4YPUA

Ash1l set domain k2264l mutant in complex with s-adenosyl methionine (sam)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
GSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVELQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase ASH1L
publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 50
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ypuA00
3M56A 3OXGA 3S7JA 3SW9A 3VUZA 3VV0A 5LSZA 3F9WA 4QEOA 5T5GA 2W5ZA 3TG5A 5JINA 4YNMA 3M5AA 3QWWA 5EG2A 5KJMA 2BQZA 3FPDA 3MEKA 3OPEA 4YPUA 4C1QA 1XQHA 2F69A 4MI5A 2O8JA 4LDGA 5AYFA 1ZKKA 2R3AA 3K5KA 5CPRB 1O9SA 1N6CA 4E47A 3CBMA 4WUYA 3RJWA 3QWPA 4O6FA 5KJNA 5KJLA 3CBPA 5T0MA 5JJ0A 3M54A 4I51A 3IHXA 4O30A 5T0KA 5TEGA 4FMUA 3RQ4A 3OS5A 4YNPA 3PDNA 5HI7A 4Z4PA 3M58A 3M55A 4AU7A 4J8OA 5F6LA 3OXLA 3N71A 5F6KC 3QWVA 5TH7A 5LSXA 4J83A 4MI0A 3F9XA 4QENA 3RAYA 1PEGA 3S7BA 1MT6A 3DALA 4NVQA 5KJKA 4J7IA 3KMJA 3SWCA 5F5EA 3MO2A 5JHNA 1N6AA 3KMAA 2W5YA 4NJ5A 2RFIA 4JDSA 1ML9A 4YPEA 3S7DA 5JIYA 3S7FA 3DB5A 3MO5A 5TTFA 4YNDA 5CCLA 3M57A 1MVXA 4JLGA 4YPAA 3RU0A 3TG4A 3S8PA 1N3JA 5CCMA 4IJ8A 3RIBA 3OOIA 4RZ0A 3F9ZA 3M59A 5EX0A 1MVHA 4IJDA 5HQ8A 4H12A 3BO5A 4BUPA 1MUFA 2G46A 5ARFA 3HNAA 2QPWA 4J7FA 3F9YA 5ARGA 2IGQA 3EP0A 5EX3A 3KMTA 3MO0A 4QEPA 5F59A 2JV0A 3M53A 1H3IA 3OXFA 3CBOA
chains in the Genus database with same CATH superfamily
3M56A 3OXGA 3S7JA 3SW9A 3VUZA 3VV0A 5LSZA 3F9WA 4QEOA 5T5GA 2W5ZA 3TG5A 5JINA 4YNMA 3M5AA 3QWWA 5EG2A 5KJMA 2BQZA 3FPDA 3MEKA 3OPEA 4YPUA 4C1QA 1XQHA 2F69A 4MI5A 2O8JA 4LDGA 5AYFA 1ZKKA 2R3AA 3K5KA 5CPRB 1O9SA 1N6CA 4E47A 3CBMA 4WUYA 3RJWA 3QWPA 4O6FA 5KJNA 5KJLA 3CBPA 5T0MA 5JJ0A 3M54A 4I51A 3IHXA 4O30A 5T0KA 5TEGA 4FMUA 3RQ4A 3OS5A 4YNPA 3PDNA 5HI7A 4Z4PA 3M58A 3M55A 4AU7A 4J8OA 5F6LA 3OXLA 3N71A 5F6KC 3QWVA 5TH7A 5LSXA 4J83A 4MI0A 3F9XA 4QENA 3RAYA 1PEGA 3S7BA 1MT6A 3DALA 4NVQA 5KJKA 4J7IA 3KMJA 3SWCA 5F5EA 3MO2A 5JHNA 1N6AA 3KMAA 2W5YA 4NJ5A 2RFIA 4JDSA 1ML9A 4YPEA 3S7DA 5JIYA 3S7FA 3DB5A 3MO5A 5TTFA 4YNDA 5CCLA 3M57A 1MVXA 4JLGA 4YPAA 3RU0A 3TG4A 3S8PA 1N3JA 5CCMA 4IJ8A 3RIBA 3OOIA 4RZ0A 3F9ZA 3M59A 5EX0A 1MVHA 4IJDA 5HQ8A 4H12A 3BO5A 4BUPA 1MUFA 2G46A 5ARFA 3HNAA 2QPWA 4J7FA 3F9YA 5ARGA 2IGQA 3EP0A 5EX3A 3KMTA 3MO0A 4QEPA 5F59A 2JV0A 3M53A 1H3IA 3OXFA 3CBOA
chains in the Genus database with same CATH topology
3M56A 3OXGA 3S7JA 3SW9A 3VUZA 3VV0A 5LSZA 3F9WA 4QEOA 5T5GA 2W5ZA 3TG5A 5JINA 4YNMA 3M5AA 3QWWA 5EG2A 5KJMA 2BQZA 3FPDA 3MEKA 3OPEA 4YPUA 4C1QA 1XQHA 2F69A 4MI5A 2O8JA 4LDGA 5AYFA 1ZKKA 2R3AA 3K5KA 5CPRB 1O9SA 1N6CA 4E47A 3CBMA 4WUYA 3RJWA 3QWPA 4O6FA 5KJNA 5KJLA 3CBPA 5T0MA 5JJ0A 3M54A 4I51A 3IHXA 4O30A 5T0KA 5TEGA 4FMUA 3RQ4A 3OS5A 4YNPA 3PDNA 5HI7A 4Z4PA 3M58A 3M55A 4AU7A 4J8OA 5F6LA 3OXLA 3N71A 5F6KC 3QWVA 5TH7A 5LSXA 4J83A 4MI0A 3F9XA 4QENA 3RAYA 1PEGA 3S7BA 1MT6A 3DALA 4NVQA 5KJKA 4J7IA 3KMJA 3SWCA 5F5EA 3MO2A 5JHNA 1N6AA 3KMAA 2W5YA 4NJ5A 2RFIA 4JDSA 1ML9A 4YPEA 3S7DA 5JIYA 3S7FA 3DB5A 3MO5A 5TTFA 4YNDA 5CCLA 3M57A 1MVXA 4JLGA 4YPAA 3RU0A 3TG4A 3S8PA 1N3JA 5CCMA 4IJ8A 3RIBA 3OOIA 4RZ0A 3F9ZA 3M59A 5EX0A 1MVHA 4IJDA 5HQ8A 4H12A 3BO5A 4BUPA 1MUFA 2G46A 5ARFA 3HNAA 2QPWA 4J7FA 3F9YA 5ARGA 2IGQA 3EP0A 5EX3A 3KMTA 3MO0A 4QEPA 5F59A 2JV0A 3M53A 1H3IA 3OXFA 3CBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M56 A;  3OXG A;  3S7J A;  3SW9 A;  3VUZ A;  3VV0 A;  5LSZ A;  3F9W A;  4QEO A;  5T5G A;  2W5Z A;  3TG5 A;  5JIN A;  4YNM A;  3M5A A;  3QWW A;  5EG2 A;  5KJM A;  2BQZ A;  3FPD A;  3MEK A;  3OPE A;  4YPU A;  4C1Q A;  1XQH A;  2F69 A;  4MI5 A;  2O8J A;  4LDG A;  5AYF A;  1ZKK A;  2R3A A;  3K5K A;  5CPR B;  1O9S A;  1N6C A;  4E47 A;  3CBM A;  4WUY A;  3RJW A;  3QWP A;  4O6F A;  5KJN A;  5KJL A;  3CBP A;  5T0M A;  5JJ0 A;  3M54 A;  4I51 A;  3IHX A;  4O30 A;  5T0K A;  5TEG A;  4FMU A;  3RQ4 A;  3OS5 A;  4YNP A;  3PDN A;  5HI7 A;  4Z4P A;  3M58 A;  3M55 A;  4AU7 A;  4J8O A;  5F6L A;  3OXL A;  3N71 A;  5F6K C;  3QWV A;  5TH7 A;  5LSX A;  4J83 A;  4MI0 A;  3F9X A;  4QEN A;  3RAY A;  1PEG A;  3S7B A;  1MT6 A;  3DAL A;  4NVQ A;  5KJK A;  4J7I A;  3KMJ A;  3SWC A;  5F5E A;  3MO2 A;  5JHN A;  1N6A A;  3KMA A;  2W5Y A;  4NJ5 A;  2RFI A;  4JDS A;  1ML9 A;  4YPE A;  3S7D A;  5JIY A;  3S7F A;  3DB5 A;  3MO5 A;  5TTF A;  4YND A;  5CCL A;  3M57 A;  1MVX A;  4JLG A;  4YPA A;  3RU0 A;  3TG4 A;  3S8P A;  1N3J A;  5CCM A;  4IJ8 A;  3RIB A;  3OOI A;  4RZ0 A;  3F9Z A;  3M59 A;  5EX0 A;  1MVH A;  4IJD A;  5HQ8 A;  4H12 A;  3BO5 A;  4BUP A;  1MUF A;  2G46 A;  5ARF A;  3HNA A;  2QPW A;  4J7F A;  3F9Y A;  5ARG A;  2IGQ A;  3EP0 A;  5EX3 A;  3KMT A;  3MO0 A;  4QEP A;  5F59 A;  2JV0 A;  3M53 A;  1H3I A;  3OXF A;  3CBO A; 
#chains in the Genus database with same CATH topology
 3M56 A;  3OXG A;  3S7J A;  3SW9 A;  3VUZ A;  3VV0 A;  5LSZ A;  3F9W A;  4QEO A;  5T5G A;  2W5Z A;  3TG5 A;  5JIN A;  4YNM A;  3M5A A;  3QWW A;  5EG2 A;  5KJM A;  2BQZ A;  3FPD A;  3MEK A;  3OPE A;  4YPU A;  4C1Q A;  1XQH A;  2F69 A;  4MI5 A;  2O8J A;  4LDG A;  5AYF A;  1ZKK A;  2R3A A;  3K5K A;  5CPR B;  1O9S A;  1N6C A;  4E47 A;  3CBM A;  4WUY A;  3RJW A;  3QWP A;  4O6F A;  5KJN A;  5KJL A;  3CBP A;  5T0M A;  5JJ0 A;  3M54 A;  4I51 A;  3IHX A;  4O30 A;  5T0K A;  5TEG A;  4FMU A;  3RQ4 A;  3OS5 A;  4YNP A;  3PDN A;  5HI7 A;  4Z4P A;  3M58 A;  3M55 A;  4AU7 A;  4J8O A;  5F6L A;  3OXL A;  3N71 A;  5F6K C;  3QWV A;  5TH7 A;  5LSX A;  4J83 A;  4MI0 A;  3F9X A;  4QEN A;  3RAY A;  1PEG A;  3S7B A;  1MT6 A;  3DAL A;  4NVQ A;  5KJK A;  4J7I A;  3KMJ A;  3SWC A;  5F5E A;  3MO2 A;  5JHN A;  1N6A A;  3KMA A;  2W5Y A;  4NJ5 A;  2RFI A;  4JDS A;  1ML9 A;  4YPE A;  3S7D A;  5JIY A;  3S7F A;  3DB5 A;  3MO5 A;  5TTF A;  4YND A;  5CCL A;  3M57 A;  1MVX A;  4JLG A;  4YPA A;  3RU0 A;  3TG4 A;  3S8P A;  1N3J A;  5CCM A;  4IJ8 A;  3RIB A;  3OOI A;  4RZ0 A;  3F9Z A;  3M59 A;  5EX0 A;  1MVH A;  4IJD A;  5HQ8 A;  4H12 A;  3BO5 A;  4BUP A;  1MUF A;  2G46 A;  5ARF A;  3HNA A;  2QPW A;  4J7F A;  3F9Y A;  5ARG A;  2IGQ A;  3EP0 A;  5EX3 A;  3KMT A;  3MO0 A;  4QEP A;  5F59 A;  2JV0 A;  3M53 A;  1H3I A;  3OXF A;  3CBO A; 
#chains in the Genus database with same CATH homology
 3M56 A;  3OXG A;  3S7J A;  3SW9 A;  3VUZ A;  3VV0 A;  5LSZ A;  3F9W A;  4QEO A;  5T5G A;  2W5Z A;  3TG5 A;  5JIN A;  4YNM A;  3M5A A;  3QWW A;  5EG2 A;  5KJM A;  2BQZ A;  3FPD A;  3MEK A;  3OPE A;  4YPU A;  4C1Q A;  1XQH A;  2F69 A;  4MI5 A;  2O8J A;  4LDG A;  5AYF A;  1ZKK A;  2R3A A;  3K5K A;  5CPR B;  1O9S A;  1N6C A;  4E47 A;  3CBM A;  4WUY A;  3RJW A;  3QWP A;  4O6F A;  5KJN A;  5KJL A;  3CBP A;  5T0M A;  5JJ0 A;  3M54 A;  4I51 A;  3IHX A;  4O30 A;  5T0K A;  5TEG A;  4FMU A;  3RQ4 A;  3OS5 A;  4YNP A;  3PDN A;  5HI7 A;  4Z4P A;  3M58 A;  3M55 A;  4AU7 A;  4J8O A;  5F6L A;  3OXL A;  3N71 A;  5F6K C;  3QWV A;  5TH7 A;  5LSX A;  4J83 A;  4MI0 A;  3F9X A;  4QEN A;  3RAY A;  1PEG A;  3S7B A;  1MT6 A;  3DAL A;  4NVQ A;  5KJK A;  4J7I A;  3KMJ A;  3SWC A;  5F5E A;  3MO2 A;  5JHN A;  1N6A A;  3KMA A;  2W5Y A;  4NJ5 A;  2RFI A;  4JDS A;  1ML9 A;  4YPE A;  3S7D A;  5JIY A;  3S7F A;  3DB5 A;  3MO5 A;  5TTF A;  4YND A;  5CCL A;  3M57 A;  1MVX A;  4JLG A;  4YPA A;  3RU0 A;  3TG4 A;  3S8P A;  1N3J A;  5CCM A;  4IJ8 A;  3RIB A;  3OOI A;  4RZ0 A;  3F9Z A;  3M59 A;  5EX0 A;  1MVH A;  4IJD A;  5HQ8 A;  4H12 A;  3BO5 A;  4BUP A;  1MUF A;  2G46 A;  5ARF A;  3HNA A;  2QPW A;  4J7F A;  3F9Y A;  5ARG A;  2IGQ A;  3EP0 A;  5EX3 A;  3KMT A;  3MO0 A;  4QEP A;  5F59 A;  2JV0 A;  3M53 A;  1H3I A;  3OXF A;  3CBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...