3TG4A

Structure of smyd2 in complex with sam
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
427
structure length
427
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 145
structure length 427
sequence length 427
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg4A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg4A01
3JYSA 4MI0A 2VSYA 3SZ7A 4G24A 5EKQD 4G26A 3LY7A 4HORA 3K9IA 3S8PA 5EX0A 1Y8MA 3LYAA 3TAXA 4U0SA 4YVOA 4B94A 2C0MA 5JJTA 1KLXA 2XCBA 4HOUA 3QWPA 4AY5A 5G05J 3QWWA 4WNFA 3RO3A 3M59A 4KXKB 4GZ5A 4KBQA 5CCLA 1WAO1 3MKRA 5DBKA 3UPVA 3M55A 2PQNA 4XI9A 2FBNA 3AS4A 3Q49B 3FP3A 3QDNA 1MT6A 4YNDA 4UI9C 4JLGA 5G04J 5DIZA 4ABNA 3QOUA 2IF4A 3RQ4A 2FF4A 4IN3B 1WM5A 3U3WA 3CK7A 4O6FA 3RJWA 2RFIA 3ZFWA 2PL2A 3MO2A 5BNWA 3MV2B 3LKUA 3SW9A 3CV0A 4YNPA 1KT1A 3OXGA 3MO0A 2L6JA 3M57A 2FEZA 4LEUA 4YPEA 4NJ5A 3FWVA 5A7DB 3F9XA 4U0ZA 3QKYA 3LY8A 4JA9A 4UI9K 2V5FA 4IJ8A 3ZGQA 4JL0A 2VYIA 3GZ1A 4MI5A 2UY1B 4UQYA 3ASFA 2XCCA 3M56A 4WNDA 2I6HA 4U07A 3OS5A 1ELWA 2E2EA 4N3AA 1XQHA 2F69A 1MUFA 3DB5A 3CVQA 4Y6CA 5AYFA 1KT0A 2VSNA 4GZ3A 3SWCA 4UQXA 1TJCA 4J7FA 4N2SA 4GPKA 3S7JA 4XIFA 3VTXA 4G23A 2JV0A 4QENA 3VTYA 3KD7A 3KMJA 4J7IA 2LNIA 3M54A 3MA5A 5FZSA 5LCWC 3F9YA 4APOA 4WUYA 5G04C 4G1TA 4J8DA 4O30A 3ASDA 4GA1A 3KMTA 1NA3A 3CBPA 5T0MA 3N71A 3BO5A 2C2LA 5JINA 3Q15A 3VUZA 3U4TA 1ZU2A 4GYOA 4HOQA 3TG4A 4J8OA 4J0UA 4YNMA 5FZQA 2GW1A 4YPAA 3LY9A 2QFCA 4Y6WA 2WQHA 2LSUA 1W3BA 4GYWA 4BT8A 3M5AA 1ELRA 5ARFA 5FT9A 3FFLA 1A17A 2P58C 4E47A 4RG9A 3IHXA 4RZ0A 4BTBA 4I2WA 5CHEE 5FTPA 2FO7A 4N2QA 2PZIA 2R5SA 3UQ3A 4GA0A 1N6CA 4I9EA 4I1AA 4BTAA 2KCKA 3NF1A 2G46A 2FI7A 5TTFA 4XI0A 4A1SA 3DALA 2MHKA 4I9CA 4BWRA 5CCMA 2VGXA 3E4BA 4QEOA 4N5CA 3CBOA 4RG6A 5BT1A 3SF4A 1HZ4A 4KYOB 2XGSA 5FZRA 3ULQA 3M58A 5KJLA 4LDGA 5JHNA 2R3AA 3VV0A 2IFUA 2OOEA 4EQFA 5A6CA 3CVLA 3ASHA 2AVPA 2W5ZA 4FMUA 3RKVA 2DBAA 5JIYA 4G2VA 1FCHA 3ZHEA 5F5EA 2O8JA 3F9ZA 3M53A 5M72A 2XGMA 3PE3A 5HQ8A 1ZBPA 3WXXA 1P5QA 4AM9A 4GZ6A 4N3BA 3OPEA 5KJMA 4HOTA 5F59A 5LSZA 2YQ8A 4NRHB 2ONDA 4U04A 3ESKA 1QQEA 2LSVA 3KS2A 3UUXA 2UY1A 4BT9A 1MVHA 3CKCA 1B89A 4NQ0A 4G25A 5HI7A 3MV3B 3RJVA 3CBMA 3ZHEB 4NVQA 1NZNA 4YVQC 3RO2A 1XNFA 3OXLA 2VGYA 3URZA 2BQZA 5F6KC 2JLBA 3AS8A 1OUVA 3OXFA 5G05C 4CGVA 3TG5A 1HH8A 1PC2A 5KJKA 2PQRA 4J83A 4UI9J 3HYMB 2UWJG 1IYGA 5D0OD 3RU0A 3EP0A 2XGOA 2VQ2A 5LCWJ 3F9WA 3RIBA 4H12A 4ME2A 1MVXA 5C1DA 2BUGA 3GW4A 3O48A 4W9RA 5EX3A 4I51A 3Q5MA 4I17A 3EDTB 3ZN3A 2Y4TA 1E96B 5AYWD 3GZ2A 3ASGA 1QZ2A 2VGXB 1IHGA 4AU7A 3CK9A 3IEGA 5F6LA 4Z4PA 4WNGA 4JDSA 4J8EA 2XPIA 4GA2A 3CVNA 3GYZA 4H7XA 3Q47B 4AIFA 4H7YA 5ARGA 2YHCA 3AS5A 3CVPA 3OOIA 4N39A 3MO5A 1H3IA 3ZPJA 2HO1A 3QWVA 3CK8A 4BUPA 2HR2A 3PE4A 2J9QA 1HXIA 1ML9A 3MEKA 4CGWA 2W5YA 4JHRA 4F3VA 5TH7A 4U0UA 2QPWA 4GYYA 3R9AB 2XEVA 1YA0A 4GCOA 5T0KA 1N6AA 2NC9A 5CPRB 4C1QA 2HYZA 3LPZA 3K5KA 3S7FA 4IJDA 5D0QD 2KC7A 3S7DA 3CKBA 4CDRA 4I2ZA 3KMAA 2Q7FA 2IGQA 3S7BA 4UQZA 5BW8C 4GCNA 5JJ7A 5TEGA 4N3CA 5T5GA 3TGOA 3KAEA 4HOSA 1NA0A 3BEEA 5LSXA 5JJ6A 5EG2A 4JA7A 5FJYA 1N3JA 4J8FA 4YPUA 3LCAA 3CEQA 1ZKKA 5KJNA 4AY6A 3HNAA 4QEPA 2KCVA 2C0LA 2KATA 2Y4UA 3PDNA 4WNEA 1O9SA 3RAYA 1PEGA 2WPVA 2KCLA 5JJ0A 3Q4AB 3FPDA
chains in the Genus database with same CATH superfamily
3JYSA 4GPMA 4MI0A 4KZ0A 4GMJA 5FWQA 4HORA 3S8PA 2KM4A 1SW6A 3TAXA 1SA5A 4CEMA 4YVOA 2C0MA 4V3IA 3MCXA 3PEVB 1KLXA 4BSXA 5D2MC 4HOUA 3TWQA 5CBOA 3QWPA 2DIWA 5KNGA 3G2VA 5CCLA 1WAO1 4FP7A 5DBKA 3UPVA 2PQNA 3AS4A 3L9TA 3Q49B 4YNDA 4DX1A 3PH0C 4JLGA 3L54A 2CHXA 5CRUA 4LCTA 2XHEA 4ABNA 1HX8A 2OEVA 4BETA 4YDYA 1G3NB 2WXIA 3SFXA 3CSTA 3ZFWA 3DSUA 3R9MA 5BNWA 4JEHA 3AG1E 3LKUA 2WQ6A 3CVYA 5BXOA 1Z5SC 4Q94A 5E76A 1N9AA 4NJ5A 3HXDA 3ZGQA 4HVBA 2KZTA 2RKKA 3CQGB 3R7RA 4MI5A 2WXPA 3ASFA 2XCCA 3Q73A 2I6HA 4U07A 3OS5A 2E2EA 3UM0A 1KPSB 2IO2C 4PH4B 3FU0A 3JXJA 3V30A 2VSNA 4GZ3A 2XS8A 4J7FA 4HRMB 3PUJA 4BESA 1N4QA 4G23A 3MKQB 3HRAA 3KD7A 2X38A 4HRLA 4J7IA 5ITZF 2Y0BG 1V55E 5T4YA 2OV8A 3F9YA 5ENNA 4O30A 3DXKG 3ASDA 3N71A 3E30A 3FUIA 1TNYA 4HOQA 3F6QA 4LNGA 3TG4A 3TWUA 2Y3AA 3MKQA 5EN5D 1W3BA 2F8XK 1UOHA 2LXMA 3FFLA 4RG9A 3IHXA 3D3MA 3PRZA 5CHEE 2R5SA 4DJAA 2DCPA 4DI4A 4EECA 4JVSA 1D9SA 1N11A 2H6GA 2IO3C 2G46A 4ZHBA 4KVOA 4A1SA 3DALA 4I9CA 4UUCA 2VGXA 2X6HA 2XQ0A 3ZNGA 2YNQA 1TN6A 1NP7A 4CRWA 5FZRA 3ULQA 4UWKA 3EU9A 3UIPC 5JHNA 2R3AA 2ETAA 3E32A 2IFUA 3LVQE 2OOEA 4EQFA 4EZLA 2IEJA 3CVLA 3ASHA 4FMUA 5JIYA 4G2VA 3UT8A 2X6FA 4DX6D 3F9ZA 4EZKA 1ZBPA 3D9LA 2JEKA 2XZTG 2X6IA 1OCCE 1TN8A 3W9FA 3CVWA 4BY6A 4HOTA 1H2VC 2R02A 1E8WA 1MQSA 4NRHB 3BQOA 4DX7D 4U04A 4U96D 4AXHA 4LNBA 1MVHA 1B89A 1YYHA 3RJVA 1NL4A 2WXGA 3QNKA 3ABME 1U3CA 3I5PA 1AP7A 4YVQC 1XNFA 2VGYA 2V0PA 4J6IA 1HH8A 5KJKA 3HYMB 3T5XA 4B93B 5J90A 1IQRA 5D0OD 3G2SA 3EP0A 4TXRA 4C9BB 3FTXA 4LERA 3TWWA 5KBAA 2NSZA 3GW4A 1MZCA 1E96B 4HRNA 3AG4E 3ASGA 2WXMA 5AQ9A 1IHGA 1TEZA 3CK9A 3IEGA 3OAWA 3NBNB 4I43A 2DZOA 3C5RA 5CEDB 2WXJA 2VJ8A 3L22A 4ACLA 3Q47B 4NURA 5EIBE 3ZUVB 3IV0A 4GTTA 2YHCA 1OCOE 3CVPA 3CHMA 3CK8A 1OCRE 2J9QA 1ML9A 4GMLA 2OVFA 3MEKA 4HNAD 2AWIA 2W5YA 3EHQA 3EIJA 3HXFA 2R59A 1WG0A 1UN9A 3TXNA 1N6AA 5BXUA 4HB5A 4J8SA 3U9WA 3NOGD 1S64A 3ABLE 1BD8A 2QZAA 1O1TA 4ATGA 1BLXB 4AEZC 1OWNA 5JJ7A 2NXPA 1TN7A 2MOWA 4C48B 2ETCA 3LDZA 4EHMA 3KAEA 3TJPA 2IOLA 4TUMA 5JJ6A 4B8CB 4CCAA 3DSSA 5ENOD 2PNNA 1OWLA 1N3JA 2CG2A 3CEQA 3CHPA 3SBSA 3DEPA 4ACKA 1GW6A 4FC8A 4ILGA 2IONA 2KATA 3ZW3A 4WNEA 3DSVA 1O9SA 4CT4A 1XGWA 2QY7A 5CBNA 2J09A 1HS6A 2V8SE 3Q9UC 2B0OE 3FPDA 3UX4A 4L1BA 4UWLA 3SZ7A 4G24A 5EKQD 3K9IA 3QK0A 4YDWA 3HDXA 4R7LA 1Y8MA 3ML8A 1NI1A 4GTOA 2XCBA 5JA4D 4AY5A 5D66A 2WXKA 4U8YD 4WNFA 3M59A 1PAQA 4AJWA 3MKRA 3ABKE 3L82A 1Y6IA 2P9IG 4JB8P 2MYOA 2J4BA 5G04J 4LSZE 5JHBA 3QOUA 3CVXA 4WAFA 2R17C 3RQ4A 3PZ4A 3UMVA 3CK7A 3RJWA 2H6FA 2ZU6B 2RFIA 1N0RA 3PZ2A 3MO2A 3MV2B 1H2UA 1TYQG 4HQDA 3CV0A 4YNPA 2DVWA 3MO0A 3M57A 2FEZA 2VSXE 2QYUA 1AWCB 2PM6A 1QBQA 4PUCA 3F9XA 3QKYA 5AAOA 4PS8A 2I1JA 4FLHA 4JL0A 3AJIA 2UY1B 4UQYA 3IHVA 2WXOA 5BUZA 3ZYMA 1XQHA 3LJNA 4CZ2D 3LJ3A 4Z68A 3CVQA 3D9JA 3ZRHA 1MX6A 3FUNA 4A63B 3ONLA 2IQCA 4N2SA 2LUHA 4D10C 4GPKA 4HFGA 4XIFA 3C3OA 3IKOB 1HO8A 2CHWA 4I1MA 4A55A 2XPZA 2A5UA 3M54A 3ESLA 3TL5A 1FVFA 4WUYA 3WG7E 4G8LA 1NA3A 3J5PA 5JINA 3APCA 4IYPA 3Q15A 4JHJA 1K3ZD 4LNUD 4GYOA 5ANLA 3Q75A 4OVVA 3LY9A 3UKUG 2QFCA 4KMOA 3D9PA 4Y6WA 2HE0A 3JCKC 4GYWA 3M5AA 1SA4A 5FIOA 2P58C 3MX3A 4XKBA 1DCQA 3L16A 4RZ0A 4BTBA 2RD0A 3MGBA 2ILRA 5FTPA 4ANVA 3AG2E 3DSTA 3UQ3A 4GA0A 3PVLA 2XRYA 1Z6TA 2P9SG 4BERA 3BG0B 3PS6A 3DXMG 1D8EA 2GRMA 5CRVA 4ANUA 5BV0A 4URKA 2F37A 3PNTB 2MHKA 4BWRA 3DBSA 1E8ZA 4QEOA 4L2YA 4RG6A 5CMYA 2XPYA 4L2LA 5KJLA 1WY6A 1BU9A 1N4RA 4J7WA 5ENTD 3ISMC 5A6CA 5EYLA 1FPPA 2AVPA 2W5ZA 2DBAA 4AV7A 5CMWA 2KXPC 3ZHEA 3V31A 4I6EA 2RFAA 5HRYA 5HQ8A 5AQBA 1K1BA 3QC1A 4MLPA 3Q9NC 3WXXA 3I3NA 4P29A 5EIDA 1RW2A 4JC8A 2GRPB 3G2UA 2CHZA 4AOFA 2YQ8A 5CERB 3PEUB 3IHYA 3KS2A 3APDA 1LD7A 3CKCA 3NAWA 5HI7A 1JWFA 2RG8A 3S2AA 5A23A 4GMRA 1JUQA 2XS1A 3AAAC 1NZNA 1N54A 2BQZA 3FU5A 4LRZA 1TNZA 1IQUA 4LUNU 4U8VD 4HI9A 2UWJG 4I6JA 1IYGA 3RK6A 4O60A 4PS7A 3RU0A 5LCWJ 4XE0A 4F7AA 1LF8A 5C1DA 4BX9A 4I51A 3SFYA 5HS0A 3Q5MA 4I17A 4CDNA 1JCQA 1S0PA 3DSXA 3ZN3A 3FHEA 5AYWD 5ENRD 3GZ2A 2OCCE 3U64A 3SQVA 2FO1E 4AU7A 5LX8A 3CIAA 5F6LA 4Z4PA 4WNGA 5J08A 4J8EA 2IOSA 3CVNA 2GROB 4C0MA 3FU3A 3EHMA 4RVBA 3HG0D 4E6HA 3HIZA 4U8HA 2H6HA 2WXQA 3ZVVA 3W9GA 3AS5A 1EYHA 4N39A 4F1SA 2HO1A 3QWVA 5LOZA 4BUPA 4CGWA 4L23A 3B7TA 5TH7A 4GYYA 4A3VA 2J08A 4GCOA 5T0KA 4K0RA 2NC9A 5CPRB 3LPZA 4Q96A 3UI2A 4IJDA 5D0QD 2ETBA 3CKBA 3PUKA 4CDRA 5ANRA 4XEIG 1Z3YA 4HS2A 3S7BA 1Q2ZA 1HFAA 1SZ9A 1OT8A 1HG5A 1E7VA 3CHQA 2ZISA 3FUFA 3B7BA 5T5GA 4FJZA 3TGOA 2I1KA 2GRQB 2BKKB 3NQPA 3BEEA 5LSXA 3IBEA 5FJYA 3DSWA 3L08A 4G11A 4GZCA 3UXGA 4OVUA 4YPUA 3T8MA 4JW1A 5H7PA 5JHAA 1ZKKA 3C72A 2AXUA 5BV1A 2C0LA 3OTNA 3PDNA 2EIME 4PS3A 4FJYA 2I2OA 1IXVA 3VLEA 4M3OA 3CR3A 4RLYA 3ZXPA 2XEEA 3V2OA 3LY7A 4BX8A 1H2TC 5EX0A 3LYAA 1N52A 2LAIA 4U0SA 4B94A 5KCMA 5JJTA 1BPOA 2EINE 3UKRG 4U95D 3JUIA 4MRUA 5G05J 3QWWA 3DPYA 4KXKB 4GZ5A 4KBQA 4BFRA 1HE8A 4XI9A 2FBNA 2BF0X 3BG1B 3QB2A 1H0AA 4BSZB 3G2TA 1A5EA 3FP3A 1MT6A 4OAVB 3Q78A 4UI9C 3L17A 4WWNA 3FULA 2WXLA 2KBXA 2CFZA 5B1AE 4GU5A 4GAAA 3U3WA 1OXJA 3EIQC 4O6FA 3I4GA 3ZYKA 3DEOA 4DRXE 2XRZA 5G55A 5LFAA 2YHEA 2LXLA 2L6JA 4NIKA 1N0QA 4LEUA 1OWMA 3IXEA 4ANXA 5A7DB 5IY5E 3SD5A 3I4RB 4TRQA 2J8SD 3LS8A 3SNXA 4Q69A 3PZDA 1IKND 3LXUX 2P9LG 4YDEA 3SHFA 2ZIRA 3CHSA 3SO8A 4O1PA 3ULYA 1FVHA 3CLJA 3MJWA 1ELWA 3B13A 5AJDA 4F53A 3C98A 1TNUA 1KT0A 2X3MA 1TJCA 1DCEA 3TWTA 4KVMA 2WB2A 3VTYA 4K03A 3MA5A 2AJAA 5LCWC 2LO6A 3C3QA 4APOA 2X6KA 2A5EA 5G04C 5FINA 1UW4B 3KMTA 3KSLA 3CGHA 3LEWA 3VUZA 1ZU2A 1S70B 1UJJA 4J8OA 5FQ4A 5FZQA 4YPAA 3TXMA 2FULA 2J4DA 5EYPF 5KNHD 3JXIA 1ELRA 3KEZA 5ARFA 1OY3D 5ENQD 2QYJA 4E47A 4I2WA 2FO7A 4N2QA 3B7SA 4DLQA 5T3RA 3UIOC 4FU3A 3C3RA 5ENSD 4OAUC 2EIJE 4I9EA 2HM8A 2NYJA 3ASNE 4GZDA 3NF1A 2FI7A 5TTFA 5AQ7A 3HVEA 3V79K 3Q79A 4B0ZA 1TJFA 1KZOA 3T5VA 2IJGX 4JHKA 1QNFA 4N5CA 2OVBA 3SF4A 1UJKA 4GTMA 3M58A 3T8KA 4LDGA 3FTSA 3VV0A 1H6KA 3SI5A 4J8YA 3BUAA 1VDYA 5G2NA 4IRUA 2F8YA 3ZYLA 1N94A 4HXIA 2L0TB 5C2YA 5F5EA 2O8JA 5AIJA 4JZYA 4XX5A 3EU5A 1O1SA 1P5QA 5KJMA 5LP0A 1INZA 3U66A 3V2XA 1JCSA 3AU5A 1K8KG 4A3TA 3RRUA 3ESKA 2LSVA 3D9KA 2UY1A 4NQ0A 2V4LA 2IY0C 1E8YA 4E85A 1MX4A 3CBMA 2VGEA 1DNPA 3CVVA 4NVQA 4RSYA 4UWHA 3EJNA 1MX2A 3Q7FA 5FQ7A 5F6KC 4TUUA 4ILHB 3X2QE 2IU1A 4EZJA 3OXFA 5G05C 1DVPA 4CGVA 4HBDA 3TG5A 4ZFHA 3NZUA 1RZ4A 3FUMA 3AG3E 1EDUA 2P9PG 2BKGA 3D9NA 2XGOA 2VQ2A 3FEXA 2AXZA 4GTPA 3GZSA 3RIBA 4H12A 4ME2A 1MVXA 3PNLB 2BUGA 4W9RA 4DUIA 4TV3A 4F1PA 1N95A 1IHBA 3EDTB 4RQIA 2Y4TA 2J07A 3UINC 5CECB 2VGXB 4F6RD 4GTQA 3UTMA 2BTDA 4GA2A 5JMND 3FUHA 4H7XA 1LTXA 4AIFA 4H7YA 5ARGA 2X6JA 2CG3A 3FTYA 3PZ3A 2R2LA 3ZPJA 2RFMA 3FTZA 5FQ6A 2HR2A 3PE4A 4DX2A 3R7QA 3P1UA 4JHRA 3E33A 4GTVA 4U0UA 2QPWA 1U2VG 1KZPA 3R9AB 4DX5D 2XEVA 1YA0A 3FU6A 1H19A 4JXTA 1JPLA 3KSQA 3K5KA 2P9KG 3S7FA 4B89A 2GGFA 1NFIE 3KEAA 3Q7AA 3KMAA 2Q7FA 2WQ7A 2Y1LE 3T9KA 4FULA 5BW8C 3P2BA 4JPSA 3HXCA 3VLDA 4GB9A 5TEGA 4G8KA 1NA0A 4L7TA 2L9BA 5HKPA 2GRLA 4QQIA 1BI8B 5EG2A 1EPUA 4JA7A 3NB2A 1UG3A 2F0YA 4J8FA 2QC9A 3LCAA 1L5JA 1O1RA 3CQCB 4AY6A 3HNAA 1JWGA 3SGHA 1N4PA 2Y4UA 3QARA 1SZAA 4GTRA 3RAYA 4TXPA 5JJ0A 1K1AA 3E34A 3HVEB 3EHRA 1YMPA 3Q4AB 4A1GA 4MS6A 1LD8A 2VSYA 2ZXWE 1PY1A 4N5QA 4G26A 1X81A 4X8QA 1FT2A 2GRRB 4KZCA 3FTVA 1N4SA 4FHJA 3FUDA 3RO3A 4CDMA 3M55A 5AJLA 3QDNA 3SY2A 1HF8A 5ENPD 5DIZA 3LVRE 1TNOA 2IF4A 4APFA 2XZDG 2FF4A 1SQMA 2XEHA 4IN3B 1WM5A 3L13A 4K5CA 2P9UG 1OWPA 2PL2A 3B7UX 4JD2G 3HXBA 4CT0A 2L6BA 3HXEA 5FQ8A 5AARA 3SW9A 4EBAA 5EDSA 3MYVA 1KT1A 3OXGA 4I1OB 2R05A 4GTSA 1MYOA 4IULA 2WMOA 4YPEA 2WXRA 3RSEG 3FWVA 4U0ZA 3LY8A 4JA9A 4UI9K 2V5FA 4HLEA 4IJ8A 3FTUA 2VYIA 3GZ1A 2CFUA 1S63A 1O5MA 3M56A 4WNDA 1U3DA 4FLBA 4N3AA 2I9CA 1OCZE 2F69A 3CSFA 3JUEA 2DYRE 2L0IA 1MUFA 3DB5A 4Y6CA 5AYFA 3E37A 4EPZA 3SWCA 4UQXA 2VTBA 2KZTB 3S7JA 3TWVA 3ZXSA 3ONKA 3L6AA 3VTXA 2JV0A 4QENA 2GRNB 3KMJA 4AVXA 3FEYA 2LNIA 3ZYQA 3TWRA 5EILA 5FZSA 4NACA 1QYMA 4G1TA 4J8DA 5CEAA 4GA1A 3CBPA 5T0MA 3BO5A 2C2LA 1EF1C 3QJZA 4BEPA 3FH8A 4LG6A 1V54E 4ILIA 3U4TA 4J0UA 3UM2A 4YNMA 2GW1A 3B7RL 2ZGDA 4PDXA 4OYSA 1FT1A 3D9HA 4DLOA 2WQHA 3D9OA 2LSUA 4BT8A 2P9NG 5FT9A 1BI7B 3D9IA 1A17A 4DI3A 2WM9A 2PZIA 2EIKE 2WVIA 1TR4A 2WXNA 1N6CA 4I1AA 4BTAA 4ANWA 3DRAA 3FUJA 3JQ1A 1TNBA 2KCKA 1JCRA 4XI0A 2P2CP 4U63A 3ASOE 3PREA 5BPPA 4FADA 5CCMA 1X5BA 4KT6B 4UWFA 3E4BA 3NOCD 3CBOA 1SVXA 1WDYA 3ULEG 5BT1A 4O1OA 1HZ4A 4KYOB 2XGSA 2J49A 4I6GA 3CVUA 4AP2A 3FUKA 2DYSE 3TWSA 2BEDA 2DWZA 4XKCA 3FDHA 4QFVA 2XENA 4WWPA 1H6OA 2LAHA 3RKVA 2OEWA 1FCHA 3BU8A 3SFZA 3M53A 4HI8A 5M72A 2XGMA 3PE3A 3ZU7B 2VTBB 4AM9A 4GZ6A 4N3BA 3OPEA 3UM3A 2M63A 5F59A 4K5AB 5LSZA 2H6IA 5T8IA 2DZNA 2ONDA 1QQEA 3UUXA 3VLFA 4BT9A 3QAQA 3RRNB 1HU3A 4G25A 3MV3B 3ZHEB 4L9PA 1OWOA 2AW6A 1YCSB 2A4ZA 1H6PA 3OXLA 3RO2A 3URZA 2Y69E 3DPDA 4XZ4A 4B8AA 2JLBA 3AS8A 1OUVA 3J5QB 3UM1A 1PC2A 3CHRA 2PQRA 3O4ZA 4J83A 4UI9J 1E8XA 3ENEA 3RRMB 4U7EB 3FH5A 3FTWA 3CHOA 3F9WA 1MJ0A 3D9MA 2E0IA 5EX3A 3HHMA 3O48A 3FUEA 4YDOA 3JQ0A 1E90A 4CYMD 5B1BE 2VSOE 1QZ2A 2V4HC 2MRIA 1HG2A 3EUVA 4JDSA 3PZ1A 2XPIA 3GYZA 4ATZD 5B3SE 3FY4A 3FH7A 5AQAA 4DK5A 4C0EA 5AENA 3DWLG 3OOIA 3MO5A 3ZKJA 1H3IA 1ELKA 3ZIMA 5KWDA 2YINA 2ZGGA 1ZB1A 1HXIA 2PM7A 3SBTB 2JABA 3UT7A 2EILE 2WXFA 4F3VA 4MBGA 2R03A 1Z3XA 4C1QA 2HYZA 3MZLB 4K5BA 3S7DA 2KC7A 2AXVA 2WXHA 4I2ZA 2B6CA 3UT4A 4HLLA 2IGQA 1D8DA 4UQZA 4FHKA 3TWXA 3ML9A 4GCNA 4MKTA 4DPRA 5E75A 1MHQA 2EQXA 3AU4A 3NZSA 3B95A 4N3CA 5AN8A 2V5QC 4HOSA 1DC2A 3ZEFA 4JEUA 3EHNA 3APFA 4WWOA 1UN8A 4FA6A 5KJNA 4TXQA 4UWGA 4QEPA 2KCVA 3G2WA 1E7UA 3RAUA 1PEGA 2WPVA 2WMNA 2KCLA 4M7CA 4EBAG
chains in the Genus database with same CATH topology
3JYSA 4A1GA 4MS6A 4L1BA 4UWLA 4KZ0A 2VSYA 3UX4A 3SZ7A 4MI0A 1PY1A 4G24A 4G26A 3LY7A 4GMJA 5EKQD 5FWQA 4BX8A 4HORA 1H2TC 3K9IA 3S8PA 3QK0A 5EX0A 2KM4A 3HDXA 4R7LA 1Y8MA 3LYAA 3TAXA 1N52A 2LAIA 3ML8A 4CEMA 4U0SA 4KZCA 4YVOA 3FTVA 2C0MA 4V3IA 4B94A 5KCMA 5JJTA 3MCXA 3PEVB 1KLXA 4BSXA 2XCBA 1BPOA 4FHJA 4HOUA 3FUDA 3QWPA 4AY5A 2DIWA 3JUIA 4MRUA 2WXKA 5G05J 3QWWA 4WNFA 3RO3A 3M59A 3G2VA 4CDMA 4KXKB 4GZ5A 1PAQA 4KBQA 4AJWA 1WAO1 3MKRA 4FP7A 5DBKA 4BFRA 2PQNA 1HE8A 4XI9A 3UPVA 3M55A 1Y6IA 2FBNA 2BF0X 3BG1B 3QB2A 5AJLA 1H0AA 3AS4A 3G2TA 3Q49B 3FP3A 3QDNA 1MT6A 4YNDA 4UI9C 3PH0C 4JLGA 2J4BA 1HF8A 2CHXA 3L17A 3L54A 5G04J 4LCTA 5DIZA 2XHEA 4ABNA 4WWNA 3FULA 3LVRE 2WXLA 5JHBA 3QOUA 3CVXA 2IF4A 4APFA 4WAFA 1HX8A 2R17C 3RQ4A 2CFZA 2FF4A 1SQMA 4IN3B 4GU5A 1WM5A 4GAAA 3UMVA 3U3WA 3CK7A 3L13A 2WXIA 3EIQC 4O6FA 3RJWA 2ZU6B 3CSTA 3I4GA 2RFIA 3ZFWA 1OWPA 3ZYKA 2XRZA 2PL2A 3B7UX 5G55A 3MO2A 4CT0A 5BNWA 3MV2B 4JEHA 1H2UA 5FQ8A 3LKUA 3SW9A 2WQ6A 3CVYA 4EBAA 3CV0A 5EDSA 4YNPA 4Q94A 3MYVA 5LFAA 1KT1A 2YHEA 3OXGA 3MO0A 4I1OB 2L6JA 3M57A 2FEZA 2VSXE 4LEUA 5E76A 4IULA 1OWMA 2WMOA 4NJ5A 2WXRA 4YPEA 2PM6A 4ANXA 3FWVA 4PUCA 5A7DB 3SD5A 4U0ZA 3QKYA 3F9XA 3I4RB 3LY8A 4TRQA 4JA9A 4UI9K 2V5FA 4HLEA 4IJ8A 3LS8A 3ZGQA 3SNXA 4HVBA 4Q69A 2KZTA 3PZDA 4PS8A 2I1JA 4FLHA 3LXUX 4JL0A 3SHFA 3CHSA 3CQGB 2VYIA 3FTUA 3GZ1A 2CFUA 3R7RA 4MI5A 2UY1B 2WXPA 4UQYA 3IHVA 2WXOA 3ASFA 1FVHA 2XCCA 3CLJA 5BUZA 3MJWA 3M56A 4WNDA 2I6HA 1U3DA 4FLBA 4U07A 3OS5A 1ELWA 2E2EA 2I9CA 4N3AA 3ZYMA 1XQHA 2F69A 3CSFA 3B13A 3LJ3A 5AJDA 4F53A 2L0IA 3C98A 1MUFA 3DB5A 3CVQA 3D9JA 4Y6CA 4PH4B 3FU0A 5AYFA 3ZRHA 3FUNA 4EPZA 1KT0A 2X3MA 2VSNA 4GZ3A 3ONLA 3SWCA 2IQCA 1TJCA 4UQXA 4J7FA 4N2SA 2VTBA 4GPKA 2KZTB 4D10C 3S7JA 3PUJA 3ZXSA 3ONKA 4HFGA 4XIFA 3L6AA 3VTXA 3IKOB 4G23A 2JV0A 1HO8A 2CHWA 4QENA 4KVMA 3MKQB 2WB2A 4I1MA 3VTYA 3KD7A 2X38A 2XPZA 4A55A 4AVXA 3FEYA 3KMJA 4J7IA 2LNIA 3ZYQA 4K03A 2A5UA 3M54A 3MA5A 5T4YA 3ESLA 2OV8A 5FZSA 5LCWC 3F9YA 3TL5A 2LO6A 1FVFA 4NACA 4APOA 2X6KA 4WUYA 5ENNA 4G1TA 4J8DA 5G04C 1UW4B 4O30A 3ASDA 4GA1A 3KMTA 1NA3A 3CBPA 5T0MA 3N71A 3BO5A 2C2LA 1EF1C 3APCA 3QJZA 5JINA 3FH8A 4IYPA 3Q15A 3CGHA 3FUIA 4JHJA 3LEWA 3VUZA 4ILIA 3U4TA 1ZU2A 4GYOA 5ANLA 4HOQA 3TG4A 1UJJA 4OVVA 4J8OA 4J0UA 4YNMA 5FQ4A 5FZQA 2GW1A 3B7RL 4YPAA 3LY9A 2Y3AA 4PDXA 2QFCA 4KMOA 3MKQA 4OYSA 3D9PA 3TXMA 4Y6WA 4DLOA 2WQHA 2FULA 3D9OA 2J4DA 3JCKC 2LSUA 1W3BA 4GYWA 4BT8A 3M5AA 1ELRA 3KEZA 5ARFA 5FT9A 3FFLA 3D9IA 1A17A 2P58C 3MX3A 4E47A 4RG9A 4XKBA 3L16A 3IHXA 3D3MA 4DI3A 4BTBA 2RD0A 3MGBA 2ILRA 2FO7A 3PRZA 4I2WA 5CHEE 2WM9A 5FTPA 2PZIA 4ANVA 3B7SA 2R5SA 4DLQA 4DJAA 3UQ3A 4N2QA 4GA0A 3PVLA 2WVIA 2DCPA 5T3RA 2WXNA 4DI4A 2XRYA 1Z6TA 4FU3A 1N6CA 4EECA 4JVSA 4I9EA 2HM8A 4I1AA 4BTAA 3BG0B 3PS6A 4ANWA 3FUJA 3JQ1A 2KCKA 2GRMA 4GZDA 3NF1A 2G46A 4ANUA 2FI7A 5BV0A 4XI0A 4KVOA 4URKA 5TTFA 3PNTB 4U63A 4A1SA 3HVEA 3PREA 2MHKA 4I9CA 4BWRA 5BPPA 3DALA 4B0ZA 1TJFA 4FADA 3DBSA 5CCMA 2VGXA 1X5BA 3T5VA 4KT6B 2X6HA 1E8ZA 2IJGX 2XQ0A 4JHKA 4UWFA 3E4BA 1QNFA 4QEOA 4N5CA 3CBOA 4L2YA 4RG6A 2OVBA 2YNQA 5CMYA 5BT1A 3SF4A 2XPYA 1UJKA 1NP7A 1HZ4A 4KYOB 4L2LA 4CRWA 2XGSA 5FZRA 3ULQA 3M58A 2J49A 4I6GA 4UWKA 5KJLA 3CVUA 1WY6A 4AP2A 3FUKA 4LDGA 5JHNA 4XKCA 3FTSA 2R3AA 3FDHA 3VV0A 2IFUA 3LVQE 2OOEA 4QFVA 1H6KA 3SI5A 4EQFA 4EZLA 4WWPA 5A6CA 3CVLA 3ASHA 2AVPA 2W5ZA 2LAHA 4FMUA 1VDYA 3RKVA 2DBAA 5G2NA 5JIYA 4AV7A 4IRUA 4G2VA 3UT8A 3ZYLA 1FCHA 2X6FA 5CMWA 4HXIA 2L0TB 5C2YA 3ZHEA 5F5EA 2O8JA 3SFZA 4I6EA 5AIJA 3F9ZA 3M53A 5M72A 2XGMA 4EZKA 3PE3A 4JZYA 5HQ8A 1ZBPA 4XX5A 3QC1A 2VTBB 4MLPA 3WXXA 1P5QA 3I3NA 3D9LA 2JEKA 4GZ6A 4AM9A 4P29A 2X6IA 4N3BA 3CVWA 5KJMA 4JC8A 4BY6A 3G2UA 3OPEA 2M63A 5LP0A 1INZA 3U66A 4HOTA 1H2VC 5F59A 2CHZA 5LSZA 1E8WA 4AOFA 2YQ8A 1MQSA 3AU5A 4NRHB 3PEUB 3IHYA 2ONDA 5T8IA 4A3TA 4U04A 3ESKA 1QQEA 2LSVA 3D9KA 3RRUA 4AXHA 3KS2A 3UUXA 3VLFA 2UY1A 3APDA 4BT9A 3QAQA 1MVHA 3CKCA 1B89A 4NQ0A 1HU3A 4G25A 5HI7A 2V4LA 3RRNB 1E8YA 3MV3B 4E85A 1JWFA 3RJVA 2RG8A 3S2AA 2WXGA 3QNKA 3CBMA 3ZHEB 5A23A 1OWOA 1U3CA 1DNPA 3CVVA 1JUQA 2AW6A 4NVQA 4RZ0A 2A4ZA 4RSYA 4UWHA 3I5PA 1NZNA 3EJNA 4YVQC 3OXLA 1XNFA 3RO2A 1N54A 2VGYA 3URZA 2BQZA 5FQ7A 5F6KC 3DPDA 4XZ4A 4B8AA 4TUUA 2JLBA 4ILHB 2V0PA 3AS8A 1OUVA 2IU1A 4J6IA 4EZJA 3OXFA 5G05C 1DVPA 4CGVA 3TG5A 3FU5A 1HH8A 1PC2A 4LRZA 1IQUA 3NZUA 3CHRA 5KJKA 4LUNU 2PQRA 3O4ZA 4J83A 4UI9J 3HYMB 2UWJG 1E8XA 3ENEA 3T5XA 3FUMA 4I6JA 3RRMB 5J90A 1IYGA 3RK6A 1EDUA 1IQRA 5D0OD 3D9NA 3G2SA 4PS7A 3FH5A 3RU0A 3EP0A 3FTWA 2XGOA 3CHOA 2VQ2A 3FEXA 4C9BB 5LCWJ 2AXZA 4XE0A 3F9WA 3FTXA 3GZSA 4LERA 3RIBA 4F7AA 3D9MA 4H12A 1LF8A 4ME2A 5C1DA 1MVXA 2E0IA 3PNLB 4BX9A 2BUGA 2NSZA 3GW4A 3HHMA 3O48A 3FUEA 4TV3A 4W9RA 5EX3A 4I51A 3Q5MA 4I17A 4CDNA 1S0PA 3EDTB 3ZN3A 3JQ0A 2Y4TA 1E90A 3FHEA 1E96B 2J07A 5AYWD 3GZ2A 2VSOE 2WXMA 3ASGA 1QZ2A 3U64A 2VGXB 1IHGA 1TEZA 4AU7A 5LX8A 3CK9A 3CIAA 2MRIA 1HG2A 3IEGA 5F6LA 3OAWA 4Z4PA 4I43A 4WNGA 4JDSA 5J08A 4J8EA 2IOSA 2BTDA 2WXJA 2XPIA 4GA2A 2VJ8A 3CVNA 3GYZA 3FUHA 4C0MA 4H7XA 3L22A 3FU3A 4ACLA 3EHMA 3Q47B 4RVBA 3FY4A 3FH7A 4NURA 4AIFA 4E6HA 4DK5A 3HIZA 4U8HA 2WXQA 4H7YA 3ZVVA 5ARGA 4C0EA 3IV0A 5AENA 2X6JA 2CG3A 2YHCA 3AS5A 1EYHA 3CVPA 3FTYA 3OOIA 4N39A 3MO5A 3CHMA 4F1SA 1H3IA 3ZPJA 2HO1A 1ELKA 3QWVA 3FTZA 2YINA 3ZIMA 5LOZA 3CK8A 5FQ6A 4BUPA 2HR2A 3PE4A 2J9QA 5CCLA 1HXIA 2PM7A 4GMLA 1ML9A 2OVFA 3MEKA 3R7QA 3SBTB 3P1UA 4CGWA 2AWIA 3UT7A 2W5YA 4L23A 4JHRA 3B7TA 3EIJA 2WXFA 4F3VA 2R59A 5TH7A 4U0UA 2QPWA 4GYYA 4A3VA 3R9AB 1UN9A 2XEVA 2J08A 3TXNA 1YA0A 4GCOA 5T0KA 4K0RA 1N6AA 3FU6A 1H19A 1Z3XA 2NC9A 5CPRB 4JXTA 1JPLA 4C1QA 2HYZA 3LPZA 3MZLB 4Q96A 3K5KA 4J8SA 3U9WA 3S7FA 4B89A 4IJDA 2GGFA 5D0QD 2KC7A 3S7DA 3CKBA 3PUKA 4CDRA 5ANRA 2AXVA 2WXHA 4I2ZA 1Z3YA 3KMAA 2Q7FA 3UT4A 2IGQA 4HS2A 2WQ7A 4ATGA 3S7BA 4AEZC 1OWNA 4UQZA 4FULA 4FHKA 5BW8C 3ML9A 4GCNA 3P2BA 4JPSA 4MKTA 1HFAA 4DPRA 1SZ9A 5JJ7A 2NXPA 5E75A 1HG5A 3VLDA 2MOWA 1E7VA 1MHQA 4GB9A 3CHQA 2EQXA 3AU4A 3NZSA 3LDZA 3FUFA 5TEGA 4N3CA 5T5GA 4FJZA 3TGOA 3KAEA 2I1KA 4HOSA 3TJPA 1NA0A 3ZEFA 4L7TA 2IOLA 4JEUA 2L9BA 3NQPA 3EHNA 3APFA 3BEEA 2GRLA 5JJ6A 5EG2A 5LSXA 4B8CB 1EPUA 4JA7A 4WWOA 4CCAA 3IBEA 5FJYA 3L08A 4G11A 1OWLA 1UG3A 1UN8A 4GZCA 1N3JA 4J8FA 4FA6A 4OVUA 3LCAA 4YPUA 3T8MA 1L5JA 2CG2A 3CEQA 4JW1A 3CHPA 3SBSA 5JHAA 3CQCB 1ZKKA 5KJNA 4AY6A 4ACKA 1GW6A 2AXUA 4FC8A 3HNAA 5BV1A 4ILGA 4UWGA 4QEPA 2KCVA 2IONA 1JWGA 3SGHA 2Y4UA 2C0LA 2KATA 3OTNA 3PDNA 3G2WA 3QARA 4FJYA 1SZAA 4PS3A 2I2OA 3ZW3A 1E7UA 4WNEA 1O9SA 4CT4A 3RAYA 1PEGA 2WPVA 2WMNA 2KCLA 3VLEA 4M3OA 1XGWA 2QY7A 5JJ0A 2J09A 3CR3A 1HS6A 2V8SE 3HVEB 4EBAG 3Q4AB 3FPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYS A;  4MI0 A;  2VSY A;  3SZ7 A;  4G24 A;  5EKQ D;  4G26 A;  3LY7 A;  4HOR A;  3K9I A;  3S8P A;  5EX0 A;  1Y8M A;  3LYA A;  3TAX A;  4U0S A;  4YVO A;  4B94 A;  2C0M A;  5JJT A;  1KLX A;  2XCB A;  4HOU A;  3QWP A;  4AY5 A;  5G05 J;  3QWW A;  4WNF A;  3RO3 A;  3M59 A;  4KXK B;  4GZ5 A;  4KBQ A;  5CCL A;  1WAO 1;  3MKR A;  5DBK A;  3UPV A;  3M55 A;  2PQN A;  4XI9 A;  2FBN A;  3AS4 A;  3Q49 B;  3FP3 A;  3QDN A;  1MT6 A;  4YND A;  4UI9 C;  4JLG A;  5G04 J;  5DIZ A;  4ABN A;  3QOU A;  2IF4 A;  3RQ4 A;  2FF4 A;  4IN3 B;  1WM5 A;  3U3W A;  3CK7 A;  4O6F A;  3RJW A;  2RFI A;  3ZFW A;  2PL2 A;  3MO2 A;  5BNW A;  3MV2 B;  3LKU A;  3SW9 A;  3CV0 A;  4YNP A;  1KT1 A;  3OXG A;  3MO0 A;  2L6J A;  3M57 A;  2FEZ A;  4LEU A;  4YPE A;  4NJ5 A;  3FWV A;  5A7D B;  3F9X A;  4U0Z A;  3QKY A;  3LY8 A;  4JA9 A;  4UI9 K;  2V5F A;  4IJ8 A;  3ZGQ A;  4JL0 A;  2VYI A;  3GZ1 A;  4MI5 A;  2UY1 B;  4UQY A;  3ASF A;  2XCC A;  3M56 A;  4WND A;  2I6H A;  4U07 A;  3OS5 A;  1ELW A;  2E2E A;  4N3A A;  1XQH A;  2F69 A;  1MUF A;  3DB5 A;  3CVQ A;  4Y6C A;  5AYF A;  1KT0 A;  2VSN A;  4GZ3 A;  3SWC A;  4UQX A;  1TJC A;  4J7F A;  4N2S A;  4GPK A;  3S7J A;  4XIF A;  3VTX A;  4G23 A;  2JV0 A;  4QEN A;  3VTY A;  3KD7 A;  3KMJ A;  4J7I A;  2LNI A;  3M54 A;  3MA5 A;  5FZS A;  5LCW C;  3F9Y A;  4APO A;  4WUY A;  5G04 C;  4G1T A;  4J8D A;  4O30 A;  3ASD A;  4GA1 A;  3KMT A;  1NA3 A;  3CBP A;  5T0M A;  3N71 A;  3BO5 A;  2C2L A;  5JIN A;  3Q15 A;  3VUZ A;  3U4T A;  1ZU2 A;  4GYO A;  4HOQ A;  3TG4 A;  4J8O A;  4J0U A;  4YNM A;  5FZQ A;  2GW1 A;  4YPA A;  3LY9 A;  2QFC A;  4Y6W A;  2WQH A;  2LSU A;  1W3B A;  4GYW A;  4BT8 A;  3M5A A;  1ELR A;  5ARF A;  5FT9 A;  3FFL A;  1A17 A;  2P58 C;  4E47 A;  4RG9 A;  3IHX A;  4RZ0 A;  4BTB A;  4I2W A;  5CHE E;  5FTP A;  2FO7 A;  4N2Q A;  2PZI A;  2R5S A;  3UQ3 A;  4GA0 A;  1N6C A;  4I9E A;  4I1A A;  4BTA A;  2KCK A;  3NF1 A;  2G46 A;  2FI7 A;  5TTF A;  4XI0 A;  4A1S A;  3DAL A;  2MHK A;  4I9C A;  4BWR A;  5CCM A;  2VGX A;  3E4B A;  4QEO A;  4N5C A;  3CBO A;  4RG6 A;  5BT1 A;  3SF4 A;  1HZ4 A;  4KYO B;  2XGS A;  5FZR A;  3ULQ A;  3M58 A;  5KJL A;  4LDG A;  5JHN A;  2R3A A;  3VV0 A;  2IFU A;  2OOE A;  4EQF A;  5A6C A;  3CVL A;  3ASH A;  2AVP A;  2W5Z A;  4FMU A;  3RKV A;  2DBA A;  5JIY A;  4G2V A;  1FCH A;  3ZHE A;  5F5E A;  2O8J A;  3F9Z A;  3M53 A;  5M72 A;  2XGM A;  3PE3 A;  5HQ8 A;  1ZBP A;  3WXX A;  1P5Q A;  4AM9 A;  4GZ6 A;  4N3B A;  3OPE A;  5KJM A;  4HOT A;  5F59 A;  5LSZ A;  2YQ8 A;  4NRH B;  2OND A;  4U04 A;  3ESK A;  1QQE A;  2LSV A;  3KS2 A;  3UUX A;  2UY1 A;  4BT9 A;  1MVH A;  3CKC A;  1B89 A;  4NQ0 A;  4G25 A;  5HI7 A;  3MV3 B;  3RJV A;  3CBM A;  3ZHE B;  4NVQ A;  1NZN A;  4YVQ C;  3RO2 A;  1XNF A;  3OXL A;  2VGY A;  3URZ A;  2BQZ A;  5F6K C;  2JLB A;  3AS8 A;  1OUV A;  3OXF A;  5G05 C;  4CGV A;  3TG5 A;  1HH8 A;  1PC2 A;  5KJK A;  2PQR A;  4J83 A;  4UI9 J;  3HYM B;  2UWJ G;  1IYG A;  5D0O D;  3RU0 A;  3EP0 A;  2XGO A;  2VQ2 A;  5LCW J;  3F9W A;  3RIB A;  4H12 A;  4ME2 A;  1MVX A;  5C1D A;  2BUG A;  3GW4 A;  3O48 A;  4W9R A;  5EX3 A;  4I51 A;  3Q5M A;  4I17 A;  3EDT B;  3ZN3 A;  2Y4T A;  1E96 B;  5AYW D;  3GZ2 A;  3ASG A;  1QZ2 A;  2VGX B;  1IHG A;  4AU7 A;  3CK9 A;  3IEG A;  5F6L A;  4Z4P A;  4WNG A;  4JDS A;  4J8E A;  2XPI A;  4GA2 A;  3CVN A;  3GYZ A;  4H7X A;  3Q47 B;  4AIF A;  4H7Y A;  5ARG A;  2YHC A;  3AS5 A;  3CVP A;  3OOI A;  4N39 A;  3MO5 A;  1H3I A;  3ZPJ A;  2HO1 A;  3QWV A;  3CK8 A;  4BUP A;  2HR2 A;  3PE4 A;  2J9Q A;  1HXI A;  1ML9 A;  3MEK A;  4CGW A;  2W5Y A;  4JHR A;  4F3V A;  5TH7 A;  4U0U A;  2QPW A;  4GYY A;  3R9A B;  2XEV A;  1YA0 A;  4GCO A;  5T0K A;  1N6A A;  2NC9 A;  5CPR B;  4C1Q A;  2HYZ A;  3LPZ A;  3K5K A;  3S7F A;  4IJD A;  5D0Q D;  2KC7 A;  3S7D A;  3CKB A;  4CDR A;  4I2Z A;  3KMA A;  2Q7F A;  2IGQ A;  3S7B A;  4UQZ A;  5BW8 C;  4GCN A;  5JJ7 A;  5TEG A;  4N3C A;  5T5G A;  3TGO A;  3KAE A;  4HOS A;  1NA0 A;  3BEE A;  5LSX A;  5JJ6 A;  5EG2 A;  4JA7 A;  5FJY A;  1N3J A;  4J8F A;  4YPU A;  3LCA A;  3CEQ A;  1ZKK A;  5KJN A;  4AY6 A;  3HNA A;  4QEP A;  2KCV A;  2C0L A;  2KAT A;  2Y4U A;  3PDN A;  4WNE A;  1O9S A;  3RAY A;  1PEG A;  2WPV A;  2KCL A;  5JJ0 A;  3Q4A B;  3FPD A; 
#chains in the Genus database with same CATH topology
 3JYS A;  4GPM A;  4MI0 A;  4KZ0 A;  4GMJ A;  5FWQ A;  4HOR A;  3S8P A;  2KM4 A;  1SW6 A;  3TAX A;  1SA5 A;  4CEM A;  4YVO A;  2C0M A;  4V3I A;  3MCX A;  3PEV B;  1KLX A;  4BSX A;  5D2M C;  4HOU A;  3TWQ A;  5CBO A;  3QWP A;  2DIW A;  5KNG A;  3G2V A;  5CCL A;  1WAO 1;  4FP7 A;  5DBK A;  3UPV A;  2PQN A;  3AS4 A;  3L9T A;  3Q49 B;  4YND A;  4DX1 A;  3PH0 C;  4JLG A;  3L54 A;  2CHX A;  5CRU A;  4LCT A;  2XHE A;  4ABN A;  1HX8 A;  2OEV A;  4BET A;  4YDY A;  1G3N B;  2WXI A;  3SFX A;  3CST A;  3ZFW A;  3DSU A;  3R9M A;  5BNW A;  4JEH A;  3AG1 E;  3LKU A;  2WQ6 A;  3CVY A;  5BXO A;  1Z5S C;  4Q94 A;  5E76 A;  1N9A A;  4NJ5 A;  3HXD A;  3ZGQ A;  4HVB A;  2KZT A;  2RKK A;  3CQG B;  3R7R A;  4MI5 A;  2WXP A;  3ASF A;  2XCC A;  3Q73 A;  2I6H A;  4U07 A;  3OS5 A;  2E2E A;  3UM0 A;  1KPS B;  2IO2 C;  4PH4 B;  3FU0 A;  3JXJ A;  3V30 A;  2VSN A;  4GZ3 A;  2XS8 A;  4J7F A;  4HRM B;  3PUJ A;  4BES A;  1N4Q A;  4G23 A;  3MKQ B;  3HRA A;  3KD7 A;  2X38 A;  4HRL A;  4J7I A;  5ITZ F;  2Y0B G;  1V55 E;  5T4Y A;  2OV8 A;  3F9Y A;  5ENN A;  4O30 A;  3DXK G;  3ASD A;  3N71 A;  3E30 A;  3FUI A;  1TNY A;  4HOQ A;  3F6Q A;  4LNG A;  3TG4 A;  3TWU A;  2Y3A A;  3MKQ A;  5EN5 D;  1W3B A;  2F8X K;  1UOH A;  2LXM A;  3FFL A;  4RG9 A;  3IHX A;  3D3M A;  3PRZ A;  5CHE E;  2R5S A;  4DJA A;  2DCP A;  4DI4 A;  4EEC A;  4JVS A;  1D9S A;  1N11 A;  2H6G A;  2IO3 C;  2G46 A;  4ZHB A;  4KVO A;  4A1S A;  3DAL A;  4I9C A;  4UUC A;  2VGX A;  2X6H A;  2XQ0 A;  3ZNG A;  2YNQ A;  1TN6 A;  1NP7 A;  4CRW A;  5FZR A;  3ULQ A;  4UWK A;  3EU9 A;  3UIP C;  5JHN A;  2R3A A;  2ETA A;  3E32 A;  2IFU A;  3LVQ E;  2OOE A;  4EQF A;  4EZL A;  2IEJ A;  3CVL A;  3ASH A;  4FMU A;  5JIY A;  4G2V A;  3UT8 A;  2X6F A;  4DX6 D;  3F9Z A;  4EZK A;  1ZBP A;  3D9L A;  2JEK A;  2XZT G;  2X6I A;  1OCC E;  1TN8 A;  3W9F A;  3CVW A;  4BY6 A;  4HOT A;  1H2V C;  2R02 A;  1E8W A;  1MQS A;  4NRH B;  3BQO A;  4DX7 D;  4U04 A;  4U96 D;  4AXH A;  4LNB A;  1MVH A;  1B89 A;  1YYH A;  3RJV A;  1NL4 A;  2WXG A;  3QNK A;  3ABM E;  1U3C A;  3I5P A;  1AP7 A;  4YVQ C;  1XNF A;  2VGY A;  2V0P A;  4J6I A;  1HH8 A;  5KJK A;  3HYM B;  3T5X A;  4B93 B;  5J90 A;  1IQR A;  5D0O D;  3G2S A;  3EP0 A;  4TXR A;  4C9B B;  3FTX A;  4LER A;  3TWW A;  5KBA A;  2NSZ A;  3GW4 A;  1MZC A;  1E96 B;  4HRN A;  3AG4 E;  3ASG A;  2WXM A;  5AQ9 A;  1IHG A;  1TEZ A;  3CK9 A;  3IEG A;  3OAW A;  3NBN B;  4I43 A;  2DZO A;  3C5R A;  5CED B;  2WXJ A;  2VJ8 A;  3L22 A;  4ACL A;  3Q47 B;  4NUR A;  5EIB E;  3ZUV B;  3IV0 A;  4GTT A;  2YHC A;  1OCO E;  3CVP A;  3CHM A;  3CK8 A;  1OCR E;  2J9Q A;  1ML9 A;  4GML A;  2OVF A;  3MEK A;  4HNA D;  2AWI A;  2W5Y A;  3EHQ A;  3EIJ A;  3HXF A;  2R59 A;  1WG0 A;  1UN9 A;  3TXN A;  1N6A A;  5BXU A;  4HB5 A;  4J8S A;  3U9W A;  3NOG D;  1S64 A;  3ABL E;  1BD8 A;  2QZA A;  1O1T A;  4ATG A;  1BLX B;  4AEZ C;  1OWN A;  5JJ7 A;  2NXP A;  1TN7 A;  2MOW A;  4C48 B;  2ETC A;  3LDZ A;  4EHM A;  3KAE A;  3TJP A;  2IOL A;  4TUM A;  5JJ6 A;  4B8C B;  4CCA A;  3DSS A;  5ENO D;  2PNN A;  1OWL A;  1N3J A;  2CG2 A;  3CEQ A;  3CHP A;  3SBS A;  3DEP A;  4ACK A;  1GW6 A;  4FC8 A;  4ILG A;  2ION A;  2KAT A;  3ZW3 A;  4WNE A;  3DSV A;  1O9S A;  4CT4 A;  1XGW A;  2QY7 A;  5CBN A;  2J09 A;  1HS6 A;  2V8S E;  3Q9U C;  2B0O E;  3FPD A;  3UX4 A;  4L1B A;  4UWL A;  3SZ7 A;  4G24 A;  5EKQ D;  3K9I A;  3QK0 A;  4YDW A;  3HDX A;  4R7L A;  1Y8M A;  3ML8 A;  1NI1 A;  4GTO A;  2XCB A;  5JA4 D;  4AY5 A;  5D66 A;  2WXK A;  4U8Y D;  4WNF A;  3M59 A;  1PAQ A;  4AJW A;  3MKR A;  3ABK E;  3L82 A;  1Y6I A;  2P9I G;  4JB8 P;  2MYO A;  2J4B A;  5G04 J;  4LSZ E;  5JHB A;  3QOU A;  3CVX A;  4WAF A;  2R17 C;  3RQ4 A;  3PZ4 A;  3UMV A;  3CK7 A;  3RJW A;  2H6F A;  2ZU6 B;  2RFI A;  1N0R A;  3PZ2 A;  3MO2 A;  3MV2 B;  1H2U A;  1TYQ G;  4HQD A;  3CV0 A;  4YNP A;  2DVW A;  3MO0 A;  3M57 A;  2FEZ A;  2VSX E;  2QYU A;  1AWC B;  2PM6 A;  1QBQ A;  4PUC A;  3F9X A;  3QKY A;  5AAO A;  4PS8 A;  2I1J A;  4FLH A;  4JL0 A;  3AJI A;  2UY1 B;  4UQY A;  3IHV A;  2WXO A;  5BUZ A;  3ZYM A;  1XQH A;  3LJN A;  4CZ2 D;  3LJ3 A;  4Z68 A;  3CVQ A;  3D9J A;  3ZRH A;  1MX6 A;  3FUN A;  4A63 B;  3ONL A;  2IQC A;  4N2S A;  2LUH A;  4D10 C;  4GPK A;  4HFG A;  4XIF A;  3C3O A;  3IKO B;  1HO8 A;  2CHW A;  4I1M A;  4A55 A;  2XPZ A;  2A5U A;  3M54 A;  3ESL A;  3TL5 A;  1FVF A;  4WUY A;  3WG7 E;  4G8L A;  1NA3 A;  3J5P A;  5JIN A;  3APC A;  4IYP A;  3Q15 A;  4JHJ A;  1K3Z D;  4LNU D;  4GYO A;  5ANL A;  3Q75 A;  4OVV A;  3LY9 A;  3UKU G;  2QFC A;  4KMO A;  3D9P A;  4Y6W A;  2HE0 A;  3JCK C;  4GYW A;  3M5A A;  1SA4 A;  5FIO A;  2P58 C;  3MX3 A;  4XKB A;  1DCQ A;  3L16 A;  4RZ0 A;  4BTB A;  2RD0 A;  3MGB A;  2ILR A;  5FTP A;  4ANV A;  3AG2 E;  3DST A;  3UQ3 A;  4GA0 A;  3PVL A;  2XRY A;  1Z6T A;  2P9S G;  4BER A;  3BG0 B;  3PS6 A;  3DXM G;  1D8E A;  2GRM A;  5CRV A;  4ANU A;  5BV0 A;  4URK A;  2F37 A;  3PNT B;  2MHK A;  4BWR A;  3DBS A;  1E8Z A;  4QEO A;  4L2Y A;  4RG6 A;  5CMY A;  2XPY A;  4L2L A;  5KJL A;  1WY6 A;  1BU9 A;  1N4R A;  4J7W A;  5ENT D;  3ISM C;  5A6C A;  5EYL A;  1FPP A;  2AVP A;  2W5Z A;  2DBA A;  4AV7 A;  5CMW A;  2KXP C;  3ZHE A;  3V31 A;  4I6E A;  2RFA A;  5HRY A;  5HQ8 A;  5AQB A;  1K1B A;  3QC1 A;  4MLP A;  3Q9N C;  3WXX A;  3I3N A;  4P29 A;  5EID A;  1RW2 A;  4JC8 A;  2GRP B;  3G2U A;  2CHZ A;  4AOF A;  2YQ8 A;  5CER B;  3PEU B;  3IHY A;  3KS2 A;  3APD A;  1LD7 A;  3CKC A;  3NAW A;  5HI7 A;  1JWF A;  2RG8 A;  3S2A A;  5A23 A;  4GMR A;  1JUQ A;  2XS1 A;  3AAA C;  1NZN A;  1N54 A;  2BQZ A;  3FU5 A;  4LRZ A;  1TNZ A;  1IQU A;  4LUN U;  4U8V D;  4HI9 A;  2UWJ G;  4I6J A;  1IYG A;  3RK6 A;  4O60 A;  4PS7 A;  3RU0 A;  5LCW J;  4XE0 A;  4F7A A;  1LF8 A;  5C1D A;  4BX9 A;  4I51 A;  3SFY A;  5HS0 A;  3Q5M A;  4I17 A;  4CDN A;  1JCQ A;  1S0P A;  3DSX A;  3ZN3 A;  3FHE A;  5AYW D;  5ENR D;  3GZ2 A;  2OCC E;  3U64 A;  3SQV A;  2FO1 E;  4AU7 A;  5LX8 A;  3CIA A;  5F6L A;  4Z4P A;  4WNG A;  5J08 A;  4J8E A;  2IOS A;  3CVN A;  2GRO B;  4C0M A;  3FU3 A;  3EHM A;  4RVB A;  3HG0 D;  4E6H A;  3HIZ A;  4U8H A;  2H6H A;  2WXQ A;  3ZVV A;  3W9G A;  3AS5 A;  1EYH A;  4N39 A;  4F1S A;  2HO1 A;  3QWV A;  5LOZ A;  4BUP A;  4CGW A;  4L23 A;  3B7T A;  5TH7 A;  4GYY A;  4A3V A;  2J08 A;  4GCO A;  5T0K A;  4K0R A;  2NC9 A;  5CPR B;  3LPZ A;  4Q96 A;  3UI2 A;  4IJD A;  5D0Q D;  2ETB A;  3CKB A;  3PUK A;  4CDR A;  5ANR A;  4XEI G;  1Z3Y A;  4HS2 A;  3S7B A;  1Q2Z A;  1HFA A;  1SZ9 A;  1OT8 A;  1HG5 A;  1E7V A;  3CHQ A;  2ZIS A;  3FUF A;  3B7B A;  5T5G A;  4FJZ A;  3TGO A;  2I1K A;  2GRQ B;  2BKK B;  3NQP A;  3BEE A;  5LSX A;  3IBE A;  5FJY A;  3DSW A;  3L08 A;  4G11 A;  4GZC A;  3UXG A;  4OVU A;  4YPU A;  3T8M A;  4JW1 A;  5H7P A;  5JHA A;  1ZKK A;  3C72 A;  2AXU A;  5BV1 A;  2C0L A;  3OTN A;  3PDN A;  2EIM E;  4PS3 A;  4FJY A;  2I2O A;  1IXV A;  3VLE A;  4M3O A;  3CR3 A;  4RLY A;  3ZXP A;  2XEE A;  3V2O A;  3LY7 A;  4BX8 A;  1H2T C;  5EX0 A;  3LYA A;  1N52 A;  2LAI A;  4U0S A;  4B94 A;  5KCM A;  5JJT A;  1BPO A;  2EIN E;  3UKR G;  4U95 D;  3JUI A;  4MRU A;  5G05 J;  3QWW A;  3DPY A;  4KXK B;  4GZ5 A;  4KBQ A;  4BFR A;  1HE8 A;  4XI9 A;  2FBN A;  2BF0 X;  3BG1 B;  3QB2 A;  1H0A A;  4BSZ B;  3G2T A;  1A5E A;  3FP3 A;  1MT6 A;  4OAV B;  3Q78 A;  4UI9 C;  3L17 A;  4WWN A;  3FUL A;  2WXL A;  2KBX A;  2CFZ A;  5B1A E;  4GU5 A;  4GAA A;  3U3W A;  1OXJ A;  3EIQ C;  4O6F A;  3I4G A;  3ZYK A;  3DEO A;  4DRX E;  2XRZ A;  5G55 A;  5LFA A;  2YHE A;  2LXL A;  2L6J A;  4NIK A;  1N0Q A;  4LEU A;  1OWM A;  3IXE A;  4ANX A;  5A7D B;  5IY5 E;  3SD5 A;  3I4R B;  4TRQ A;  2J8S D;  3LS8 A;  3SNX A;  4Q69 A;  3PZD A;  1IKN D;  3LXU X;  2P9L G;  4YDE A;  3SHF A;  2ZIR A;  3CHS A;  3SO8 A;  4O1P A;  3ULY A;  1FVH A;  3CLJ A;  3MJW A;  1ELW A;  3B13 A;  5AJD A;  4F53 A;  3C98 A;  1TNU A;  1KT0 A;  2X3M A;  1TJC A;  1DCE A;  3TWT A;  4KVM A;  2WB2 A;  3VTY A;  4K03 A;  3MA5 A;  2AJA A;  5LCW C;  2LO6 A;  3C3Q A;  4APO A;  2X6K A;  2A5E A;  5G04 C;  5FIN A;  1UW4 B;  3KMT A;  3KSL A;  3CGH A;  3LEW A;  3VUZ A;  1ZU2 A;  1S70 B;  1UJJ A;  4J8O A;  5FQ4 A;  5FZQ A;  4YPA A;  3TXM A;  2FUL A;  2J4D A;  5EYP F;  5KNH D;  3JXI A;  1ELR A;  3KEZ A;  5ARF A;  1OY3 D;  5ENQ D;  2QYJ A;  4E47 A;  4I2W A;  2FO7 A;  4N2Q A;  3B7S A;  4DLQ A;  5T3R A;  3UIO C;  4FU3 A;  3C3R A;  5ENS D;  4OAU C;  2EIJ E;  4I9E A;  2HM8 A;  2NYJ A;  3ASN E;  4GZD A;  3NF1 A;  2FI7 A;  5TTF A;  5AQ7 A;  3HVE A;  3V79 K;  3Q79 A;  4B0Z A;  1TJF A;  1KZO A;  3T5V A;  2IJG X;  4JHK A;  1QNF A;  4N5C A;  2OVB A;  3SF4 A;  1UJK A;  4GTM A;  3M58 A;  3T8K A;  4LDG A;  3FTS A;  3VV0 A;  1H6K A;  3SI5 A;  4J8Y A;  3BUA A;  1VDY A;  5G2N A;  4IRU A;  2F8Y A;  3ZYL A;  1N94 A;  4HXI A;  2L0T B;  5C2Y A;  5F5E A;  2O8J A;  5AIJ A;  4JZY A;  4XX5 A;  3EU5 A;  1O1S A;  1P5Q A;  5KJM A;  5LP0 A;  1INZ A;  3U66 A;  3V2X A;  1JCS A;  3AU5 A;  1K8K G;  4A3T A;  3RRU A;  3ESK A;  2LSV A;  3D9K A;  2UY1 A;  4NQ0 A;  2V4L A;  2IY0 C;  1E8Y A;  4E85 A;  1MX4 A;  3CBM A;  2VGE A;  1DNP A;  3CVV A;  4NVQ A;  4RSY A;  4UWH A;  3EJN A;  1MX2 A;  3Q7F A;  5FQ7 A;  5F6K C;  4TUU A;  4ILH B;  3X2Q E;  2IU1 A;  4EZJ A;  3OXF A;  5G05 C;  1DVP A;  4CGV A;  4HBD A;  3TG5 A;  4ZFH A;  3NZU A;  1RZ4 A;  3FUM A;  3AG3 E;  1EDU A;  2P9P G;  2BKG A;  3D9N A;  2XGO A;  2VQ2 A;  3FEX A;  2AXZ A;  4GTP A;  3GZS A;  3RIB A;  4H12 A;  4ME2 A;  1MVX A;  3PNL B;  2BUG A;  4W9R A;  4DUI A;  4TV3 A;  4F1P A;  1N95 A;  1IHB A;  3EDT B;  4RQI A;  2Y4T A;  2J07 A;  3UIN C;  5CEC B;  2VGX B;  4F6R D;  4GTQ A;  3UTM A;  2BTD A;  4GA2 A;  5JMN D;  3FUH A;  4H7X A;  1LTX A;  4AIF A;  4H7Y A;  5ARG A;  2X6J A;  2CG3 A;  3FTY A;  3PZ3 A;  2R2L A;  3ZPJ A;  2RFM A;  3FTZ A;  5FQ6 A;  2HR2 A;  3PE4 A;  4DX2 A;  3R7Q A;  3P1U A;  4JHR A;  3E33 A;  4GTV A;  4U0U A;  2QPW A;  1U2V G;  1KZP A;  3R9A B;  4DX5 D;  2XEV A;  1YA0 A;  3FU6 A;  1H19 A;  4JXT A;  1JPL A;  3KSQ A;  3K5K A;  2P9K G;  3S7F A;  4B89 A;  2GGF A;  1NFI E;  3KEA A;  3Q7A A;  3KMA A;  2Q7F A;  2WQ7 A;  2Y1L E;  3T9K A;  4FUL A;  5BW8 C;  3P2B A;  4JPS A;  3HXC A;  3VLD A;  4GB9 A;  5TEG A;  4G8K A;  1NA0 A;  4L7T A;  2L9B A;  5HKP A;  2GRL A;  4QQI A;  1BI8 B;  5EG2 A;  1EPU A;  4JA7 A;  3NB2 A;  1UG3 A;  2F0Y A;  4J8F A;  2QC9 A;  3LCA A;  1L5J A;  1O1R A;  3CQC B;  4AY6 A;  3HNA A;  1JWG A;  3SGH A;  1N4P A;  2Y4U A;  3QAR A;  1SZA A;  4GTR A;  3RAY A;  4TXP A;  5JJ0 A;  1K1A A;  3E34 A;  3HVE B;  3EHR A;  1YMP A;  3Q4A B;  4A1G A;  4MS6 A;  1LD8 A;  2VSY A;  2ZXW E;  1PY1 A;  4N5Q A;  4G26 A;  1X81 A;  4X8Q A;  1FT2 A;  2GRR B;  4KZC A;  3FTV A;  1N4S A;  4FHJ A;  3FUD A;  3RO3 A;  4CDM A;  3M55 A;  5AJL A;  3QDN A;  3SY2 A;  1HF8 A;  5ENP D;  5DIZ A;  3LVR E;  1TNO A;  2IF4 A;  4APF A;  2XZD G;  2FF4 A;  1SQM A;  2XEH A;  4IN3 B;  1WM5 A;  3L13 A;  4K5C A;  2P9U G;  1OWP A;  2PL2 A;  3B7U X;  4JD2 G;  3HXB A;  4CT0 A;  2L6B A;  3HXE A;  5FQ8 A;  5AAR A;  3SW9 A;  4EBA A;  5EDS A;  3MYV A;  1KT1 A;  3OXG A;  4I1O B;  2R05 A;  4GTS A;  1MYO A;  4IUL A;  2WMO A;  4YPE A;  2WXR A;  3RSE G;  3FWV A;  4U0Z A;  3LY8 A;  4JA9 A;  4UI9 K;  2V5F A;  4HLE A;  4IJ8 A;  3FTU A;  2VYI A;  3GZ1 A;  2CFU A;  1S63 A;  1O5M A;  3M56 A;  4WND A;  1U3D A;  4FLB A;  4N3A A;  2I9C A;  1OCZ E;  2F69 A;  3CSF A;  3JUE A;  2DYR E;  2L0I A;  1MUF A;  3DB5 A;  4Y6C A;  5AYF A;  3E37 A;  4EPZ A;  3SWC A;  4UQX A;  2VTB A;  2KZT B;  3S7J A;  3TWV A;  3ZXS A;  3ONK A;  3L6A A;  3VTX A;  2JV0 A;  4QEN A;  2GRN B;  3KMJ A;  4AVX A;  3FEY A;  2LNI A;  3ZYQ A;  3TWR A;  5EIL A;  5FZS A;  4NAC A;  1QYM A;  4G1T A;  4J8D A;  5CEA A;  4GA1 A;  3CBP A;  5T0M A;  3BO5 A;  2C2L A;  1EF1 C;  3QJZ A;  4BEP A;  3FH8 A;  4LG6 A;  1V54 E;  4ILI A;  3U4T A;  4J0U A;  3UM2 A;  4YNM A;  2GW1 A;  3B7R L;  2ZGD A;  4PDX A;  4OYS A;  1FT1 A;  3D9H A;  4DLO A;  2WQH A;  3D9O A;  2LSU A;  4BT8 A;  2P9N G;  5FT9 A;  1BI7 B;  3D9I A;  1A17 A;  4DI3 A;  2WM9 A;  2PZI A;  2EIK E;  2WVI A;  1TR4 A;  2WXN A;  1N6C A;  4I1A A;  4BTA A;  4ANW A;  3DRA A;  3FUJ A;  3JQ1 A;  1TNB A;  2KCK A;  1JCR A;  4XI0 A;  2P2C P;  4U63 A;  3ASO E;  3PRE A;  5BPP A;  4FAD A;  5CCM A;  1X5B A;  4KT6 B;  4UWF A;  3E4B A;  3NOC D;  3CBO A;  1SVX A;  1WDY A;  3ULE G;  5BT1 A;  4O1O A;  1HZ4 A;  4KYO B;  2XGS A;  2J49 A;  4I6G A;  3CVU A;  4AP2 A;  3FUK A;  2DYS E;  3TWS A;  2BED A;  2DWZ A;  4XKC A;  3FDH A;  4QFV A;  2XEN A;  4WWP A;  1H6O A;  2LAH A;  3RKV A;  2OEW A;  1FCH A;  3BU8 A;  3SFZ A;  3M53 A;  4HI8 A;  5M72 A;  2XGM A;  3PE3 A;  3ZU7 B;  2VTB B;  4AM9 A;  4GZ6 A;  4N3B A;  3OPE A;  3UM3 A;  2M63 A;  5F59 A;  4K5A B;  5LSZ A;  2H6I A;  5T8I A;  2DZN A;  2OND A;  1QQE A;  3UUX A;  3VLF A;  4BT9 A;  3QAQ A;  3RRN B;  1HU3 A;  4G25 A;  3MV3 B;  3ZHE B;  4L9P A;  1OWO A;  2AW6 A;  1YCS B;  2A4Z A;  1H6P A;  3OXL A;  3RO2 A;  3URZ A;  2Y69 E;  3DPD A;  4XZ4 A;  4B8A A;  2JLB A;  3AS8 A;  1OUV A;  3J5Q B;  3UM1 A;  1PC2 A;  3CHR A;  2PQR A;  3O4Z A;  4J83 A;  4UI9 J;  1E8X A;  3ENE A;  3RRM B;  4U7E B;  3FH5 A;  3FTW A;  3CHO A;  3F9W A;  1MJ0 A;  3D9M A;  2E0I A;  5EX3 A;  3HHM A;  3O48 A;  3FUE A;  4YDO A;  3JQ0 A;  1E90 A;  4CYM D;  5B1B E;  2VSO E;  1QZ2 A;  2V4H C;  2MRI A;  1HG2 A;  3EUV A;  4JDS A;  3PZ1 A;  2XPI A;  3GYZ A;  4ATZ D;  5B3S E;  3FY4 A;  3FH7 A;  5AQA A;  4DK5 A;  4C0E A;  5AEN A;  3DWL G;  3OOI A;  3MO5 A;  3ZKJ A;  1H3I A;  1ELK A;  3ZIM A;  5KWD A;  2YIN A;  2ZGG A;  1ZB1 A;  1HXI A;  2PM7 A;  3SBT B;  2JAB A;  3UT7 A;  2EIL E;  2WXF A;  4F3V A;  4MBG A;  2R03 A;  1Z3X A;  4C1Q A;  2HYZ A;  3MZL B;  4K5B A;  3S7D A;  2KC7 A;  2AXV A;  2WXH A;  4I2Z A;  2B6C A;  3UT4 A;  4HLL A;  2IGQ A;  1D8D A;  4UQZ A;  4FHK A;  3TWX A;  3ML9 A;  4GCN A;  4MKT A;  4DPR A;  5E75 A;  1MHQ A;  2EQX A;  3AU4 A;  3NZS A;  3B95 A;  4N3C A;  5AN8 A;  2V5Q C;  4HOS A;  1DC2 A;  3ZEF A;  4JEU A;  3EHN A;  3APF A;  4WWO A;  1UN8 A;  4FA6 A;  5KJN A;  4TXQ A;  4UWG A;  4QEP A;  2KCV A;  3G2W A;  1E7U A;  3RAU A;  1PEG A;  2WPV A;  2WMN A;  2KCL A;  4M7C A;  4EBA G; 
#chains in the Genus database with same CATH homology
 3JYS A;  4A1G A;  4MS6 A;  4L1B A;  4UWL A;  4KZ0 A;  2VSY A;  3UX4 A;  3SZ7 A;  4MI0 A;  1PY1 A;  4G24 A;  4G26 A;  3LY7 A;  4GMJ A;  5EKQ D;  5FWQ A;  4BX8 A;  4HOR A;  1H2T C;  3K9I A;  3S8P A;  3QK0 A;  5EX0 A;  2KM4 A;  3HDX A;  4R7L A;  1Y8M A;  3LYA A;  3TAX A;  1N52 A;  2LAI A;  3ML8 A;  4CEM A;  4U0S A;  4KZC A;  4YVO A;  3FTV A;  2C0M A;  4V3I A;  4B94 A;  5KCM A;  5JJT A;  3MCX A;  3PEV B;  1KLX A;  4BSX A;  2XCB A;  1BPO A;  4FHJ A;  4HOU A;  3FUD A;  3QWP A;  4AY5 A;  2DIW A;  3JUI A;  4MRU A;  2WXK A;  5G05 J;  3QWW A;  4WNF A;  3RO3 A;  3M59 A;  3G2V A;  4CDM A;  4KXK B;  4GZ5 A;  1PAQ A;  4KBQ A;  4AJW A;  1WAO 1;  3MKR A;  4FP7 A;  5DBK A;  4BFR A;  2PQN A;  1HE8 A;  4XI9 A;  3UPV A;  3M55 A;  1Y6I A;  2FBN A;  2BF0 X;  3BG1 B;  3QB2 A;  5AJL A;  1H0A A;  3AS4 A;  3G2T A;  3Q49 B;  3FP3 A;  3QDN A;  1MT6 A;  4YND A;  4UI9 C;  3PH0 C;  4JLG A;  2J4B A;  1HF8 A;  2CHX A;  3L17 A;  3L54 A;  5G04 J;  4LCT A;  5DIZ A;  2XHE A;  4ABN A;  4WWN A;  3FUL A;  3LVR E;  2WXL A;  5JHB A;  3QOU A;  3CVX A;  2IF4 A;  4APF A;  4WAF A;  1HX8 A;  2R17 C;  3RQ4 A;  2CFZ A;  2FF4 A;  1SQM A;  4IN3 B;  4GU5 A;  1WM5 A;  4GAA A;  3UMV A;  3U3W A;  3CK7 A;  3L13 A;  2WXI A;  3EIQ C;  4O6F A;  3RJW A;  2ZU6 B;  3CST A;  3I4G A;  2RFI A;  3ZFW A;  1OWP A;  3ZYK A;  2XRZ A;  2PL2 A;  3B7U X;  5G55 A;  3MO2 A;  4CT0 A;  5BNW A;  3MV2 B;  4JEH A;  1H2U A;  5FQ8 A;  3LKU A;  3SW9 A;  2WQ6 A;  3CVY A;  4EBA A;  3CV0 A;  5EDS A;  4YNP A;  4Q94 A;  3MYV A;  5LFA A;  1KT1 A;  2YHE A;  3OXG A;  3MO0 A;  4I1O B;  2L6J A;  3M57 A;  2FEZ A;  2VSX E;  4LEU A;  5E76 A;  4IUL A;  1OWM A;  2WMO A;  4NJ5 A;  2WXR A;  4YPE A;  2PM6 A;  4ANX A;  3FWV A;  4PUC A;  5A7D B;  3SD5 A;  4U0Z A;  3QKY A;  3F9X A;  3I4R B;  3LY8 A;  4TRQ A;  4JA9 A;  4UI9 K;  2V5F A;  4HLE A;  4IJ8 A;  3LS8 A;  3ZGQ A;  3SNX A;  4HVB A;  4Q69 A;  2KZT A;  3PZD A;  4PS8 A;  2I1J A;  4FLH A;  3LXU X;  4JL0 A;  3SHF A;  3CHS A;  3CQG B;  2VYI A;  3FTU A;  3GZ1 A;  2CFU A;  3R7R A;  4MI5 A;  2UY1 B;  2WXP A;  4UQY A;  3IHV A;  2WXO A;  3ASF A;  1FVH A;  2XCC A;  3CLJ A;  5BUZ A;  3MJW A;  3M56 A;  4WND A;  2I6H A;  1U3D A;  4FLB A;  4U07 A;  3OS5 A;  1ELW A;  2E2E A;  2I9C A;  4N3A A;  3ZYM A;  1XQH A;  2F69 A;  3CSF A;  3B13 A;  3LJ3 A;  5AJD A;  4F53 A;  2L0I A;  3C98 A;  1MUF A;  3DB5 A;  3CVQ A;  3D9J A;  4Y6C A;  4PH4 B;  3FU0 A;  5AYF A;  3ZRH A;  3FUN A;  4EPZ A;  1KT0 A;  2X3M A;  2VSN A;  4GZ3 A;  3ONL A;  3SWC A;  2IQC A;  1TJC A;  4UQX A;  4J7F A;  4N2S A;  2VTB A;  4GPK A;  2KZT B;  4D10 C;  3S7J A;  3PUJ A;  3ZXS A;  3ONK A;  4HFG A;  4XIF A;  3L6A A;  3VTX A;  3IKO B;  4G23 A;  2JV0 A;  1HO8 A;  2CHW A;  4QEN A;  4KVM A;  3MKQ B;  2WB2 A;  4I1M A;  3VTY A;  3KD7 A;  2X38 A;  2XPZ A;  4A55 A;  4AVX A;  3FEY A;  3KMJ A;  4J7I A;  2LNI A;  3ZYQ A;  4K03 A;  2A5U A;  3M54 A;  3MA5 A;  5T4Y A;  3ESL A;  2OV8 A;  5FZS A;  5LCW C;  3F9Y A;  3TL5 A;  2LO6 A;  1FVF A;  4NAC A;  4APO A;  2X6K A;  4WUY A;  5ENN A;  4G1T A;  4J8D A;  5G04 C;  1UW4 B;  4O30 A;  3ASD A;  4GA1 A;  3KMT A;  1NA3 A;  3CBP A;  5T0M A;  3N71 A;  3BO5 A;  2C2L A;  1EF1 C;  3APC A;  3QJZ A;  5JIN A;  3FH8 A;  4IYP A;  3Q15 A;  3CGH A;  3FUI A;  4JHJ A;  3LEW A;  3VUZ A;  4ILI A;  3U4T A;  1ZU2 A;  4GYO A;  5ANL A;  4HOQ A;  3TG4 A;  1UJJ A;  4OVV A;  4J8O A;  4J0U A;  4YNM A;  5FQ4 A;  5FZQ A;  2GW1 A;  3B7R L;  4YPA A;  3LY9 A;  2Y3A A;  4PDX A;  2QFC A;  4KMO A;  3MKQ A;  4OYS A;  3D9P A;  3TXM A;  4Y6W A;  4DLO A;  2WQH A;  2FUL A;  3D9O A;  2J4D A;  3JCK C;  2LSU A;  1W3B A;  4GYW A;  4BT8 A;  3M5A A;  1ELR A;  3KEZ A;  5ARF A;  5FT9 A;  3FFL A;  3D9I A;  1A17 A;  2P58 C;  3MX3 A;  4E47 A;  4RG9 A;  4XKB A;  3L16 A;  3IHX A;  3D3M A;  4DI3 A;  4BTB A;  2RD0 A;  3MGB A;  2ILR A;  2FO7 A;  3PRZ A;  4I2W A;  5CHE E;  2WM9 A;  5FTP A;  2PZI A;  4ANV A;  3B7S A;  2R5S A;  4DLQ A;  4DJA A;  3UQ3 A;  4N2Q A;  4GA0 A;  3PVL A;  2WVI A;  2DCP A;  5T3R A;  2WXN A;  4DI4 A;  2XRY A;  1Z6T A;  4FU3 A;  1N6C A;  4EEC A;  4JVS A;  4I9E A;  2HM8 A;  4I1A A;  4BTA A;  3BG0 B;  3PS6 A;  4ANW A;  3FUJ A;  3JQ1 A;  2KCK A;  2GRM A;  4GZD A;  3NF1 A;  2G46 A;  4ANU A;  2FI7 A;  5BV0 A;  4XI0 A;  4KVO A;  4URK A;  5TTF A;  3PNT B;  4U63 A;  4A1S A;  3HVE A;  3PRE A;  2MHK A;  4I9C A;  4BWR A;  5BPP A;  3DAL A;  4B0Z A;  1TJF A;  4FAD A;  3DBS A;  5CCM A;  2VGX A;  1X5B A;  3T5V A;  4KT6 B;  2X6H A;  1E8Z A;  2IJG X;  2XQ0 A;  4JHK A;  4UWF A;  3E4B A;  1QNF A;  4QEO A;  4N5C A;  3CBO A;  4L2Y A;  4RG6 A;  2OVB A;  2YNQ A;  5CMY A;  5BT1 A;  3SF4 A;  2XPY A;  1UJK A;  1NP7 A;  1HZ4 A;  4KYO B;  4L2L A;  4CRW A;  2XGS A;  5FZR A;  3ULQ A;  3M58 A;  2J49 A;  4I6G A;  4UWK A;  5KJL A;  3CVU A;  1WY6 A;  4AP2 A;  3FUK A;  4LDG A;  5JHN A;  4XKC A;  3FTS A;  2R3A A;  3FDH A;  3VV0 A;  2IFU A;  3LVQ E;  2OOE A;  4QFV A;  1H6K A;  3SI5 A;  4EQF A;  4EZL A;  4WWP A;  5A6C A;  3CVL A;  3ASH A;  2AVP A;  2W5Z A;  2LAH A;  4FMU A;  1VDY A;  3RKV A;  2DBA A;  5G2N A;  5JIY A;  4AV7 A;  4IRU A;  4G2V A;  3UT8 A;  3ZYL A;  1FCH A;  2X6F A;  5CMW A;  4HXI A;  2L0T B;  5C2Y A;  3ZHE A;  5F5E A;  2O8J A;  3SFZ A;  4I6E A;  5AIJ A;  3F9Z A;  3M53 A;  5M72 A;  2XGM A;  4EZK A;  3PE3 A;  4JZY A;  5HQ8 A;  1ZBP A;  4XX5 A;  3QC1 A;  2VTB B;  4MLP A;  3WXX A;  1P5Q A;  3I3N A;  3D9L A;  2JEK A;  4GZ6 A;  4AM9 A;  4P29 A;  2X6I A;  4N3B A;  3CVW A;  5KJM A;  4JC8 A;  4BY6 A;  3G2U A;  3OPE A;  2M63 A;  5LP0 A;  1INZ A;  3U66 A;  4HOT A;  1H2V C;  5F59 A;  2CHZ A;  5LSZ A;  1E8W A;  4AOF A;  2YQ8 A;  1MQS A;  3AU5 A;  4NRH B;  3PEU B;  3IHY A;  2OND A;  5T8I A;  4A3T A;  4U04 A;  3ESK A;  1QQE A;  2LSV A;  3D9K A;  3RRU A;  4AXH A;  3KS2 A;  3UUX A;  3VLF A;  2UY1 A;  3APD A;  4BT9 A;  3QAQ A;  1MVH A;  3CKC A;  1B89 A;  4NQ0 A;  1HU3 A;  4G25 A;  5HI7 A;  2V4L A;  3RRN B;  1E8Y A;  3MV3 B;  4E85 A;  1JWF A;  3RJV A;  2RG8 A;  3S2A A;  2WXG A;  3QNK A;  3CBM A;  3ZHE B;  5A23 A;  1OWO A;  1U3C A;  1DNP A;  3CVV A;  1JUQ A;  2AW6 A;  4NVQ A;  4RZ0 A;  2A4Z A;  4RSY A;  4UWH A;  3I5P A;  1NZN A;  3EJN A;  4YVQ C;  3OXL A;  1XNF A;  3RO2 A;  1N54 A;  2VGY A;  3URZ A;  2BQZ A;  5FQ7 A;  5F6K C;  3DPD A;  4XZ4 A;  4B8A A;  4TUU A;  2JLB A;  4ILH B;  2V0P A;  3AS8 A;  1OUV A;  2IU1 A;  4J6I A;  4EZJ A;  3OXF A;  5G05 C;  1DVP A;  4CGV A;  3TG5 A;  3FU5 A;  1HH8 A;  1PC2 A;  4LRZ A;  1IQU A;  3NZU A;  3CHR A;  5KJK A;  4LUN U;  2PQR A;  3O4Z A;  4J83 A;  4UI9 J;  3HYM B;  2UWJ G;  1E8X A;  3ENE A;  3T5X A;  3FUM A;  4I6J A;  3RRM B;  5J90 A;  1IYG A;  3RK6 A;  1EDU A;  1IQR A;  5D0O D;  3D9N A;  3G2S A;  4PS7 A;  3FH5 A;  3RU0 A;  3EP0 A;  3FTW A;  2XGO A;  3CHO A;  2VQ2 A;  3FEX A;  4C9B B;  5LCW J;  2AXZ A;  4XE0 A;  3F9W A;  3FTX A;  3GZS A;  4LER A;  3RIB A;  4F7A A;  3D9M A;  4H12 A;  1LF8 A;  4ME2 A;  5C1D A;  1MVX A;  2E0I A;  3PNL B;  4BX9 A;  2BUG A;  2NSZ A;  3GW4 A;  3HHM A;  3O48 A;  3FUE A;  4TV3 A;  4W9R A;  5EX3 A;  4I51 A;  3Q5M A;  4I17 A;  4CDN A;  1S0P A;  3EDT B;  3ZN3 A;  3JQ0 A;  2Y4T A;  1E90 A;  3FHE A;  1E96 B;  2J07 A;  5AYW D;  3GZ2 A;  2VSO E;  2WXM A;  3ASG A;  1QZ2 A;  3U64 A;  2VGX B;  1IHG A;  1TEZ A;  4AU7 A;  5LX8 A;  3CK9 A;  3CIA A;  2MRI A;  1HG2 A;  3IEG A;  5F6L A;  3OAW A;  4Z4P A;  4I43 A;  4WNG A;  4JDS A;  5J08 A;  4J8E A;  2IOS A;  2BTD A;  2WXJ A;  2XPI A;  4GA2 A;  2VJ8 A;  3CVN A;  3GYZ A;  3FUH A;  4C0M A;  4H7X A;  3L22 A;  3FU3 A;  4ACL A;  3EHM A;  3Q47 B;  4RVB A;  3FY4 A;  3FH7 A;  4NUR A;  4AIF A;  4E6H A;  4DK5 A;  3HIZ A;  4U8H A;  2WXQ A;  4H7Y A;  3ZVV A;  5ARG A;  4C0E A;  3IV0 A;  5AEN A;  2X6J A;  2CG3 A;  2YHC A;  3AS5 A;  1EYH A;  3CVP A;  3FTY A;  3OOI A;  4N39 A;  3MO5 A;  3CHM A;  4F1S A;  1H3I A;  3ZPJ A;  2HO1 A;  1ELK A;  3QWV A;  3FTZ A;  2YIN A;  3ZIM A;  5LOZ A;  3CK8 A;  5FQ6 A;  4BUP A;  2HR2 A;  3PE4 A;  2J9Q A;  5CCL A;  1HXI A;  2PM7 A;  4GML A;  1ML9 A;  2OVF A;  3MEK A;  3R7Q A;  3SBT B;  3P1U A;  4CGW A;  2AWI A;  3UT7 A;  2W5Y A;  4L23 A;  4JHR A;  3B7T A;  3EIJ A;  2WXF A;  4F3V A;  2R59 A;  5TH7 A;  4U0U A;  2QPW A;  4GYY A;  4A3V A;  3R9A B;  1UN9 A;  2XEV A;  2J08 A;  3TXN A;  1YA0 A;  4GCO A;  5T0K A;  4K0R A;  1N6A A;  3FU6 A;  1H19 A;  1Z3X A;  2NC9 A;  5CPR B;  4JXT A;  1JPL A;  4C1Q A;  2HYZ A;  3LPZ A;  3MZL B;  4Q96 A;  3K5K A;  4J8S A;  3U9W A;  3S7F A;  4B89 A;  4IJD A;  2GGF A;  5D0Q D;  2KC7 A;  3S7D A;  3CKB A;  3PUK A;  4CDR A;  5ANR A;  2AXV A;  2WXH A;  4I2Z A;  1Z3Y A;  3KMA A;  2Q7F A;  3UT4 A;  2IGQ A;  4HS2 A;  2WQ7 A;  4ATG A;  3S7B A;  4AEZ C;  1OWN A;  4UQZ A;  4FUL A;  4FHK A;  5BW8 C;  3ML9 A;  4GCN A;  3P2B A;  4JPS A;  4MKT A;  1HFA A;  4DPR A;  1SZ9 A;  5JJ7 A;  2NXP A;  5E75 A;  1HG5 A;  3VLD A;  2MOW A;  1E7V A;  1MHQ A;  4GB9 A;  3CHQ A;  2EQX A;  3AU4 A;  3NZS A;  3LDZ A;  3FUF A;  5TEG A;  4N3C A;  5T5G A;  4FJZ A;  3TGO A;  3KAE A;  2I1K A;  4HOS A;  3TJP A;  1NA0 A;  3ZEF A;  4L7T A;  2IOL A;  4JEU A;  2L9B A;  3NQP A;  3EHN A;  3APF A;  3BEE A;  2GRL A;  5JJ6 A;  5EG2 A;  5LSX A;  4B8C B;  1EPU A;  4JA7 A;  4WWO A;  4CCA A;  3IBE A;  5FJY A;  3L08 A;  4G11 A;  1OWL A;  1UG3 A;  1UN8 A;  4GZC A;  1N3J A;  4J8F A;  4FA6 A;  4OVU A;  3LCA A;  4YPU A;  3T8M A;  1L5J A;  2CG2 A;  3CEQ A;  4JW1 A;  3CHP A;  3SBS A;  5JHA A;  3CQC B;  1ZKK A;  5KJN A;  4AY6 A;  4ACK A;  1GW6 A;  2AXU A;  4FC8 A;  3HNA A;  5BV1 A;  4ILG A;  4UWG A;  4QEP A;  2KCV A;  2ION A;  1JWG A;  3SGH A;  2Y4U A;  2C0L A;  2KAT A;  3OTN A;  3PDN A;  3G2W A;  3QAR A;  4FJY A;  1SZA A;  4PS3 A;  2I2O A;  3ZW3 A;  1E7U A;  4WNE A;  1O9S A;  4CT4 A;  3RAY A;  1PEG A;  2WPV A;  2WMN A;  2KCL A;  3VLE A;  4M3O A;  1XGW A;  2QY7 A;  5JJ0 A;  2J09 A;  3CR3 A;  1HS6 A;  2V8S E;  3HVE B;  4EBA G;  3Q4A B;  3FPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...