYA 3NQPA 4UUCA 4ILIA 1U3DA 4J7FA 5HI7A 5LFAA 3L16A 3ZRHA 2JABA 4HRLA 3M55A 3JXIA 2GRPB 5H7PA 2YHCA 2R03A 1ZB1A 3P1UA 4PS8A 4GMJA 1E7UA 5AJLA 1QNFA 2J09A 2XGSA 1GW6A 2P58C 4O60A 3OAWA 1H6PA 2ZGDA 3G2TA 3F6QA 1HXIA 2P9NG 1HG2A 2IOLA 1ELRA 4O1PA 4YDWA 1MZCA 3JQ0A 4N39A 3I4RB 3PDNA 4G26A 2WPVA 5AQAA 2NXPA 3KMJA 3CR3A 3NB2A 2Y4TA 3W9GA 3SI5A 1N4SA 3OPEA 1JWGA 3FFLA 1N94A 1IQRA 3FH8A 3DXKG 2NC9A 3F9YA 3QNKA 1OWMA 5KNHD 5C1DA 3CVVA 5CPRB 3C5RA 3RO3A 1JCQA 2GRMA 4LNGA 4J8OA 3CEQA 3JQ1A 3DALA 1OWOA 2VSYA 3GZ1A 4XZ4A 3KSLA 3S7DA 1HF8A 1TR4A 2KC7A 5CCLA 4TV3A 5LOZA 5FZSA 4GU5A 4WWOA 4TUMA 1MYOA 3WG7E 2MOWA 3HXCA 1N54A 3URZA 2CFUA 3AS5A 3SD5A 3MO0A 5EKQD 5EILA 1Y8MA 3G2VA 3T5XA 3EDTB 3JYSA 4I9EA 4ILGA 4G8LA 4HOUA 3UKRG 2E0IA 4AJWA 3FUMA 3U64A 4BTBA 4L2LA 3QWVA 5JIYA 3NF1A 4U0SA 2IY0C 3BG0B 4JZYA 2I1KA 3VLDA 3CHRA 3R7QA 2RD0A 5BPPA 3V79K 2WXQA 3GZSA 4QENA 4H7XA 2VSNA 3DRAA 4GTOA 3VV0A 3FHEA 3LY9A 1INZA 1TN8A 2V8SE 3DWLG 3PEVB 3M57A 4GCOA 2GRLA 2V5FA 3MGBA 3CQCB 1MHQA 1Q2ZA 4YVOA 4N3BA 3E4BA 4HNAD 5T0KA 1O1TA 4FLHA 5BNWA 4U07A 1UJJA 5EYPF 3N71A 4CT0A 3D9IA 4URKA 4U0ZA 3S8PA 2NSZA 4I2ZA 2Y0BG 3AU4A 3KAEA 4I1AA 3MV2B 4C0EA 4DX2A 2EIME 3FU5A 2OVFA 3IBEA 2WXPA 3TWUA 2XZTG 2P9IG 3Q9NC 4K03A 3F9WA 1AWCB 1E7VA 2F0YA 4J8EA 4RSYA 1TN7A 2PQRA 3IHYA 3FDHA 4I9CA 2EQXA 3B7UX 3L54A 5D0OD 1LD7A 4WNEA 2EINE 2RG8A 1FPPA 2Q7FA 4N3AA 1JWFA 4U0UA 4OVUA 2F37A 3U3WA 2J08A 3MJWA 3LS8A 3DSXA 3M59A 3CVPA 3FUFA 4G2VA 4I6GA 4FJYA 5FIOA 5FWQA 2J07A 3EU5A 2HR2A 1NP7A 3DB5A 3VUZA 2PL2A 4C48B 3UM0A 4AVXA 4EZKA 4F1SA 4LNUD 2VGEA 4Z4PA 4KVOA 2WQ7A 3NBNB 1FT1A 1TNZA 5BV0A 3EHRA 1A17A 3PE4A 1DNPA 5ARGA 3O4ZA 3TWVA 4LG6A 2IGQA 5JJTA 4DUIA 4LCTA 5HRYA 4K5AB 3UKUG 3OS5A 1SQMA 4JEHA 3UXGA 1S0PA 3HDXA 3UTMA 4D10C 3PE3A 2RKKA 1RZ4A 2J9QA 3PUKA 3Q73A 5TTFA 4U04A 1EYHA 4WNGA 1LD8A 5AAOA 1W3BA 3FUHA 1N6CA 3GZ2A 3U9WA 2VGXB 1SZ9A 3FU6A 4BX9A 1JUQA 1XGWA 3I3NA 3CSTA 3ABLE 3LJ3A 4ILHB 2J8SD 4U8HA 3JUIA 2OV8A 5HS0A 3B7RL 1N95A 3CVUA 4I6JA 5A23A 4JEUA 4EBAA 3QJZA 5T3RA 3KEZA 4N5CA 1BI7B 4GYYA 3BQOA 2VGXA 5ENPD 3E37A 2CHZA 3CBOA 1YA0A 2Y69E 3MV3B 4LNBA 2FBNA 4G1TA 3NZSA 3SFYA 4KT6B 3RKVA 5F5EA 3DSSA 2IONA 4JW1A 3FTYA 5CBNA 3ZXPA 1A5EA 4GZCA 2XPZA 5CCMA 2WXGA 1N0QA 4EECA 4HS2A 5TEGA 5FQ8A 2X6HA 3PNLB 3MKQB 2ONDA 1LTXA 2HE0A 4GTRA 3OTNA 4TXRA 1HZ4A 3HXDA 3MCXA 4GTQA 4DK5A 1QQEA 1YYHA 4TRQA 3F9ZA 2X6KA 2W5YA 1ELKA 1AP7A 3VTXA 3E30A 5JJ0A 3PRZA 4FMUA 3D9NA 3UI2A 3C98A 4A1GA 3MYVA 1BLXB 2PM6A 1OCZE 3MKQA 2DBAA 4HOTA 2L0IA 3VTYA 4GYOA 3TWXA 3CQGB 2AXVA 4EBAG 4MRUA 1H19A 4AM9A 4CDMA 3L17A 3LYAA 2GROB 3T5VA 3SY2A 4LERA 3FUEA 3EU9A 2LSUA 4Y6WA 3SBTB 4IJDA 3ZKJA 4MLPA 5LSZA 3MKRA 2UY1B 4NRHB 4XI0A 2WM9A 4JB8P 1H0AA 4FHJA 1KZPA 4RQIA 2FI7A 4XX5A 1TNBA 4JHJA 3SF4A 1E8WA 2R05A 2X6JA 4UQXA 3ZYKA 3QWPA 4IULA 4C1QA 3UUXA 3HNAA 3Q9UC 2X38A 4J8DA 4KYOB 3LDZA 3CVYA 4BTAA 3TGOA 3CVQA 4X8QA 4I6EA 1NI1A 3BU8A 4Z68A 3UT7A 5JA4D 2H6FA 5CEDB 3G2WA 3DBSA 4DRXE 2QY7A 3KMAA 5BUZA 4OYSA 2R5SA 3KEAA 2F69A 3CK8A 3B13A 3B7BA 2LO6A 4LDGA 5E75A 2AVPA 3CSFA 4YDEA 5KJLA 4LRZA 3EJNA 3L82A 2AXUA 2R17C 2L0TB 3E32A 3LJNA 5F59A 3S7FA 3TG4A 4QEPA 3M5AA 1QBQA 5AIJA 3ONKA 1IHGA 2DCPA 3QKYA 2OEVA 5D2MC 4E85A 3W9FA 3TL5A 3EUVA 2ZGGA 3ESLA 3TXNA 4GAAA 4DI3A 1HO8A 3Q7FA 4I2WA 3ABKE 3F9XA 2OCCE 1OY3D 3TWWA 1IQUA 3CBPA 4K5CA 2LAIA 1N4QA 4DLQA 3IXEA 3IHXA 3HXEA 3E33A 4IRUA 3Q47B 3RO2A 5KJMA 5FJYA 3NOCD 4BT8A 3ML9A 4L9PA 4UWHA 4WAFA 3APFA 4GPMA 3NZUA 3VLFA 1N11A 3SBSA 1OUVA 4GYWA 4I1MA 5AENA 4BX8A 2RFIA 3Q7AA 3FEYA 4YVQC 2J49A 3DEPA 4BFRA 4Q96A 1E90A 3ASDA 3FUDA 1BI8B 4F1PA 4DX5D 2WMOA 4YPUA 4W9RA 2LAHA 3Q49B 1OT8A 2RFAA 2JEKA 3RAYA 4UWGA 4EPZA 1E8ZA 4GTTA 4JD2G 4HRMB 4B8CB 2V4HC 2C0MA 3FTSA 3T9KA 4RZ0A 1ELWA 3TWTA 4GTVA 3CBMA 4ABNA 3RSEG 4CYMD 5EX3A 2MHKA 3RU0A 1H2UA 2H6IA 2KCKA 3D3MA 1K3ZD 1E96B 3ESKA 3RAUA 3SQVA 2PZIA 4A63B 5CERB 3RK6A 4AOFA 2CG3A 1E8XA 4G8KA 4KZCA 3LEWA 2B6CA 3L6AA 3Q78A 3PVLA 4UWFA 4NQ0A 2CFZA 2L6JA 2XENA 2XEEA 3D9OA 3LVQE 4TUUA 4XKCA 4BETA 2ZISA 2XQ0A 4N2SA 4UQYA 4KXKB 3FUIA 4XIFA 3K5KA 3ZYQA 4RLYA 3SW9A 1TJFA 1X5BA 2XGOA 3QC1A 3CVLA 3RIBA 2WXKA 2BF0X 1NA0A 4CRWA 1KZOA 4FP7A 2DYSE 5G55A 4AP2A 3DSVA 1D9SA 2IO3C 3RJVA 4LSZE 1P5QA
chains in the Genus database with same CATH topology
3QOUA 3FU6A 1Y6IA 2X6IA 2YHEA 2JLBA 4YNMA 5DIZA 5C2YA 4BX9A 4MI5A 4BT9A 2VTBB 2XPYA 4FADA 4B8AA 3LY7A 4H12A 1JUQA 1XGWA 4Q94A 3I3NA 2WXOA 3ASFA 3CSTA 4NURA 3LJ3A 4WWNA 3I5PA 4ILHB 3FTVA 3D9PA 3UMVA 3FWVA 4UWKA 3CLJA 3D9LA 1Z6TA 3AS8A 3JUIA 4L7TA 4U8HA 2OV8A 2WXNA 4CCAA 3B7RL 4YPAA 3QARA 2BQZA 3SFZA 5ARFA 4ACLA 2G46A 3CVUA 4BWRA 2IU1A 4I6JA 1FVHA 5A23A 4JEUA 4F7AA 3HIZA 3ZPJA 2DIWA 3I4GA 3ASHA 4EBAA 3EIJA 1H6KA 3QB2A 3QJZA 4MKTA 5T3RA 3KEZA 4G24A 4N3CA 3S2AA 3T8MA 3HVEB 4N5CA 1TJCA 4LUNU 4GYYA 3CVNA 2VGXA 4IN3B 2CHZA 1BPOA 2LSVA 1YA0A 3CBOA 3MV3B 5FZRA 4ATGA 4J7IA 3EIQC 2VTBA 1H3IA 3FPDA 4HOQA 2FBNA 1U3CA 1B89A 2IOSA 4G1TA 4B0ZA 4NVQA 3NZSA 4KT6B 4PDXA 4FA6A 5J08A 3RKVA 2PM7A 5F5EA 1MUFA 3OXLA 1Z3XA 4CT4A 4ANVA 3BO5A 4UI9K 3OXGA 4JDSA 2IONA 4JW1A 2M63A 3AU5A 3FTYA 3CHSA 5AYWD 4GMLA 3M53A 4GZCA 4C0MA 2XPZA 2W5ZA 2VJ8A 2XEVA 4NACA 5CCMA 2MRIA 2WXGA 3L22A 3AS4A 3GYZA 5FT9A 4EECA 2CHWA 3HVEA 3ZIMA 2YINA 2XRYA 3FP3A 2X3MA 1E8YA 4JC8A 4HS2A 1XNFA 5TEGA 4GA2A 3B7SA 5FQ8A 4F53A 5FQ4A 2X6HA 3PNLB 3MKQB 3PNTB 3S7BA 1IYGA 2ONDA 3SZ7A 1N52A 3LVRE 2FF4A 3OTNA 2HM8A 1FVFA 3QDNA 4HFGA 1HZ4A 1HFAA 3MCXA 4DK5A 4EQFA 5AYFA 4QEOA 1QQEA 3FTXA 3TG5A 5CMWA 2YNQA 2VYIA 4TRQA 4ANWA 4XKBA 5KCMA 4Q69A 5T8IA 2I2OA 3FU3A 3F9ZA 5T4YA 2X6KA 2W5YA 3IEGA 1ELKA 4GZDA 1MT6A 3VTXA 2IQCA 5E76A 4GZ5A 5JJ0A 3PRZA 3ZXSA 2WVIA 4FMUA 3D9NA 4PS3A 1UG3A 1QZ2A 4L23A 1ZU2A 4UQZA 2J4BA 4A1SA 3FH5A 2I9CA 5HQ8A 3U66A 4IJ8A 3C98A 3ASGA 3LPZA 4A1GA 3MYVA 3QAQA 4RVBA 1EDUA 2A4ZA 3Q5MA 3QK0A 3ZYLA 2PM6A 1PY1A 3MKQA 2DBAA 1UN8A 2L9BA 4EZLA 3R7RA 1L5JA 4HVBA 2ZU6B 1VDYA 1H2TC 3NQPA 4JXTA 4ILIA 1U3DA 3RRUA 3CVWA 2WXLA 3KS2A 2V0PA 2L0IA 4FC8A 3B7TA 5HI7A 5LFAA 3L16A 4HOTA 3ZYMA 4J7FA 3VTYA 2Y4UA 3ZRHA 4GYOA 5BT1A 3M55A 3CQGB 2AXVA 3RJWA 4E47A 3TXMA 1UJKA 3O48A 4EBAG 2YHCA 4MRUA 1H19A 4Y6CA 2WXIA 3P1UA 4PS8A 4JHKA 4AM9A 4CDMA 5KJKA 4GMJA 3MA5A 1E7UA 5AJLA 4GZ6A 1QNFA 2J09A 2XGSA 3EP0A 2Y3AA 3L17A 3LYAA 1GW6A 2R59A 4EZJA 2P58C 4NJ5A 3OAWA 2XRZA 3T5VA 4GA1A 3G2TA 4LERA 4JL0A 3FUEA 4UI9J 1HXIA 2KCLA 3BEEA 5KJNA 1HG2A 2IOLA 2VSXE 2LSUA 4Y6WA 3SBTB 2XCCA 2X6FA 1ELRA 3FTWA 3MEKA 3VLEA 4IJDA 3TJPA 3JQ0A 4N39A 2FULA 3I4RB 4RG9A 3M56A 4UWLA 2BUGA 2XCBA 3PDNA 4G11A 3LCAA 4G26A 4DPRA 2WPVA 1MVXA 2CG2A 3FU0A 1EPUA 4MLPA 2NXPA 3MKRA 4ME2A 4RG6A 3KMJA 5LSZA 2UY1B 4NRHB 2IF4A 4XI0A 4J83A 3CR3A 3HYMB 2AWIA 2WM9A 3Q4AB 5LP0A 1H0AA 1WAO1 3FUNA 4FHJA 2Y4TA 3RQ4A 3SI5A 5TH7A 3ZVVA 1JPLA 2A5UA 3RRNB 2FI7A 3CV0A 1JWGA 3OPEA 4XX5A 2E2EA 3FFLA 3FUJA 1N3JA 4B89A 4WUYA 3CHMA 2R3AA 2WQHA 2XGMA 4AY5A 1IQRA 2FEZA 2WXMA 3ENEA 3FH8A 4JHJA 4XE0A 3SF4A 2NC9A 1E8WA 3F9YA 3QNKA 4CGWA 1OWMA 2X6JA 5C1DA 3CVVA 5CPRB 3RO3A 4UQXA 4UI9C 1N6AA 1OWNA 2GRMA 3HHMA 3ZYKA 4J8OA 1HG5A 2PQNA 2UWJG 3QWPA 4G23A 4A3VA 3CEQA 4IULA 3JQ1A 1N6CA 3DALA 1OWOA 4C1QA 2VSYA 3UUXA 1MVHA 4ANXA 3HNAA 3GZ1A 4YPEA 2C2LA 2X38A 4DJAA 4XZ4A 2FO7A 4J8DA 4KYOB 3S7DA 2ILRA 4GCNA 1ZBPA 4ANUA 1HF8A 3LDZA 4WNDA 2WXJA 2KC7A 3CVYA 4BTAA 2QPWA 4KVMA 5CCLA 3TGOA 4ACKA 4TV3A 5LOZA 1O9SA 5FZSA 4DLOA 4GU5A 4WWOA 1SZAA 3CVQA 4FU3A 4KZ0A 4I6EA 4GZ3A 1KLXA 4J0UA 5JHBA 5BW8C 5G2NA 3UT7A 3ZHEB 3FTUA 4KMOA 3G2WA 4V3IA 2MOWA 1HS6A 5FQ6A 4U63A 3DBSA 4P29A 2QY7A 1N54A 3KMAA 5G04J 3URZA 5BUZA 3GW4A 2CFUA 3CGHA 4OYSA 3AS5A 3SD5A 4I17A 2R5SA 4AXHA 2F69A 3CK8A 2GGFA 3MO0A 5EKQD 2KZTB 3B13A 5G05J 2LO6A 3LXUX 1Y8MA 3P2BA 5E75A 4LDGA 1OWLA 3D9MA 2AVPA 3CSFA 3G2VA 3EDTB 4GA0A 3T5XA 4LEUA 4AY6A 5EDSA 5KJLA 2HO1A 3JYSA 4I9EA 4LRZA 4ILGA 4L1BA 4J6IA 3EJNA 4HOUA 5ANRA 4JHRA 2E0IA 4AJWA 1DVPA 1EF1C 2AXUA 2R17C 2L0TB 5F59A 5D0QD 3FUMA 2VGYA 3U64A 3S7FA 3U9WA 3TG4A 4BTBA 3EHMA 4QEPA 3CIAA 4C9BB 3M5AA 4L2LA 3QWVA 3SW9A 5JIYA 4PS7A 3NF1A 4U0SA 1HE8A 4JVSA 3BG0B 5J90A 4JZYA 5AIJA 2I1KA 3VLDA 3ONKA 3ZHEA 5LSXA 4J8FA 3APCA 3CHRA 2VSOE 3R7QA 3SGHA 1IHGA 2DCPA 3QKYA 3RRMB 2RD0A 4E85A 5ENNA 3TL5A 5BPPA 3ZEFA 5JJ7A 2WXQA 4AEZC 3ESLA 3GZSA 3TXNA 3G2UA 5BV1A 1OWPA 2VSNA 4GAAA 4H7XA 4QENA 5G04C 1HO8A 4DI3A 2KZTA 3M58A 4I2WA 1XQHA 3F9XA 4JA9A 4O6FA 3VV0A 3FHEA 3LY9A 1IQUA 2V8SE 1INZA 3CBPA 3OOIA 3D9KA 3LY8A 2LAIA 3KD7A 4DLQA 3Q15A 3LKUA 2I6HA 5LX8A 3IHXA 2WMNA 4IRUA 5FZQA 1HU3A 3PEVB 3M57A 3K9IA 3Q47B 4GCOA 3CHQA 2GRLA 1PAQA 4K0RA 4JPSA 2V5FA 4WWPA 1HH8A 2XPIA 3MGBA 4XI9A 3CQCB 3RO2A 1MHQA 4BY6A 5EG2A 3EHNA 3ZW3A 5KJMA 5FJYA 4YVOA 1ZKKA 1MQSA 4BT8A 1TEZA 4N3BA 3E4BA 3ML9A 3BG1B 1ML9A 2IGQA 4UWHA 5F6LA 5T0KA 4WAFA 5EX0A 4FLHA 2CHXA 3U4TA 5BNWA 3APFA 2C0LA 4I43A 4M3OA 1UJJA 4U07A 2J4DA 3FEXA 2O8JA 3ML8A 3N71A 3NZUA 3CKCA 4CT0A 3D9IA 4URKA 4U0ZA 3ZN3A 4E6HA 3S8PA 1UN9A 3VLFA 3SBSA 1OUVA 3SNXA 2NSZA 3MO2A 4GYWA 2WQ6A 4I2ZA 3TAXA 5A6CA 4I1MA 5AENA 4BX8A 3UQ3A 4FULA 3R9AB 4A3TA 3S7JA 3UT4A 5M72A 1PC2A 2XHEA 2RFIA 3AU4A 1HX8A 3DPDA 4PH4B 3KAEA 4I1AA 3MV2B 4C0EA 4I51A 3L08A 3FU5A 2OVFA 3IBEA 2WXPA 2VQ2A 1WY6A 3FEYA 3PUJA 1NZNA 4YVQC 2GW1A 3ZFWA 2J49A 2LNIA 3SHFA 3SWCA 4BFRA 2OVBA 3MZLB 4K03A 3F9WA 4F3VA 4Q96A 1E7VA 5T5GA 5LCWJ 1E90A 3ASDA 3FUDA 4H7YA 4BSXA 4OVVA 4RSYA 4J8EA 4IYPA 2BTDA 3OXFA 4QFVA 2PQRA 2WMOA 4YPUA 4W9RA 4FLBA 3IV0A 2LAHA 3FDHA 3IHYA 3PZDA 3Q49B 4I9CA 5JINA 2UY1A 2EQXA 4FHKA 2JV0A 1Z3YA 4YNPA 2JEKA 3RAYA 4UWGA 3IKOB 3B7UX 4YNDA 3L54A 5D0OD 5CHEE 4CEMA 4EPZA 1E8ZA 3APDA 5JJ6A 4WNEA 4DI4A 2RG8A 4APOA 3FH7A 3CKBA 4I1OB 2Q7FA 4B8CB 2C0MA 4N3AA 3FTSA 1JWFA 4U0UA 4RZ0A 1ELWA 4AV7A 4OVUA 4AU7A 5A7DB 3KMTA 5FQ7A 3PH0C 3U3WA 2J08A 2OOEA 3CBMA 3MJWA 3LS8A 4ABNA 4JA7A 3M59A 3FY4A 5EX3A 3CVPA 3FUFA 4G2VA 4I6GA 4FJYA 2MHKA 5FWQA 4AIFA 3D9JA 3RU0A 2J07A 1H2UA 5F6KC 2WXRA 2HR2A 1NP7A 4J8SA 2KCKA 3D3MA 3DB5A 2WB2A 1E96B 2KM4A 3VUZA 5LCWC 3ESKA 2PL2A 2WXHA 3IHVA 1KT0A 3CHOA 5JHNA 3G2SA 4AVXA 1KT1A 4EZKA 1H2VC 4F1SA 2KATA 4B94A 4G25A 4A55A 3L13A 2PZIA 4HORA 4GPKA 3CK9A 4KVOA 4Z4PA 2KCVA 3CHPA 3ZGQA 3CVXA 3RK6A 3M54A 4CDNA 2QFCA 2V4LA 4AOFA 1NA3A 2CG3A 2YQ8A 4FJZA 2WQ7A 1PEGA 3UT8A 4HLEA 1E8XA 5FTPA 4KZCA 3PS6A 3MX3A 5BV0A 4PUCA 3LEWA 1A17A 3PE4A 3WXXA 1DNPA 3L6AA 5ARGA 3PVLA 5T0MA 3O4ZA 3PEUB 2CFZA 2L6JA 2AXZA 3FUKA 3PREA 4HXIA 4NQ0A 4UWFA 3UPVA 3D9OA 3LVQE 4TUUA 4XKCA 4CDRA 4HOSA 4JLGA 5JJTA 2XQ0A 4CGVA 4N2SA 4UQYA 1FCHA 4KXKB 4LCTA 3OS5A 3FULA 3FUIA 4XIFA 1SQMA 1WM5A 4JEHA 3K5KA 1LF8A 2AW6A 3CK7A 1S0PA 3HDXA 3ZYQA 3MO5A 2HYZA 3QWWA 5AJDA 4L2YA 1TJFA 3PE3A 4KBQA 3ULQA 4D10C 5CMYA 1X5BA 2XGOA 3QC1A 4GB9A 1UW4B 3FTZA 4MI0A 4O30A 5G05C 3CVLA 3RIBA 2J9QA 2WXKA 3PUKA 2WXFA 3JCKC 3ONLA 5TTFA 4WNFA 2BF0X 4U04A 1NA0A 1EYHA 4CRWA 4FP7A 5G55A 4WNGA 5ANLA 4AP2A 5JHAA 2IFUA 4R7LA 2I1JA 2IJGX 3UX4A 3RJVA 4BUPA 1W3BA 4APFA 3FUHA 5DBKA 4MS6A 3GZ2A 1P5QA 4N2QA 2VGXB 1SZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOU A;  2JLB A;  4YNM A;  5DIZ A;  4MI5 A;  4BT9 A;  3LY7 A;  4H12 A;  3ASF A;  3FWV A;  3AS8 A;  4YPA A;  2BQZ A;  5ARF A;  2G46 A;  4BWR A;  3ZPJ A;  3ASH A;  4G24 A;  4N3C A;  4N5C A;  1TJC A;  4GYY A;  3CVN A;  2VGX A;  4IN3 B;  2LSV A;  3CBO A;  1YA0 A;  3MV3 B;  5FZR A;  4J7I A;  1H3I A;  3FPD A;  4HOQ A;  2FBN A;  1B89 A;  4G1T A;  4NVQ A;  3RKV A;  5F5E A;  1MUF A;  3OXL A;  3BO5 A;  4UI9 K;  3OXG A;  4JDS A;  5AYW D;  3M53 A;  2W5Z A;  2XEV A;  5CCM A;  3AS4 A;  3GYZ A;  5FT9 A;  3FP3 A;  1XNF A;  5TEG A;  4GA2 A;  1IYG A;  3S7B A;  2OND A;  3SZ7 A;  2FF4 A;  3QDN A;  1HZ4 A;  4EQF A;  5AYF A;  4QEO A;  1QQE A;  3TG5 A;  2VYI A;  3F9Z A;  2W5Y A;  3IEG A;  1MT6 A;  3VTX A;  4GZ5 A;  5JJ0 A;  4FMU A;  1QZ2 A;  1ZU2 A;  4UQZ A;  4A1S A;  5HQ8 A;  4IJ8 A;  3ASG A;  3LPZ A;  3Q5M A;  2DBA A;  3KS2 A;  4HOT A;  4J7F A;  5HI7 A;  3VTY A;  2Y4U A;  4GYO A;  5BT1 A;  3M55 A;  4E47 A;  3RJW A;  3O48 A;  2YHC A;  4Y6C A;  4AM9 A;  5KJK A;  3MA5 A;  4GZ6 A;  2XGS A;  3EP0 A;  3LYA A;  2P58 C;  4NJ5 A;  4GA1 A;  4JL0 A;  4UI9 J;  1HXI A;  2KCL A;  3BEE A;  5KJN A;  2LSU A;  4Y6W A;  2XCC A;  1ELR A;  3MEK A;  4IJD A;  4N39 A;  4RG9 A;  3M56 A;  2BUG A;  2XCB A;  3PDN A;  3LCA A;  4G26 A;  1MVX A;  2WPV A;  3SWC A;  4RG6 A;  4ME2 A;  3MKR A;  3KMJ A;  5LSZ A;  2UY1 B;  4NRH B;  2IF4 A;  4XI0 A;  4J83 A;  3HYM B;  3Q4A B;  1WAO 1;  2Y4T A;  3RQ4 A;  5TH7 A;  3OPE A;  2FI7 A;  3CV0 A;  2E2E A;  3FFL A;  1N3J A;  4WUY A;  2R3A A;  2WQH A;  2XGM A;  4AY5 A;  2FEZ A;  3SF4 A;  2NC9 A;  3F9Y A;  4CGW A;  5C1D A;  5CPR B;  3RO3 A;  4UQX A;  4UI9 C;  1N6A A;  4J8O A;  2PQN A;  2UWJ G;  3QWP A;  4G23 A;  3CEQ A;  3DAL A;  4C1Q A;  2VSY A;  3UUX A;  1MVH A;  3HNA A;  3GZ1 A;  4YPE A;  2C2L A;  2FO7 A;  4J8D A;  4KYO B;  3S7D A;  4GCN A;  1ZBP A;  4WND A;  2KC7 A;  2QPW A;  4BTA A;  5CCL A;  3TGO A;  1O9S A;  5FZS A;  3CVQ A;  4GZ3 A;  1KLX A;  4J0U A;  5BW8 C;  3ZHE B;  3KMA A;  5G04 J;  3URZ A;  3GW4 A;  3AS5 A;  4I17 A;  2R5S A;  2F69 A;  3CK8 A;  3MO0 A;  5EKQ D;  5G05 J;  4LDG A;  1Y8M A;  2AVP A;  4GA0 A;  3EDT B;  4LEU A;  4AY6 A;  5KJL A;  2HO1 A;  3JYS A;  4I9E A;  4HOU A;  4JHR A;  5F59 A;  5D0Q D;  2VGY A;  3S7F A;  3TG4 A;  4BTB A;  4QEP A;  3M5A A;  3QWV A;  5JIY A;  3NF1 A;  4U0S A;  3ZHE A;  5LSX A;  4J8F A;  1IHG A;  3QKY A;  5JJ7 A;  4QEN A;  4H7X A;  2VSN A;  5G04 C;  3M58 A;  4I2W A;  1XQH A;  3F9X A;  4JA9 A;  4O6F A;  3VV0 A;  3LY9 A;  3CBP A;  3OOI A;  3LY8 A;  3KD7 A;  3Q15 A;  3LKU A;  2I6H A;  3IHX A;  5FZQ A;  3M57 A;  3K9I A;  3Q47 B;  4GCO A;  2V5F A;  1HH8 A;  2XPI A;  4XI9 A;  3RO2 A;  5EG2 A;  5KJM A;  5FJY A;  4YVO A;  1ZKK A;  1ML9 A;  4BT8 A;  5F6L A;  4N3B A;  3E4B A;  5T0K A;  5EX0 A;  3U4T A;  5BNW A;  2C0L A;  4U07 A;  2O8J A;  3N71 A;  3CKC A;  4U0Z A;  3ZN3 A;  3S8P A;  1OUV A;  3MO2 A;  4GYW A;  4I2Z A;  3TAX A;  5A6C A;  3UQ3 A;  3R9A B;  5M72 A;  3S7J A;  1PC2 A;  2RFI A;  3KAE A;  4I1A A;  3MV2 B;  4I51 A;  2VQ2 A;  4YVQ C;  1NZN A;  3ZFW A;  2GW1 A;  2LNI A;  3F9W A;  4F3V A;  5T5G A;  5LCW J;  3ASD A;  4H7Y A;  4J8E A;  3OXF A;  2PQR A;  4YPU A;  4W9R A;  5JIN A;  4I9C A;  3Q49 B;  2UY1 A;  2JV0 A;  4YNP A;  3RAY A;  4YND A;  5D0O D;  5CHE E;  5JJ6 A;  4WNE A;  4APO A;  3CKB A;  2Q7F A;  2C0M A;  4N3A A;  4U0U A;  4RZ0 A;  1ELW A;  4AU7 A;  5A7D B;  3KMT A;  3U3W A;  2OOE A;  3CBM A;  4ABN A;  4JA7 A;  3M59 A;  5EX3 A;  3CVP A;  4G2V A;  2MHK A;  4AIF A;  3RU0 A;  5F6K C;  2HR2 A;  2KCK A;  3DB5 A;  3VUZ A;  1E96 B;  5LCW C;  3ESK A;  2PL2 A;  1KT0 A;  5JHN A;  1KT1 A;  4B94 A;  2KAT A;  4G25 A;  2PZI A;  4HOR A;  4GPK A;  3CK9 A;  4Z4P A;  2KCV A;  3ZGQ A;  3M54 A;  2QFC A;  1NA3 A;  2YQ8 A;  1PEG A;  5FTP A;  3PE4 A;  1A17 A;  3WXX A;  5ARG A;  5T0M A;  4NQ0 A;  2L6J A;  3UPV A;  2IGQ A;  4CDR A;  4HOS A;  4JLG A;  5JJT A;  4N2S A;  4CGV A;  4UQY A;  1FCH A;  4KXK B;  3OS5 A;  4XIF A;  1WM5 A;  3K5K A;  3CK7 A;  3MO5 A;  3SW9 A;  2HYZ A;  3QWW A;  4KBQ A;  3PE3 A;  3ULQ A;  2XGO A;  4O30 A;  4MI0 A;  5G05 C;  3CVL A;  3RIB A;  2J9Q A;  5TTF A;  4WNF A;  4U04 A;  1NA0 A;  4WNG A;  2IFU A;  4BUP A;  3RJV A;  1W3B A;  5DBK A;  1N6C A;  3GZ2 A;  1P5Q A;  4N2Q A;  2VGX B; 
#chains in the Genus database with same CATH topology
 1Y6I A;  5DIZ A;  4MI5 A;  2XPY A;  2PNN A;  1V54 E;  2P9K G;  2WXO A;  3FTV A;  3D9P A;  3UMV A;  2P9P G;  3D9L A;  4L7T A;  4BEP A;  2WXN A;  4YPA A;  2DZO A;  2DIW A;  4HI8 A;  1H6K A;  3S2A A;  3UIN C;  5FIN A;  1TJC A;  5JMN D;  1BPO A;  3PZ4 A;  5FZR A;  1FT2 A;  4HOQ A;  1B89 A;  2IOS A;  3J5Q B;  3HXF A;  2DWZ A;  4FA6 A;  3D9H A;  3OXG A;  3PZ1 A;  5AYW D;  4GML A;  1OCO E;  4C0M A;  3V2X A;  3L22 A;  3GYZ A;  4U95 D;  1E8Y A;  4JC8 A;  1SA4 A;  5FQ4 A;  1JCR A;  3PNT B;  4YDY A;  3S7B A;  3LVR E;  1HFA A;  4GTP A;  2VYI A;  4ANW A;  4XKB A;  5T8I A;  1Z5S C;  2I2O A;  3KSQ A;  5E76 A;  4GZ5 A;  2ETC A;  3ZXS A;  2WVI A;  1QZ2 A;  3V31 A;  2I9C A;  3U66 A;  4RVB A;  1EDU A;  3Q5M A;  4NIK A;  4TXP A;  2IEJ A;  1PY1 A;  3AG3 E;  3R7R A;  1L5J A;  4HVB A;  2ZU6 B;  4JXT A;  3RRU A;  3CVW A;  2WXL A;  3B7T A;  2DVW A;  3ZYM A;  2F8X K;  4E47 A;  1MX4 A;  1DCQ A;  3RJW A;  3TXM A;  1UJK A;  1SW6 A;  3DXM G;  3O48 A;  4DX1 A;  4Y6C A;  5KJK A;  3MA5 A;  5BXU A;  4GZ6 A;  5ENS D;  2XRZ A;  5BXO A;  4JL0 A;  4UI9 J;  2KCL A;  3BEE A;  3C72 A;  4HBD A;  2VSX E;  2X6F A;  3FTW A;  3MEK A;  3VLE A;  4UWL A;  2BUG A;  4G11 A;  4DPR A;  1MVX A;  3FU0 A;  4ME2 A;  1N4P A;  3Q4A B;  5ENT D;  1WAO 1;  3FUN A;  3ZVV A;  3RRN B;  3UM3 A;  4ATZ D;  4WUY A;  2R3A A;  2WQH A;  3V2O A;  4AY5 A;  2FEZ A;  2WXM A;  3R9M A;  4CGW A;  4UI9 C;  3HHM A;  1HG5 A;  2PQN A;  1OCR E;  4G23 A;  2P2C P;  1MVH A;  2C2L A;  4DJA A;  5EIB E;  2ILR A;  3HG0 D;  3V30 A;  5B3S E;  4ANU A;  2H6G A;  4B93 B;  4WND A;  1TNU A;  4KVM A;  4ACK A;  1O9S A;  4FU3 A;  4GZ3 A;  1KLX A;  4J0U A;  5JHB A;  1WG0 A;  2QYU A;  3ZHE B;  3FTU A;  4U63 A;  1YCS B;  5G04 J;  3GW4 A;  1TN6 A;  2GGF A;  2KZT B;  5G05 J;  3LXU X;  2IO2 C;  4BES A;  3D9M A;  5EDS A;  2HO1 A;  4J6I A;  1O1R A;  4U8V D;  5ANR A;  1EF1 C;  3UIP C;  4C9B B;  1HE8 A;  4JVS A;  2P9L G;  3ZHE A;  4J8F A;  2VSO E;  3RRM B;  3ZEF A;  5JJ7 A;  4AEZ C;  1OWP A;  1G3N B;  5G04 C;  2GRN B;  2B0O E;  2KZT A;  5ENO D;  5ENQ D;  3OOI A;  3Q15 A;  5KWD A;  5FZQ A;  4QQI A;  3CHQ A;  4WWP A;  1PAQ A;  4BY6 A;  2XPI A;  1ZKK A;  3ASO E;  1MQS A;  1ML9 A;  4XEI G;  5EX0 A;  2C0L A;  4I43 A;  4M3O A;  2J4D A;  3FEX A;  3ML8 A;  3CKC A;  3NOG D;  4E6H A;  2EIL E;  1UN9 A;  3MO2 A;  5A6C A;  5CBO A;  2DZN A;  3UT4 A;  1PC2 A;  3DPD A;  4PH4 B;  1S70 B;  2KXP C;  3L08 A;  3AG1 E;  3PUJ A;  2GW1 A;  2LNI A;  3AJI A;  5T5G A;  5LCW J;  4H7Y A;  4BSX A;  2ETB A;  4IYP A;  2BTD A;  1BU9 A;  3PZD A;  3ASN E;  2UY1 A;  4YNP A;  4YND A;  5CHE E;  2RFM A;  4CEM A;  3APD A;  4K5B A;  4DI4 A;  4APO A;  3FH7 A;  1D8D A;  3PZ3 A;  5A7D B;  3PH0 C;  4JA7 A;  1QYM A;  2ZXW E;  3L9T A;  2ETA A;  3D9J A;  5F6K C;  2L6B A;  4J8S A;  5CEC B;  5LCW C;  2WXH A;  1KT0 A;  5JHN A;  1H2V C;  2KAT A;  4B94 A;  3ZNG A;  4A55 A;  4HOR A;  4GPK A;  3ZGQ A;  3CVX A;  2LXM A;  4CDN A;  2QFC A;  1NA3 A;  2YQ8 A;  3UT8 A;  1IHB A;  5FTP A;  3PS6 A;  3MX3 A;  4PUC A;  4N5Q A;  3FUK A;  2AXZ A;  3PRE A;  4HXI A;  4CDR A;  4JLG A;  4GMR A;  4CGV A;  1WM5 A;  1LF8 A;  2AW6 A;  3QWW A;  4L2Y A;  4KBQ A;  3ULQ A;  5CMY A;  4O30 A;  3FTZ A;  1MX6 A;  4CZ2 D;  4DX7 D;  4HLL A;  4OAU C;  3Q79 A;  1TYQ G;  5ANL A;  5JHA A;  4R7L A;  2I1J A;  2IJG X;  4BUP A;  4APF A;  5DBK A;  3BO5 A;  5TH7 A;  3ISM C;  5C2Y A;  4B8A A;  3LY7 A;  1U2V G;  4Q94 A;  3ULE G;  2R02 A;  3ASF A;  4NUR A;  4WWN A;  1DCE A;  5CRU A;  3AS8 A;  1KPS B;  4CCA A;  3SFX A;  3QAR A;  3SFZ A;  5ARF A;  4ACL A;  2G46 A;  4BWR A;  2IU1 A;  1FVH A;  3ZPJ A;  3ASH A;  1K1A A;  1H6O A;  1OXJ A;  3CVN A;  3DPY A;  1MX2 A;  1IKN D;  4ATG A;  4J7I A;  3EIQ C;  5B1B E;  4U96 D;  4B0Z A;  4M7C A;  5J08 A;  3DEO A;  4CT4 A;  4UI9 K;  5HKP A;  1O1S A;  3AU5 A;  3M53 A;  2W5Z A;  2VJ8 A;  4NAC A;  2MRI A;  3AAA C;  2CHW A;  3ZIM A;  3FP3 A;  2X3M A;  4GA2 A;  3B7S A;  4F53 A;  5EYL A;  1RW2 A;  3SZ7 A;  1N52 A;  2FF4 A;  5D66 A;  2HM8 A;  3X2Q E;  3UM1 A;  1FVF A;  3QDN A;  4QEO A;  5CMW A;  1OCC E;  5EID A;  5KBA A;  1YMP A;  1MT6 A;  2LXL A;  2IQC A;  2QZA A;  4PS3 A;  5AQ7 A;  5KNG A;  4L23 A;  1ZU2 A;  1S63 A;  2J4B A;  3ASG A;  3LPZ A;  2A4Z A;  1UN8 A;  2XEH A;  4EZL A;  4BER A;  2BKG A;  1H2T C;  2DYR E;  3PZ2 A;  3KS2 A;  3UM2 A;  2V0P A;  1WDY A;  4FC8 A;  4J7W A;  3NAW A;  1O5M A;  2Y4U A;  5BT1 A;  1N4R A;  2WXI A;  3UIO C;  4JHK A;  2EIJ E;  3EP0 A;  4MBG A;  2Y3A A;  1JCS A;  2R59 A;  4EZJ A;  4NJ5 A;  4GA1 A;  3E34 A;  5KJN A;  2XCC A;  3TJP A;  3AG4 E;  2FUL A;  4RG9 A;  3M56 A;  4ZFH A;  2XCB A;  3LCA A;  3SWC A;  2CG2 A;  1EPU A;  4RG6 A;  3ZUV B;  2IF4 A;  4J83 A;  3HYM B;  2AWI A;  5LP0 A;  3RQ4 A;  1D8E A;  1K1B A;  1JPL A;  2A5U A;  3CV0 A;  1UOH A;  2E2E A;  3FUJ A;  1N3J A;  4B89 A;  3CHM A;  2XGM A;  3ENE A;  4XE0 A;  3TWQ A;  1N6A A;  1OWN A;  4GTS A;  4F6R D;  2UWJ G;  3TWS A;  4A3V A;  2KBX A;  2V5Q C;  2OEW A;  4ANX A;  3C3R A;  4YPE A;  2FO7 A;  4U7E B;  4GCN A;  1ZBP A;  4BSZ B;  2WXJ A;  2QPW A;  2BED A;  4DLO A;  1SZA A;  3AG2 E;  4KZ0 A;  5BW8 C;  1K8K G;  5G2N A;  4KMO A;  4V3I A;  5FQ6 A;  1HS6 A;  4P29 A;  3CGH A;  4I17 A;  4AXH A;  3JXJ A;  5AAR A;  3P2B A;  1OWL A;  4GA0 A;  4LEU A;  4AY6 A;  4L1B A;  4JHR A;  3DSU A;  1DVP A;  1V55 E;  5D0Q D;  2VGY A;  3EHM A;  3CIA A;  4PS7 A;  5AQ9 A;  5J90 A;  5LSX A;  3APC A;  3SGH A;  4DX6 D;  5ENN A;  3B95 A;  3G2U A;  5BV1 A;  3M58 A;  1XQH A;  2XZD G;  4JA9 A;  4O6F A;  3D9K A;  3LY8 A;  1SVX A;  3KD7 A;  3LKU A;  2I6H A;  5LX8 A;  2WMN A;  1HU3 A;  4TXQ A;  2A5E A;  3K9I A;  4JPS A;  1IXV A;  4K0R A;  1HH8 A;  4XI9 A;  5EG2 A;  3EHQ A;  3EHN A;  2F8Y A;  3ZW3 A;  1N0R A;  1TEZ A;  5F6L A;  3DST A;  2GRR B;  3BG1 B;  2CHX A;  3U4T A;  2FO1 E;  3ULY A;  2O8J A;  3ZN3 A;  3SNX A;  2WQ6 A;  3TAX A;  3UQ3 A;  4FUL A;  3R9A B;  5AQB A;  3S7J A;  4A3T A;  5M72 A;  2XHE A;  1HX8 A;  2R2L A;  3ABM E;  4I51 A;  1WY6 A;  2VQ2 A;  1NZN A;  3ZFW A;  3SHF A;  2OVB A;  3MZL B;  1X81 A;  4F3V A;  4OVV A;  3OXF A;  4QFV A;  4FLB A;  1TNY A;  3IV0 A;  5JIN A;  4FHK A;  2JV0 A;  1Z3Y A;  3IKO B;  5JJ6 A;  5IY5 E;  4I1O B;  3CKB A;  3HRA A;  4AV7 A;  4AU7 A;  4O1O A;  3KMT A;  5FQ7 A;  4OAV B;  2OOE A;  3C3O A;  3FY4 A;  1SA5 A;  4EHM A;  2P9S G;  4AIF A;  4U8Y D;  3TWR A;  2WXR A;  2LUH A;  5EN5 D;  2WB2 A;  2KM4 A;  3IHV A;  5ITZ F;  3CHO A;  3G2S A;  1KT1 A;  5CRV A;  3T8K A;  4G25 A;  3L13 A;  3CK9 A;  2KCV A;  3CHP A;  4HB5 A;  3M54 A;  2V4L A;  4FJZ A;  1PEG A;  4GTM A;  4HLE A;  2XS8 A;  3WXX A;  5T0M A;  3PEU B;  3UPV A;  2Y1L E;  4HOS A;  2P9U G;  1FCH A;  4YDO A;  5ENR D;  3FUL A;  3CK7 A;  3MO5 A;  2HYZ A;  5AJD A;  4GB9 A;  1UW4 B;  4HRN A;  4MI0 A;  5G05 C;  2WXF A;  5B1A E;  3SO8 A;  3JCK C;  3ONL A;  4WNF A;  3Q75 A;  2IFU A;  3UX4 A;  2QC9 A;  1BD8 A;  4MS6 A;  4N2Q A;  3QOU A;  2X6I A;  2YHE A;  2JLB A;  4YNM A;  4BT9 A;  2VTB B;  4FAD A;  4H12 A;  2NYJ A;  3I5P A;  3FWV A;  4UWK A;  3CLJ A;  2BKK B;  1Z6T A;  2BQZ A;  3JUE A;  4F7A A;  3HIZ A;  3I4G A;  3EIJ A;  3C3Q A;  3QB2 A;  4MKT A;  4G24 A;  4N3C A;  3T8M A;  3BUA A;  3HVE B;  1MJ0 A;  4J8Y A;  2ZIR A;  4LUN U;  4ZHB A;  4IN3 B;  2MYO A;  2LSV A;  1TNO A;  2VTB A;  1H3I A;  3FPD A;  1U3C A;  2H6H A;  1DC2 A;  4NVQ A;  3ZU7 B;  4PDX A;  2PM7 A;  1MUF A;  3OXL A;  1Z3X A;  4ANV A;  4JDS A;  2GRQ B;  2M63 A;  1NL4 A;  3CHS A;  5AN8 A;  2XS1 A;  2XEV A;  3AS4 A;  5FT9 A;  3HVE A;  2YIN A;  2XRY A;  4HI9 A;  1XNF A;  1IYG A;  4HQD A;  1S64 A;  3DSW A;  3HXB A;  4HFG A;  3J5P A;  4EQF A;  5AYF A;  3FTX A;  3TG5 A;  2YNQ A;  2QYJ A;  5KCM A;  4Q69 A;  3FU3 A;  5T4Y A;  3IEG A;  4GZD A;  1NFI E;  2EIK E;  1UG3 A;  2AJA A;  4UQZ A;  5CEA A;  4A1S A;  3FH5 A;  5HQ8 A;  4IJ8 A;  3ZYL A;  3QAQ A;  3QK0 A;  1N9A A;  2L9B A;  1VDY A;  3NQP A;  4UUC A;  4ILI A;  1U3D A;  4J7F A;  5HI7 A;  5LFA A;  3L16 A;  3ZRH A;  2JAB A;  4HRL A;  3M55 A;  3JXI A;  2GRP B;  5H7P A;  2YHC A;  2R03 A;  1ZB1 A;  3P1U A;  4PS8 A;  4GMJ A;  1E7U A;  5AJL A;  1QNF A;  2J09 A;  2XGS A;  1GW6 A;  2P58 C;  4O60 A;  3OAW A;  1H6P A;  2ZGD A;  3G2T A;  3F6Q A;  1HXI A;  2P9N G;  1HG2 A;  2IOL A;  1ELR A;  4O1P A;  4YDW A;  1MZC A;  3JQ0 A;  4N39 A;  3I4R B;  3PDN A;  4G26 A;  2WPV A;  5AQA A;  2NXP A;  3KMJ A;  3CR3 A;  3NB2 A;  2Y4T A;  3W9G A;  3SI5 A;  1N4S A;  3OPE A;  1JWG A;  3FFL A;  1N94 A;  1IQR A;  3FH8 A;  3DXK G;  2NC9 A;  3F9Y A;  3QNK A;  1OWM A;  5KNH D;  5C1D A;  3CVV A;  5CPR B;  3C5R A;  3RO3 A;  1JCQ A;  2GRM A;  4LNG A;  4J8O A;  3CEQ A;  3JQ1 A;  3DAL A;  1OWO A;  2VSY A;  3GZ1 A;  4XZ4 A;  3KSL A;  3S7D A;  1HF8 A;  1TR4 A;  2KC7 A;  5CCL A;  4TV3 A;  5LOZ A;  5FZS A;  4GU5 A;  4WWO A;  4TUM A;  1MYO A;  3WG7 E;  2MOW A;  3HXC A;  1N54 A;  3URZ A;  2CFU A;  3AS5 A;  3SD5 A;  3MO0 A;  5EKQ D;  5EIL A;  1Y8M A;  3G2V A;  3T5X A;  3EDT B;  3JYS A;  4I9E A;  4ILG A;  4G8L A;  4HOU A;  3UKR G;  2E0I A;  4AJW A;  3FUM A;  3U64 A;  4BTB A;  4L2L A;  3QWV A;  5JIY A;  3NF1 A;  4U0S A;  2IY0 C;  3BG0 B;  4JZY A;  2I1K A;  3VLD A;  3CHR A;  3R7Q A;  2RD0 A;  5BPP A;  3V79 K;  2WXQ A;  3GZS A;  4QEN A;  4H7X A;  2VSN A;  3DRA A;  4GTO A;  3VV0 A;  3FHE A;  3LY9 A;  1INZ A;  1TN8 A;  2V8S E;  3DWL G;  3PEV B;  3M57 A;  4GCO A;  2GRL A;  2V5F A;  3MGB A;  3CQC B;  1MHQ A;  1Q2Z A;  4YVO A;  4N3B A;  3E4B A;  4HNA D;  5T0K A;  1O1T A;  4FLH A;  5BNW A;  4U07 A;  1UJJ A;  5EYP F;  3N71 A;  4CT0 A;  3D9I A;  4URK A;  4U0Z A;  3S8P A;  2NSZ A;  4I2Z A;  2Y0B G;  3AU4 A;  3KAE A;  4I1A A;  3MV2 B;  4C0E A;  4DX2 A;  2EIM E;  3FU5 A;  2OVF A;  3IBE A;  2WXP A;  3TWU A;  2XZT G;  2P9I G;  3Q9N C;  4K03 A;  3F9W A;  1AWC B;  1E7V A;  2F0Y A;  4J8E A;  4RSY A;  1TN7 A;  2PQR A;  3IHY A;  3FDH A;  4I9C A;  2EQX A;  3B7U X;  3L54 A;  5D0O D;  1LD7 A;  4WNE A;  2EIN E;  2RG8 A;  1FPP A;  2Q7F A;  4N3A A;  1JWF A;  4U0U A;  4OVU A;  2F37 A;  3U3W A;  2J08 A;  3MJW A;  3LS8 A;  3DSX A;  3M59 A;  3CVP A;  3FUF A;  4G2V A;  4I6G A;  4FJY A;  5FIO A;  5FWQ A;  2J07 A;  3EU5 A;  2HR2 A;  1NP7 A;  3DB5 A;  3VUZ A;  2PL2 A;  4C48 B;  3UM0 A;  4AVX A;  4EZK A;  4F1S A;  4LNU D;  2VGE A;  4Z4P A;  4KVO A;  2WQ7 A;  3NBN B;  1FT1 A;  1TNZ A;  5BV0 A;  3EHR A;  1A17 A;  3PE4 A;  1DNP A;  5ARG A;  3O4Z A;  3TWV A;  4LG6 A;  2IGQ A;  5JJT A;  4DUI A;  4LCT A;  5HRY A;  4K5A B;  3UKU G;  3OS5 A;  1SQM A;  4JEH A;  3UXG A;  1S0P A;  3HDX A;  3UTM A;  4D10 C;  3PE3 A;  2RKK A;  1RZ4 A;  2J9Q A;  3PUK A;  3Q73 A;  5TTF A;  4U04 A;  1EYH A;  4WNG A;  1LD8 A;  5AAO A;  1W3B A;  3FUH A;  1N6C A;  3GZ2 A;  3U9W A;  2VGX B;  1SZ9 A;  3FU6 A;  4BX9 A;  1JUQ A;  1XGW A;  3I3N A;  3CST A;  3ABL E;  3LJ3 A;  4ILH B;  2J8S D;  4U8H A;  3JUI A;  2OV8 A;  5HS0 A;  3B7R L;  1N95 A;  3CVU A;  4I6J A;  5A23 A;  4JEU A;  4EBA A;  3QJZ A;  5T3R A;  3KEZ A;  4N5C A;  1BI7 B;  4GYY A;  3BQO A;  2VGX A;  5ENP D;  3E37 A;  2CHZ A;  3CBO A;  1YA0 A;  2Y69 E;  3MV3 B;  4LNB A;  2FBN A;  4G1T A;  3NZS A;  3SFY A;  4KT6 B;  3RKV A;  5F5E A;  3DSS A;  2ION A;  4JW1 A;  3FTY A;  5CBN A;  3ZXP A;  1A5E A;  4GZC A;  2XPZ A;  5CCM A;  2WXG A;  1N0Q A;  4EEC A;  4HS2 A;  5TEG A;  5FQ8 A;  2X6H A;  3PNL B;  3MKQ B;  2OND A;  1LTX A;  2HE0 A;  4GTR A;  3OTN A;  4TXR A;  1HZ4 A;  3HXD A;  3MCX A;  4GTQ A;  4DK5 A;  1QQE A;  1YYH A;  4TRQ A;  3F9Z A;  2X6K A;  2W5Y A;  1ELK A;  1AP7 A;  3VTX A;  3E30 A;  5JJ0 A;  3PRZ A;  4FMU A;  3D9N A;  3UI2 A;  3C98 A;  4A1G A;  3MYV A;  1BLX B;  2PM6 A;  1OCZ E;  3MKQ A;  2DBA A;  4HOT A;  2L0I A;  3VTY A;  4GYO A;  3TWX A;  3CQG B;  2AXV A;  4EBA G;  4MRU A;  1H19 A;  4AM9 A;  4CDM A;  3L17 A;  3LYA A;  2GRO B;  3T5V A;  3SY2 A;  4LER A;  3FUE A;  3EU9 A;  2LSU A;  4Y6W A;  3SBT B;  4IJD A;  3ZKJ A;  4MLP A;  5LSZ A;  3MKR A;  2UY1 B;  4NRH B;  4XI0 A;  2WM9 A;  4JB8 P;  1H0A A;  4FHJ A;  1KZP A;  4RQI A;  2FI7 A;  4XX5 A;  1TNB A;  4JHJ A;  3SF4 A;  1E8W A;  2R05 A;  2X6J A;  4UQX A;  3ZYK A;  3QWP A;  4IUL A;  4C1Q A;  3UUX A;  3HNA A;  3Q9U C;  2X38 A;  4J8D A;  4KYO B;  3LDZ A;  3CVY A;  4BTA A;  3TGO A;  3CVQ A;  4X8Q A;  4I6E A;  1NI1 A;  3BU8 A;  4Z68 A;  3UT7 A;  5JA4 D;  2H6F A;  5CED B;  3G2W A;  3DBS A;  4DRX E;  2QY7 A;  3KMA A;  5BUZ A;  4OYS A;  2R5S A;  3KEA A;  2F69 A;  3CK8 A;  3B13 A;  3B7B A;  2LO6 A;  4LDG A;  5E75 A;  2AVP A;  3CSF A;  4YDE A;  5KJL A;  4LRZ A;  3EJN A;  3L82 A;  2AXU A;  2R17 C;  2L0T B;  3E32 A;  3LJN A;  5F59 A;  3S7F A;  3TG4 A;  4QEP A;  3M5A A;  1QBQ A;  5AIJ A;  3ONK A;  1IHG A;  2DCP A;  3QKY A;  2OEV A;  5D2M C;  4E85 A;  3W9F A;  3TL5 A;  3EUV A;  2ZGG A;  3ESL A;  3TXN A;  4GAA A;  4DI3 A;  1HO8 A;  3Q7F A;  4I2W A;  3ABK E;  3F9X A;  2OCC E;  1OY3 D;  3TWW A;  1IQU A;  3CBP A;  4K5C A;  2LAI A;  1N4Q A;  4DLQ A;  3IXE A;  3IHX A;  3HXE A;  3E33 A;  4IRU A;  3Q47 B;  3RO2 A;  5KJM A;  5FJY A;  3NOC D;  4BT8 A;  3ML9 A;  4L9P A;  4UWH A;  4WAF A;  3APF A;  4GPM A;  3NZU A;  3VLF A;  1N11 A;  3SBS A;  1OUV A;  4GYW A;  4I1M A;  5AEN A;  4BX8 A;  2RFI A;  3Q7A A;  3FEY A;  4YVQ C;  2J49 A;  3DEP A;  4BFR A;  4Q96 A;  1E90 A;  3ASD A;  3FUD A;  1BI8 B;  4F1P A;  4DX5 D;  2WMO A;  4YPU A;  4W9R A;  2LAH A;  3Q49 B;  1OT8 A;  2RFA A;  2JEK A;  3RAY A;  4UWG A;  4EPZ A;  1E8Z A;  4GTT A;  4JD2 G;  4HRM B;  4B8C B;  2V4H C;  2C0M A;  3FTS A;  3T9K A;  4RZ0 A;  1ELW A;  3TWT A;  4GTV A;  3CBM A;  4ABN A;  3RSE G;  4CYM D;  5EX3 A;  2MHK A;  3RU0 A;  1H2U A;  2H6I A;  2KCK A;  3D3M A;  1K3Z D;  1E96 B;  3ESK A;  3RAU A;  3SQV A;  2PZI A;  4A63 B;  5CER B;  3RK6 A;  4AOF A;  2CG3 A;  1E8X A;  4G8K A;  4KZC A;  3LEW A;  2B6C A;  3L6A A;  3Q78 A;  3PVL A;  4UWF A;  4NQ0 A;  2CFZ A;  2L6J A;  2XEN A;  2XEE A;  3D9O A;  3LVQ E;  4TUU A;  4XKC A;  4BET A;  2ZIS A;  2XQ0 A;  4N2S A;  4UQY A;  4KXK B;  3FUI A;  4XIF A;  3K5K A;  3ZYQ A;  4RLY A;  3SW9 A;  1TJF A;  1X5B A;  2XGO A;  3QC1 A;  3CVL A;  3RIB A;  2WXK A;  2BF0 X;  1NA0 A;  4CRW A;  1KZO A;  4FP7 A;  2DYS E;  5G55 A;  4AP2 A;  3DSV A;  1D9S A;  2IO3 C;  3RJV A;  4LSZ E;  1P5Q A; 
#chains in the Genus database with same CATH homology
 3QOU A;  3FU6 A;  1Y6I A;  2X6I A;  2YHE A;  2JLB A;  4YNM A;  5DIZ A;  5C2Y A;  4BX9 A;  4MI5 A;  4BT9 A;  2VTB B;  2XPY A;  4FAD A;  4B8A A;  3LY7 A;  4H12 A;  1JUQ A;  1XGW A;  4Q94 A;  3I3N A;  2WXO A;  3ASF A;  3CST A;  4NUR A;  3LJ3 A;  4WWN A;  3I5P A;  4ILH B;  3FTV A;  3D9P A;  3UMV A;  3FWV A;  4UWK A;  3CLJ A;  3D9L A;  1Z6T A;  3AS8 A;  3JUI A;  4L7T A;  4U8H A;  2OV8 A;  2WXN A;  4CCA A;  3B7R L;  4YPA A;  3QAR A;  2BQZ A;  3SFZ A;  5ARF A;  4ACL A;  2G46 A;  3CVU A;  4BWR A;  2IU1 A;  4I6J A;  1FVH A;  5A23 A;  4JEU A;  4F7A A;  3HIZ A;  3ZPJ A;  2DIW A;  3I4G A;  3ASH A;  4EBA A;  3EIJ A;  1H6K A;  3QB2 A;  3QJZ A;  4MKT A;  5T3R A;  3KEZ A;  4G24 A;  4N3C A;  3S2A A;  3T8M A;  3HVE B;  4N5C A;  1TJC A;  4LUN U;  4GYY A;  3CVN A;  2VGX A;  4IN3 B;  2CHZ A;  1BPO A;  2LSV A;  1YA0 A;  3CBO A;  3MV3 B;  5FZR A;  4ATG A;  4J7I A;  3EIQ C;  2VTB A;  1H3I A;  3FPD A;  4HOQ A;  2FBN A;  1U3C A;  1B89 A;  2IOS A;  4G1T A;  4B0Z A;  4NVQ A;  3NZS A;  4KT6 B;  4PDX A;  4FA6 A;  5J08 A;  3RKV A;  2PM7 A;  5F5E A;  1MUF A;  3OXL A;  1Z3X A;  4CT4 A;  4ANV A;  3BO5 A;  4UI9 K;  3OXG A;  4JDS A;  2ION A;  4JW1 A;  2M63 A;  3AU5 A;  3FTY A;  3CHS A;  5AYW D;  4GML A;  3M53 A;  4GZC A;  4C0M A;  2XPZ A;  2W5Z A;  2VJ8 A;  2XEV A;  4NAC A;  5CCM A;  2MRI A;  2WXG A;  3L22 A;  3AS4 A;  3GYZ A;  5FT9 A;  4EEC A;  2CHW A;  3HVE A;  3ZIM A;  2YIN A;  2XRY A;  3FP3 A;  2X3M A;  1E8Y A;  4JC8 A;  4HS2 A;  1XNF A;  5TEG A;  4GA2 A;  3B7S A;  5FQ8 A;  4F53 A;  5FQ4 A;  2X6H A;  3PNL B;  3MKQ B;  3PNT B;  3S7B A;  1IYG A;  2OND A;  3SZ7 A;  1N52 A;  3LVR E;  2FF4 A;  3OTN A;  2HM8 A;  1FVF A;  3QDN A;  4HFG A;  1HZ4 A;  1HFA A;  3MCX A;  4DK5 A;  4EQF A;  5AYF A;  4QEO A;  1QQE A;  3FTX A;  3TG5 A;  5CMW A;  2YNQ A;  2VYI A;  4TRQ A;  4ANW A;  4XKB A;  5KCM A;  4Q69 A;  5T8I A;  2I2O A;  3FU3 A;  3F9Z A;  5T4Y A;  2X6K A;  2W5Y A;  3IEG A;  1ELK A;  4GZD A;  1MT6 A;  3VTX A;  2IQC A;  5E76 A;  4GZ5 A;  5JJ0 A;  3PRZ A;  3ZXS A;  2WVI A;  4FMU A;  3D9N A;  4PS3 A;  1UG3 A;  1QZ2 A;  4L23 A;  1ZU2 A;  4UQZ A;  2J4B A;  4A1S A;  3FH5 A;  2I9C A;  5HQ8 A;  3U66 A;  4IJ8 A;  3C98 A;  3ASG A;  3LPZ A;  4A1G A;  3MYV A;  3QAQ A;  4RVB A;  1EDU A;  2A4Z A;  3Q5M A;  3QK0 A;  3ZYL A;  2PM6 A;  1PY1 A;  3MKQ A;  2DBA A;  1UN8 A;  2L9B A;  4EZL A;  3R7R A;  1L5J A;  4HVB A;  2ZU6 B;  1VDY A;  1H2T C;  3NQP A;  4JXT A;  4ILI A;  1U3D A;  3RRU A;  3CVW A;  2WXL A;  3KS2 A;  2V0P A;  2L0I A;  4FC8 A;  3B7T A;  5HI7 A;  5LFA A;  3L16 A;  4HOT A;  3ZYM A;  4J7F A;  3VTY A;  2Y4U A;  3ZRH A;  4GYO A;  5BT1 A;  3M55 A;  3CQG B;  2AXV A;  3RJW A;  4E47 A;  3TXM A;  1UJK A;  3O48 A;  4EBA G;  2YHC A;  4MRU A;  1H19 A;  4Y6C A;  2WXI A;  3P1U A;  4PS8 A;  4JHK A;  4AM9 A;  4CDM A;  5KJK A;  4GMJ A;  3MA5 A;  1E7U A;  5AJL A;  4GZ6 A;  1QNF A;  2J09 A;  2XGS A;  3EP0 A;  2Y3A A;  3L17 A;  3LYA A;  1GW6 A;  2R59 A;  4EZJ A;  2P58 C;  4NJ5 A;  3OAW A;  2XRZ A;  3T5V A;  4GA1 A;  3G2T A;  4LER A;  4JL0 A;  3FUE A;  4UI9 J;  1HXI A;  2KCL A;  3BEE A;  5KJN A;  1HG2 A;  2IOL A;  2VSX E;  2LSU A;  4Y6W A;  3SBT B;  2XCC A;  2X6F A;  1ELR A;  3FTW A;  3MEK A;  3VLE A;  4IJD A;  3TJP A;  3JQ0 A;  4N39 A;  2FUL A;  3I4R B;  4RG9 A;  3M56 A;  4UWL A;  2BUG A;  2XCB A;  3PDN A;  4G11 A;  3LCA A;  4G26 A;  4DPR A;  2WPV A;  1MVX A;  2CG2 A;  3FU0 A;  1EPU A;  4MLP A;  2NXP A;  3MKR A;  4ME2 A;  4RG6 A;  3KMJ A;  5LSZ A;  2UY1 B;  4NRH B;  2IF4 A;  4XI0 A;  4J83 A;  3CR3 A;  3HYM B;  2AWI A;  2WM9 A;  3Q4A B;  5LP0 A;  1H0A A;  1WAO 1;  3FUN A;  4FHJ A;  2Y4T A;  3RQ4 A;  3SI5 A;  5TH7 A;  3ZVV A;  1JPL A;  2A5U A;  3RRN B;  2FI7 A;  3CV0 A;  1JWG A;  3OPE A;  4XX5 A;  2E2E A;  3FFL A;  3FUJ A;  1N3J A;  4B89 A;  4WUY A;  3CHM A;  2R3A A;  2WQH A;  2XGM A;  4AY5 A;  1IQR A;  2FEZ A;  2WXM A;  3ENE A;  3FH8 A;  4JHJ A;  4XE0 A;  3SF4 A;  2NC9 A;  1E8W A;  3F9Y A;  3QNK A;  4CGW A;  1OWM A;  2X6J A;  5C1D A;  3CVV A;  5CPR B;  3RO3 A;  4UQX A;  4UI9 C;  1N6A A;  1OWN A;  2GRM A;  3HHM A;  3ZYK A;  4J8O A;  1HG5 A;  2PQN A;  2UWJ G;  3QWP A;  4G23 A;  4A3V A;  3CEQ A;  4IUL A;  3JQ1 A;  1N6C A;  3DAL A;  1OWO A;  4C1Q A;  2VSY A;  3UUX A;  1MVH A;  4ANX A;  3HNA A;  3GZ1 A;  4YPE A;  2C2L A;  2X38 A;  4DJA A;  4XZ4 A;  2FO7 A;  4J8D A;  4KYO B;  3S7D A;  2ILR A;  4GCN A;  1ZBP A;  4ANU A;  1HF8 A;  3LDZ A;  4WND A;  2WXJ A;  2KC7 A;  3CVY A;  4BTA A;  2QPW A;  4KVM A;  5CCL A;  3TGO A;  4ACK A;  4TV3 A;  5LOZ A;  1O9S A;  5FZS A;  4DLO A;  4GU5 A;  4WWO A;  1SZA A;  3CVQ A;  4FU3 A;  4KZ0 A;  4I6E A;  4GZ3 A;  1KLX A;  4J0U A;  5JHB A;  5BW8 C;  5G2N A;  3UT7 A;  3ZHE B;  3FTU A;  4KMO A;  3G2W A;  4V3I A;  2MOW A;  1HS6 A;  5FQ6 A;  4U63 A;  3DBS A;  4P29 A;  2QY7 A;  1N54 A;  3KMA A;  5G04 J;  3URZ A;  5BUZ A;  3GW4 A;  2CFU A;  3CGH A;  4OYS A;  3AS5 A;  3SD5 A;  4I17 A;  2R5S A;  4AXH A;  2F69 A;  3CK8 A;  2GGF A;  3MO0 A;  5EKQ D;  2KZT B;  3B13 A;  5G05 J;  2LO6 A;  3LXU X;  1Y8M A;  3P2B A;  5E75 A;  4LDG A;  1OWL A;  3D9M A;  2AVP A;  3CSF A;  3G2V A;  3EDT B;  4GA0 A;  3T5X A;  4LEU A;  4AY6 A;  5EDS A;  5KJL A;  2HO1 A;  3JYS A;  4I9E A;  4LRZ A;  4ILG A;  4L1B A;  4J6I A;  3EJN A;  4HOU A;  5ANR A;  4JHR A;  2E0I A;  4AJW A;  1DVP A;  1EF1 C;  2AXU A;  2R17 C;  2L0T B;  5F59 A;  5D0Q D;  3FUM A;  2VGY A;  3U64 A;  3S7F A;  3U9W A;  3TG4 A;  4BTB A;  3EHM A;  4QEP A;  3CIA A;  4C9B B;  3M5A A;  4L2L A;  3QWV A;  3SW9 A;  5JIY A;  4PS7 A;  3NF1 A;  4U0S A;  1HE8 A;  4JVS A;  3BG0 B;  5J90 A;  4JZY A;  5AIJ A;  2I1K A;  3VLD A;  3ONK A;  3ZHE A;  5LSX A;  4J8F A;  3APC A;  3CHR A;  2VSO E;  3R7Q A;  3SGH A;  1IHG A;  2DCP A;  3QKY A;  3RRM B;  2RD0 A;  4E85 A;  5ENN A;  3TL5 A;  5BPP A;  3ZEF A;  5JJ7 A;  2WXQ A;  4AEZ C;  3ESL A;  3GZS A;  3TXN A;  3G2U A;  5BV1 A;  1OWP A;  2VSN A;  4GAA A;  4H7X A;  4QEN A;  5G04 C;  1HO8 A;  4DI3 A;  2KZT A;  3M58 A;  4I2W A;  1XQH A;  3F9X A;  4JA9 A;  4O6F A;  3VV0 A;  3FHE A;  3LY9 A;  1IQU A;  2V8S E;  1INZ A;  3CBP A;  3OOI A;  3D9K A;  3LY8 A;  2LAI A;  3KD7 A;  4DLQ A;  3Q15 A;  3LKU A;  2I6H A;  5LX8 A;  3IHX A;  2WMN A;  4IRU A;  5FZQ A;  1HU3 A;  3PEV B;  3M57 A;  3K9I A;  3Q47 B;  4GCO A;  3CHQ A;  2GRL A;  1PAQ A;  4K0R A;  4JPS A;  2V5F A;  4WWP A;  1HH8 A;  2XPI A;  3MGB A;  4XI9 A;  3CQC B;  3RO2 A;  1MHQ A;  4BY6 A;  5EG2 A;  3EHN A;  3ZW3 A;  5KJM A;  5FJY A;  4YVO A;  1ZKK A;  1MQS A;  4BT8 A;  1TEZ A;  4N3B A;  3E4B A;  3ML9 A;  3BG1 B;  1ML9 A;  2IGQ A;  4UWH A;  5F6L A;  5T0K A;  4WAF A;  5EX0 A;  4FLH A;  2CHX A;  3U4T A;  5BNW A;  3APF A;  2C0L A;  4I43 A;  4M3O A;  1UJJ A;  4U07 A;  2J4D A;  3FEX A;  2O8J A;  3ML8 A;  3N71 A;  3NZU A;  3CKC A;  4CT0 A;  3D9I A;  4URK A;  4U0Z A;  3ZN3 A;  4E6H A;  3S8P A;  1UN9 A;  3VLF A;  3SBS A;  1OUV A;  3SNX A;  2NSZ A;  3MO2 A;  4GYW A;  2WQ6 A;  4I2Z A;  3TAX A;  5A6C A;  4I1M A;  5AEN A;  4BX8 A;  3UQ3 A;  4FUL A;  3R9A B;  4A3T A;  3S7J A;  3UT4 A;  5M72 A;  1PC2 A;  2XHE A;  2RFI A;  3AU4 A;  1HX8 A;  3DPD A;  4PH4 B;  3KAE A;  4I1A A;  3MV2 B;  4C0E A;  4I51 A;  3L08 A;  3FU5 A;  2OVF A;  3IBE A;  2WXP A;  2VQ2 A;  1WY6 A;  3FEY A;  3PUJ A;  1NZN A;  4YVQ C;  2GW1 A;  3ZFW A;  2J49 A;  2LNI A;  3SHF A;  3SWC A;  4BFR A;  2OVB A;  3MZL B;  4K03 A;  3F9W A;  4F3V A;  4Q96 A;  1E7V A;  5T5G A;  5LCW J;  1E90 A;  3ASD A;  3FUD A;  4H7Y A;  4BSX A;  4OVV A;  4RSY A;  4J8E A;  4IYP A;  2BTD A;  3OXF A;  4QFV A;  2PQR A;  2WMO A;  4YPU A;  4W9R A;  4FLB A;  3IV0 A;  2LAH A;  3FDH A;  3IHY A;  3PZD A;  3Q49 B;  4I9C A;  5JIN A;  2UY1 A;  2EQX A;  4FHK A;  2JV0 A;  1Z3Y A;  4YNP A;  2JEK A;  3RAY A;  4UWG A;  3IKO B;  3B7U X;  4YND A;  3L54 A;  5D0O D;  5CHE E;  4CEM A;  4EPZ A;  1E8Z A;  3APD A;  5JJ6 A;  4WNE A;  4DI4 A;  2RG8 A;  4APO A;  3FH7 A;  3CKB A;  4I1O B;  2Q7F A;  4B8C B;  2C0M A;  4N3A A;  3FTS A;  1JWF A;  4U0U A;  4RZ0 A;  1ELW A;  4AV7 A;  4OVU A;  4AU7 A;  5A7D B;  3KMT A;  5FQ7 A;  3PH0 C;  3U3W A;  2J08 A;  2OOE A;  3CBM A;  3MJW A;  3LS8 A;  4ABN A;  4JA7 A;  3M59 A;  3FY4 A;  5EX3 A;  3CVP A;  3FUF A;  4G2V A;  4I6G A;  4FJY A;  2MHK A;  5FWQ A;  4AIF A;  3D9J A;  3RU0 A;  2J07 A;  1H2U A;  5F6K C;  2WXR A;  2HR2 A;  1NP7 A;  4J8S A;  2KCK A;  3D3M A;  3DB5 A;  2WB2 A;  1E96 B;  2KM4 A;  3VUZ A;  5LCW C;  3ESK A;  2PL2 A;  2WXH A;  3IHV A;  1KT0 A;  3CHO A;  5JHN A;  3G2S A;  4AVX A;  1KT1 A;  4EZK A;  1H2V C;  4F1S A;  2KAT A;  4B94 A;  4G25 A;  4A55 A;  3L13 A;  2PZI A;  4HOR A;  4GPK A;  3CK9 A;  4KVO A;  4Z4P A;  2KCV A;  3CHP A;  3ZGQ A;  3CVX A;  3RK6 A;  3M54 A;  4CDN A;  2QFC A;  2V4L A;  4AOF A;  1NA3 A;  2CG3 A;  2YQ8 A;  4FJZ A;  2WQ7 A;  1PEG A;  3UT8 A;  4HLE A;  1E8X A;  5FTP A;  4KZC A;  3PS6 A;  3MX3 A;  5BV0 A;  4PUC A;  3LEW A;  1A17 A;  3PE4 A;  3WXX A;  1DNP A;  3L6A A;  5ARG A;  3PVL A;  5T0M A;  3O4Z A;  3PEU B;  2CFZ A;  2L6J A;  2AXZ A;  3FUK A;  3PRE A;  4HXI A;  4NQ0 A;  4UWF A;  3UPV A;  3D9O A;  3LVQ E;  4TUU A;  4XKC A;  4CDR A;  4HOS A;  4JLG A;  5JJT A;  2XQ0 A;  4CGV A;  4N2S A;  4UQY A;  1FCH A;  4KXK B;  4LCT A;  3OS5 A;  3FUL A;  3FUI A;  4XIF A;  1SQM A;  1WM5 A;  4JEH A;  3K5K A;  1LF8 A;  2AW6 A;  3CK7 A;  1S0P A;  3HDX A;  3ZYQ A;  3MO5 A;  2HYZ A;  3QWW A;  5AJD A;  4L2Y A;  1TJF A;  3PE3 A;  4KBQ A;  3ULQ A;  4D10 C;  5CMY A;  1X5B A;  2XGO A;  3QC1 A;  4GB9 A;  1UW4 B;  3FTZ A;  4MI0 A;  4O30 A;  5G05 C;  3CVL A;  3RIB A;  2J9Q A;  2WXK A;  3PUK A;  2WXF A;  3JCK C;  3ONL A;  5TTF A;  4WNF A;  2BF0 X;  4U04 A;  1NA0 A;  1EYH A;  4CRW A;  4FP7 A;  5G55 A;  4WNG A;  5ANL A;  4AP2 A;  5JHA A;  2IFU A;  4R7L A;  2I1J A;  2IJG X;  3UX4 A;  3RJV A;  4BUP A;  1W3B A;  4APF A;  3FUH A;  5DBK A;  4MS6 A;  3GZ2 A;  1P5Q A;  4N2Q A;  2VGX B;  1SZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...