4YPUA

Ash1l set domain k2264l mutant in complex with s-adenosyl methionine (sam)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
GSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVELQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase ASH1L
publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 50
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ypuA00
3VUZA 3FPDA 3S7JA 4JLGA 3F9WA 5CPRB 4IJ8A 5T0MA 4YNDA 5F5EA 3M59A 3M57A 4I51A 1N6AA 3QWPA 3F9XA 3DALA 5KJNA 3OXFA 4J83A 5HI7A 5KJMA 1MVHA 3OPEA 4YNPA 3OXLA 4QEPA 2RFIA 4YPAA 3BO5A 1ZKKA 3IHXA 5JINA 3RAYA 2O8JA 4LDGA 3CBOA 5F59A 2R3AA 4O6FA 4BUPA 4FMUA 5JIYA 2IGQA 3TG4A 5T5GA 3MO0A 4J7FA 3EP0A 5F6LA 5EX3A 5CCLA 3SWCA 5EG2A 3QWWA 3DB5A 1PEGA 3S7FA 4AU7A 4NJ5A 3RU0A 1ML9A 3PDNA 3QWVA 4YPUA 2QPWA 4JDSA 2JV0A 4Z4PA 5T0KA 3S7BA 3KMJA 4J8OA 3S7DA 3M58A 4YPEA 5TTFA 3M53A 4H12A 4RZ0A 5F6KC 3RJWA 2W5YA 3M5AA 4MI5A 5AYFA 3S8PA 3F9YA 3MO5A 3OOIA 3K5KA 4J7IA 5KJLA 1MT6A 1N3JA 3F9ZA 5HQ8A 5CCMA 3KMTA 3CBMA 2W5ZA 5KJKA 5EX0A 3TG5A 1MVXA 3OXGA 3VV0A 5JJ0A 5TEGA 4IJDA 2G46A 3SW9A 5JHNA 3M55A 3RQ4A 5ARFA 3HNAA 4O30A 4C1QA 3CBPA 4MI0A 3M54A 4YNMA 1H3IA 5LSXA 5TH7A 2F69A 5LSZA 3MO2A 3KMAA 3M56A 3RIBA 1N6CA 4QEOA 3OS5A 5ARGA 2BQZA 3MEKA 1O9SA 1XQHA 4WUYA 4E47A 4QENA 4NVQA 1MUFA 3N71A
chains in the Genus database with same CATH superfamily
3VUZA 3FPDA 3S7JA 4JLGA 3F9WA 5CPRB 4IJ8A 5T0MA 4YNDA 5F5EA 3M59A 3M57A 4I51A 1N6AA 3QWPA 3F9XA 3DALA 5KJNA 3OXFA 4J83A 5HI7A 5KJMA 1MVHA 3OPEA 4YNPA 3OXLA 4QEPA 2RFIA 4YPAA 3BO5A 1ZKKA 3IHXA 5JINA 3RAYA 2O8JA 4LDGA 3CBOA 5F59A 2R3AA 4O6FA 4BUPA 4FMUA 5JIYA 2IGQA 3TG4A 5T5GA 3MO0A 4J7FA 3EP0A 5F6LA 5EX3A 5CCLA 3SWCA 5EG2A 3QWWA 3DB5A 1PEGA 3S7FA 4AU7A 4NJ5A 3RU0A 1ML9A 3PDNA 3QWVA 4YPUA 2QPWA 4JDSA 2JV0A 4Z4PA 5T0KA 3S7BA 3KMJA 4J8OA 3S7DA 3M58A 4YPEA 5TTFA 3M53A 4H12A 4RZ0A 5F6KC 3RJWA 2W5YA 3M5AA 4MI5A 5AYFA 3S8PA 3F9YA 3MO5A 3OOIA 3K5KA 4J7IA 5KJLA 1MT6A 1N3JA 3F9ZA 5HQ8A 5CCMA 3KMTA 3CBMA 2W5ZA 5KJKA 5EX0A 3TG5A 1MVXA 3OXGA 3VV0A 5JJ0A 5TEGA 4IJDA 2G46A 3SW9A 5JHNA 3M55A 3RQ4A 5ARFA 3HNAA 4O30A 4C1QA 3CBPA 4MI0A 3M54A 4YNMA 1H3IA 5LSXA 5TH7A 2F69A 5LSZA 3MO2A 3KMAA 3M56A 3RIBA 1N6CA 4QEOA 3OS5A 5ARGA 2BQZA 3MEKA 1O9SA 1XQHA 4WUYA 4E47A 4QENA 4NVQA 1MUFA 3N71A
chains in the Genus database with same CATH topology
3VUZA 3FPDA 3S7JA 4JLGA 3F9WA 5CPRB 4IJ8A 5T0MA 4YNDA 5F5EA 3M59A 3M57A 4I51A 1N6AA 3QWPA 3F9XA 3DALA 5KJNA 3OXFA 4J83A 5HI7A 5KJMA 1MVHA 3OPEA 4YNPA 3OXLA 4QEPA 2RFIA 4YPAA 3BO5A 1ZKKA 3IHXA 5JINA 3RAYA 2O8JA 4LDGA 3CBOA 5F59A 2R3AA 4O6FA 4BUPA 4FMUA 5JIYA 2IGQA 3TG4A 5T5GA 3MO0A 4J7FA 3EP0A 5F6LA 5EX3A 5CCLA 3SWCA 5EG2A 3QWWA 3DB5A 1PEGA 3S7FA 4AU7A 4NJ5A 3RU0A 1ML9A 3PDNA 3QWVA 4YPUA 2QPWA 4JDSA 2JV0A 4Z4PA 5T0KA 3S7BA 3KMJA 4J8OA 3S7DA 3M58A 4YPEA 5TTFA 3M53A 4H12A 4RZ0A 5F6KC 3RJWA 2W5YA 3M5AA 4MI5A 5AYFA 3S8PA 3F9YA 3MO5A 3OOIA 3K5KA 4J7IA 5KJLA 1MT6A 1N3JA 3F9ZA 5HQ8A 5CCMA 3KMTA 3CBMA 2W5ZA 5KJKA 5EX0A 3TG5A 1MVXA 3OXGA 3VV0A 5JJ0A 5TEGA 4IJDA 2G46A 3SW9A 5JHNA 3M55A 3RQ4A 5ARFA 3HNAA 4O30A 4C1QA 3CBPA 4MI0A 3M54A 4YNMA 1H3IA 5LSXA 5TH7A 2F69A 5LSZA 3MO2A 3KMAA 3M56A 3RIBA 1N6CA 4QEOA 3OS5A 5ARGA 2BQZA 3MEKA 1O9SA 1XQHA 4WUYA 4E47A 4QENA 4NVQA 1MUFA 3N71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUZ A;  3FPD A;  3S7J A;  4JLG A;  3F9W A;  5CPR B;  4IJ8 A;  5T0M A;  4YND A;  5F5E A;  3M59 A;  3M57 A;  4I51 A;  1N6A A;  3QWP A;  3F9X A;  3DAL A;  5KJN A;  3OXF A;  4J83 A;  5HI7 A;  5KJM A;  1MVH A;  3OPE A;  4YNP A;  3OXL A;  4QEP A;  2RFI A;  4YPA A;  3BO5 A;  1ZKK A;  3IHX A;  5JIN A;  3RAY A;  2O8J A;  4LDG A;  3CBO A;  5F59 A;  2R3A A;  4O6F A;  4BUP A;  4FMU A;  5JIY A;  2IGQ A;  3TG4 A;  5T5G A;  3MO0 A;  4J7F A;  3EP0 A;  5F6L A;  5EX3 A;  5CCL A;  3SWC A;  5EG2 A;  3QWW A;  3DB5 A;  1PEG A;  3S7F A;  4AU7 A;  4NJ5 A;  3RU0 A;  1ML9 A;  3PDN A;  3QWV A;  4YPU A;  2QPW A;  4JDS A;  2JV0 A;  4Z4P A;  5T0K A;  3S7B A;  3KMJ A;  4J8O A;  3S7D A;  3M58 A;  4YPE A;  5TTF A;  3M53 A;  4H12 A;  4RZ0 A;  5F6K C;  3RJW A;  2W5Y A;  3M5A A;  4MI5 A;  5AYF A;  3S8P A;  3F9Y A;  3MO5 A;  3OOI A;  3K5K A;  4J7I A;  5KJL A;  1MT6 A;  1N3J A;  3F9Z A;  5HQ8 A;  5CCM A;  3KMT A;  3CBM A;  2W5Z A;  5KJK A;  5EX0 A;  3TG5 A;  1MVX A;  3OXG A;  3VV0 A;  5JJ0 A;  5TEG A;  4IJD A;  2G46 A;  3SW9 A;  5JHN A;  3M55 A;  3RQ4 A;  5ARF A;  3HNA A;  4O30 A;  4C1Q A;  3CBP A;  4MI0 A;  3M54 A;  4YNM A;  1H3I A;  5LSX A;  5TH7 A;  2F69 A;  5LSZ A;  3MO2 A;  3KMA A;  3M56 A;  3RIB A;  1N6C A;  4QEO A;  3OS5 A;  5ARG A;  2BQZ A;  3MEK A;  1O9S A;  1XQH A;  4WUY A;  4E47 A;  4QEN A;  4NVQ A;  1MUF A;  3N71 A; 
#chains in the Genus database with same CATH topology
 3VUZ A;  3FPD A;  3S7J A;  4JLG A;  3F9W A;  5CPR B;  4IJ8 A;  5T0M A;  4YND A;  5F5E A;  3M59 A;  3M57 A;  4I51 A;  1N6A A;  3QWP A;  3F9X A;  3DAL A;  5KJN A;  3OXF A;  4J83 A;  5HI7 A;  5KJM A;  1MVH A;  3OPE A;  4YNP A;  3OXL A;  4QEP A;  2RFI A;  4YPA A;  3BO5 A;  1ZKK A;  3IHX A;  5JIN A;  3RAY A;  2O8J A;  4LDG A;  3CBO A;  5F59 A;  2R3A A;  4O6F A;  4BUP A;  4FMU A;  5JIY A;  2IGQ A;  3TG4 A;  5T5G A;  3MO0 A;  4J7F A;  3EP0 A;  5F6L A;  5EX3 A;  5CCL A;  3SWC A;  5EG2 A;  3QWW A;  3DB5 A;  1PEG A;  3S7F A;  4AU7 A;  4NJ5 A;  3RU0 A;  1ML9 A;  3PDN A;  3QWV A;  4YPU A;  2QPW A;  4JDS A;  2JV0 A;  4Z4P A;  5T0K A;  3S7B A;  3KMJ A;  4J8O A;  3S7D A;  3M58 A;  4YPE A;  5TTF A;  3M53 A;  4H12 A;  4RZ0 A;  5F6K C;  3RJW A;  2W5Y A;  3M5A A;  4MI5 A;  5AYF A;  3S8P A;  3F9Y A;  3MO5 A;  3OOI A;  3K5K A;  4J7I A;  5KJL A;  1MT6 A;  1N3J A;  3F9Z A;  5HQ8 A;  5CCM A;  3KMT A;  3CBM A;  2W5Z A;  5KJK A;  5EX0 A;  3TG5 A;  1MVX A;  3OXG A;  3VV0 A;  5JJ0 A;  5TEG A;  4IJD A;  2G46 A;  3SW9 A;  5JHN A;  3M55 A;  3RQ4 A;  5ARF A;  3HNA A;  4O30 A;  4C1Q A;  3CBP A;  4MI0 A;  3M54 A;  4YNM A;  1H3I A;  5LSX A;  5TH7 A;  2F69 A;  5LSZ A;  3MO2 A;  3KMA A;  3M56 A;  3RIB A;  1N6C A;  4QEO A;  3OS5 A;  5ARG A;  2BQZ A;  3MEK A;  1O9S A;  1XQH A;  4WUY A;  4E47 A;  4QEN A;  4NVQ A;  1MUF A;  3N71 A; 
#chains in the Genus database with same CATH homology
 3VUZ A;  3FPD A;  3S7J A;  4JLG A;  3F9W A;  5CPR B;  4IJ8 A;  5T0M A;  4YND A;  5F5E A;  3M59 A;  3M57 A;  4I51 A;  1N6A A;  3QWP A;  3F9X A;  3DAL A;  5KJN A;  3OXF A;  4J83 A;  5HI7 A;  5KJM A;  1MVH A;  3OPE A;  4YNP A;  3OXL A;  4QEP A;  2RFI A;  4YPA A;  3BO5 A;  1ZKK A;  3IHX A;  5JIN A;  3RAY A;  2O8J A;  4LDG A;  3CBO A;  5F59 A;  2R3A A;  4O6F A;  4BUP A;  4FMU A;  5JIY A;  2IGQ A;  3TG4 A;  5T5G A;  3MO0 A;  4J7F A;  3EP0 A;  5F6L A;  5EX3 A;  5CCL A;  3SWC A;  5EG2 A;  3QWW A;  3DB5 A;  1PEG A;  3S7F A;  4AU7 A;  4NJ5 A;  3RU0 A;  1ML9 A;  3PDN A;  3QWV A;  4YPU A;  2QPW A;  4JDS A;  2JV0 A;  4Z4P A;  5T0K A;  3S7B A;  3KMJ A;  4J8O A;  3S7D A;  3M58 A;  4YPE A;  5TTF A;  3M53 A;  4H12 A;  4RZ0 A;  5F6K C;  3RJW A;  2W5Y A;  3M5A A;  4MI5 A;  5AYF A;  3S8P A;  3F9Y A;  3MO5 A;  3OOI A;  3K5K A;  4J7I A;  5KJL A;  1MT6 A;  1N3J A;  3F9Z A;  5HQ8 A;  5CCM A;  3KMT A;  3CBM A;  2W5Z A;  5KJK A;  5EX0 A;  3TG5 A;  1MVX A;  3OXG A;  3VV0 A;  5JJ0 A;  5TEG A;  4IJD A;  2G46 A;  3SW9 A;  5JHN A;  3M55 A;  3RQ4 A;  5ARF A;  3HNA A;  4O30 A;  4C1Q A;  3CBP A;  4MI0 A;  3M54 A;  4YNM A;  1H3I A;  5LSX A;  5TH7 A;  2F69 A;  5LSZ A;  3MO2 A;  3KMA A;  3M56 A;  3RIB A;  1N6C A;  4QEO A;  3OS5 A;  5ARG A;  2BQZ A;  3MEK A;  1O9S A;  1XQH A;  4WUY A;  4E47 A;  4QEN A;  4NVQ A;  1MUF A;  3N71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...