4YPUA

Ash1l set domain k2264l mutant in complex with s-adenosyl methionine (sam)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
b'GSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVELQQLCKCGFEKCRGIIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase ASH1L
publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 50
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ypuA00
3S7FA 5HI7A 5CCMA 3QWVA 4MI0A 3CBPA 3M53A 5F6LA 5JINA 3M56A 2F69A 5T0MA 5LSZA 3SWCA 1N6AA 5T0KA 3HNAA 3F9ZA 4YPEA 4NVQA 1N3JA 4YPUA 3OS5A 3MEKA 2RFIA 3S8PA 4IJDA 3M57A 5ARGA 3EP0A 3TG4A 5CPRB 2R3AA 3BO5A 2G46A 3QWPA 4YPAA 3OXFA 4JDSA 3PDNA 1ML9A 3S7DA 3RJWA 1PEGA 2JV0A 4QENA 5HQ8A 4J7IA 4FMUA 4H12A 3SW9A 3RIBA 1MT6A 1O9SA 3M55A 3IHXA 5EX3A 3RQ4A 4MI5A 5KJKA 3RU0A 1N6CA 3FPDA 3KMAA 3F9YA 4WUYA 4J8OA 5KJNA 4J7FA 4J83A 5JHNA 4YNMA 3MO0A 2QPWA 5ARFA 3M5AA 3S7JA 5KJMA 4QEPA 3OPEA 4YNDA 4LDGA 4QEOA 3F9WA 4O30A 3MO2A 3QWWA 4JLGA 4O6FA 2W5ZA 4NJ5A 2IGQA 3KMTA 3M54A 3DALA 5EX0A 3M59A 3OOIA 5AYFA 1H3IA 3N71A 3VV0A 5JIYA 5EG2A 5CCLA 5KJLA 5TH7A 3CBOA 3DB5A 1XQHA 3OXLA 1ZKKA 5F5EA 3OXGA 5TTFA 3K5KA 3CBMA 3RAYA 2O8JA 4IJ8A 2W5YA 4I51A 4AU7A 5F59A 4C1QA 3TG5A 1MVXA 3KMJA 3MO5A 5F6KC 1MVHA 4Z4PA 5TEGA 3F9XA 4BUPA 5T5GA 3S7BA 4RZ0A 3VUZA 3M58A 4YNPA 5JJ0A 1MUFA 5LSXA 4E47A 2BQZA
chains in the Genus database with same CATH superfamily
3S7FA 5HI7A 5CCMA 3QWVA 4MI0A 3CBPA 3M53A 5F6LA 5JINA 3M56A 2F69A 5T0MA 5LSZA 3SWCA 1N6AA 5T0KA 3HNAA 3F9ZA 4YPEA 4NVQA 1N3JA 4YPUA 3OS5A 3MEKA 2RFIA 3S8PA 4IJDA 3M57A 5ARGA 3EP0A 3TG4A 5CPRB 2R3AA 3BO5A 2G46A 3QWPA 4YPAA 3OXFA 4JDSA 3PDNA 1ML9A 3S7DA 3RJWA 1PEGA 2JV0A 4QENA 5HQ8A 4J7IA 4FMUA 4H12A 3SW9A 3RIBA 1MT6A 1O9SA 3M55A 3IHXA 5EX3A 3RQ4A 4MI5A 5KJKA 3RU0A 1N6CA 3FPDA 3KMAA 3F9YA 4WUYA 4J8OA 5KJNA 4J7FA 4J83A 5JHNA 4YNMA 3MO0A 2QPWA 5ARFA 3M5AA 3S7JA 5KJMA 4QEPA 3OPEA 4YNDA 4LDGA 4QEOA 3F9WA 4O30A 3MO2A 3QWWA 4JLGA 4O6FA 2W5ZA 4NJ5A 2IGQA 3KMTA 3M54A 3DALA 5EX0A 3M59A 3OOIA 5AYFA 1H3IA 3N71A 3VV0A 5JIYA 5EG2A 5CCLA 5KJLA 5TH7A 3CBOA 3DB5A 1XQHA 3OXLA 1ZKKA 5F5EA 3OXGA 5TTFA 3K5KA 3CBMA 3RAYA 2O8JA 4IJ8A 2W5YA 4I51A 4AU7A 5F59A 4C1QA 3TG5A 1MVXA 3KMJA 3MO5A 5F6KC 1MVHA 4Z4PA 5TEGA 3F9XA 4BUPA 5T5GA 3S7BA 4RZ0A 3VUZA 3M58A 4YNPA 5JJ0A 1MUFA 5LSXA 4E47A 2BQZA
chains in the Genus database with same CATH topology
3S7FA 5HI7A 5CCMA 3QWVA 4MI0A 3CBPA 3M53A 5F6LA 5JINA 3M56A 2F69A 5T0MA 5LSZA 3SWCA 1N6AA 5T0KA 3HNAA 3F9ZA 4YPEA 4NVQA 1N3JA 4YPUA 3OS5A 3MEKA 2RFIA 3S8PA 4IJDA 3M57A 5ARGA 3EP0A 3TG4A 5CPRB 2R3AA 3BO5A 2G46A 3QWPA 4YPAA 3OXFA 4JDSA 3PDNA 1ML9A 3S7DA 3RJWA 1PEGA 2JV0A 4QENA 5HQ8A 4J7IA 4FMUA 4H12A 3SW9A 3RIBA 1MT6A 1O9SA 3M55A 3IHXA 5EX3A 3RQ4A 4MI5A 5KJKA 3RU0A 1N6CA 3FPDA 3KMAA 3F9YA 4WUYA 4J8OA 5KJNA 4J7FA 4J83A 5JHNA 4YNMA 3MO0A 2QPWA 5ARFA 3M5AA 3S7JA 5KJMA 4QEPA 3OPEA 4YNDA 4LDGA 4QEOA 3F9WA 4O30A 3MO2A 3QWWA 4JLGA 4O6FA 2W5ZA 4NJ5A 2IGQA 3KMTA 3M54A 3DALA 5EX0A 3M59A 3OOIA 5AYFA 1H3IA 3N71A 3VV0A 5JIYA 5EG2A 5CCLA 5KJLA 5TH7A 3CBOA 3DB5A 1XQHA 3OXLA 1ZKKA 5F5EA 3OXGA 5TTFA 3K5KA 3CBMA 3RAYA 2O8JA 4IJ8A 2W5YA 4I51A 4AU7A 5F59A 4C1QA 3TG5A 1MVXA 3KMJA 3MO5A 5F6KC 1MVHA 4Z4PA 5TEGA 3F9XA 4BUPA 5T5GA 3S7BA 4RZ0A 3VUZA 3M58A 4YNPA 5JJ0A 1MUFA 5LSXA 4E47A 2BQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7F A;  5HI7 A;  5CCM A;  3QWV A;  4MI0 A;  3CBP A;  3M53 A;  5F6L A;  5JIN A;  3M56 A;  2F69 A;  5T0M A;  5LSZ A;  3SWC A;  1N6A A;  5T0K A;  3HNA A;  3F9Z A;  4YPE A;  4NVQ A;  1N3J A;  4YPU A;  3OS5 A;  3MEK A;  2RFI A;  3S8P A;  4IJD A;  3M57 A;  5ARG A;  3EP0 A;  3TG4 A;  5CPR B;  2R3A A;  3BO5 A;  2G46 A;  3QWP A;  4YPA A;  3OXF A;  4JDS A;  3PDN A;  1ML9 A;  3S7D A;  3RJW A;  1PEG A;  2JV0 A;  4QEN A;  5HQ8 A;  4J7I A;  4FMU A;  4H12 A;  3SW9 A;  3RIB A;  1MT6 A;  1O9S A;  3M55 A;  3IHX A;  5EX3 A;  3RQ4 A;  4MI5 A;  5KJK A;  3RU0 A;  1N6C A;  3FPD A;  3KMA A;  3F9Y A;  4WUY A;  4J8O A;  5KJN A;  4J7F A;  4J83 A;  5JHN A;  4YNM A;  3MO0 A;  2QPW A;  5ARF A;  3M5A A;  3S7J A;  5KJM A;  4QEP A;  3OPE A;  4YND A;  4LDG A;  4QEO A;  3F9W A;  4O30 A;  3MO2 A;  3QWW A;  4JLG A;  4O6F A;  2W5Z A;  4NJ5 A;  2IGQ A;  3KMT A;  3M54 A;  3DAL A;  5EX0 A;  3M59 A;  3OOI A;  5AYF A;  1H3I A;  3N71 A;  3VV0 A;  5JIY A;  5EG2 A;  5CCL A;  5KJL A;  5TH7 A;  3CBO A;  3DB5 A;  1XQH A;  3OXL A;  1ZKK A;  5F5E A;  3OXG A;  5TTF A;  3K5K A;  3CBM A;  3RAY A;  2O8J A;  4IJ8 A;  2W5Y A;  4I51 A;  4AU7 A;  5F59 A;  4C1Q A;  3TG5 A;  1MVX A;  3KMJ A;  3MO5 A;  5F6K C;  1MVH A;  4Z4P A;  5TEG A;  3F9X A;  4BUP A;  5T5G A;  3S7B A;  4RZ0 A;  3VUZ A;  3M58 A;  4YNP A;  5JJ0 A;  1MUF A;  5LSX A;  4E47 A;  2BQZ A; 
#chains in the Genus database with same CATH topology
 3S7F A;  5HI7 A;  5CCM A;  3QWV A;  4MI0 A;  3CBP A;  3M53 A;  5F6L A;  5JIN A;  3M56 A;  2F69 A;  5T0M A;  5LSZ A;  3SWC A;  1N6A A;  5T0K A;  3HNA A;  3F9Z A;  4YPE A;  4NVQ A;  1N3J A;  4YPU A;  3OS5 A;  3MEK A;  2RFI A;  3S8P A;  4IJD A;  3M57 A;  5ARG A;  3EP0 A;  3TG4 A;  5CPR B;  2R3A A;  3BO5 A;  2G46 A;  3QWP A;  4YPA A;  3OXF A;  4JDS A;  3PDN A;  1ML9 A;  3S7D A;  3RJW A;  1PEG A;  2JV0 A;  4QEN A;  5HQ8 A;  4J7I A;  4FMU A;  4H12 A;  3SW9 A;  3RIB A;  1MT6 A;  1O9S A;  3M55 A;  3IHX A;  5EX3 A;  3RQ4 A;  4MI5 A;  5KJK A;  3RU0 A;  1N6C A;  3FPD A;  3KMA A;  3F9Y A;  4WUY A;  4J8O A;  5KJN A;  4J7F A;  4J83 A;  5JHN A;  4YNM A;  3MO0 A;  2QPW A;  5ARF A;  3M5A A;  3S7J A;  5KJM A;  4QEP A;  3OPE A;  4YND A;  4LDG A;  4QEO A;  3F9W A;  4O30 A;  3MO2 A;  3QWW A;  4JLG A;  4O6F A;  2W5Z A;  4NJ5 A;  2IGQ A;  3KMT A;  3M54 A;  3DAL A;  5EX0 A;  3M59 A;  3OOI A;  5AYF A;  1H3I A;  3N71 A;  3VV0 A;  5JIY A;  5EG2 A;  5CCL A;  5KJL A;  5TH7 A;  3CBO A;  3DB5 A;  1XQH A;  3OXL A;  1ZKK A;  5F5E A;  3OXG A;  5TTF A;  3K5K A;  3CBM A;  3RAY A;  2O8J A;  4IJ8 A;  2W5Y A;  4I51 A;  4AU7 A;  5F59 A;  4C1Q A;  3TG5 A;  1MVX A;  3KMJ A;  3MO5 A;  5F6K C;  1MVH A;  4Z4P A;  5TEG A;  3F9X A;  4BUP A;  5T5G A;  3S7B A;  4RZ0 A;  3VUZ A;  3M58 A;  4YNP A;  5JJ0 A;  1MUF A;  5LSX A;  4E47 A;  2BQZ A; 
#chains in the Genus database with same CATH homology
 3S7F A;  5HI7 A;  5CCM A;  3QWV A;  4MI0 A;  3CBP A;  3M53 A;  5F6L A;  5JIN A;  3M56 A;  2F69 A;  5T0M A;  5LSZ A;  3SWC A;  1N6A A;  5T0K A;  3HNA A;  3F9Z A;  4YPE A;  4NVQ A;  1N3J A;  4YPU A;  3OS5 A;  3MEK A;  2RFI A;  3S8P A;  4IJD A;  3M57 A;  5ARG A;  3EP0 A;  3TG4 A;  5CPR B;  2R3A A;  3BO5 A;  2G46 A;  3QWP A;  4YPA A;  3OXF A;  4JDS A;  3PDN A;  1ML9 A;  3S7D A;  3RJW A;  1PEG A;  2JV0 A;  4QEN A;  5HQ8 A;  4J7I A;  4FMU A;  4H12 A;  3SW9 A;  3RIB A;  1MT6 A;  1O9S A;  3M55 A;  3IHX A;  5EX3 A;  3RQ4 A;  4MI5 A;  5KJK A;  3RU0 A;  1N6C A;  3FPD A;  3KMA A;  3F9Y A;  4WUY A;  4J8O A;  5KJN A;  4J7F A;  4J83 A;  5JHN A;  4YNM A;  3MO0 A;  2QPW A;  5ARF A;  3M5A A;  3S7J A;  5KJM A;  4QEP A;  3OPE A;  4YND A;  4LDG A;  4QEO A;  3F9W A;  4O30 A;  3MO2 A;  3QWW A;  4JLG A;  4O6F A;  2W5Z A;  4NJ5 A;  2IGQ A;  3KMT A;  3M54 A;  3DAL A;  5EX0 A;  3M59 A;  3OOI A;  5AYF A;  1H3I A;  3N71 A;  3VV0 A;  5JIY A;  5EG2 A;  5CCL A;  5KJL A;  5TH7 A;  3CBO A;  3DB5 A;  1XQH A;  3OXL A;  1ZKK A;  5F5E A;  3OXG A;  5TTF A;  3K5K A;  3CBM A;  3RAY A;  2O8J A;  4IJ8 A;  2W5Y A;  4I51 A;  4AU7 A;  5F59 A;  4C1Q A;  3TG5 A;  1MVX A;  3KMJ A;  3MO5 A;  5F6K C;  1MVH A;  4Z4P A;  5TEG A;  3F9X A;  4BUP A;  5T5G A;  3S7B A;  4RZ0 A;  3VUZ A;  3M58 A;  4YNP A;  5JJ0 A;  1MUF A;  5LSX A;  4E47 A;  2BQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...