3TG4A

Structure of smyd2 in complex with sam
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
427
structure length
427
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 145
structure length 427
sequence length 427
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg4A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg4A01
5G04C 4YPUA 4J8FA 4H7XA 2VSNA 4N39A 3CKCA 4AIFA 3LCAA 3GYZA 4UI9J 3MKRA 4O30A 2C2LA 3ASDA 4Y6CA 3ZHEA 2UY1A 3IEGA 1XQHA 2NC9A 3OXLA 2PL2A 3K5KA 3ASFA 4UQXA 4GCOA 3BEEA 3CEQA 5D0OD 2VGYA 3S7JA 3MV3B 3ESKA 5G05C 3DB5A 3RAYA 4IJ8A 1E96B 4NJ5A 3RQ4A 2KCKA 4H7YA 5F6LA 3MO2A 3ZHEB 2HYZA 5FZRA 3QWWA 4I9CA 5JJ0A 4BWRA 4U04A 3RO3A 3FWVA 3OXGA 3NF1A 4Z4PA 3CK7A 4GZ6A 5FTPA 4GYYA 1WM5A 3U4TA 4O6FA 4XI9A 2OOEA 3QDNA 4U0UA 1ZKKA 2QPWA 1A17A 4J83A 1KLXA 4ABNA 3VV0A 2QFCA 3M58A 1B89A 3URZA 4RG9A 3PDNA 5A7DB 4NRHB 4BTAA 3BO5A 2ONDA 1TJCA 1IHGA 4BT9A 2XCCA 3TAXA 5F59A 4UI9C 2IFUA 5T0KA 4I2ZA 2VGXB 3M55A 5LCWJ 2WQHA 5EKQD 1ML9A 4N3CA 4G25A 4GYOA 3VTXA 1KT0A 1MVXA 3CVPA 4BT8A 3RU0A 3N71A 3MO0A 4A1SA 3M56A 5TH7A 5EG2A 5LSXA 2XGSA 4U07A 3Q49B 4N2QA 3AS5A 2BQZA 1MT6A 3CBOA 4WNGA 4YPAA 2XEVA 5JIYA 4NVQA 3ZN3A 3SW9A 4JA7A 3UPVA 3EP0A 4I9EA 4AM9A 1HZ4A 2FBNA 3QOUA 4CGWA 4AY6A 4BUPA 1OUVA 2KATA 4HORA 2WPVA 2JLBA 3QWPA 4I17A 5F5EA 2R3AA 4AU7A 4U0ZA 4RG6A 5F6KC 4I1AA 5TTFA 5D0QD 3FPDA 5T5GA 1KT1A 3CVLA 1NZNA 5KJMA 3Q4AB 5EX0A 1XNFA 4GYWA 4UI9K 4U0SA 5JJ6A 3CVNA 3S7BA 1P5QA 3RIBA 2XPIA 4IJDA 2UWJG 5HQ8A 3Q15A 5BW8C 4YPEA 5LCWC 4I51A 4HOTA 2I6HA 2Q7FA 1MVHA 3ZGQA 5JINA 5C1DA 2C0LA 3CK9A 1YA0A 2V5FA 3AS8A 3CBPA 4J8OA 1QZ2A 4HOQA 4MI0A 1PC2A 5CHEE 5BT1A 3DALA 2KCVA 2YHCA 3LY9A 3F9WA 4UQYA 1ZU2A 4J7IA 1N6AA 5CCMA 3KMJA 2VGXA 5JHNA 3TG4A 2PZIA 3AS4A 2IGQA 2RFIA 2VSYA 2J9QA 4G26A 2AVPA 3PE3A 1MUFA 2VQ2A 2E2EA 4CGVA 3O48A 5JJ7A 2XCBA 4XI0A 4JHRA 3GW4A 4J7FA 3OOIA 4IN3B 3FFLA 2HO1A 2F69A 3RO2A 5KJNA 3IHXA 2Y4TA 2FF4A 1H3IA 5A6CA 5ARGA 4H12A 2XGOA 4N3AA 4LEUA 3SZ7A 3KAEA 4WNEA 4GA2A 2PQNA 2LSVA 4QENA 4HOUA 2LNIA 4J8DA 2VYIA 5T0MA 3SWCA 3VUZA 3ASHA 3CVQA 4G2VA 2XGMA 2GW1A 3FP3A 4AY5A 1PEGA 2C0MA 3WXXA 3TGOA 3HNAA 5KJLA 3CK8A 3KD7A 3GZ1A 3KMAA 2FI7A 4GA0A 3OPEA 4GPKA 3EDTB 3M5AA 3OS5A 3KMTA 3M57A 4BTBA 4HOSA 4J8EA 5FZSA 4KYOB 4WUYA 4EQFA 2FO7A 4JA9A 3Q5MA 3M54A 2IF4A 4C1QA 4APOA 3MV2B 3CBMA 4UQZA 5KJKA 3CKBA 3VTYA 4WNDA 2Y4UA 4QEPA 1ZBPA 3U3WA 4QEOA 4YNPA 3K9IA 3RJVA 3S8PA 3CV0A 4G24A 1HXIA 4I2WA 3F9YA 3OXFA 4YNDA 3UUXA 5HI7A 2W5YA 4J0UA 5DBKA 2MHKA 2DBAA 5FZQA 2HR2A 3MO5A 3RJWA 3QKYA 3S7FA 1Y8MA 4JL0A 4N3BA 1N3JA 5FJYA 3LPZA 2FEZA 4LDGA 2UY1B 4WNFA 4N2SA 3M59A 4G23A 5AYWD 2KC7A 3LKUA 3F9XA 3ZPJA 3LY8A 5G04J 4YVOA 3M53A 5CPRB 1QQEA 5CCLA 4B94A 4ME2A 1NA3A 1ELRA 3ASGA 5TEGA 5FT9A 1W3BA 4NQ0A 1FCHA 4JDSA 4JLGA 4W9RA 4GCNA 2O8JA 4GZ3A 4G1TA 3JYSA 3MEKA 2PQRA 2YQ8A 3LYAA 3QWVA 3RKVA 1ELWA 4KBQA 4YVQC 2P58C 5G05J 3GZ2A 3ULQA 1HH8A 2G46A 3HYMB 4XIFA 3TG5A 4RZ0A 2LSUA 5DIZA 3MA5A 2JV0A 1NA0A 5ARFA 4N5CA 3Q47B 2BUGA 4GA1A 5M72A 4GZ5A 3UQ3A 1WAO1 4Y6WA 5AYFA 3KS2A 4KXKB 2KCLA 3F9ZA 5LSZA 4E47A 2W5ZA 3ZFWA 5EX3A 4YNMA 1O9SA 1N6CA 4CDRA 5BNWA 4F3VA 3LY7A 3PE4A 5JJTA 2R5SA 2L6JA 3R9AB 4FMUA 1IYGA 4MI5A 3SF4A 3S7DA 3E4BA
chains in the Genus database with same CATH superfamily
3CGHA 4M3OA 4EHMA 5FIOA 3DSSA 4AVXA 2VSNA 1OCOE 2XHEA 4I6EA 3APFA 3L08A 4UI9J 1O1TA 3FUFA 3UT8A 3DPDA 4L7TA 4Y6CA 4WAFA 2UY1A 3E32A 1DNPA 1HG2A 3B7BA 3CEQA 3TWWA 4JHJA 3DPYA 4G8LA 4O60A 2PM6A 4UUCA 1E90A 4NJ5A 4TUMA 3TXMA 2P9KG 4LUNU 5FZRA 4BX9A 3GZSA 2H6FA 5JJ0A 4BWRA 4DI3A 3I4GA 3OXGA 1BI7B 3L16A 2QZAA 5AN8A 2XS1A 5A23A 1A5EA 1E8XA 2IOLA 4XI9A 2OOEA 4AP2A 4HLEA 3X2QE 1ZKKA 3SNXA 3L13A 4A3TA 1KLXA 4EBAG 2XRZA 1B89A 1QYMA 4L2YA 1U3CA 3FHEA 2DZNA 3ENEA 3BO5A 2ONDA 3NZSA 1TJCA 3FUEA 3AU5A 3W9GA 4MLPA 3NOCD 4U7EB 4DX6D 3DSVA 3F6QA 2VGXB 5KNGA 4G25A 3ABKE 4GYOA 4RLYA 3VTXA 1KT0A 2WXJA 4GTSA 1MVXA 1JWFA 3MO0A 4A1SA 3M56A 2WXRA 5TH7A 4EZKA 4ATGA 5EG2A 3UM2A 3ML8A 4U07A 2V0PA 4A55A 2CG3A 1SZAA 2CHZA 2WXKA 2WXHA 4WWPA 3ZYMA 4KZ0A 5CBOA 3EP0A 3FEYA 3FU0A 3QOUA 4K03A 3T8KA 4BUPA 1Q2ZA 4DLOA 2OVFA 4CRWA 4FHJA 4HORA 2EIKE 2Y0BG 1IQUA 3PEVB 3ZXSA 2F0YA 3EHRA 2B0OE 4BETA 3VLDA 1KT1A 2V4HC 4MKTA 2J09A 3PEUB 5B1BE 5AQBA 2V5QC 4GTVA 3MGBA 1K3ZD 3CQGB 5FQ6A 1UJKA 4YPEA 3PREA 4I51A 3PNLB 4LNGA 2AXUA 2H6IA 1YA0A 1LF8A 1QZ2A 5AARA 4HXIA 1O5MA 1PC2A 3G2UA 4XZ4A 2P9LG 1NL4A 3LY9A 4UQYA 3V2OA 1SA4A 2X6JA 3AS4A 2DIWA 2IGQA 2KZTA 4G26A 1HU3A 1EPUA 3J5QB 2QYUA 4JC8A 4CGVA 3O48A 5JJ7A 2XCBA 4JHRA 3UKRG 3GW4A 2XPYA 4IN3B 1OXJA 1UW4B 3BUAA 3CHRA 3RO2A 2Y4TA 3U9WA 2FF4A 3QB2A 4JPSA 4HLLA 1N4PA 4K5CA 5CRVA 5HS0A 4N3AA 4LEUA 2PQNA 2LSVA 3APDA 3WG7E 1N4RA 3PNTB 3SWCA 1E7VA 1ELKA 3FTXA 2CHXA 3ASHA 3CVQA 2BKGA 2XGMA 4HNAD 4HFGA 4JXTA 3MKQA 2ILRA 5FQ7A 3HVEA 3D9PA 3HDXA 2PNNA 1G3NB 5FWQA 3WXXA 4DX7D 3TGOA 3HNAA 1WDYA 2EIME 4PUCA 4FADA 4GA0A 2ETCA 3FUHA 2IQCA 2Y1LE 2IU1A 3M54A 1DCEA 3HVEB 2OVBA 3E37A 3MV2B 4KVOA 4HI8A 5ENOD 3CKBA 3VTYA 4WNDA 3SGHA 3ZYQA 3SY2A 4QEPA 3Q75A 5AJLA 1ZBPA 1QBQA 1Z5SC 4JEHA 4LERA 4OAUC 4RVBA 3S8PA 2XEEA 4G24A 4Q69A 2W5YA 2MHKA 2DBAA 2HR2A 2EILE 3RJWA 3FDHA 3QKYA 1Y8MA 4JL0A 1K8KG 4EBAA 3FTUA 2FEZA 1TN8A 4N2SA 4G23A 4PS3A 2LXLA 4B0ZA 2WXFA 2ZISA 1MHQA 3ZPJA 3T5VA 5G04J 4DRXE 4YVOA 5CPRB 1QQEA 5CCLA 2GROB 3UKUG 1E8YA 3Q9UC 3QAQA 1LD7A 3LS8A 2VSXE 4B8AA 4GCNA 4G1TA 1HO8A 3T5XA 5BPPA 3LYAA 3PH0C 4V3IA 1ELWA 1E8ZA 2QC9A 4LSZE 5G05J 3BG1B 3GZ2A 2NSZA 2G46A 2LSUA 3MA5A 1S0PA 2JV0A 3SI5A 4FC8A 3LVRE 2BUGA 1WAO1 4Y6WA 4JHKA 2W5ZA 3EIQC 1TNBA 3SBSA 3ZFWA 3CHQA 5EX3A 3SHFA 4YNMA 4U96D 2KM4A 2ZGDA 2OEWA 4FA6A 3R9AB 5BV0A 4YPUA 3E34A 3UM1A 4AIFA 3GYZA 4GB9A 3MKRA 3FUIA 4PS8A 4A63B 4KZCA 1S64A 3ZHEA 2I1JA 3IEGA 2NC9A 4ANUA 3K5KA 4RSYA 3T9KA 3PRZA 5ENTD 3ZVVA 4GCOA 3ZNGA 3DEOA 2P9NG 3DB5A 3LJ3A 3RAYA 3EUVA 1E96B 3Q79A 3Q7FA 3Q7AA 5F6LA 4U95D 3ZHEB 2HYZA 3QWWA 3SQVA 2LUHA 1K1AA 3RO3A 3EU5A 3UX4A 2P9PG 3NF1A 4K5AB 2WXGA 3TWSA 4GZ6A 5EN5D 1HX8A 3DRAA 3IHVA 1U3DA 4ABNA 2QFCA 2A4ZA 2WQ6A 2ETAA 1BI8B 1N52A 3JXJA 4ANWA 3PDNA 4F6RD 2GRNB 3Q78A 4BT9A 5ENSD 2V4LA 5AQ9A 3ESLA 4CCAA 5F59A 3S2AA 1OWLA 3CVWA 4UI9C 2IFUA 3JUEA 5EKQD 3CVPA 2BTDA 3RU0A 4UWGA 4Q94A 3TL5A 2IOSA 4URKA 3JUIA 2GRMA 2HM8A 5LSXA 3Q73A 2BQZA 1H0AA 4F1SA 1IXVA 3CBOA 5CEAA 4YPAA 4CEMA 2XEVA 5LFAA 4HS2A 3FUMA 4BX8A 4GU5A 3KEAA 5T8IA 4JA7A 3FEXA 4I9EA 3TWQA 2FBNA 4CGWA 2ZU6B 5D2MC 2QY7A 3BU8A 2KATA 2WPVA 5F5EA 4AU7A 2R3AA 3CR3A 4G11A 5LP0A 4QQIA 2DWZA 1RZ4A 2BKKB 5CERB 4F7AA 5KNHD 5KJMA 1OT8A 1XNFA 4GYWA 4B93B 3DSXA 2ZXWE 3PZDA 4U0SA 5JJ6A 3CVNA 3S7BA 1DCQA 3C98A 3JCKC 4MBGA 3Q15A 3HRAA 5BW8C 3RK6A 3NZUA 4HI9A 3IV0A 3LEWA 1AWCB 4TXRA 4HOTA 2XEHA 2I6HA 4DLQA 1MVHA 3FUNA 5C1DA 5EIDA 2J08A 4EECA 1WY6A 1D9SA 2I2OA 4J8OA 4HOQA 3TJPA 2ETBA 3NOGD 1SZ9A 4J7IA 2VGXA 3VLFA 3SFYA 3AU4A 4JEUA 2J9QA 2VQ2A 5H7PA 2E2EA 3D9IA 4B89A 2NXPA 3ZW3A 2WQ7A 3OOIA 1N0QA 2FULA 2B6CA 3FFLA 2F69A 3W9FA 3FY4A 3HXCA 4CDNA 3QC1A 2A5EA 3FTSA 1WG0A 4J8YA 1D8EA 3KAEA 3ASNE 4WWNA 2WXNA 3U64A 4BSZB 4J8DA 3UXGA 4LG6A 3D9MA 5T0MA 1O1RA 4PDXA 4G2VA 5ENPD 2NYJA 3FP3A 1E8WA 2IEJA 5EYLA 3UM3A 3CK8A 3KD7A 3AG2E 2FI7A 2AWIA 1BU9A 2KXPC 4BERA 1JUQA 4U8HA 4ANXA 3OPEA 3EDTB 4J8EA 4EQFA 2P9SG 2WXIA 4C1QA 3QNKA 3CLJA 4F53A 3DSUA 3RRMB 3CBMA 3PS6A 4RQIA 1HE8A 2Y4UA 5KWDA 3SO8A 3DSWA 5B1AE 3LJNA 3G2TA 4YDEA 3RJVA 3NBNB 4AOFA 4PS7A 1HXIA 3MJWA 3D9JA 3F9YA 3ASOE 4J0UA 1TR4A 5DBKA 5FZQA 3MO5A 2H6GA 4N3BA 5B3SE 1N3JA 2X6KA 3FTVA 1Z6TA 2J07A 3M59A 5AYWD 4X8QA 5CECB 4L23A 3UIOC 1OCRE 2VSOE 1V54E 4J8SA 5AENA 5ENRD 3LY8A 5KCMA 2EIJE 3M53A 1NFIE 3FH5A 4A1GA 2LAIA 4JZYA 3ASGA 5TEGA 1E7UA 4R7LA 1W3BA 1FCHA 4JDSA 4JLGA 3JYSA 2PQRA 2YQ8A 3QWVA 1X81A 3RKVA 5LOZA 3B13A 3RAUA 4MRUA 3L22A 3ULQA 4XX5A 3ZIMA 3TXNA 4O1OA 3EU9A 5AAOA 2Y3AA 3DXKG 3TWTA 4RZ0A 5EDSA 1ZB1A 1NA0A 5T4YA 1UN8A 4NACA 3PZ4A 3UI2A 4GA1A 4GZ5A 5E76A 5M72A 2I1KA 1H6OA 3KS2A 4WWOA 1UN9A 5LSZA 3NAWA 4GPMA 4I6GA 2RFAA 2GRPB 1EDUA 2JABA 4FHKA 4YDWA 1JWGA 1O9SA 1EF1C 3R9MA 4CDRA 3HXBA 5BNWA 4F3VA 1DC2A 5JHBA 3LY7A 1IKND 3I4RB 2R5SA 2L6JA 4MI5A 3ZYLA 3ML9A 3S7DA 3E4BA 5G04C 4J8FA 4H7XA 3FTWA 4DX5D 5FQ8A 1H2UA 2JEKA 3LDZA 2DZOA 3EHNA 4TRQA 4UQXA 3ZYKA 2EINE 2AW6A 4DK5A 2VGYA 3MV3B 3ESKA 5G05C 3I3NA 1N54A 2DCPA 3DXMG 3RQ4A 2RKKA 4BY6A 4I9CA 1FT2A 4I1OB 3G2VA 2VJ8A 4HB5A 3FWVA 4GZCA 4FLHA 5FTPA 2IO3C 4GYYA 1WM5A 4GZDA 1NP7A 4O6FA 2E0IA 4CDMA 4U0UA 4F1PA 1QNFA 1TNYA 3L6AA 2QPWA 5EILA 3VLEA 3HHMA 3VV0A 3M58A 2VTBA 2XZDG 3URZA 3QARA 2Y69E 4RG9A 3IHYA 5J08A 2OCCE 5ANRA 3B7SA 4NRHB 4ZHBA 1YYHA 1IHGA 3L82A 4ZFHA 1KZPA 2XCCA 4XE0A 4ACLA 5T0KA 4UWHA 2VTBB 3M55A 5LCWJ 1ML9A 3HXFA 4BT8A 3N71A 4UWLA 4TUUA 1PAQA 2XGSA 3FU6A 4UWKA 2YNQA 1MT6A 1YMPA 5JIYA 3I5PA 2P9IG 2RFMA 4NVQA 3ZKJA 1SVXA 4ILIA 4OVUA 4AEZC 5IY5E 4CT4A 4AM9A 3ISMC 2WXOA 4GAAA 4E85A 1OUVA 3AG3E 2R2LA 2YINA 2X6FA 4U0ZA 2CFZA 2WB2A 5AIJA 1HFAA 4I1AA 3SBTB 4U8YD 4TXQA 4OAVB 3CVLA 4FJZA 3AJIA 1NZNA 1TN7A 4J7WA 3Q4AB 5EX0A 4NURA 3UMVA 3C3QA 4GMRA 2WMOA 3NQPA 3ONKA 3B7UX 2Q7FA 3ZGQA 2C0LA 2WXLA 3MCXA 2QYJA 3TWXA 3CBPA 4C48B 4MS6A 4GTMA 4MI0A 3APCA 2KCVA 2YHCA 3SFXA 4BFRA 3F9WA 3B95A 1N6AA 5G55A 5JHNA 2DVWA 1TEZA 5BV1A 2OEVA 3P2BA 2RD0A 2VSYA 4GMLA 4DI4A 3PE3A 3HG0D 1JCSA 2L9BA 4TV3A 2LO6A 4ILGA 2AXZA 3FULA 1FT1A 4GTOA 2HO1A 2WM9A 5G2NA 4XKCA 3IHXA 2LXMA 3D9KA 4EPZA 1H3IA 5KBAA 4H12A 5CMYA 3SZ7A 3CHOA 4WNEA 4DJAA 1LTXA 1H2TC 3CHSA 2BEDA 2J49A 5HRYA 3DEPA 4LCTA 4K0RA 4OVVA 1BLXB 1HS6A 1RW2A 1S70B 2GW1A 2R02A 3IBEA 2IY0C 4P29A 2C0MA 2M63A 5KJLA 3GZ1A 4I6JA 3RSEG 1S63A 4GPKA 3M5AA 3KMTA 3M57A 4KYOB 4WUYA 3ZEFA 2AXVA 2CFUA 2FO7A 3Q5MA 1BPOA 2IF4A 2RG8A 3BQOA 1OWPA 3BG0B 4I1MA 5D66A 3V79K 1OCZE 3V2XA 3PZ1A 4XKBA 4XEIG 3CSTA 3UTMA 3K9IA 1N9AA 5EYPF 3UT7A 4YNDA 3UUXA 5HI7A 1U2VG 3MYVA 3AG1E 3LPZA 3PZ2A 4LDGA 2UY1B 4HRNA 3OTNA 1MJ0A 3LKUA 3TWUA 3EHMA 4HRLA 3V30A 1TNZA 4APFA 3MX3A 4B94A 3FU5A 1L5JA 2GRRB 1VDYA 1NA3A 4HRMB 2WXMA 4GTQA 2OV8A 4NQ0A 3B7RL 3NB2A 4W9RA 2L0IA 4GZ3A 1OWNA 3UT4A 1GW6A 3MEKA 4GTTA 3KEZA 1MX4A 5LX8A 3B7TA 1JCQA 5JHAA 4AV7A 1HH8A 2XRYA 4J6IA 2L0TB 4O1PA 5DIZA 3TWRA 3U66A 1FPPA 5ARFA 4DPRA 3PUKA 1EYHA 3UQ3A 5AYFA 3F9ZA 4GTPA 3KSQA 5C2YA 1H6KA 2I9CA 4A3VA 1NI1A 1N6CA 1N0RA 4JB8P 2X38A 5JJTA 3L54A 4FMUA 4CZ2D 2WVIA 3DBSA 3FH7A 2YHEA 2IO2C 3C5RA 4N39A 3CKCA 3QJZA 3LCAA 1FVHA 3EJNA 1X5BA 2P9UG 4L9PA 4O30A 2ZIRA 3CVVA 2C2LA 3LVQE 3ASDA 2MOWA 3JXIA 3PVLA 3IKOB 3L9TA 2XPZA 2R05A 2MRIA 2J4DA 5AQAA 2FO1E 1XQHA 3ZXPA 3OXLA 2PL2A 3ASFA 1H19A 1PY1A 2X6HA 3AG4E 3BEEA 4N5QA 5D0OD 5HKPA 3S7JA 2J4BA 2GRQB 4IJ8A 5FQ4A 3L17A 5FINA 3FUKA 3KSLA 2KCKA 2F8XK 2X6IA 4H7YA 3MO2A 1OWMA 3T8MA 3V31A 4U04A 3ONLA 4KVMA 4Z4PA 3CK7A 3SD5A 2GGFA 4UWFA 2AJAA 3U4TA 4L1BA 3P1UA 3ULEG 3D9NA 2R59A 3QDNA 4IRUA 4GTRA 2A5UA 2BF0X 1A17A 3FTZA 4J83A 3ABLE 2R03A 2WMNA 5A7DB 1N94A 3R7QA 4BTAA 3CHMA 2ZGGA 5BUZA 3TAXA 1FVFA 5JMND 1D8DA 1TYQG 1N11A 4I2ZA 1N95A 3D9HA 1TNOA 2WQHA 4N3CA 4AJWA 2KZTB 2GRLA 1INZA 4KMOA 3R7RA 4FULA 3Q49B 4N2QA 3AS5A 5ITZF 1DVPA 4WNGA 3CVUA 3ZRHA 1KPSB 3JQ1A 3ZN3A 3SW9A 2X3MA 3UPVA 3UM0A 1HZ4A 5AJDA 3CVYA 1K1BA 2P2CP 4AY6A 4JVSA 4YDOA 2JLBA 3QWPA 4I17A 1Y6IA 1YCSB 1BD8A 4DX1A 4RG6A 5F6KC 5TTFA 3D3MA 5D0QD 3FPDA 5T5GA 3CSFA 1SW6A 3MKQB 4NIKA 1MYOA 4UI9K 3IXEA 1P5QA 3RIBA 2XPIA 4IJDA 4E6HA 2CHWA 2UWJG 2L6BA 5HQ8A 3PUJA 4LRZA 3J5PA 4JD2G 1HG5A 3HIZA 4GMJA 5LCWC 4C9BB 5CRUA 4ILHB 3CVXA 1UOHA 1SA5A 4D10C 5JINA 4FJYA 2XZTG 3CK9A 3Q9NC 1N4SA 3O4ZA 2WXPA 2F8YA 4YDYA 2V5FA 3AS8A 3SFZA 5T3RA 5ENQD 4FU3A 5CHEE 3G2SA 5BT1A 3DALA 2DYRE 4C0MA 1OCCE 1TN6A 4G8KA 1ZU2A 5CCMA 3FU3A 3KMJA 5BXUA 4I43A 2LAHA 3EHQA 3TG4A 2PZIA 4IULA 1Z3YA 1MX6A 5BXOA 4QFVA 2RFIA 4EZLA 3MZLB 3D9OA 2XENA 2AVPA 1MUFA 4C0EA 3ZU7B 4XI0A 1H6PA 4M7CA 4CT0A 4EZJA 4OYSA 4J7FA 1JCRA 3CIAA 3FH8A 4PH4B 3C72A 1V55E 4KT6B 5KJNA 3FUJA 4AXHA 4U8VD 5A6CA 2R17C 5ARGA 3E33A 2XGOA 3PZ3A 3CHPA 1SQMA 4GA2A 4QENA 4HOUA 3HXEA 2LNIA 2VYIA 2KBXA 1IQRA 3VUZA 1MQSA 2J8SD 4HBDA 1TNUA 3RRUA 2VGEA 4AY5A 1PEGA 4BESA 1XGWA 4L2LA 4IYPA 4BEPA 3KMAA 3HXDA 4B8CB 3OS5A 4DX2A 5CBNA 4JW1A 2DYSE 4BTBA 3FUDA 4HOSA 1O1SA 5FZSA 3RRNB 4JA9A 4APOA 4DUIA 1KZOA 4UQZA 5KJKA 1H2VC 2H6HA 4ACKA 3U3WA 4QEOA 3ULYA 4YNPA 4Z68A 2HE0A 3CV0A 4I2WA 3OXFA 5CMWA 1N4QA 4TXPA 3C3RA 4HQDA 3C3OA 4LNUD 4K5BA 3S7FA 2WXQA 1IHBA 5CEDB 3TWVA 5FJYA 4LNBA 4WNFA 1HF8A 4CYMD 2XQ0A 2KC7A 3F9XA 3UINC 5J90A 4FP7A 3DWLG 1MX2A 3FTYA 2EQXA 5ENNA 5E75A 3ABME 4ME2A 5JA4D 1ELRA 2MYOA 1UG3A 5FT9A 3G2WA 4FLBA 5EIBE 4ATZD 4U63A 5AQ7A 1TJFA 2O8JA 3OAWA 4ANVA 4KBQA 4YVQC 4BSXA 2P58C 3DSTA 2PM7A 1OWOA 3HYMB 4XIFA 3TG5A 1UJJA 3ZUVB 2V8SE 1LD8A 3UIPC 4N5CA 3Q47B 4HVBA 2IJGX 3LXUX 1OY3D 4KXKB 2KCLA 1Z3XA 2F37A 2XS8A 3EIJA 4E47A 4Q96A 3QK0A 3E30A 3CQCB 5ANLA 1MZCA 3AAAC 1AP7A 3JQ0A 2CG2A 3PE4A 3D9LA 2IONA 1IYGA 3SF4A 1JPLA
chains in the Genus database with same CATH topology
5G04C 3CGHA 4M3OA 5BV0A 4YPUA 4J8FA 4AVXA 4H7XA 2VSNA 2XHEA 3FTWA 4I6EA 4N39A 3APFA 3CKCA 3QJZA 4AIFA 3LCAA 1FVHA 3GYZA 3EJNA 3L08A 1X5BA 4GB9A 4UI9J 3MKRA 3FUFA 4O30A 3UT8A 3CVVA 2C2LA 3LVQE 3ASDA 5FQ8A 3DPDA 2MOWA 3FUIA 4L7TA 4PS8A 4Y6CA 1H2UA 3IKOB 3PVLA 4KZCA 4WAFA 2XPZA 2JEKA 3LDZA 3ZHEA 2UY1A 2MRIA 2I1JA 2J4DA 3IEGA 1XQHA 2NC9A 3OXLA 2PL2A 3EHNA 4ANUA 3K5KA 4TRQA 3ASFA 1H19A 4RSYA 1PY1A 2X6HA 3PRZA 4UQXA 3ZYKA 3ZVVA 1DNPA 4GCOA 2AW6A 3BEEA 4DK5A 1HG2A 3CEQA 5D0OD 2VGYA 3S7JA 3MV3B 3ESKA 4JHJA 5G05C 3DB5A 3I3NA 2J4BA 3LJ3A 1N54A 2DCPA 3RAYA 2PM6A 4IJ8A 1E90A 5FQ4A 1E96B 3L17A 4NJ5A 3FUKA 3RQ4A 2KCKA 4BY6A 3TXMA 2X6IA 4H7YA 4LUNU 5F6LA 3MO2A 3ZHEB 2HYZA 1OWMA 3QWWA 4I9CA 5FZRA 3T8MA 4BX9A 3GZSA 4I1OB 5JJ0A 3G2VA 4BWRA 4U04A 4DI3A 2VJ8A 3I4GA 3ONLA 3RO3A 3FWVA 4KVMA 3OXGA 3UX4A 3NF1A 4Z4PA 4GZCA 2WXGA 3CK7A 3SD5A 4FLHA 2GGFA 4UWFA 4GZ6A 5FTPA 3L16A 4GYYA 1WM5A 3U4TA 4L1BA 3P1UA 4GZDA 1NP7A 5A23A 4O6FA 1E8XA 2IOLA 4XI9A 2OOEA 1HX8A 3D9NA 2E0IA 4AP2A 2R59A 3QDNA 4U0UA 4CDMA 1QNFA 4IRUA 4HLEA 2A5UA 3L6AA 1ZKKA 2BF0X 3SNXA 3L13A 4A3TA 3VLEA 2QPWA 3HHMA 1A17A 1U3DA 1KLXA 3FTZA 3IHVA 4ABNA 4J83A 2QFCA 3M58A 2A4ZA 4EBAG 2XRZA 1B89A 2WQ6A 2VTBA 3URZA 3QARA 4L2YA 1U3CA 1N52A 4RG9A 4ANWA 3IHYA 3FHEA 3PDNA 5J08A 5ANRA 3B7SA 2WMNA 5A7DB 3R7QA 3ENEA 4NRHB 4BTAA 3BO5A 3CHMA 2ONDA 1TJCA 3NZSA 3FUEA 1IHGA 3AU5A 4BT9A 5BUZA 2XCCA 2V4LA 4MLPA 3ESLA 4XE0A 4CCAA 3TAXA 5F59A 1FVFA 1OWLA 3S2AA 3CVWA 4UI9C 4ACLA 2IFUA 5T0KA 4UWHA 4I2ZA 2VGXB 2VTBB 3M55A 5LCWJ 2WQHA 5EKQD 1ML9A 4N3CA 4G25A 4GYOA 4AJWA 3VTXA 1KT0A 2WXJA 1MVXA 2KZTB 3CVPA 2GRLA 2BTDA 3RU0A 4BT8A 3N71A 4UWGA 1JWFA 4Q94A 4UWLA 4A1SA 4TUUA 3MO0A 3TL5A 2IOSA 1PAQA 1INZA 2WXRA 3M56A 4URKA 3JUIA 4KMOA 3R7RA 4EZKA 4ATGA 5TH7A 2GRMA 2HM8A 5EG2A 5LSXA 2XGSA 3ML8A 4U07A 4FULA 3FU6A 3Q49B 4UWKA 3AS5A 4N2QA 2BQZA 1H0AA 4F1SA 2V0PA 2YNQA 1MT6A 1DVPA 4A55A 4WNGA 3CBOA 3CVUA 3ZRHA 2CG3A 4CEMA 4YPAA 2XEVA 1SZAA 5JIYA 3I5PA 2CHZA 5LFAA 4HS2A 3FUMA 4NVQA 3JQ1A 2WXKA 4BX8A 4ILIA 3ZN3A 2WXHA 4OVUA 4WWPA 4AEZC 3SW9A 4GU5A 2X3MA 3ZYMA 4CT4A 5T8IA 4JA7A 3FEXA 4KZ0A 3UPVA 3EP0A 3FEYA 4I9EA 3FU0A 4AM9A 1HZ4A 5AJDA 2WXOA 2FBNA 3CVYA 3QOUA 4K03A 4CGWA 4GAAA 2ZU6B 4E85A 4AY6A 2QY7A 4JVSA 4BUPA 1OUVA 4DLOA 2OVFA 4CRWA 2KATA 4FHJA 4HORA 2WPVA 1IQUA 3PEVB 2JLBA 2YINA 3QWPA 1Y6IA 4I17A 3ZXSA 2X6FA 3CR3A 2R3AA 4U0ZA 5F5EA 4AU7A 4G11A 2CFZA 5LP0A 4RG6A 2WB2A 5AIJA 1HFAA 5F6KC 4I1AA 3SBTB 5TTFA 3D3MA 5D0QD 3VLDA 3FPDA 5T5GA 1KT1A 3CVLA 4FJZA 1NZNA 4MKTA 4F7AA 3CSFA 2J09A 5KJMA 3MKQB 3PEUB 3Q4AB 5EX0A 1XNFA 4GYWA 3PZDA 4UI9K 4U0SA 5JJ6A 3CVNA 3S7BA 3C98A 3JCKC 3MGBA 4NURA 3UMVA 1P5QA 3RIBA 2XPIA 3CQGB 4IJDA 4E6HA 2CHWA 5FQ6A 2UWJG 5HQ8A 3Q15A 5BW8C 3PUJA 3RK6A 3NZUA 4LRZA 1UJKA 4YPEA 5LCWC 2WMOA 1HG5A 3HIZA 3IV0A 4GMJA 3LEWA 3NQPA 3PREA 4HVBA 3ONKA 4C9BB 4I51A 4HOTA 3PNLB 2I6HA 4DLQA 3B7UX 4ILHB 2Q7FA 3CVXA 1MVHA 3ZGQA 4D10C 5JINA 4FJYA 3FUNA 2AXUA 5C1DA 3ML9A 2C0LA 3CK9A 2WXLA 2J08A 3O4ZA 3MCXA 2WXPA 1YA0A 4EECA 2V5FA 3AS8A 1WY6A 3SFZA 5T3RA 3CBPA 2I2OA 4J8OA 1LF8A 1QZ2A 4HOQA 4MS6A 4FU3A 3TJPA 4HXIA 4MI0A 1PC2A 5CHEE 3G2SA 5BT1A 3APCA 3DALA 3G2UA 4XZ4A 4C0MA 2KCVA 2YHCA 3VV0A 3LY9A 1SZ9A 4BFRA 3F9WA 4UQYA 1ZU2A 4J7IA 1N6AA 5G55A 5CCMA 3FU3A 3KMJA 2VGXA 5JHNA 2X6JA 4I43A 2LAHA 3TG4A 2PZIA 3AS4A 4IULA 3VLFA 5BPPA 1Z3YA 2DIWA 1TEZA 5BV1A 3AU4A 4JEUA 4QFVA 2IGQA 2RFIA 3P2BA 2KZTA 2RD0A 4EZLA 2VSYA 2J9QA 3D9OA 3MZLB 4G26A 1HU3A 4GMLA 4DI4A 1EPUA 2AVPA 3PE3A 1MUFA 2VQ2A 4C0EA 4JC8A 2E2EA 3D9IA 2L9BA 3O48A 4TV3A 4CGVA 5JJ7A 2LO6A 2XCBA 4XI0A 4CT0A 4JHRA 4ILGA 2AXZA 3FULA 4B89A 3GW4A 4OYSA 4EZJA 2NXPA 4J7FA 3CIAA 3ZW3A 2XPYA 2WQ7A 3FH8A 3OOIA 4IN3B 2FULA 4PH4B 3FFLA 2HO1A 2F69A 4KT6B 1UW4B 2WM9A 3FY4A 5G2NA 4XKCA 4CDNA 3CHRA 3RO2A 5KJNA 3IHXA 2Y4TA 3U9WA 2FF4A 3FUJA 4AXHA 3D9KA 3QC1A 3QB2A 4EPZA 1H3IA 5A6CA 2R17C 3FTSA 4JPSA 5ARGA 4H12A 5CMYA 2XGOA 4N3AA 4LEUA 3SZ7A 3CHOA 3KAEA 4WNEA 3CHPA 1SQMA 4GA2A 2PQNA 2LSVA 3APDA 4WWNA 4QENA 4DJAA 4HOUA 2WXNA 3U64A 2LNIA 1H2TC 3CHSA 4J8DA 2J49A 2VYIA 3D9MA 3PNTB 5T0MA 3SWCA 1IQRA 4LCTA 4OVVA 1MQSA 1E7VA 4K0RA 3VUZA 1HS6A 1ELKA 4PDXA 3FTXA 2CHXA 3ASHA 3CVQA 3RRUA 4G2VA 2XGMA 4HFGA 4JXTA 2GW1A 3FP3A 3IBEA 3MKQA 2ILRA 1E8WA 5FQ7A 4AY5A 3HVEA 4P29A 3D9PA 3HDXA 1PEGA 5FWQA 2C0MA 2M63A 3WXXA 1XGWA 3TGOA 5KJLA 3HNAA 3CK8A 3KD7A 4L2LA 4IYPA 3GZ1A 3KMAA 4I6JA 4PUCA 2FI7A 2AWIA 4B8CB 4FADA 1JUQA 4GA0A 4U8HA 4ANXA 4GPKA 3OPEA 3EDTB 3M5AA 3OS5A 3FUHA 3KMTA 4JW1A 3M57A 4BTBA 3FUDA 4HOSA 2IQCA 4J8EA 5FZSA 2IU1A 4KYOB 4WUYA 4EQFA 3RRNB 2AXVA 2CFUA 2FO7A 4JA9A 3ZEFA 2WXIA 1BPOA 2IF4A 2RG8A 3Q5MA 3M54A 4C1QA 3HVEB 3QNKA 3CLJA 4APOA 2OVBA 3MV2B 4KVOA 4F53A 3RRMB 3CBMA 1OWPA 3BG0B 3PS6A 4UQZA 5KJKA 3CKBA 1H2VC 3VTYA 4I1MA 4WNDA 3SGHA 1HE8A 3ZYQA 2Y4UA 4ACKA 4QEPA 5AJLA 4XKBA 1ZBPA 3U3WA 4JEHA 4LERA 4QEOA 4YNPA 3G2TA 3CSTA 4RVBA 3K9IA 3RJVA 4AOFA 3S8PA 4PS7A 3CV0A 4G24A 1HXIA 4I2WA 3MJWA 3D9JA 3F9YA 3UT7A 3OXFA 4YNDA 3UUXA 4Q69A 5HI7A 5CMWA 2W5YA 4J0UA 2MHKA 5DBKA 2DBAA 5FZQA 2HR2A 3MYVA 3MO5A 3RJWA 3FDHA 3QKYA 3S7FA 2WXQA 1Y8MA 4JL0A 4N3BA 1N3JA 2X6KA 5FJYA 4EBAA 3FTVA 3FTUA 3LPZA 2FEZA 4LDGA 2UY1B 4WNFA 4N2SA 1HF8A 3OTNA 1Z6TA 2J07A 2XQ0A 4G23A 3M59A 4PS3A 5AYWD 4B0ZA 2KC7A 3LKUA 3F9XA 3EHMA 4L23A 2WXFA 5J90A 1MHQA 2VSOE 4FP7A 3ZPJA 4J8SA 3T5VA 5AENA 3LY8A 5G04J 3FTYA 2EQXA 4YVOA 5KCMA 4APFA 3MX3A 3FH5A 5ENNA 5E75A 3M53A 5CPRB 1QQEA 4A1GA 5CCLA 4B94A 2LAIA 4ME2A 3FU5A 1L5JA 1VDYA 1NA3A 1ELRA 1E8YA 4JZYA 3ASGA 5TEGA 1E7UA 4R7LA 1UG3A 5FT9A 3G2WA 3QAQA 4FLBA 2WXMA 3LS8A 4U63A 2OV8A 1W3BA 2VSXE 4NQ0A 3B7RL 4B8AA 5M72A 1FCHA 4JDSA 4JLGA 1TJFA 4W9RA 4GCNA 2O8JA 2L0IA 4GZ3A 4G1TA 1HO8A 1OWNA 3JYSA 3T5XA 3OAWA 1GW6A 3MEKA 2PQRA 2YQ8A 3LYAA 3PH0C 3QWVA 4V3IA 1ELWA 3RKVA 4ANVA 4KBQA 1E8ZA 5LOZA 4YVQC 3B13A 2P58C 4BSXA 4MRUA 3KEZA 2PM7A 5G05J 3BG1B 3GZ2A 3L22A 5LX8A 3B7TA 2NSZA 4XX5A 3ULQA 3ZIMA 5JHAA 4AV7A 3TXNA 1HH8A 1OWOA 2XRYA 2Y3AA 4J6IA 2G46A 2L0TB 3HYMB 4XIFA 3TG5A 4RZ0A 2LSUA 3UT4A 5DIZA 1UJJA 3MA5A 2V8SE 1S0PA 5EDSA 3U66A 2JV0A 1NA0A 3SI5A 5T4YA 4FC8A 5ARFA 1UN8A 4N5CA 4DPRA 3LVRE 3PUKA 3Q47B 2BUGA 2IJGX 1EYHA 3LXUX 4GA1A 1WAO1 4GZ5A 4NACA 4Y6WA 5E76A 3UQ3A 5AYFA 2I1KA 3KS2A 4KXKB 2KCLA 1UN9A 1Z3XA 3EIJA 4WWOA 3F9ZA 4E47A 4I6GA 4JHKA 5LSZA 2W5ZA 1EDUA 5C2YA 4Q96A 3EIQC 3QK0A 3SBSA 3ZFWA 1H6KA 3CHQA 3CQCB 4FHKA 2I9CA 5EX3A 3SHFA 1JWGA 1O9SA 4YNMA 1EF1C 5ANLA 4A3VA 1N6CA 2KM4A 4CDRA 5BNWA 4F3VA 3JQ0A 2CG2A 5JHBA 3LY7A 2X38A 3PE4A 4FA6A 3I4RB 5JJTA 2R5SA 2L6JA 3D9LA 3L54A 3R9AB 2IONA 1IYGA 4FMUA 3ZYLA 2WVIA 3SF4A 4MI5A 3DBSA 1JPLA 3FH7A 2YHEA 3S7DA 3E4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G04 C;  4YPU A;  4J8F A;  4H7X A;  2VSN A;  4N39 A;  3CKC A;  4AIF A;  3LCA A;  3GYZ A;  4UI9 J;  3MKR A;  4O30 A;  2C2L A;  3ASD A;  4Y6C A;  3ZHE A;  2UY1 A;  3IEG A;  1XQH A;  2NC9 A;  3OXL A;  2PL2 A;  3K5K A;  3ASF A;  4UQX A;  4GCO A;  3BEE A;  3CEQ A;  5D0O D;  2VGY A;  3S7J A;  3MV3 B;  3ESK A;  5G05 C;  3DB5 A;  3RAY A;  4IJ8 A;  1E96 B;  4NJ5 A;  3RQ4 A;  2KCK A;  4H7Y A;  5F6L A;  3MO2 A;  3ZHE B;  2HYZ A;  5FZR A;  3QWW A;  4I9C A;  5JJ0 A;  4BWR A;  4U04 A;  3RO3 A;  3FWV A;  3OXG A;  3NF1 A;  4Z4P A;  3CK7 A;  4GZ6 A;  5FTP A;  4GYY A;  1WM5 A;  3U4T A;  4O6F A;  4XI9 A;  2OOE A;  3QDN A;  4U0U A;  1ZKK A;  2QPW A;  1A17 A;  4J83 A;  1KLX A;  4ABN A;  3VV0 A;  2QFC A;  3M58 A;  1B89 A;  3URZ A;  4RG9 A;  3PDN A;  5A7D B;  4NRH B;  4BTA A;  3BO5 A;  2OND A;  1TJC A;  1IHG A;  4BT9 A;  2XCC A;  3TAX A;  5F59 A;  4UI9 C;  2IFU A;  5T0K A;  4I2Z A;  2VGX B;  3M55 A;  5LCW J;  2WQH A;  5EKQ D;  1ML9 A;  4N3C A;  4G25 A;  4GYO A;  3VTX A;  1KT0 A;  1MVX A;  3CVP A;  4BT8 A;  3RU0 A;  3N71 A;  3MO0 A;  4A1S A;  3M56 A;  5TH7 A;  5EG2 A;  5LSX A;  2XGS A;  4U07 A;  3Q49 B;  4N2Q A;  3AS5 A;  2BQZ A;  1MT6 A;  3CBO A;  4WNG A;  4YPA A;  2XEV A;  5JIY A;  4NVQ A;  3ZN3 A;  3SW9 A;  4JA7 A;  3UPV A;  3EP0 A;  4I9E A;  4AM9 A;  1HZ4 A;  2FBN A;  3QOU A;  4CGW A;  4AY6 A;  4BUP A;  1OUV A;  2KAT A;  4HOR A;  2WPV A;  2JLB A;  3QWP A;  4I17 A;  5F5E A;  2R3A A;  4AU7 A;  4U0Z A;  4RG6 A;  5F6K C;  4I1A A;  5TTF A;  5D0Q D;  3FPD A;  5T5G A;  1KT1 A;  3CVL A;  1NZN A;  5KJM A;  3Q4A B;  5EX0 A;  1XNF A;  4GYW A;  4UI9 K;  4U0S A;  5JJ6 A;  3CVN A;  3S7B A;  1P5Q A;  3RIB A;  2XPI A;  4IJD A;  2UWJ G;  5HQ8 A;  3Q15 A;  5BW8 C;  4YPE A;  5LCW C;  4I51 A;  4HOT A;  2I6H A;  2Q7F A;  1MVH A;  3ZGQ A;  5JIN A;  5C1D A;  2C0L A;  3CK9 A;  1YA0 A;  2V5F A;  3AS8 A;  3CBP A;  4J8O A;  1QZ2 A;  4HOQ A;  4MI0 A;  1PC2 A;  5CHE E;  5BT1 A;  3DAL A;  2KCV A;  2YHC A;  3LY9 A;  3F9W A;  4UQY A;  1ZU2 A;  4J7I A;  1N6A A;  5CCM A;  3KMJ A;  2VGX A;  5JHN A;  3TG4 A;  2PZI A;  3AS4 A;  2IGQ A;  2RFI A;  2VSY A;  2J9Q A;  4G26 A;  2AVP A;  3PE3 A;  1MUF A;  2VQ2 A;  2E2E A;  4CGV A;  3O48 A;  5JJ7 A;  2XCB A;  4XI0 A;  4JHR A;  3GW4 A;  4J7F A;  3OOI A;  4IN3 B;  3FFL A;  2HO1 A;  2F69 A;  3RO2 A;  5KJN A;  3IHX A;  2Y4T A;  2FF4 A;  1H3I A;  5A6C A;  5ARG A;  4H12 A;  2XGO A;  4N3A A;  4LEU A;  3SZ7 A;  3KAE A;  4WNE A;  4GA2 A;  2PQN A;  2LSV A;  4QEN A;  4HOU A;  2LNI A;  4J8D A;  2VYI A;  5T0M A;  3SWC A;  3VUZ A;  3ASH A;  3CVQ A;  4G2V A;  2XGM A;  2GW1 A;  3FP3 A;  4AY5 A;  1PEG A;  2C0M A;  3WXX A;  3TGO A;  3HNA A;  5KJL A;  3CK8 A;  3KD7 A;  3GZ1 A;  3KMA A;  2FI7 A;  4GA0 A;  3OPE A;  4GPK A;  3EDT B;  3M5A A;  3OS5 A;  3KMT A;  3M57 A;  4BTB A;  4HOS A;  4J8E A;  5FZS A;  4KYO B;  4WUY A;  4EQF A;  2FO7 A;  4JA9 A;  3Q5M A;  3M54 A;  2IF4 A;  4C1Q A;  4APO A;  3MV2 B;  3CBM A;  4UQZ A;  5KJK A;  3CKB A;  3VTY A;  4WND A;  2Y4U A;  4QEP A;  1ZBP A;  3U3W A;  4QEO A;  4YNP A;  3K9I A;  3RJV A;  3S8P A;  3CV0 A;  4G24 A;  1HXI A;  4I2W A;  3F9Y A;  3OXF A;  4YND A;  3UUX A;  5HI7 A;  2W5Y A;  4J0U A;  5DBK A;  2MHK A;  2DBA A;  5FZQ A;  2HR2 A;  3MO5 A;  3RJW A;  3QKY A;  3S7F A;  1Y8M A;  4JL0 A;  4N3B A;  1N3J A;  5FJY A;  3LPZ A;  2FEZ A;  4LDG A;  2UY1 B;  4WNF A;  4N2S A;  3M59 A;  4G23 A;  5AYW D;  2KC7 A;  3LKU A;  3F9X A;  3ZPJ A;  3LY8 A;  5G04 J;  4YVO A;  3M53 A;  5CPR B;  1QQE A;  5CCL A;  4B94 A;  4ME2 A;  1NA3 A;  1ELR A;  3ASG A;  5TEG A;  5FT9 A;  1W3B A;  4NQ0 A;  1FCH A;  4JDS A;  4JLG A;  4W9R A;  4GCN A;  2O8J A;  4GZ3 A;  4G1T A;  3JYS A;  3MEK A;  2PQR A;  2YQ8 A;  3LYA A;  3QWV A;  3RKV A;  1ELW A;  4KBQ A;  4YVQ C;  2P58 C;  5G05 J;  3GZ2 A;  3ULQ A;  1HH8 A;  2G46 A;  3HYM B;  4XIF A;  3TG5 A;  4RZ0 A;  2LSU A;  5DIZ A;  3MA5 A;  2JV0 A;  1NA0 A;  5ARF A;  4N5C A;  3Q47 B;  2BUG A;  4GA1 A;  5M72 A;  4GZ5 A;  3UQ3 A;  1WAO 1;  4Y6W A;  5AYF A;  3KS2 A;  4KXK B;  2KCL A;  3F9Z A;  5LSZ A;  4E47 A;  2W5Z A;  3ZFW A;  5EX3 A;  4YNM A;  1O9S A;  1N6C A;  4CDR A;  5BNW A;  4F3V A;  3LY7 A;  3PE4 A;  5JJT A;  2R5S A;  2L6J A;  3R9A B;  4FMU A;  1IYG A;  4MI5 A;  3SF4 A;  3S7D A;  3E4B A; 
#chains in the Genus database with same CATH topology
 3CGH A;  4M3O A;  4EHM A;  5FIO A;  3DSS A;  4AVX A;  2VSN A;  1OCO E;  2XHE A;  4I6E A;  3APF A;  3L08 A;  4UI9 J;  1O1T A;  3FUF A;  3UT8 A;  3DPD A;  4L7T A;  4Y6C A;  4WAF A;  2UY1 A;  3E32 A;  1DNP A;  1HG2 A;  3B7B A;  3CEQ A;  3TWW A;  4JHJ A;  3DPY A;  4G8L A;  4O60 A;  2PM6 A;  4UUC A;  1E90 A;  4NJ5 A;  4TUM A;  3TXM A;  2P9K G;  4LUN U;  5FZR A;  4BX9 A;  3GZS A;  2H6F A;  5JJ0 A;  4BWR A;  4DI3 A;  3I4G A;  3OXG A;  1BI7 B;  3L16 A;  2QZA A;  5AN8 A;  2XS1 A;  5A23 A;  1A5E A;  1E8X A;  2IOL A;  4XI9 A;  2OOE A;  4AP2 A;  4HLE A;  3X2Q E;  1ZKK A;  3SNX A;  3L13 A;  4A3T A;  1KLX A;  4EBA G;  2XRZ A;  1B89 A;  1QYM A;  4L2Y A;  1U3C A;  3FHE A;  2DZN A;  3ENE A;  3BO5 A;  2OND A;  3NZS A;  1TJC A;  3FUE A;  3AU5 A;  3W9G A;  4MLP A;  3NOC D;  4U7E B;  4DX6 D;  3DSV A;  3F6Q A;  2VGX B;  5KNG A;  4G25 A;  3ABK E;  4GYO A;  4RLY A;  3VTX A;  1KT0 A;  2WXJ A;  4GTS A;  1MVX A;  1JWF A;  3MO0 A;  4A1S A;  3M56 A;  2WXR A;  5TH7 A;  4EZK A;  4ATG A;  5EG2 A;  3UM2 A;  3ML8 A;  4U07 A;  2V0P A;  4A55 A;  2CG3 A;  1SZA A;  2CHZ A;  2WXK A;  2WXH A;  4WWP A;  3ZYM A;  4KZ0 A;  5CBO A;  3EP0 A;  3FEY A;  3FU0 A;  3QOU A;  4K03 A;  3T8K A;  4BUP A;  1Q2Z A;  4DLO A;  2OVF A;  4CRW A;  4FHJ A;  4HOR A;  2EIK E;  2Y0B G;  1IQU A;  3PEV B;  3ZXS A;  2F0Y A;  3EHR A;  2B0O E;  4BET A;  3VLD A;  1KT1 A;  2V4H C;  4MKT A;  2J09 A;  3PEU B;  5B1B E;  5AQB A;  2V5Q C;  4GTV A;  3MGB A;  1K3Z D;  3CQG B;  5FQ6 A;  1UJK A;  4YPE A;  3PRE A;  4I51 A;  3PNL B;  4LNG A;  2AXU A;  2H6I A;  1YA0 A;  1LF8 A;  1QZ2 A;  5AAR A;  4HXI A;  1O5M A;  1PC2 A;  3G2U A;  4XZ4 A;  2P9L G;  1NL4 A;  3LY9 A;  4UQY A;  3V2O A;  1SA4 A;  2X6J A;  3AS4 A;  2DIW A;  2IGQ A;  2KZT A;  4G26 A;  1HU3 A;  1EPU A;  3J5Q B;  2QYU A;  4JC8 A;  4CGV A;  3O48 A;  5JJ7 A;  2XCB A;  4JHR A;  3UKR G;  3GW4 A;  2XPY A;  4IN3 B;  1OXJ A;  1UW4 B;  3BUA A;  3CHR A;  3RO2 A;  2Y4T A;  3U9W A;  2FF4 A;  3QB2 A;  4JPS A;  4HLL A;  1N4P A;  4K5C A;  5CRV A;  5HS0 A;  4N3A A;  4LEU A;  2PQN A;  2LSV A;  3APD A;  3WG7 E;  1N4R A;  3PNT B;  3SWC A;  1E7V A;  1ELK A;  3FTX A;  2CHX A;  3ASH A;  3CVQ A;  2BKG A;  2XGM A;  4HNA D;  4HFG A;  4JXT A;  3MKQ A;  2ILR A;  5FQ7 A;  3HVE A;  3D9P A;  3HDX A;  2PNN A;  1G3N B;  5FWQ A;  3WXX A;  4DX7 D;  3TGO A;  3HNA A;  1WDY A;  2EIM E;  4PUC A;  4FAD A;  4GA0 A;  2ETC A;  3FUH A;  2IQC A;  2Y1L E;  2IU1 A;  3M54 A;  1DCE A;  3HVE B;  2OVB A;  3E37 A;  3MV2 B;  4KVO A;  4HI8 A;  5ENO D;  3CKB A;  3VTY A;  4WND A;  3SGH A;  3ZYQ A;  3SY2 A;  4QEP A;  3Q75 A;  5AJL A;  1ZBP A;  1QBQ A;  1Z5S C;  4JEH A;  4LER A;  4OAU C;  4RVB A;  3S8P A;  2XEE A;  4G24 A;  4Q69 A;  2W5Y A;  2MHK A;  2DBA A;  2HR2 A;  2EIL E;  3RJW A;  3FDH A;  3QKY A;  1Y8M A;  4JL0 A;  1K8K G;  4EBA A;  3FTU A;  2FEZ A;  1TN8 A;  4N2S A;  4G23 A;  4PS3 A;  2LXL A;  4B0Z A;  2WXF A;  2ZIS A;  1MHQ A;  3ZPJ A;  3T5V A;  5G04 J;  4DRX E;  4YVO A;  5CPR B;  1QQE A;  5CCL A;  2GRO B;  3UKU G;  1E8Y A;  3Q9U C;  3QAQ A;  1LD7 A;  3LS8 A;  2VSX E;  4B8A A;  4GCN A;  4G1T A;  1HO8 A;  3T5X A;  5BPP A;  3LYA A;  3PH0 C;  4V3I A;  1ELW A;  1E8Z A;  2QC9 A;  4LSZ E;  5G05 J;  3BG1 B;  3GZ2 A;  2NSZ A;  2G46 A;  2LSU A;  3MA5 A;  1S0P A;  2JV0 A;  3SI5 A;  4FC8 A;  3LVR E;  2BUG A;  1WAO 1;  4Y6W A;  4JHK A;  2W5Z A;  3EIQ C;  1TNB A;  3SBS A;  3ZFW A;  3CHQ A;  5EX3 A;  3SHF A;  4YNM A;  4U96 D;  2KM4 A;  2ZGD A;  2OEW A;  4FA6 A;  3R9A B;  5BV0 A;  4YPU A;  3E34 A;  3UM1 A;  4AIF A;  3GYZ A;  4GB9 A;  3MKR A;  3FUI A;  4PS8 A;  4A63 B;  4KZC A;  1S64 A;  3ZHE A;  2I1J A;  3IEG A;  2NC9 A;  4ANU A;  3K5K A;  4RSY A;  3T9K A;  3PRZ A;  5ENT D;  3ZVV A;  4GCO A;  3ZNG A;  3DEO A;  2P9N G;  3DB5 A;  3LJ3 A;  3RAY A;  3EUV A;  1E96 B;  3Q79 A;  3Q7F A;  3Q7A A;  5F6L A;  4U95 D;  3ZHE B;  2HYZ A;  3QWW A;  3SQV A;  2LUH A;  1K1A A;  3RO3 A;  3EU5 A;  3UX4 A;  2P9P G;  3NF1 A;  4K5A B;  2WXG A;  3TWS A;  4GZ6 A;  5EN5 D;  1HX8 A;  3DRA A;  3IHV A;  1U3D A;  4ABN A;  2QFC A;  2A4Z A;  2WQ6 A;  2ETA A;  1BI8 B;  1N52 A;  3JXJ A;  4ANW A;  3PDN A;  4F6R D;  2GRN B;  3Q78 A;  4BT9 A;  5ENS D;  2V4L A;  5AQ9 A;  3ESL A;  4CCA A;  5F59 A;  3S2A A;  1OWL A;  3CVW A;  4UI9 C;  2IFU A;  3JUE A;  5EKQ D;  3CVP A;  2BTD A;  3RU0 A;  4UWG A;  4Q94 A;  3TL5 A;  2IOS A;  4URK A;  3JUI A;  2GRM A;  2HM8 A;  5LSX A;  3Q73 A;  2BQZ A;  1H0A A;  4F1S A;  1IXV A;  3CBO A;  5CEA A;  4YPA A;  4CEM A;  2XEV A;  5LFA A;  4HS2 A;  3FUM A;  4BX8 A;  4GU5 A;  3KEA A;  5T8I A;  4JA7 A;  3FEX A;  4I9E A;  3TWQ A;  2FBN A;  4CGW A;  2ZU6 B;  5D2M C;  2QY7 A;  3BU8 A;  2KAT A;  2WPV A;  5F5E A;  4AU7 A;  2R3A A;  3CR3 A;  4G11 A;  5LP0 A;  4QQI A;  2DWZ A;  1RZ4 A;  2BKK B;  5CER B;  4F7A A;  5KNH D;  5KJM A;  1OT8 A;  1XNF A;  4GYW A;  4B93 B;  3DSX A;  2ZXW E;  3PZD A;  4U0S A;  5JJ6 A;  3CVN A;  3S7B A;  1DCQ A;  3C98 A;  3JCK C;  4MBG A;  3Q15 A;  3HRA A;  5BW8 C;  3RK6 A;  3NZU A;  4HI9 A;  3IV0 A;  3LEW A;  1AWC B;  4TXR A;  4HOT A;  2XEH A;  2I6H A;  4DLQ A;  1MVH A;  3FUN A;  5C1D A;  5EID A;  2J08 A;  4EEC A;  1WY6 A;  1D9S A;  2I2O A;  4J8O A;  4HOQ A;  3TJP A;  2ETB A;  3NOG D;  1SZ9 A;  4J7I A;  2VGX A;  3VLF A;  3SFY A;  3AU4 A;  4JEU A;  2J9Q A;  2VQ2 A;  5H7P A;  2E2E A;  3D9I A;  4B89 A;  2NXP A;  3ZW3 A;  2WQ7 A;  3OOI A;  1N0Q A;  2FUL A;  2B6C A;  3FFL A;  2F69 A;  3W9F A;  3FY4 A;  3HXC A;  4CDN A;  3QC1 A;  2A5E A;  3FTS A;  1WG0 A;  4J8Y A;  1D8E A;  3KAE A;  3ASN E;  4WWN A;  2WXN A;  3U64 A;  4BSZ B;  4J8D A;  3UXG A;  4LG6 A;  3D9M A;  5T0M A;  1O1R A;  4PDX A;  4G2V A;  5ENP D;  2NYJ A;  3FP3 A;  1E8W A;  2IEJ A;  5EYL A;  3UM3 A;  3CK8 A;  3KD7 A;  3AG2 E;  2FI7 A;  2AWI A;  1BU9 A;  2KXP C;  4BER A;  1JUQ A;  4U8H A;  4ANX A;  3OPE A;  3EDT B;  4J8E A;  4EQF A;  2P9S G;  2WXI A;  4C1Q A;  3QNK A;  3CLJ A;  4F53 A;  3DSU A;  3RRM B;  3CBM A;  3PS6 A;  4RQI A;  1HE8 A;  2Y4U A;  5KWD A;  3SO8 A;  3DSW A;  5B1A E;  3LJN A;  3G2T A;  4YDE A;  3RJV A;  3NBN B;  4AOF A;  4PS7 A;  1HXI A;  3MJW A;  3D9J A;  3F9Y A;  3ASO E;  4J0U A;  1TR4 A;  5DBK A;  5FZQ A;  3MO5 A;  2H6G A;  4N3B A;  5B3S E;  1N3J A;  2X6K A;  3FTV A;  1Z6T A;  2J07 A;  3M59 A;  5AYW D;  4X8Q A;  5CEC B;  4L23 A;  3UIO C;  1OCR E;  2VSO E;  1V54 E;  4J8S A;  5AEN A;  5ENR D;  3LY8 A;  5KCM A;  2EIJ E;  3M53 A;  1NFI E;  3FH5 A;  4A1G A;  2LAI A;  4JZY A;  3ASG A;  5TEG A;  1E7U A;  4R7L A;  1W3B A;  1FCH A;  4JDS A;  4JLG A;  3JYS A;  2PQR A;  2YQ8 A;  3QWV A;  1X81 A;  3RKV A;  5LOZ A;  3B13 A;  3RAU A;  4MRU A;  3L22 A;  3ULQ A;  4XX5 A;  3ZIM A;  3TXN A;  4O1O A;  3EU9 A;  5AAO A;  2Y3A A;  3DXK G;  3TWT A;  4RZ0 A;  5EDS A;  1ZB1 A;  1NA0 A;  5T4Y A;  1UN8 A;  4NAC A;  3PZ4 A;  3UI2 A;  4GA1 A;  4GZ5 A;  5E76 A;  5M72 A;  2I1K A;  1H6O A;  3KS2 A;  4WWO A;  1UN9 A;  5LSZ A;  3NAW A;  4GPM A;  4I6G A;  2RFA A;  2GRP B;  1EDU A;  2JAB A;  4FHK A;  4YDW A;  1JWG A;  1O9S A;  1EF1 C;  3R9M A;  4CDR A;  3HXB A;  5BNW A;  4F3V A;  1DC2 A;  5JHB A;  3LY7 A;  1IKN D;  3I4R B;  2R5S A;  2L6J A;  4MI5 A;  3ZYL A;  3ML9 A;  3S7D A;  3E4B A;  5G04 C;  4J8F A;  4H7X A;  3FTW A;  4DX5 D;  5FQ8 A;  1H2U A;  2JEK A;  3LDZ A;  2DZO A;  3EHN A;  4TRQ A;  4UQX A;  3ZYK A;  2EIN E;  2AW6 A;  4DK5 A;  2VGY A;  3MV3 B;  3ESK A;  5G05 C;  3I3N A;  1N54 A;  2DCP A;  3DXM G;  3RQ4 A;  2RKK A;  4BY6 A;  4I9C A;  1FT2 A;  4I1O B;  3G2V A;  2VJ8 A;  4HB5 A;  3FWV A;  4GZC A;  4FLH A;  5FTP A;  2IO3 C;  4GYY A;  1WM5 A;  4GZD A;  1NP7 A;  4O6F A;  2E0I A;  4CDM A;  4U0U A;  4F1P A;  1QNF A;  1TNY A;  3L6A A;  2QPW A;  5EIL A;  3VLE A;  3HHM A;  3VV0 A;  3M58 A;  2VTB A;  2XZD G;  3URZ A;  3QAR A;  2Y69 E;  4RG9 A;  3IHY A;  5J08 A;  2OCC E;  5ANR A;  3B7S A;  4NRH B;  4ZHB A;  1YYH A;  1IHG A;  3L82 A;  4ZFH A;  1KZP A;  2XCC A;  4XE0 A;  4ACL A;  5T0K A;  4UWH A;  2VTB B;  3M55 A;  5LCW J;  1ML9 A;  3HXF A;  4BT8 A;  3N71 A;  4UWL A;  4TUU A;  1PAQ A;  2XGS A;  3FU6 A;  4UWK A;  2YNQ A;  1MT6 A;  1YMP A;  5JIY A;  3I5P A;  2P9I G;  2RFM A;  4NVQ A;  3ZKJ A;  1SVX A;  4ILI A;  4OVU A;  4AEZ C;  5IY5 E;  4CT4 A;  4AM9 A;  3ISM C;  2WXO A;  4GAA A;  4E85 A;  1OUV A;  3AG3 E;  2R2L A;  2YIN A;  2X6F A;  4U0Z A;  2CFZ A;  2WB2 A;  5AIJ A;  1HFA A;  4I1A A;  3SBT B;  4U8Y D;  4TXQ A;  4OAV B;  3CVL A;  4FJZ A;  3AJI A;  1NZN A;  1TN7 A;  4J7W A;  3Q4A B;  5EX0 A;  4NUR A;  3UMV A;  3C3Q A;  4GMR A;  2WMO A;  3NQP A;  3ONK A;  3B7U X;  2Q7F A;  3ZGQ A;  2C0L A;  2WXL A;  3MCX A;  2QYJ A;  3TWX A;  3CBP A;  4C48 B;  4MS6 A;  4GTM A;  4MI0 A;  3APC A;  2KCV A;  2YHC A;  3SFX A;  4BFR A;  3F9W A;  3B95 A;  1N6A A;  5G55 A;  5JHN A;  2DVW A;  1TEZ A;  5BV1 A;  2OEV A;  3P2B A;  2RD0 A;  2VSY A;  4GML A;  4DI4 A;  3PE3 A;  3HG0 D;  1JCS A;  2L9B A;  4TV3 A;  2LO6 A;  4ILG A;  2AXZ A;  3FUL A;  1FT1 A;  4GTO A;  2HO1 A;  2WM9 A;  5G2N A;  4XKC A;  3IHX A;  2LXM A;  3D9K A;  4EPZ A;  1H3I A;  5KBA A;  4H12 A;  5CMY A;  3SZ7 A;  3CHO A;  4WNE A;  4DJA A;  1LTX A;  1H2T C;  3CHS A;  2BED A;  2J49 A;  5HRY A;  3DEP A;  4LCT A;  4K0R A;  4OVV A;  1BLX B;  1HS6 A;  1RW2 A;  1S70 B;  2GW1 A;  2R02 A;  3IBE A;  2IY0 C;  4P29 A;  2C0M A;  2M63 A;  5KJL A;  3GZ1 A;  4I6J A;  3RSE G;  1S63 A;  4GPK A;  3M5A A;  3KMT A;  3M57 A;  4KYO B;  4WUY A;  3ZEF A;  2AXV A;  2CFU A;  2FO7 A;  3Q5M A;  1BPO A;  2IF4 A;  2RG8 A;  3BQO A;  1OWP A;  3BG0 B;  4I1M A;  5D66 A;  3V79 K;  1OCZ E;  3V2X A;  3PZ1 A;  4XKB A;  4XEI G;  3CST A;  3UTM A;  3K9I A;  1N9A A;  5EYP F;  3UT7 A;  4YND A;  3UUX A;  5HI7 A;  1U2V G;  3MYV A;  3AG1 E;  3LPZ A;  3PZ2 A;  4LDG A;  2UY1 B;  4HRN A;  3OTN A;  1MJ0 A;  3LKU A;  3TWU A;  3EHM A;  4HRL A;  3V30 A;  1TNZ A;  4APF A;  3MX3 A;  4B94 A;  3FU5 A;  1L5J A;  2GRR B;  1VDY A;  1NA3 A;  4HRM B;  2WXM A;  4GTQ A;  2OV8 A;  4NQ0 A;  3B7R L;  3NB2 A;  4W9R A;  2L0I A;  4GZ3 A;  1OWN A;  3UT4 A;  1GW6 A;  3MEK A;  4GTT A;  3KEZ A;  1MX4 A;  5LX8 A;  3B7T A;  1JCQ A;  5JHA A;  4AV7 A;  1HH8 A;  2XRY A;  4J6I A;  2L0T B;  4O1P A;  5DIZ A;  3TWR A;  3U66 A;  1FPP A;  5ARF A;  4DPR A;  3PUK A;  1EYH A;  3UQ3 A;  5AYF A;  3F9Z A;  4GTP A;  3KSQ A;  5C2Y A;  1H6K A;  2I9C A;  4A3V A;  1NI1 A;  1N6C A;  1N0R A;  4JB8 P;  2X38 A;  5JJT A;  3L54 A;  4FMU A;  4CZ2 D;  2WVI A;  3DBS A;  3FH7 A;  2YHE A;  2IO2 C;  3C5R A;  4N39 A;  3CKC A;  3QJZ A;  3LCA A;  1FVH A;  3EJN A;  1X5B A;  2P9U G;  4L9P A;  4O30 A;  2ZIR A;  3CVV A;  2C2L A;  3LVQ E;  3ASD A;  2MOW A;  3JXI A;  3PVL A;  3IKO B;  3L9T A;  2XPZ A;  2R05 A;  2MRI A;  2J4D A;  5AQA A;  2FO1 E;  1XQH A;  3ZXP A;  3OXL A;  2PL2 A;  3ASF A;  1H19 A;  1PY1 A;  2X6H A;  3AG4 E;  3BEE A;  4N5Q A;  5D0O D;  5HKP A;  3S7J A;  2J4B A;  2GRQ B;  4IJ8 A;  5FQ4 A;  3L17 A;  5FIN A;  3FUK A;  3KSL A;  2KCK A;  2F8X K;  2X6I A;  4H7Y A;  3MO2 A;  1OWM A;  3T8M A;  3V31 A;  4U04 A;  3ONL A;  4KVM A;  4Z4P A;  3CK7 A;  3SD5 A;  2GGF A;  4UWF A;  2AJA A;  3U4T A;  4L1B A;  3P1U A;  3ULE G;  3D9N A;  2R59 A;  3QDN A;  4IRU A;  4GTR A;  2A5U A;  2BF0 X;  1A17 A;  3FTZ A;  4J83 A;  3ABL E;  2R03 A;  2WMN A;  5A7D B;  1N94 A;  3R7Q A;  4BTA A;  3CHM A;  2ZGG A;  5BUZ A;  3TAX A;  1FVF A;  5JMN D;  1D8D A;  1TYQ G;  1N11 A;  4I2Z A;  1N95 A;  3D9H A;  1TNO A;  2WQH A;  4N3C A;  4AJW A;  2KZT B;  2GRL A;  1INZ A;  4KMO A;  3R7R A;  4FUL A;  3Q49 B;  4N2Q A;  3AS5 A;  5ITZ F;  1DVP A;  4WNG A;  3CVU A;  3ZRH A;  1KPS B;  3JQ1 A;  3ZN3 A;  3SW9 A;  2X3M A;  3UPV A;  3UM0 A;  1HZ4 A;  5AJD A;  3CVY A;  1K1B A;  2P2C P;  4AY6 A;  4JVS A;  4YDO A;  2JLB A;  3QWP A;  4I17 A;  1Y6I A;  1YCS B;  1BD8 A;  4DX1 A;  4RG6 A;  5F6K C;  5TTF A;  3D3M A;  5D0Q D;  3FPD A;  5T5G A;  3CSF A;  1SW6 A;  3MKQ B;  4NIK A;  1MYO A;  4UI9 K;  3IXE A;  1P5Q A;  3RIB A;  2XPI A;  4IJD A;  4E6H A;  2CHW A;  2UWJ G;  2L6B A;  5HQ8 A;  3PUJ A;  4LRZ A;  3J5P A;  4JD2 G;  1HG5 A;  3HIZ A;  4GMJ A;  5LCW C;  4C9B B;  5CRU A;  4ILH B;  3CVX A;  1UOH A;  1SA5 A;  4D10 C;  5JIN A;  4FJY A;  2XZT G;  3CK9 A;  3Q9N C;  1N4S A;  3O4Z A;  2WXP A;  2F8Y A;  4YDY A;  2V5F A;  3AS8 A;  3SFZ A;  5T3R A;  5ENQ D;  4FU3 A;  5CHE E;  3G2S A;  5BT1 A;  3DAL A;  2DYR E;  4C0M A;  1OCC E;  1TN6 A;  4G8K A;  1ZU2 A;  5CCM A;  3FU3 A;  3KMJ A;  5BXU A;  4I43 A;  2LAH A;  3EHQ A;  3TG4 A;  2PZI A;  4IUL A;  1Z3Y A;  1MX6 A;  5BXO A;  4QFV A;  2RFI A;  4EZL A;  3MZL B;  3D9O A;  2XEN A;  2AVP A;  1MUF A;  4C0E A;  3ZU7 B;  4XI0 A;  1H6P A;  4M7C A;  4CT0 A;  4EZJ A;  4OYS A;  4J7F A;  1JCR A;  3CIA A;  3FH8 A;  4PH4 B;  3C72 A;  1V55 E;  4KT6 B;  5KJN A;  3FUJ A;  4AXH A;  4U8V D;  5A6C A;  2R17 C;  5ARG A;  3E33 A;  2XGO A;  3PZ3 A;  3CHP A;  1SQM A;  4GA2 A;  4QEN A;  4HOU A;  3HXE A;  2LNI A;  2VYI A;  2KBX A;  1IQR A;  3VUZ A;  1MQS A;  2J8S D;  4HBD A;  1TNU A;  3RRU A;  2VGE A;  4AY5 A;  1PEG A;  4BES A;  1XGW A;  4L2L A;  4IYP A;  4BEP A;  3KMA A;  3HXD A;  4B8C B;  3OS5 A;  4DX2 A;  5CBN A;  4JW1 A;  2DYS E;  4BTB A;  3FUD A;  4HOS A;  1O1S A;  5FZS A;  3RRN B;  4JA9 A;  4APO A;  4DUI A;  1KZO A;  4UQZ A;  5KJK A;  1H2V C;  2H6H A;  4ACK A;  3U3W A;  4QEO A;  3ULY A;  4YNP A;  4Z68 A;  2HE0 A;  3CV0 A;  4I2W A;  3OXF A;  5CMW A;  1N4Q A;  4TXP A;  3C3R A;  4HQD A;  3C3O A;  4LNU D;  4K5B A;  3S7F A;  2WXQ A;  1IHB A;  5CED B;  3TWV A;  5FJY A;  4LNB A;  4WNF A;  1HF8 A;  4CYM D;  2XQ0 A;  2KC7 A;  3F9X A;  3UIN C;  5J90 A;  4FP7 A;  3DWL G;  1MX2 A;  3FTY A;  2EQX A;  5ENN A;  5E75 A;  3ABM E;  4ME2 A;  5JA4 D;  1ELR A;  2MYO A;  1UG3 A;  5FT9 A;  3G2W A;  4FLB A;  5EIB E;  4ATZ D;  4U63 A;  5AQ7 A;  1TJF A;  2O8J A;  3OAW A;  4ANV A;  4KBQ A;  4YVQ C;  4BSX A;  2P58 C;  3DST A;  2PM7 A;  1OWO A;  3HYM B;  4XIF A;  3TG5 A;  1UJJ A;  3ZUV B;  2V8S E;  1LD8 A;  3UIP C;  4N5C A;  3Q47 B;  4HVB A;  2IJG X;  3LXU X;  1OY3 D;  4KXK B;  2KCL A;  1Z3X A;  2F37 A;  2XS8 A;  3EIJ A;  4E47 A;  4Q96 A;  3QK0 A;  3E30 A;  3CQC B;  5ANL A;  1MZC A;  3AAA C;  1AP7 A;  3JQ0 A;  2CG2 A;  3PE4 A;  3D9L A;  2ION A;  1IYG A;  3SF4 A;  1JPL A; 
#chains in the Genus database with same CATH homology
 5G04 C;  3CGH A;  4M3O A;  5BV0 A;  4YPU A;  4J8F A;  4AVX A;  4H7X A;  2VSN A;  2XHE A;  3FTW A;  4I6E A;  4N39 A;  3APF A;  3CKC A;  3QJZ A;  4AIF A;  3LCA A;  1FVH A;  3GYZ A;  3EJN A;  3L08 A;  1X5B A;  4GB9 A;  4UI9 J;  3MKR A;  3FUF A;  4O30 A;  3UT8 A;  3CVV A;  2C2L A;  3LVQ E;  3ASD A;  5FQ8 A;  3DPD A;  2MOW A;  3FUI A;  4L7T A;  4PS8 A;  4Y6C A;  1H2U A;  3IKO B;  3PVL A;  4KZC A;  4WAF A;  2XPZ A;  2JEK A;  3LDZ A;  3ZHE A;  2UY1 A;  2MRI A;  2I1J A;  2J4D A;  3IEG A;  1XQH A;  2NC9 A;  3OXL A;  2PL2 A;  3EHN A;  4ANU A;  3K5K A;  4TRQ A;  3ASF A;  1H19 A;  4RSY A;  1PY1 A;  2X6H A;  3PRZ A;  4UQX A;  3ZYK A;  3ZVV A;  1DNP A;  4GCO A;  2AW6 A;  3BEE A;  4DK5 A;  1HG2 A;  3CEQ A;  5D0O D;  2VGY A;  3S7J A;  3MV3 B;  3ESK A;  4JHJ A;  5G05 C;  3DB5 A;  3I3N A;  2J4B A;  3LJ3 A;  1N54 A;  2DCP A;  3RAY A;  2PM6 A;  4IJ8 A;  1E90 A;  5FQ4 A;  1E96 B;  3L17 A;  4NJ5 A;  3FUK A;  3RQ4 A;  2KCK A;  4BY6 A;  3TXM A;  2X6I A;  4H7Y A;  4LUN U;  5F6L A;  3MO2 A;  3ZHE B;  2HYZ A;  1OWM A;  3QWW A;  4I9C A;  5FZR A;  3T8M A;  4BX9 A;  3GZS A;  4I1O B;  5JJ0 A;  3G2V A;  4BWR A;  4U04 A;  4DI3 A;  2VJ8 A;  3I4G A;  3ONL A;  3RO3 A;  3FWV A;  4KVM A;  3OXG A;  3UX4 A;  3NF1 A;  4Z4P A;  4GZC A;  2WXG A;  3CK7 A;  3SD5 A;  4FLH A;  2GGF A;  4UWF A;  4GZ6 A;  5FTP A;  3L16 A;  4GYY A;  1WM5 A;  3U4T A;  4L1B A;  3P1U A;  4GZD A;  1NP7 A;  5A23 A;  4O6F A;  1E8X A;  2IOL A;  4XI9 A;  2OOE A;  1HX8 A;  3D9N A;  2E0I A;  4AP2 A;  2R59 A;  3QDN A;  4U0U A;  4CDM A;  1QNF A;  4IRU A;  4HLE A;  2A5U A;  3L6A A;  1ZKK A;  2BF0 X;  3SNX A;  3L13 A;  4A3T A;  3VLE A;  2QPW A;  3HHM A;  1A17 A;  1U3D A;  1KLX A;  3FTZ A;  3IHV A;  4ABN A;  4J83 A;  2QFC A;  3M58 A;  2A4Z A;  4EBA G;  2XRZ A;  1B89 A;  2WQ6 A;  2VTB A;  3URZ A;  3QAR A;  4L2Y A;  1U3C A;  1N52 A;  4RG9 A;  4ANW A;  3IHY A;  3FHE A;  3PDN A;  5J08 A;  5ANR A;  3B7S A;  2WMN A;  5A7D B;  3R7Q A;  3ENE A;  4NRH B;  4BTA A;  3BO5 A;  3CHM A;  2OND A;  1TJC A;  3NZS A;  3FUE A;  1IHG A;  3AU5 A;  4BT9 A;  5BUZ A;  2XCC A;  2V4L A;  4MLP A;  3ESL A;  4XE0 A;  4CCA A;  3TAX A;  5F59 A;  1FVF A;  1OWL A;  3S2A A;  3CVW A;  4UI9 C;  4ACL A;  2IFU A;  5T0K A;  4UWH A;  4I2Z A;  2VGX B;  2VTB B;  3M55 A;  5LCW J;  2WQH A;  5EKQ D;  1ML9 A;  4N3C A;  4G25 A;  4GYO A;  4AJW A;  3VTX A;  1KT0 A;  2WXJ A;  1MVX A;  2KZT B;  3CVP A;  2GRL A;  2BTD A;  3RU0 A;  4BT8 A;  3N71 A;  4UWG A;  1JWF A;  4Q94 A;  4UWL A;  4A1S A;  4TUU A;  3MO0 A;  3TL5 A;  2IOS A;  1PAQ A;  1INZ A;  2WXR A;  3M56 A;  4URK A;  3JUI A;  4KMO A;  3R7R A;  4EZK A;  4ATG A;  5TH7 A;  2GRM A;  2HM8 A;  5EG2 A;  5LSX A;  2XGS A;  3ML8 A;  4U07 A;  4FUL A;  3FU6 A;  3Q49 B;  4UWK A;  3AS5 A;  4N2Q A;  2BQZ A;  1H0A A;  4F1S A;  2V0P A;  2YNQ A;  1MT6 A;  1DVP A;  4A55 A;  4WNG A;  3CBO A;  3CVU A;  3ZRH A;  2CG3 A;  4CEM A;  4YPA A;  2XEV A;  1SZA A;  5JIY A;  3I5P A;  2CHZ A;  5LFA A;  4HS2 A;  3FUM A;  4NVQ A;  3JQ1 A;  2WXK A;  4BX8 A;  4ILI A;  3ZN3 A;  2WXH A;  4OVU A;  4WWP A;  4AEZ C;  3SW9 A;  4GU5 A;  2X3M A;  3ZYM A;  4CT4 A;  5T8I A;  4JA7 A;  3FEX A;  4KZ0 A;  3UPV A;  3EP0 A;  3FEY A;  4I9E A;  3FU0 A;  4AM9 A;  1HZ4 A;  5AJD A;  2WXO A;  2FBN A;  3CVY A;  3QOU A;  4K03 A;  4CGW A;  4GAA A;  2ZU6 B;  4E85 A;  4AY6 A;  2QY7 A;  4JVS A;  4BUP A;  1OUV A;  4DLO A;  2OVF A;  4CRW A;  2KAT A;  4FHJ A;  4HOR A;  2WPV A;  1IQU A;  3PEV B;  2JLB A;  2YIN A;  3QWP A;  1Y6I A;  4I17 A;  3ZXS A;  2X6F A;  3CR3 A;  2R3A A;  4U0Z A;  5F5E A;  4AU7 A;  4G11 A;  2CFZ A;  5LP0 A;  4RG6 A;  2WB2 A;  5AIJ A;  1HFA A;  5F6K C;  4I1A A;  3SBT B;  5TTF A;  3D3M A;  5D0Q D;  3VLD A;  3FPD A;  5T5G A;  1KT1 A;  3CVL A;  4FJZ A;  1NZN A;  4MKT A;  4F7A A;  3CSF A;  2J09 A;  5KJM A;  3MKQ B;  3PEU B;  3Q4A B;  5EX0 A;  1XNF A;  4GYW A;  3PZD A;  4UI9 K;  4U0S A;  5JJ6 A;  3CVN A;  3S7B A;  3C98 A;  3JCK C;  3MGB A;  4NUR A;  3UMV A;  1P5Q A;  3RIB A;  2XPI A;  3CQG B;  4IJD A;  4E6H A;  2CHW A;  5FQ6 A;  2UWJ G;  5HQ8 A;  3Q15 A;  5BW8 C;  3PUJ A;  3RK6 A;  3NZU A;  4LRZ A;  1UJK A;  4YPE A;  5LCW C;  2WMO A;  1HG5 A;  3HIZ A;  3IV0 A;  4GMJ A;  3LEW A;  3NQP A;  3PRE A;  4HVB A;  3ONK A;  4C9B B;  4I51 A;  4HOT A;  3PNL B;  2I6H A;  4DLQ A;  3B7U X;  4ILH B;  2Q7F A;  3CVX A;  1MVH A;  3ZGQ A;  4D10 C;  5JIN A;  4FJY A;  3FUN A;  2AXU A;  5C1D A;  3ML9 A;  2C0L A;  3CK9 A;  2WXL A;  2J08 A;  3O4Z A;  3MCX A;  2WXP A;  1YA0 A;  4EEC A;  2V5F A;  3AS8 A;  1WY6 A;  3SFZ A;  5T3R A;  3CBP A;  2I2O A;  4J8O A;  1LF8 A;  1QZ2 A;  4HOQ A;  4MS6 A;  4FU3 A;  3TJP A;  4HXI A;  4MI0 A;  1PC2 A;  5CHE E;  3G2S A;  5BT1 A;  3APC A;  3DAL A;  3G2U A;  4XZ4 A;  4C0M A;  2KCV A;  2YHC A;  3VV0 A;  3LY9 A;  1SZ9 A;  4BFR A;  3F9W A;  4UQY A;  1ZU2 A;  4J7I A;  1N6A A;  5G55 A;  5CCM A;  3FU3 A;  3KMJ A;  2VGX A;  5JHN A;  2X6J A;  4I43 A;  2LAH A;  3TG4 A;  2PZI A;  3AS4 A;  4IUL A;  3VLF A;  5BPP A;  1Z3Y A;  2DIW A;  1TEZ A;  5BV1 A;  3AU4 A;  4JEU A;  4QFV A;  2IGQ A;  2RFI A;  3P2B A;  2KZT A;  2RD0 A;  4EZL A;  2VSY A;  2J9Q A;  3D9O A;  3MZL B;  4G26 A;  1HU3 A;  4GML A;  4DI4 A;  1EPU A;  2AVP A;  3PE3 A;  1MUF A;  2VQ2 A;  4C0E A;  4JC8 A;  2E2E A;  3D9I A;  2L9B A;  3O48 A;  4TV3 A;  4CGV A;  5JJ7 A;  2LO6 A;  2XCB A;  4XI0 A;  4CT0 A;  4JHR A;  4ILG A;  2AXZ A;  3FUL A;  4B89 A;  3GW4 A;  4OYS A;  4EZJ A;  2NXP A;  4J7F A;  3CIA A;  3ZW3 A;  2XPY A;  2WQ7 A;  3FH8 A;  3OOI A;  4IN3 B;  2FUL A;  4PH4 B;  3FFL A;  2HO1 A;  2F69 A;  4KT6 B;  1UW4 B;  2WM9 A;  3FY4 A;  5G2N A;  4XKC A;  4CDN A;  3CHR A;  3RO2 A;  5KJN A;  3IHX A;  2Y4T A;  3U9W A;  2FF4 A;  3FUJ A;  4AXH A;  3D9K A;  3QC1 A;  3QB2 A;  4EPZ A;  1H3I A;  5A6C A;  2R17 C;  3FTS A;  4JPS A;  5ARG A;  4H12 A;  5CMY A;  2XGO A;  4N3A A;  4LEU A;  3SZ7 A;  3CHO A;  3KAE A;  4WNE A;  3CHP A;  1SQM A;  4GA2 A;  2PQN A;  2LSV A;  3APD A;  4WWN A;  4QEN A;  4DJA A;  4HOU A;  2WXN A;  3U64 A;  2LNI A;  1H2T C;  3CHS A;  4J8D A;  2J49 A;  2VYI A;  3D9M A;  3PNT B;  5T0M A;  3SWC A;  1IQR A;  4LCT A;  4OVV A;  1MQS A;  1E7V A;  4K0R A;  3VUZ A;  1HS6 A;  1ELK A;  4PDX A;  3FTX A;  2CHX A;  3ASH A;  3CVQ A;  3RRU A;  4G2V A;  2XGM A;  4HFG A;  4JXT A;  2GW1 A;  3FP3 A;  3IBE A;  3MKQ A;  2ILR A;  1E8W A;  5FQ7 A;  4AY5 A;  3HVE A;  4P29 A;  3D9P A;  3HDX A;  1PEG A;  5FWQ A;  2C0M A;  2M63 A;  3WXX A;  1XGW A;  3TGO A;  5KJL A;  3HNA A;  3CK8 A;  3KD7 A;  4L2L A;  4IYP A;  3GZ1 A;  3KMA A;  4I6J A;  4PUC A;  2FI7 A;  2AWI A;  4B8C B;  4FAD A;  1JUQ A;  4GA0 A;  4U8H A;  4ANX A;  4GPK A;  3OPE A;  3EDT B;  3M5A A;  3OS5 A;  3FUH A;  3KMT A;  4JW1 A;  3M57 A;  4BTB A;  3FUD A;  4HOS A;  2IQC A;  4J8E A;  5FZS A;  2IU1 A;  4KYO B;  4WUY A;  4EQF A;  3RRN B;  2AXV A;  2CFU A;  2FO7 A;  4JA9 A;  3ZEF A;  2WXI A;  1BPO A;  2IF4 A;  2RG8 A;  3Q5M A;  3M54 A;  4C1Q A;  3HVE B;  3QNK A;  3CLJ A;  4APO A;  2OVB A;  3MV2 B;  4KVO A;  4F53 A;  3RRM B;  3CBM A;  1OWP A;  3BG0 B;  3PS6 A;  4UQZ A;  5KJK A;  3CKB A;  1H2V C;  3VTY A;  4I1M A;  4WND A;  3SGH A;  1HE8 A;  3ZYQ A;  2Y4U A;  4ACK A;  4QEP A;  5AJL A;  4XKB A;  1ZBP A;  3U3W A;  4JEH A;  4LER A;  4QEO A;  4YNP A;  3G2T A;  3CST A;  4RVB A;  3K9I A;  3RJV A;  4AOF A;  3S8P A;  4PS7 A;  3CV0 A;  4G24 A;  1HXI A;  4I2W A;  3MJW A;  3D9J A;  3F9Y A;  3UT7 A;  3OXF A;  4YND A;  3UUX A;  4Q69 A;  5HI7 A;  5CMW A;  2W5Y A;  4J0U A;  2MHK A;  5DBK A;  2DBA A;  5FZQ A;  2HR2 A;  3MYV A;  3MO5 A;  3RJW A;  3FDH A;  3QKY A;  3S7F A;  2WXQ A;  1Y8M A;  4JL0 A;  4N3B A;  1N3J A;  2X6K A;  5FJY A;  4EBA A;  3FTV A;  3FTU A;  3LPZ A;  2FEZ A;  4LDG A;  2UY1 B;  4WNF A;  4N2S A;  1HF8 A;  3OTN A;  1Z6T A;  2J07 A;  2XQ0 A;  4G23 A;  3M59 A;  4PS3 A;  5AYW D;  4B0Z A;  2KC7 A;  3LKU A;  3F9X A;  3EHM A;  4L23 A;  2WXF A;  5J90 A;  1MHQ A;  2VSO E;  4FP7 A;  3ZPJ A;  4J8S A;  3T5V A;  5AEN A;  3LY8 A;  5G04 J;  3FTY A;  2EQX A;  4YVO A;  5KCM A;  4APF A;  3MX3 A;  3FH5 A;  5ENN A;  5E75 A;  3M53 A;  5CPR B;  1QQE A;  4A1G A;  5CCL A;  4B94 A;  2LAI A;  4ME2 A;  3FU5 A;  1L5J A;  1VDY A;  1NA3 A;  1ELR A;  1E8Y A;  4JZY A;  3ASG A;  5TEG A;  1E7U A;  4R7L A;  1UG3 A;  5FT9 A;  3G2W A;  3QAQ A;  4FLB A;  2WXM A;  3LS8 A;  4U63 A;  2OV8 A;  1W3B A;  2VSX E;  4NQ0 A;  3B7R L;  4B8A A;  5M72 A;  1FCH A;  4JDS A;  4JLG A;  1TJF A;  4W9R A;  4GCN A;  2O8J A;  2L0I A;  4GZ3 A;  4G1T A;  1HO8 A;  1OWN A;  3JYS A;  3T5X A;  3OAW A;  1GW6 A;  3MEK A;  2PQR A;  2YQ8 A;  3LYA A;  3PH0 C;  3QWV A;  4V3I A;  1ELW A;  3RKV A;  4ANV A;  4KBQ A;  1E8Z A;  5LOZ A;  4YVQ C;  3B13 A;  2P58 C;  4BSX A;  4MRU A;  3KEZ A;  2PM7 A;  5G05 J;  3BG1 B;  3GZ2 A;  3L22 A;  5LX8 A;  3B7T A;  2NSZ A;  4XX5 A;  3ULQ A;  3ZIM A;  5JHA A;  4AV7 A;  3TXN A;  1HH8 A;  1OWO A;  2XRY A;  2Y3A A;  4J6I A;  2G46 A;  2L0T B;  3HYM B;  4XIF A;  3TG5 A;  4RZ0 A;  2LSU A;  3UT4 A;  5DIZ A;  1UJJ A;  3MA5 A;  2V8S E;  1S0P A;  5EDS A;  3U66 A;  2JV0 A;  1NA0 A;  3SI5 A;  5T4Y A;  4FC8 A;  5ARF A;  1UN8 A;  4N5C A;  4DPR A;  3LVR E;  3PUK A;  3Q47 B;  2BUG A;  2IJG X;  1EYH A;  3LXU X;  4GA1 A;  1WAO 1;  4GZ5 A;  4NAC A;  4Y6W A;  5E76 A;  3UQ3 A;  5AYF A;  2I1K A;  3KS2 A;  4KXK B;  2KCL A;  1UN9 A;  1Z3X A;  3EIJ A;  4WWO A;  3F9Z A;  4E47 A;  4I6G A;  4JHK A;  5LSZ A;  2W5Z A;  1EDU A;  5C2Y A;  4Q96 A;  3EIQ C;  3QK0 A;  3SBS A;  3ZFW A;  1H6K A;  3CHQ A;  3CQC B;  4FHK A;  2I9C A;  5EX3 A;  3SHF A;  1JWG A;  1O9S A;  4YNM A;  1EF1 C;  5ANL A;  4A3V A;  1N6C A;  2KM4 A;  4CDR A;  5BNW A;  4F3V A;  3JQ0 A;  2CG2 A;  5JHB A;  3LY7 A;  2X38 A;  3PE4 A;  4FA6 A;  3I4R B;  5JJT A;  2R5S A;  2L6J A;  3D9L A;  3L54 A;  3R9A B;  2ION A;  1IYG A;  4FMU A;  3ZYL A;  2WVI A;  3SF4 A;  4MI5 A;  3DBS A;  1JPL A;  3FH7 A;  2YHE A;  3S7D A;  3E4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...