4YPUA

Ash1l set domain k2264l mutant in complex with s-adenosyl methionine (sam)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
GSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVELQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASH1L
total genus 50
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ypuA00
4J7FA 2W5ZA 4E47A 3BO5A 2IGQA 3F9XA 5EG2A 3M59A 4YNMA 5T0MA 3MEKA 1XQHA 2R3AA 3VUZA 5T0KA 3S8PA 4YPEA 4J8OA 3MO5A 4QENA 5CCLA 3RJWA 3RIBA 4J83A 3CBMA 5JHNA 1MT6A 4WUYA 3M56A 3OXLA 3M57A 1N3JA 5TTFA 4IJ8A 3S7FA 4QEOA 5CPRB 5TH7A 3SW9A 3VV0A 4BUPA 2W5YA 3OOIA 1MVHA 5F6KC 5JJ0A 3QWPA 2O8JA 4JLGA 2QPWA 4YNPA 3S7JA 2JV0A 3QWVA 5CCMA 2RFIA 4QEPA 5EX3A 3OXGA 3OS5A 3N71A 1PEGA 4LDGA 4YNDA 5ARFA 5LSZA 3M58A 1MUFA 5KJLA 3SWCA 4IJDA 1ZKKA 5F59A 5LSXA 5TEGA 3RAYA 4NVQA 3F9YA 3HNAA 4MI0A 3S7DA 3TG4A 5HQ8A 3RU0A 2G46A 3S7BA 4RZ0A 3IHXA 1O9SA 3RQ4A 4YPUA 5JINA 1N6AA 3F9WA 1ML9A 4O30A 4I51A 3CBOA 4H12A 3M5AA 5EX0A 4AU7A 5KJKA 3QWWA 4JDSA 3KMAA 3CBPA 3M54A 4FMUA 4NJ5A 5KJNA 4MI5A 3MO0A 1MVXA 3DALA 3F9ZA 3TG5A 3M55A 3PDNA 5KJMA 3M53A 1H3IA 3EP0A 5ARGA 5T5GA 3OPEA 3KMTA 2F69A 4YPAA 5F5EA 5HI7A 3FPDA 4Z4PA 4C1QA 3OXFA 4J7IA 3DB5A 5F6LA 3K5KA 4O6FA 1N6CA 5JIYA 3MO2A 5AYFA 3KMJA 2BQZA
chains in the Genus database with same CATH superfamily
4J7FA 2W5ZA 4E47A 3BO5A 2IGQA 3F9XA 5EG2A 3M59A 4YNMA 5T0MA 3MEKA 1XQHA 2R3AA 3VUZA 5T0KA 3S8PA 4YPEA 4J8OA 3MO5A 4QENA 5CCLA 3RJWA 3RIBA 4J83A 3CBMA 5JHNA 1MT6A 4WUYA 3M56A 3OXLA 3M57A 1N3JA 5TTFA 4IJ8A 3S7FA 4QEOA 5CPRB 5TH7A 3SW9A 3VV0A 4BUPA 2W5YA 3OOIA 1MVHA 5F6KC 5JJ0A 3QWPA 2O8JA 4JLGA 2QPWA 4YNPA 3S7JA 2JV0A 3QWVA 5CCMA 2RFIA 4QEPA 5EX3A 3OXGA 3OS5A 3N71A 1PEGA 4LDGA 4YNDA 5ARFA 5LSZA 3M58A 1MUFA 5KJLA 3SWCA 4IJDA 1ZKKA 5F59A 5LSXA 5TEGA 3RAYA 4NVQA 3F9YA 3HNAA 4MI0A 3S7DA 3TG4A 5HQ8A 3RU0A 2G46A 3S7BA 4RZ0A 3IHXA 1O9SA 3RQ4A 4YPUA 5JINA 1N6AA 3F9WA 1ML9A 4O30A 4I51A 3CBOA 4H12A 3M5AA 5EX0A 4AU7A 5KJKA 3QWWA 4JDSA 3KMAA 3CBPA 3M54A 4FMUA 4NJ5A 5KJNA 4MI5A 3MO0A 1MVXA 3DALA 3F9ZA 3TG5A 3M55A 3PDNA 5KJMA 3M53A 1H3IA 3EP0A 5ARGA 5T5GA 3OPEA 3KMTA 2F69A 4YPAA 5F5EA 5HI7A 3FPDA 4Z4PA 4C1QA 3OXFA 4J7IA 3DB5A 5F6LA 3K5KA 4O6FA 1N6CA 5JIYA 3MO2A 5AYFA 3KMJA 2BQZA
chains in the Genus database with same CATH topology
4J7FA 2W5ZA 4E47A 3BO5A 2IGQA 3F9XA 5EG2A 3M59A 4YNMA 5T0MA 3MEKA 1XQHA 2R3AA 3VUZA 5T0KA 3S8PA 4YPEA 4J8OA 3MO5A 4QENA 5CCLA 3RJWA 3RIBA 4J83A 3CBMA 5JHNA 1MT6A 4WUYA 3M56A 3OXLA 3M57A 1N3JA 5TTFA 4IJ8A 3S7FA 4QEOA 5CPRB 5TH7A 3SW9A 3VV0A 4BUPA 2W5YA 3OOIA 1MVHA 5F6KC 5JJ0A 3QWPA 2O8JA 4JLGA 2QPWA 4YNPA 3S7JA 2JV0A 3QWVA 5CCMA 2RFIA 4QEPA 5EX3A 3OXGA 3OS5A 3N71A 1PEGA 4LDGA 4YNDA 5ARFA 5LSZA 3M58A 1MUFA 5KJLA 3SWCA 4IJDA 1ZKKA 5F59A 5LSXA 5TEGA 3RAYA 4NVQA 3F9YA 3HNAA 4MI0A 3S7DA 3TG4A 5HQ8A 3RU0A 2G46A 3S7BA 4RZ0A 3IHXA 1O9SA 3RQ4A 4YPUA 5JINA 1N6AA 3F9WA 1ML9A 4O30A 4I51A 3CBOA 4H12A 3M5AA 5EX0A 4AU7A 5KJKA 3QWWA 4JDSA 3KMAA 3CBPA 3M54A 4FMUA 4NJ5A 5KJNA 4MI5A 3MO0A 1MVXA 3DALA 3F9ZA 3TG5A 3M55A 3PDNA 5KJMA 3M53A 1H3IA 3EP0A 5ARGA 5T5GA 3OPEA 3KMTA 2F69A 4YPAA 5F5EA 5HI7A 3FPDA 4Z4PA 4C1QA 3OXFA 4J7IA 3DB5A 5F6LA 3K5KA 4O6FA 1N6CA 5JIYA 3MO2A 5AYFA 3KMJA 2BQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7F A;  2W5Z A;  4E47 A;  3BO5 A;  2IGQ A;  3F9X A;  5EG2 A;  3M59 A;  4YNM A;  5T0M A;  3MEK A;  1XQH A;  2R3A A;  3VUZ A;  5T0K A;  3S8P A;  4YPE A;  4J8O A;  3MO5 A;  4QEN A;  5CCL A;  3RJW A;  3RIB A;  4J83 A;  3CBM A;  5JHN A;  1MT6 A;  4WUY A;  3M56 A;  3OXL A;  3M57 A;  1N3J A;  5TTF A;  4IJ8 A;  3S7F A;  4QEO A;  5CPR B;  5TH7 A;  3SW9 A;  3VV0 A;  4BUP A;  2W5Y A;  3OOI A;  1MVH A;  5F6K C;  5JJ0 A;  3QWP A;  2O8J A;  4JLG A;  2QPW A;  4YNP A;  3S7J A;  2JV0 A;  3QWV A;  5CCM A;  2RFI A;  4QEP A;  5EX3 A;  3OXG A;  3OS5 A;  3N71 A;  1PEG A;  4LDG A;  4YND A;  5ARF A;  5LSZ A;  3M58 A;  1MUF A;  5KJL A;  3SWC A;  4IJD A;  1ZKK A;  5F59 A;  5LSX A;  5TEG A;  3RAY A;  4NVQ A;  3F9Y A;  3HNA A;  4MI0 A;  3S7D A;  3TG4 A;  5HQ8 A;  3RU0 A;  2G46 A;  3S7B A;  4RZ0 A;  3IHX A;  1O9S A;  3RQ4 A;  4YPU A;  5JIN A;  1N6A A;  3F9W A;  1ML9 A;  4O30 A;  4I51 A;  3CBO A;  4H12 A;  3M5A A;  5EX0 A;  4AU7 A;  5KJK A;  3QWW A;  4JDS A;  3KMA A;  3CBP A;  3M54 A;  4FMU A;  4NJ5 A;  5KJN A;  4MI5 A;  3MO0 A;  1MVX A;  3DAL A;  3F9Z A;  3TG5 A;  3M55 A;  3PDN A;  5KJM A;  3M53 A;  1H3I A;  3EP0 A;  5ARG A;  5T5G A;  3OPE A;  3KMT A;  2F69 A;  4YPA A;  5F5E A;  5HI7 A;  3FPD A;  4Z4P A;  4C1Q A;  3OXF A;  4J7I A;  3DB5 A;  5F6L A;  3K5K A;  4O6F A;  1N6C A;  5JIY A;  3MO2 A;  5AYF A;  3KMJ A;  2BQZ A; 
#chains in the Genus database with same CATH topology
 4J7F A;  2W5Z A;  4E47 A;  3BO5 A;  2IGQ A;  3F9X A;  5EG2 A;  3M59 A;  4YNM A;  5T0M A;  3MEK A;  1XQH A;  2R3A A;  3VUZ A;  5T0K A;  3S8P A;  4YPE A;  4J8O A;  3MO5 A;  4QEN A;  5CCL A;  3RJW A;  3RIB A;  4J83 A;  3CBM A;  5JHN A;  1MT6 A;  4WUY A;  3M56 A;  3OXL A;  3M57 A;  1N3J A;  5TTF A;  4IJ8 A;  3S7F A;  4QEO A;  5CPR B;  5TH7 A;  3SW9 A;  3VV0 A;  4BUP A;  2W5Y A;  3OOI A;  1MVH A;  5F6K C;  5JJ0 A;  3QWP A;  2O8J A;  4JLG A;  2QPW A;  4YNP A;  3S7J A;  2JV0 A;  3QWV A;  5CCM A;  2RFI A;  4QEP A;  5EX3 A;  3OXG A;  3OS5 A;  3N71 A;  1PEG A;  4LDG A;  4YND A;  5ARF A;  5LSZ A;  3M58 A;  1MUF A;  5KJL A;  3SWC A;  4IJD A;  1ZKK A;  5F59 A;  5LSX A;  5TEG A;  3RAY A;  4NVQ A;  3F9Y A;  3HNA A;  4MI0 A;  3S7D A;  3TG4 A;  5HQ8 A;  3RU0 A;  2G46 A;  3S7B A;  4RZ0 A;  3IHX A;  1O9S A;  3RQ4 A;  4YPU A;  5JIN A;  1N6A A;  3F9W A;  1ML9 A;  4O30 A;  4I51 A;  3CBO A;  4H12 A;  3M5A A;  5EX0 A;  4AU7 A;  5KJK A;  3QWW A;  4JDS A;  3KMA A;  3CBP A;  3M54 A;  4FMU A;  4NJ5 A;  5KJN A;  4MI5 A;  3MO0 A;  1MVX A;  3DAL A;  3F9Z A;  3TG5 A;  3M55 A;  3PDN A;  5KJM A;  3M53 A;  1H3I A;  3EP0 A;  5ARG A;  5T5G A;  3OPE A;  3KMT A;  2F69 A;  4YPA A;  5F5E A;  5HI7 A;  3FPD A;  4Z4P A;  4C1Q A;  3OXF A;  4J7I A;  3DB5 A;  5F6L A;  3K5K A;  4O6F A;  1N6C A;  5JIY A;  3MO2 A;  5AYF A;  3KMJ A;  2BQZ A; 
#chains in the Genus database with same CATH homology
 4J7F A;  2W5Z A;  4E47 A;  3BO5 A;  2IGQ A;  3F9X A;  5EG2 A;  3M59 A;  4YNM A;  5T0M A;  3MEK A;  1XQH A;  2R3A A;  3VUZ A;  5T0K A;  3S8P A;  4YPE A;  4J8O A;  3MO5 A;  4QEN A;  5CCL A;  3RJW A;  3RIB A;  4J83 A;  3CBM A;  5JHN A;  1MT6 A;  4WUY A;  3M56 A;  3OXL A;  3M57 A;  1N3J A;  5TTF A;  4IJ8 A;  3S7F A;  4QEO A;  5CPR B;  5TH7 A;  3SW9 A;  3VV0 A;  4BUP A;  2W5Y A;  3OOI A;  1MVH A;  5F6K C;  5JJ0 A;  3QWP A;  2O8J A;  4JLG A;  2QPW A;  4YNP A;  3S7J A;  2JV0 A;  3QWV A;  5CCM A;  2RFI A;  4QEP A;  5EX3 A;  3OXG A;  3OS5 A;  3N71 A;  1PEG A;  4LDG A;  4YND A;  5ARF A;  5LSZ A;  3M58 A;  1MUF A;  5KJL A;  3SWC A;  4IJD A;  1ZKK A;  5F59 A;  5LSX A;  5TEG A;  3RAY A;  4NVQ A;  3F9Y A;  3HNA A;  4MI0 A;  3S7D A;  3TG4 A;  5HQ8 A;  3RU0 A;  2G46 A;  3S7B A;  4RZ0 A;  3IHX A;  1O9S A;  3RQ4 A;  4YPU A;  5JIN A;  1N6A A;  3F9W A;  1ML9 A;  4O30 A;  4I51 A;  3CBO A;  4H12 A;  3M5A A;  5EX0 A;  4AU7 A;  5KJK A;  3QWW A;  4JDS A;  3KMA A;  3CBP A;  3M54 A;  4FMU A;  4NJ5 A;  5KJN A;  4MI5 A;  3MO0 A;  1MVX A;  3DAL A;  3F9Z A;  3TG5 A;  3M55 A;  3PDN A;  5KJM A;  3M53 A;  1H3I A;  3EP0 A;  5ARG A;  5T5G A;  3OPE A;  3KMT A;  2F69 A;  4YPA A;  5F5E A;  5HI7 A;  3FPD A;  4Z4P A;  4C1Q A;  3OXF A;  4J7I A;  3DB5 A;  5F6L A;  3K5K A;  4O6F A;  1N6C A;  5JIY A;  3MO2 A;  5AYF A;  3KMJ A;  2BQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...