4YPUA

Ash1l set domain k2264l mutant in complex with s-adenosyl methionine (sam)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
GSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVELQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASH1L
publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ypuA00
1MVXA 5F6KC 3M5AA 5ARGA 2RFIA 2BQZA 4C1QA 4MI5A 3S8PA 5JIYA 1MVHA 4YNMA 5TEGA 4FMUA 5TTFA 5KJKA 4YPAA 3N71A 4J7FA 4Z4PA 5T5GA 2O8JA 4JDSA 5JHNA 1H3IA 3HNAA 3M56A 4JLGA 4QEOA 4RZ0A 3SWCA 3S7DA 3CBOA 5JJ0A 3FPDA 5CCMA 2G46A 1MT6A 2JV0A 4BUPA 5T0MA 3QWWA 3TG5A 4NVQA 3OPEA 3RJWA 4J8OA 3OOIA 1ML9A 5CPRB 4LDGA 3VUZA 3M57A 5AYFA 3BO5A 3S7FA 3CBPA 5HI7A 5T0KA 5TH7A 3RAYA 3F9XA 3EP0A 5ARFA 2QPWA 3KMTA 4AU7A 4H12A 1N3JA 5F5EA 5EG2A 5EX3A 4QENA 3RU0A 3PDNA 5KJNA 3KMJA 4I51A 5KJLA 3S7JA 3M58A 3M53A 4WUYA 3F9WA 3SW9A 3MO2A 3M55A 3RQ4A 3OS5A 3IHXA 3OXGA 3QWPA 2IGQA 4YPEA 3M54A 1XQHA 2R3AA 2W5YA 3MO5A 4QEPA 5EX0A 5CCLA 4O6FA 3VV0A 5LSZA 3DALA 3DB5A 3RIBA 4IJ8A 5JINA 4J83A 3F9ZA 3S7BA 1O9SA 3QWVA 3CBMA 5F59A 1N6CA 3MO0A 4O30A 5LSXA 3F9YA 3TG4A 2F69A 1N6AA 5F6LA 3OXFA 5HQ8A 4NJ5A 3OXLA 2W5ZA 4YNPA 4J7IA 3MEKA 4YNDA 4IJDA 4E47A 1MUFA 5KJMA 1PEGA 4YPUA 3K5KA 3KMAA 3M59A 4MI0A 1ZKKA
chains in the Genus database with same CATH superfamily
1MVXA 5F6KC 3M5AA 5ARGA 2RFIA 2BQZA 4C1QA 4MI5A 3S8PA 5JIYA 1MVHA 4YNMA 5TEGA 4FMUA 5TTFA 5KJKA 4YPAA 3N71A 4J7FA 4Z4PA 5T5GA 2O8JA 4JDSA 5JHNA 1H3IA 3HNAA 3M56A 4JLGA 4QEOA 4RZ0A 3SWCA 3S7DA 3CBOA 5JJ0A 3FPDA 5CCMA 2G46A 1MT6A 2JV0A 4BUPA 5T0MA 3QWWA 3TG5A 4NVQA 3OPEA 3RJWA 4J8OA 3OOIA 1ML9A 5CPRB 4LDGA 3VUZA 3M57A 5AYFA 3BO5A 3S7FA 3CBPA 5HI7A 5T0KA 5TH7A 3RAYA 3F9XA 3EP0A 5ARFA 2QPWA 3KMTA 4AU7A 4H12A 1N3JA 5F5EA 5EG2A 5EX3A 4QENA 3RU0A 3PDNA 5KJNA 3KMJA 4I51A 5KJLA 3S7JA 3M58A 3M53A 4WUYA 3F9WA 3SW9A 3MO2A 3M55A 3RQ4A 3OS5A 3IHXA 3OXGA 3QWPA 2IGQA 4YPEA 3M54A 1XQHA 2R3AA 2W5YA 3MO5A 4QEPA 5EX0A 5CCLA 4O6FA 3VV0A 5LSZA 3DALA 3DB5A 3RIBA 4IJ8A 5JINA 4J83A 3F9ZA 3S7BA 1O9SA 3QWVA 3CBMA 5F59A 1N6CA 3MO0A 4O30A 5LSXA 3F9YA 3TG4A 2F69A 1N6AA 5F6LA 3OXFA 5HQ8A 4NJ5A 3OXLA 2W5ZA 4YNPA 4J7IA 3MEKA 4YNDA 4IJDA 4E47A 1MUFA 5KJMA 1PEGA 4YPUA 3K5KA 3KMAA 3M59A 4MI0A 1ZKKA
chains in the Genus database with same CATH topology
1MVXA 5F6KC 3M5AA 5ARGA 2RFIA 2BQZA 4C1QA 4MI5A 3S8PA 5JIYA 1MVHA 4YNMA 5TEGA 4FMUA 5TTFA 5KJKA 4YPAA 3N71A 4J7FA 4Z4PA 5T5GA 2O8JA 4JDSA 5JHNA 1H3IA 3HNAA 3M56A 4JLGA 4QEOA 4RZ0A 3SWCA 3S7DA 3CBOA 5JJ0A 3FPDA 5CCMA 2G46A 1MT6A 2JV0A 4BUPA 5T0MA 3QWWA 3TG5A 4NVQA 3OPEA 3RJWA 4J8OA 3OOIA 1ML9A 5CPRB 4LDGA 3VUZA 3M57A 5AYFA 3BO5A 3S7FA 3CBPA 5HI7A 5T0KA 5TH7A 3RAYA 3F9XA 3EP0A 5ARFA 2QPWA 3KMTA 4AU7A 4H12A 1N3JA 5F5EA 5EG2A 5EX3A 4QENA 3RU0A 3PDNA 5KJNA 3KMJA 4I51A 5KJLA 3S7JA 3M58A 3M53A 4WUYA 3F9WA 3SW9A 3MO2A 3M55A 3RQ4A 3OS5A 3IHXA 3OXGA 3QWPA 2IGQA 4YPEA 3M54A 1XQHA 2R3AA 2W5YA 3MO5A 4QEPA 5EX0A 5CCLA 4O6FA 3VV0A 5LSZA 3DALA 3DB5A 3RIBA 4IJ8A 5JINA 4J83A 3F9ZA 3S7BA 1O9SA 3QWVA 3CBMA 5F59A 1N6CA 3MO0A 4O30A 5LSXA 3F9YA 3TG4A 2F69A 1N6AA 5F6LA 3OXFA 5HQ8A 4NJ5A 3OXLA 2W5ZA 4YNPA 4J7IA 3MEKA 4YNDA 4IJDA 4E47A 1MUFA 5KJMA 1PEGA 4YPUA 3K5KA 3KMAA 3M59A 4MI0A 1ZKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MVX A;  5F6K C;  3M5A A;  5ARG A;  2RFI A;  2BQZ A;  4C1Q A;  4MI5 A;  3S8P A;  5JIY A;  1MVH A;  4YNM A;  5TEG A;  4FMU A;  5TTF A;  5KJK A;  4YPA A;  3N71 A;  4J7F A;  4Z4P A;  5T5G A;  2O8J A;  4JDS A;  5JHN A;  1H3I A;  3HNA A;  3M56 A;  4JLG A;  4QEO A;  4RZ0 A;  3SWC A;  3S7D A;  3CBO A;  5JJ0 A;  3FPD A;  5CCM A;  2G46 A;  1MT6 A;  2JV0 A;  4BUP A;  5T0M A;  3QWW A;  3TG5 A;  4NVQ A;  3OPE A;  3RJW A;  4J8O A;  3OOI A;  1ML9 A;  5CPR B;  4LDG A;  3VUZ A;  3M57 A;  5AYF A;  3BO5 A;  3S7F A;  3CBP A;  5HI7 A;  5T0K A;  5TH7 A;  3RAY A;  3F9X A;  3EP0 A;  5ARF A;  2QPW A;  3KMT A;  4AU7 A;  4H12 A;  1N3J A;  5F5E A;  5EG2 A;  5EX3 A;  4QEN A;  3RU0 A;  3PDN A;  5KJN A;  3KMJ A;  4I51 A;  5KJL A;  3S7J A;  3M58 A;  3M53 A;  4WUY A;  3F9W A;  3SW9 A;  3MO2 A;  3M55 A;  3RQ4 A;  3OS5 A;  3IHX A;  3OXG A;  3QWP A;  2IGQ A;  4YPE A;  3M54 A;  1XQH A;  2R3A A;  2W5Y A;  3MO5 A;  4QEP A;  5EX0 A;  5CCL A;  4O6F A;  3VV0 A;  5LSZ A;  3DAL A;  3DB5 A;  3RIB A;  4IJ8 A;  5JIN A;  4J83 A;  3F9Z A;  3S7B A;  1O9S A;  3QWV A;  3CBM A;  5F59 A;  1N6C A;  3MO0 A;  4O30 A;  5LSX A;  3F9Y A;  3TG4 A;  2F69 A;  1N6A A;  5F6L A;  3OXF A;  5HQ8 A;  4NJ5 A;  3OXL A;  2W5Z A;  4YNP A;  4J7I A;  3MEK A;  4YND A;  4IJD A;  4E47 A;  1MUF A;  5KJM A;  1PEG A;  4YPU A;  3K5K A;  3KMA A;  3M59 A;  4MI0 A;  1ZKK A; 
#chains in the Genus database with same CATH topology
 1MVX A;  5F6K C;  3M5A A;  5ARG A;  2RFI A;  2BQZ A;  4C1Q A;  4MI5 A;  3S8P A;  5JIY A;  1MVH A;  4YNM A;  5TEG A;  4FMU A;  5TTF A;  5KJK A;  4YPA A;  3N71 A;  4J7F A;  4Z4P A;  5T5G A;  2O8J A;  4JDS A;  5JHN A;  1H3I A;  3HNA A;  3M56 A;  4JLG A;  4QEO A;  4RZ0 A;  3SWC A;  3S7D A;  3CBO A;  5JJ0 A;  3FPD A;  5CCM A;  2G46 A;  1MT6 A;  2JV0 A;  4BUP A;  5T0M A;  3QWW A;  3TG5 A;  4NVQ A;  3OPE A;  3RJW A;  4J8O A;  3OOI A;  1ML9 A;  5CPR B;  4LDG A;  3VUZ A;  3M57 A;  5AYF A;  3BO5 A;  3S7F A;  3CBP A;  5HI7 A;  5T0K A;  5TH7 A;  3RAY A;  3F9X A;  3EP0 A;  5ARF A;  2QPW A;  3KMT A;  4AU7 A;  4H12 A;  1N3J A;  5F5E A;  5EG2 A;  5EX3 A;  4QEN A;  3RU0 A;  3PDN A;  5KJN A;  3KMJ A;  4I51 A;  5KJL A;  3S7J A;  3M58 A;  3M53 A;  4WUY A;  3F9W A;  3SW9 A;  3MO2 A;  3M55 A;  3RQ4 A;  3OS5 A;  3IHX A;  3OXG A;  3QWP A;  2IGQ A;  4YPE A;  3M54 A;  1XQH A;  2R3A A;  2W5Y A;  3MO5 A;  4QEP A;  5EX0 A;  5CCL A;  4O6F A;  3VV0 A;  5LSZ A;  3DAL A;  3DB5 A;  3RIB A;  4IJ8 A;  5JIN A;  4J83 A;  3F9Z A;  3S7B A;  1O9S A;  3QWV A;  3CBM A;  5F59 A;  1N6C A;  3MO0 A;  4O30 A;  5LSX A;  3F9Y A;  3TG4 A;  2F69 A;  1N6A A;  5F6L A;  3OXF A;  5HQ8 A;  4NJ5 A;  3OXL A;  2W5Z A;  4YNP A;  4J7I A;  3MEK A;  4YND A;  4IJD A;  4E47 A;  1MUF A;  5KJM A;  1PEG A;  4YPU A;  3K5K A;  3KMA A;  3M59 A;  4MI0 A;  1ZKK A; 
#chains in the Genus database with same CATH homology
 1MVX A;  5F6K C;  3M5A A;  5ARG A;  2RFI A;  2BQZ A;  4C1Q A;  4MI5 A;  3S8P A;  5JIY A;  1MVH A;  4YNM A;  5TEG A;  4FMU A;  5TTF A;  5KJK A;  4YPA A;  3N71 A;  4J7F A;  4Z4P A;  5T5G A;  2O8J A;  4JDS A;  5JHN A;  1H3I A;  3HNA A;  3M56 A;  4JLG A;  4QEO A;  4RZ0 A;  3SWC A;  3S7D A;  3CBO A;  5JJ0 A;  3FPD A;  5CCM A;  2G46 A;  1MT6 A;  2JV0 A;  4BUP A;  5T0M A;  3QWW A;  3TG5 A;  4NVQ A;  3OPE A;  3RJW A;  4J8O A;  3OOI A;  1ML9 A;  5CPR B;  4LDG A;  3VUZ A;  3M57 A;  5AYF A;  3BO5 A;  3S7F A;  3CBP A;  5HI7 A;  5T0K A;  5TH7 A;  3RAY A;  3F9X A;  3EP0 A;  5ARF A;  2QPW A;  3KMT A;  4AU7 A;  4H12 A;  1N3J A;  5F5E A;  5EG2 A;  5EX3 A;  4QEN A;  3RU0 A;  3PDN A;  5KJN A;  3KMJ A;  4I51 A;  5KJL A;  3S7J A;  3M58 A;  3M53 A;  4WUY A;  3F9W A;  3SW9 A;  3MO2 A;  3M55 A;  3RQ4 A;  3OS5 A;  3IHX A;  3OXG A;  3QWP A;  2IGQ A;  4YPE A;  3M54 A;  1XQH A;  2R3A A;  2W5Y A;  3MO5 A;  4QEP A;  5EX0 A;  5CCL A;  4O6F A;  3VV0 A;  5LSZ A;  3DAL A;  3DB5 A;  3RIB A;  4IJ8 A;  5JIN A;  4J83 A;  3F9Z A;  3S7B A;  1O9S A;  3QWV A;  3CBM A;  5F59 A;  1N6C A;  3MO0 A;  4O30 A;  5LSX A;  3F9Y A;  3TG4 A;  2F69 A;  1N6A A;  5F6L A;  3OXF A;  5HQ8 A;  4NJ5 A;  3OXL A;  2W5Z A;  4YNP A;  4J7I A;  3MEK A;  4YND A;  4IJD A;  4E47 A;  1MUF A;  5KJM A;  1PEG A;  4YPU A;  3K5K A;  3KMA A;  3M59 A;  4MI0 A;  1ZKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...